08\O<  \O*X <  <\O@@<@T 08\O<  \O*X <  <\O@@<@T U\O <HA\O\O\OA\O\O\OA&\O\O\O@HPA\O\O\OSA\O\O\O_A\O\O\OfA\O\O\OgA\O\O\OA\O\O\OA\O\O\OC\O\O\OA\O\O\OA\O\O\O$ p\O\O\OmCy\O\O\O (08@HP H$\O\O\O8@HPX`hpxD$\O\O\O|D$x.\O\O\O=$H\O\O\O (08C!\O\O\O a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\Oa\O\O\O a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O!\O\O\O4!\O\O\O!\O\O\O!\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O B!\O\O\O B!\O\O\O!\O\O\O"!\O\O\O"!\O\O\O"a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\Oa\O\O\O a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O!\O\O\O!\O\O\O!\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O!\O\O\O !\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O!\O\O\O!\O\O\O!\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O!\O\O\O !\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O !\O\O\O!\O\O\O !\O\O\O!\O\O\O!\O\O\O!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\ !\O\O\O\ !\O\O\O\ !\O\O\O\ !\O\O\O\ !\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\ !\O\O\O\ !\O\O\O\ !\O\O\O\ !\O\O\O\ !\O\O\O\!\O\O\O\ !\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O\!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O!\O\O\O!\O\O\O!\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O!\O\O\O !\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O !\O\O\O!\O\O\O !\O\O\O!\O\O\O!\O\O\O!$\O\O\O4!\O\O\O!\O\O\O!\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O !\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\O!\O\O\Oa\O\O\Oa\O\O\O!\O\O\O!\O\O\O!\O\O\Oa\O\O\O a\O\O\Oa\O\O\O a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\ a\O\O\O\ a\O\O\O\ a\O\O\O\ a\O\O\O\ a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\ a\O\O\O\ a\O\O\O\ a\O\O\O\ a\O\O\O\ a\O\O\O\a\O\O\O\ a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\a\O\O\O\!$\O\O\Oi!\O\O\O!\O\O\O!\O\O\O a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\O a\O\O\Oa\O\O\O a\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O!\O\O\O!\O\O\Oa\O\O\Oa\O\O\O!\O\O\O!\O\O\O!\O\O\O B!\O\O\O B!\O\O\O!\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\Oa\O\O\O!\O\O\O!\O\O\Oa\O\O\O a\O\O\Oa\O\O\O a\O\O\Oa\O\O\Oa\O\O\O\O\O\Obpf!\O\O\O $\O\O\OT$\O\O\OU$\O\O\OX$s\O\O\OZ$\O\O\O`$\O\O\ObA\O\O\Oem\O\O\Ohp$j\O\O\Ox $\O\O\OA\O\O\OA\O\O\OA\O\O\OA\O\O\OA\O\O\OA\O\O\OA\O\O\OA\O\O\OA\O\O\OA\O\O\OwJ\(~ '"BITrGS-jJ,?.`MܺDz~zGeR_*umPCD't|۞_>(c}qY6j:a 4\F"/nrt%@bv+⦸NTJM$(*p{bTQHk0P6C.D $ =q2 ˥9oQ+Hp wpORu:#v C=KJfay < . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.2 2003/07/26 17:06:40 salo Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF( 4v4 (@@@ hL8@@@dtPNetBSD/J@ NetBSDearmv7hfeb P L0 -L@P`PU(0`@&a`@03/T(PRA @-L Mb !1 P`0SQ 0 0S  /S 0ST10S QH z8 P5MR ,1! 0  %+0S1 0lS0쀟 X *0 p)p03/ WpWS0pW *0@(@03/T 'R< \0 00L0 0@0 0|TtXXp~~%JIHzLT +dF5DO- I 5FT,4 IHdI  nPm(18@8 Kn:f*oB² *IGŽmQeppGmm-GONNFTO GFkh;k`+s(F `AFrк )3h3 ,/a''shh , #a&msp%j4K-CF@F2O`1Ka5h->/I(F+ (@a'Ф-:j"!(FGiFG0 FGpCO FG1hH F(FG1hH #NFa3hNFa, I FI0ZЛB FG3h+'msp r>jfIFFHP nPJh3`pG -CF-FK"gFIF@F`@9F0F'g @ I H{{zЃ@Y wnP0p FFˍ@iF0F H1F J ph@S-AF@pGF`jiV0FG,h+% -HG(5F)I%)H h#@c`Fh0FGh HG0 I%H  O&K p,9FV0FG0,h-+  HG00#I% H 6!FHu(%(F݄ -O"FFjFAF KX`h+KhKh+Kh4$$+\ѥKh+9ФMJI(F8FCh;C`+ vFUiPF!hOF#FFFBB$ I 80 [j(G(7F # LBB#0kO IijG0bj@FI @mj)FpOO FK F!!!FHJF!F I h%9F@*5B pF L%h=UQ "0F)v(`h@ p`h0 p p /KF-OFh FihYhIi+H! OFZ%/F@ DFB6 0#h,0#h&0@!F  hF)XQFZ" A @!~(@iFPF)F57(F0F GK-ABFyEK"EM`#FBBAK"h( +Hh;IF;H::HU:N%i3hB:۵8LophOwD"h9F2"`$+&h*IF*H,H[#h;#`+/)Kh & #h7`;p`#`+ KhԛK*F!phh~(ۅB+hPIFHH& #[Br# KXh#CU  5nP 0 \ T J#FBhB 3KBHo+F R)L)M*Ih.hB+`'Khg h2hB ``.`V5 J'`Rh `BRh;'bO hBh:#+`JF` `Bh3'/ `` Kh  ch 0 \ T T8FM(hJh#`h\`h`3`+h``3+`8 T-CF .F4F +h}:IF:H9HS#xg +B `%BV#@ B ўEȿ3Oؿ# Eȿ3Oؿ#h`   Kp$h J KhhBF 3$P (K`p` p   oK-OFxF 0`jKjIh)@)F[F$dNF+S^I)(XF(G(F0`o:FG(tti(F , *к 0#` 0GHFKh@0x+(qF(dFb+7I)h,5H!F(/LsEC/J3 hOssDhF1`F:*<h"IF"H."Hp0;0+zKh p - h;`+Khԛ$hQF F2(_ DFL  D \5nP T 4mp$MN+h0h3+`K`K`K`K`2+h4`;+`[ Kh  p \     T-GF'L#hx - -$HFo9#hxBM3#`(h-hF0B" F F(0# #"!i#QFF0F@ B5$h F(  D 8 ` L Kn:f*oB² *IEӼmQeppGmm-OF%FtK,Fh8F{h;{`+8FhF0:;hZ:`x5້`+2dJBx۵0lhOt D3!F0t(R*hXUIFUHUH. : *2z . E\LJ̿ OyDhFIF3`AKh(7*h%IF>H=H9:h::`*b:Kh Y .K0`;h;;`+0Khԛ1h_ U,K!` \F&(JXFh3`3h" %K2h`O@*hIFH"#`K`B"`&Fi J h Uh FK`om X 4 \5nP T L DāK-OFhFF; +--P; (O30rKhFB!qOdtXh!F:h2:`:(N;h4`;p`;`[gKh  =sh*F\FF( "F[D,xX  RD, *QHG 2h B0JORr9h19`F)hKBIFBHAH!;h;;`L :h::`*6Jhԑ8KRFwhh8(l8F9hP0 "#D,+Ь3hB9#LoOwD"h9F2"`JPhй)hIFHH#h;#`+Kh?VV#h7`;p`#`; Kh?G?Iph#CUP D L \ T5nP 4-OFFFF'H$/DB:504BI$HX(x ^+\(\ .xf1FH84 400(x00(x005(x m\#J8Ih# `jFD8( ۽0+;J`0+;JS`] T@th Kh J K ``hhB*JhBHo  < 8 ` TR!K-OhFFO O#;hB"4,̿4O F8`0(j8Kh+< +6J0 @B#`ZP+x T0Xx +@(+x.+kx ++0\F30(FeFh:`*-Kh 9$ &8h`:h0FFF(BK"`0;0+ Khԛo 4m T 0 D H-OFQKQJhFQKFhhB F7O B(EBEA%GNh3`ePFF8F| AK`FYRF9F  h;`cd0!F Bb*F`3Kh O PFP0BF8FHF FDF F?F8F;F;h +`;hB]`00#0p3DK`KhQF(hyK"`h;`[ KhЯo T ` 8 T H 0-OF6L6O h5K=`h#hBFܪBU4%O F,I4> @F'N2  :hXFFFh;`o%3h  SK"` : * ԓ8h,F%0F  8 ` T 0-G F*MF FF h.F3`xh;`+;+h 3 M7+hB` MF8FIKhFIFh+h4K",``K`h;`[Kho T T H 0iK-OFhFgL%B̿H FF8FFVEV0F7F(2ih*DhB=ݲrh i1`F~ )~hNIFNHpMH0;0+@0 x q`h a:`""hԐF2i(D'3i6hD4LjhB)۵hȿ iؿOvD2`1F0h)2h(IF(H$'Hg h`; a`+KhԚ JAF#i8FNZS(%M?h0i3/``0h;`Kh*h F(K"`h;`K0hІo  T T5nPFL 0-AF*Mki.F+ݰisiF\>xhiAF2`F)hIFHHh;`[(h [# h;a`++hԛ:x\*zx7+7 BD", F T5nP-OL#i #j Hz!NF0`(sejB9۳h3jOsD2`)FD)HhIFH:H|h;`+MфKh D =heb;b`+{Khԝԣj!"%pF%+̀cj pJE%3hjxSU3hY1`x\)kI`[x 0 ]F2hx +!+їB*0+UdH)o6hj`̿OrDF(cbhb;`+NKhԙԸcjJIB!۵h jO{D2`YF(?eh$;b`;H!0` mx!+00`(5L h0f h[0Hy/O,aJ$(hFn) p)l)@DDD`7I h)[x320XFF(x!+$)J0Hp( D`.h3F n(l(@DD%N4h %H%K h(GHBHA(G/V/J(hFn) p)l)@̄DDD` F3h!F33`r D ` 0 T < H TKh+?R$)h F+n* p*l*@DDD3`Kh+?7$)h F+n* p*l*@DDD3`;h$!KhF;(LN7h!(Kh+6h.򉀑Hp* D3`)h F+n*l*@cDDKhA ($)h F+n* p*l*@WDDD3`8h2`($/h;F+n* p*l*@ODDD3`eKhF("(hFn) p)l)@=BBB3`VKhF(SLSN7h(LKh+@NHyNKhB?rIKE`ܷB$HJHHgp) D`(hFn)l)@DD6KhFp(M"(hFn) p)l)@BBB3`'KhFR(/)I",h#F n( p(l(@BBB `Kh+? )h F+n* p*l*@Ӄ@@@3` Kh+? J(hFn)p)l)@̃` < 8 `R T D[x320ZۭKhKhK`BF(?ĭJ$(hFn) p)l)@DDD`O$F+hx9*0* *;Dp*r*g*1DDD33`(|O "I0h <@80 (jh"+H}KJA@1# @1+hxn)p)l)@@A@A@A3@`6h.ɭ'KhB?ĭ&K&J$`(hFn) p)l)@DDD`Kh+?$)h F+n* p*l*@yDDD3` J` x +(Kh Kh( < T ` D T | H ^xQ)3+`+h O4$x320[cF(?SKܒh;0#J`J` a(>J(hFn) p)l)@lDDD`Kh+? J(hFn)p)l)@ `K `KhD-( +hx1;+(I& "L`h  `@80 (h"+уH&`}I",h#F n( p(l(@قBBB `p* D3`)h F+n*l*@тDDdKh+?5($)h F+n* p*l*@ԀDDD3`VK `WKhD(PK"hF( PHoHJ` x +JKh AKhAKhG(lDJ;hhB F:J` x +D 0 TL@KhF(\=J$(hFn) p)l) DDD`2J`x +۫;h |J(1FBY +[+\+FP5Hkx +3H$XF5/O ,OzD:hQF2:`<F'>h%IF%H0$Hs;h;;`"Kh & 4;h(;,;`+Khԛ,A2F F%K"UPh31F F #GB F D  \5nP T L/Jhx (-H (+K0!FZ)HY`[x +ИB0CF(N0(Kh 0X'h IFHHK'!F0M`KhRh@'*F0n00q0 D  5nP vJ-OhFtMY`xYx%)љxBБ$F.3`+h+@̀jHIF>H6>Hx0;0+:Kh?qr+h;`+`+2Kh?abFE\hT3VF K J>`h;`;$Kh?E?G VF0U46;h\BC۴MfOvD*h1F2*`'h: IF H H+h;+` \ 5nP T+h>`;+`;Kh??0 F"U T-O} FF/(CKh# #"!i#i"# O\FxFOT6Bh 3  EDDJDr8h 1FJ 'LhIFH>H : *@|Kh @ > 8`: *qKhԙ0+# " FX8h!F(D%JF F[hKڵ4  E2^KJDr8hh 1`F 'hENIFNHMHh:` h8`:`*GKhԛ0+# "QF F8hRF!F(DMF% #D!xaD9K hEL!C#"!F (?#*Nȿ  ؿOyD2hIF22`JhFz'|hIFHnH3h;3`+?23h;3`;Kh?(?+/ #C Ho, L 5nP T \ Kh+# "9F Fs K:F!Fh(D%K Jh# +?@F } L FL-O8FOEJELFh%h;#`h@KhB\ h0 `O:FFKXJ5KhF(P4Kؐh0&30(FF : *8)Kh z/ & h`"h0FF:F(B0;0+KhԚ%h3%`Ho :F)F(F%(  8 ` T \VJ-OhULTKh!h1ch3PHoNM+hNK"`MN mhO 3hHF33`(71X)# ShhYhh `hY`ShhYh `Y`hZ`Wh ;+DhYh>hh`>hq`Qh `Y`:`W`8FXPO  wO  B   ^Kh #h`#`ch`c`h;`cKh   T 0 \ H T-C &M/F+hjh;"YFF; h :,ыhLh8`DE F FLFK"`JKh`JhZ`  T-GF#MFFh.F*hlhBd3 ! F`YC`F3h %t`HFkC DD8F3hZ2```ph&Dh IF H6 Hyhhl`` F 5nP.IFFH nPK-OFh]F FF¹ZhIK* FGHpCO &#`)FHN wWOb)F $o FA0(pCOгh FAعpCO p&?##FJOav8ov3hc|KhK+x/+(FA)F{HOb!F $T FOaqJ ` `AmH)F FAF(k3h+h!F(F%|("F)FdH/!(FG/F/! FFAF8F%`(F oA o<ڽB WO8S;ZF)F8F$ 0*8FAfF(DEO8S;RF!F8F$ x8F zAFANx*Z#BB.#ZBB3i+)K[iEi+jйgĀX@F""F)IX{h;{`+8F4FXX#0l;\0.+&Kh+0 0#!j!H !jH# 01F(FFF Fo;h+ѻ"!F(F&h(Fh&`&h I g L X>P7 \34x < -GFhFI  " jFI A 0 J`J#`J`K"`@K"`M&t$JAF8FCT18G(FHDDDDDDDDDDDDDDDNDDDDDDDDD/DD6ADDDDDDDDDZDl|,2D:XK"`#YJ2TK"`#VJ`RJ`UJ`UJUJh3O`PJ`#MJ`IJ`MJ`FJJK"`#GJ`CJ`GJ`@J`O2EKAK"`#F@p$ FFAF8F HDKhKh0FK0Fh.KDhCKhKhpCOѨhmD F  ` ]  x P t d8Fh|#*+*j Fj` h8-CF KKh(FY.h}OL.#*+;hm+#juH 0+:rKh۱o!o !RnIBR[!0jI )jhH gKgJh`K)FFeKh>F@p$ FF)jHF hi*kXH zWKh+ kUH p jRH jQKh+ ijOH bh0C_j" ٲ #A1)lFHk J#7Kh#! !3I!0ik0H 4 /I*HikpF &2Kh 0Kh,Kh+Kh0F)K0Fhl%KhC%KhChpCOѠh=hpC O0F h 0 <  ]  x   l D P t d `NK-OFhij3DJKh;IKh ck#j3DFKhFKh1EKMhFEBNi3hB݉@8 FOwi2`!h&I#*+@&6h?h)F8FFF8FAF0FAFF0FB5 F'B0{O O E jR Jh bk"jBF 7B 2  +DD ` d 0.K-GFhij3D*Kh;*Kh ck#j3D'Kh&Kh1%K1hA FG۽(Fp&FF(FF FJ%h#*+FE &0j bk"j(F#FE 76h Gx ` d-CF#Kh j4!Kh;!Kh sk3j3DKh47h%hl?#*+-, 5B;kbD B %7 30j rk2j8FDh C! `  FFFhFCF ହ(CD +FK!hF , F0(mKpFh+ &&#FXFO0$(*FI 0F I 2F)F!FFH F(Fp P-j-CðF#"!$0.%"!"$B7)FBFeF"B "? r"!5D$ 0E"? `D=D@F"(@F? QD5F FCqXIFH B <nPJh3`pG >IFFH ( fnP?8F+J,L,IPh+J( F F)I)K(H!Fb @>"0I"HV"/QI" I!?PLJ FKI"0ISIHB"" IH:F 4`{j-O FNF-h)@ F?F(@hc(F?)FHR"FIH P3i+r! F?(l F?F(e(F?xF("KJAF)p / FFAFF;F !IH P F?(V FpCOL?0 (HxH!F'qvO{h;{`+[8Ft?Fи {h;{`+OiHbC@OyиY!F(F?FHsh 'B"F)F^H B<$h+"F)FZHV?,(F?BFhpCO@ F(F?, )F@a F? HH!F0PFmsiCO Oذ3<4F(M Hx030#IF@F##0@'###F*F@&IH{{z riPFi? F8F?B!F3)FH F?!FHPF?8F?%@Y nP)EmjwU9FPF0!F(-D-D FFFF$*F1F8F>(-D-D Fp FLch&F+.MFh+i+>I"j` hB `˱*`>#k` Mt`D$Bj Jh j FI7#FFp !0]K 0 !HF##UJ XJOa 茨"fF >3h+OK , hMK1FCF"CFDJOq8F FJ3FOa R0 ,7J xh=Kj;8Kh;K !0F +J!8F (I, KFFFF J YFPF"KFJOq@F OaJ ~=JI Fh "팩F >-Tx 4m m!`! <,!<N!Fx;jpCO "#CDKh> BKh+AKh+ h(!>h> h("^3h0Khk+i+ /O4H9hx+K8h"`O3`kh#Kh+:#k``*KhFj3b3hKh[LN#h#0h{##`+hӱKHh#.蠹K"4hQOSI" FFI F  /0h#0 !=(!=$!=l!=!=!l !=p!!(#Jh F" >(#Jh 6~M0+@|Nsj+{Kh,@yKhF"xKyHh{xOȡ HF"(b HF"([+i3W+( IFkH\jHjHWjHTiKh;+gHgHIfHDeHAeH>dH;@AJ(I`I"b(CН0˱ Y+S+ s+ y+ 8h(wGKSHhSHRH 0#OI 7`jMHJHJH@A(>I"p#0,KO4@Ht`h?K"`90 %I 2OL !F #HiG(  Y*0+ K!FJHS*0 #J` 5;h+I <,I"FHRq I O0  ! B-OO8O$8H;hFFh95F)FhBиV/I<(Ա5FO$;h(I)H[jGFر0ik!F!HGȱ( 5FH Kh+II \KhikHGȹKh+I I IJF$H%F Jh3`O5(F! m!x  !hZ` ppG-OLO3F#hi.(( #hjG(ۉK hkFKh#OF (H2F(~H({He(Ҁ(O3wKh#tH'vrHs(nHp(mKh+ ;+Б"F=( #0cJh $!\H' YHjWH0/+ v8VH"PUIFHLHPJHNKh+FHm(;h+IKhAH#[hAHCK"`CJ9Hh3`G 4H!E0C8M+h+6Kh#+`+H1#h(H[lGF%H0S *'Jh-))p#K)pq(l(%!}"I =Kh +w #h[kG !!=x!=(!x!=t!CFн@ֿ#|Jh  FF>t0#j#FJh @0F>C##Vh+ +++N+#HiFh(F>j0pCO#8`O0 '0-C( AL#hlG(#hjG( H!AIFH(@O;h?Kh6H=;h:KhC5K#Br1K#Br{+K#-O;h+,KhH#hHV&K"`03h "Kh !Kh+ 1(L0+_ +];+4HE2!!h!=x!M@IF<)FBp FFD`@I FFU2K_F[F2F F)F FFF[F2F >jFNC T `D)F F(O0>#d HL[BA#x<9@ F)p NF)pQIEKFpBF F@F Dh@ ! T!-OFNKNO)p% #BpHI k#"#(vCKCJhCKBh+D<9 u$0ܐB!#DȰBr#0*F<FF+D@90BB0@9;(#6DBr#02FFJF3D@9KhYi0F.#"#( 0I BD<)۞ K"O0` F!Kh{iF@FJ#Fh O0'0!=T'!=BpF425#!m%KhF$Kh3 F<^ȹ+hK#Ozq#Kh#Ozq#u!#FJh _iF F<렱!hN+!#F Jh M.iF F<"0.pSopF FF<  p2F)F F<(Khp!#FJh O0p!= FD!g nP pG hh;s"F3FD2o@B FoB?B<xk*b*`i@P m*w*Ѡ@p@PBp 3 FF )@0x*+x+{ F)F0hC2BDr FFFp-Cx#I jFX!I#8F`X`ft*hZ+`k`\#xK,! FF=! FFpI@F4O0FO M F(I4Fjh` 1Z!IH <nPqKhQЂB` L!F H!F H!FH!FH nP|vsFF(J`, *3(FlFK"`=1F*F&#cU Fp!-GFFO I@F*I F.@F8FCFй /#cU (;FJh NF0F=-O FF/! hpM(`0(`#h+`(hOAFz(J%KF/FFF!``O K!FJ0F KFA z(R //л/////////////////////////////////////СХ//ЩЭ/бе/////////)////9?////Ѓ//?/Ѝ/Г/Н//////// /-/37=}/CgρχϏϟχϣϩϯ/ϻz8K)` 6II` >4J4Khx-*3JYx`#`#".K.J"-K"-K-Kh+,H(Ѐj)K"`"(K`'Kh$K"`%J#`$J`$J"$K Khu(G "K"K "KJ!=!!=!D!l!=p!=T!= v!=!!=4!=p!=(!=xKJi3aKhKX"KU E  (FO&F I)𘽒I S;OF hE3KhS`'J 0"K."K+Kh JJJJJJJK"KzKhK"K J uKhY(?K"`J#`OKhKhZ}J+|I|I`* 6V2xKL!3vI `  +sJ`sI h*@D#G?nh5 h(gI(@Հ׀DK4h`I@F0_KO  \I@F(BF"XIXF 2 V O FXFF^FF;N*0F&FIH( XFF2 #0F"1FXF(#FO O #+@ڀ.0Fp'I@F0+?dBF!(>D!\!=1!=!=$ZPF<2(!l!p!=,!=\!hg  !=nPm!!= rmGw# &h^I0Fch3+"YKXJ4`030SK"0F4h1(W#MKhعLI0FF(.2FIIC.h?hh5.B&hBI0F~(``h(a4!(0/ h(VmKO O;`'KJ!F0F~;FAF(z*.,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,{,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,*-7=CIL,}EJ3nI kBOI 8h@K)`?a:h>I >K"I `WD!nJIi`VKh(>IiQKh(4IYeK"IY`cK"II`aK"II`_K"H`]J`"\K=KhZJ[K[K"` 1 QxVJVKp`+#/(o#0'##MK" *?#*#0# (?@̀#0=K" C*hLF9IHP8M,O3Zk"3I@H$\<ǛnG 0 (>D!=L!=t!=(!_nPum!=!KT&`C(M  !T#(+h3+`+hB K"`m<!g o!=Khh`pG!KhбK IhhW0 I HF K HhH!!nP!=KF F":`xD**2h?*.x[*-b+x 1I h)O0/+=`+Q.5 F+JCx*+?+)F5 x+#:F F(+3.А"!!Fx4]((Б-ё м]ІBfEؿ"B"!F!NE,Ѥ)xBР!=\p hxD/.5FF(@o3FI O0p`)FB  ;1DB  (ppO+KpFMh)HM(F'HG'HD&HA@AP(6"Ih!HJ@oH*0#H# .+ѝ@$H F.H)h0F@BF0F(`O0 Mp!=iLT8Ho-O]xK0 EFFF @hF2.'si# ")F0`(} 'FB4Jx1 ؋0:B(\*&*ыF)p#+r E FRF)DTD1BF2I + D LcB7+x+7'si?qii;#;B)F##p LcB  xB+[FBFI V *೹0+@BYF@F` 4 Lbsi՝0+BF I H*[FBF IH" ]!nP-AFmx LI FF3x+M\+6B6*xB:O` `(A8F FJ "r  3F @3"  x/+kF J@   H( kFJ@   9(O0kFJ@   ((kF J@    ]rF F I  FhFF*F9e-1F@(e"8F h\"(F"`:`Oa xKhOaOq pG!8K0$`D_BO00yhH`Hh 1``h(̿  0 0!8!=8F&x#"IPJHhY!`I#`"F{OqF(F#O3O3F8I$OF8%hI(FHch*FI zKJI fhI0Fr(:h:* I3F*F eO0K"Z` 4>lš!8-CFFOq0F(߀BB! FA PB8C"P0K;BhK@AgJeJ@AdK ` @ "dFB(H"FW7U DlB!8J-CFh}c-@Khs- d=5D*xk:/*F+CKh3 ! F5F2FI!OrSBOO /F#";1F eN/#+p=Fd")FFBCXZ *))r`rrr5#"0!# #sKh !1Kh+ #11A~HXU+Oih 3#4#0 U# !E8AqHX"Fkh ] ٲ#-A10( #"! '(6#"0!# #(A\HX+2# + K#1#d" A 0SK"i# #F(AMHX +U86L#0FKB@!!P iSBk` F"00 @Bp2FFS"0" BA4IX %BD) +@O 7#0#0S `@ ## 0 02)B@r0FFQ"0!BѽB K1B(C%X# lбA HX%!=jIŊŒŚ!8ţŬuB ! b($Nh@BCX +0%,1i3i`5a(H@(0oPoP0pF;(.?!Or5FS!  (F }!<!88FtoF"FI )F F8@ڿFx-+CxI0FF`jh2FIF b M'(FF7o3F:FI N F(KB(FO0 FGwmL h8 n h@pG!LpM-FO0p KZh*)F($ !tU0F p Fp!L3S[K"`KhKhCL#h+I J##`KI Hh)F H "I 80@pG!=h!=$!=(!=lnP!=8!H7IL `PI(F`` 8 hf(F7 Kh+J IO08%!LGw!=x. s FSkK"`KhKhCM+h+I #+`KIHhh1FH , FIF HZ I p@pG!=h!=$!=(!=lm!=nP  LIFH6 JnP̰HF *x/+I(I F(iF F7B0&H7<0&#BB*#BB FLՏ[PJh3`pG!= IFH t_nP IFH d6nP-C%KFOhF2`W%`G%fphh0FNF5'-#h;#`3KhC!?!?!?9/ DF'!H!?FhFLfh(F1F~h0pFN3h33`#h;``hh F4h<4`TKh=%F'F$h%(F!?!? H(a(y L#hh3F#h3#`L!G-CFF(FNO3h33`F F(F ``HFF0*FIF`h "ZUhD;h#`3h<`;3`3KhCU!?!?pFFQhtah(F8Fh F p$h FpF!h(-CF$3O؀9Ԁ%0NX%@ 'ܱah x-H h 0hCh;C`+ "2hhY`hZ`p$h5'-8=!h nFX(FFX*FI$ V_-!)FH  g8hCh;C`+ :hhY`hZ` "p#(F;4 F"!?-CsKtM,hrN!F#F+WF> " FjK +` p cK&FhdK`dJ?\tBF!F0 p.`+*x!*k *6*3 *, *-.(*%%*a&*O&)*u**(!=*# /*R-*Z:*e<*/^*\>*?*Y |*~*P" Y3h33` FF6HX  cx=+G>+I F 3cx|+ F x=*D 09cx<+ F =+6 F . ,cx&+ F  $cx=+ F(  bx+* Hbx-* H$  % & #  F 3 F  F  +`r!?!?!?!?I7gԋHFKHh!=ԯKshM.h+` ,K.`~0FH("xK*FL6"` F FF,hxH)F Fp!?!J-8FFF#- BO>FX j49&-p0m a5HS4H O)U?/H ,hFF8d8JC"D8PA8`8?8?8BpBr BrO!F8BpO!F8BBO !F8BBO!F8@@8Y@P@8CC8!-GF FFF'&-; -+-=-`6K)"-$-H-V##BfFEFF@FIF})Lch#+F F'H?)F``@F;"K2 h.##K##KF!FF@FPO !FK##KF!FF@FCCH3D!=.!?<-OFFF(O#a#F+FF FY@+F F,ػ <̜E "F@F FMKF0FBFF F+&FhJHw!F0FdFGH0FFHF0D09hjF08h(Yh0DH F4F)0F #x-+cx+4Kh /Kh&2K"x*F#x.+cx.+c#Fx*K/+!(H @(F6("!FF(!pCO~+x.+kx/+ѫx!F!F(Fx0FF(F( )!F H(Փ!=ՠլ!?!Gtս!G Kh)"H@ H@7!=ՏL$H}FܲKhhHL,AK"LHh !h"H hL hCh;C`+ v"hhY`hZ` " pg!G!?!=ՌՏ-C F5,ht[L hCh;C`+ H"hhY`TI F/=FF' PI F=F&F&7F$U+*xxAF,Z\,C.ASxe+$ a+0+\+42b+c+m-r+f+n+& $%t+v+ $$AF2$$$ $ $ $;0( 0<BFFCh;C`+ hY`hZ`pBF+h+Ch;C`+ hY`hZ` "p/ZhZ` "pL h #h| mcUpF"HF FhhB< + mKh FIH ]2F)FH ,IH , FYIFH L hCh;C`+ \"hhY`hZ` "Hpp@ 4!?.jKh pJ!`F\!?!?FK `Hh3`O0 F!?!?KhK"`"FiF `5 Kh3 K60 F!  *!?!?!ElKh "` !> RK` !> FS[L)Fh$ FF FF>2F)Fh FFO0R FFO0 FSK!Fh@pG8 FF*F!F8@hO0R]pG FFO0 JFHBѲBPh2J !H Hd!=KhpG!?pF5F h( ")F5BF h5*&``h( "!5CF`h5f`O5(Fp(7 FK"6 F  Kh,`hB! $h 6Kh#F2F( 0!?!I<F%N F3h+' J<#XC0`7h(F9FAkJ!SF F:G{'{zfk[[#x6+ cx0+"I Fp F*" D<0+8<.+p0F@N!>r J#`J`J`J`pG!?!@!@!@F#h;+ "iFh[h#a iH "iF" FYh(dh0Leh-*F!H <00``B! H ,0 Jchhy`q`h Kc``h0!>hpFh+уhch@K"hhh3!I<-GFh!1h5L8FܠO6F#h3#`hF-Dhh+hchF(.0F5%Hzh@Fih2"'#h;#`#0 .!0F +5! !hh).0F55-h{h N#@F 0`5`#h;#`#Kh !?w!@ !?-A FFNV0+V0+рh!+R(<@hV0+@΀rK!@hV0+@ÀlKh+@kKh,@!@hV0+@bKh,@aKh+)Fhdh0㱻hӱZKhZK0h WH h4!F "UH dhSH yQH !h )Fxhl "0+pлh+mDKhDK0h \DH YAH])F~O)FzW!@hIV0+O3Kh,K2K)Fh7DF@h)F0:6H30iAhh"K$`(!@hJh[ `!@hKh"`")F@HF !H m$Kh Գ;Kh#Kh !?!@ !I!J׈לsס!HpF FK F!LNhK BF +V0)Ffp!J(-CL(LhA(O'JO 'M;hh*`"x*h :*`*"x3,]"xCpLF4h *h:*`l*ۃNF3HNFC*Zph iKVI h*Kh:`* ` * M*h:*`*`-h"h:"`J !@ !@!I!J;!?!?-GFF#N]h`h"3`'ht0t;h+i(F3`Yhȱ\#P ¹VP#h9Fh +#ieh3`0E,Fmhdh##FJ`2!J!@ !?-GFhF=N;h J 0㱣hӱ7Kh7K0hL 4H h5)F "2H mh0H .H .M! F+h3+`VRF!FFy+h;+`#&Kh /O(h H`h/HFn K`+h;+`#Kh /Ж0h Kh K0h aH ^HG Ͽ!I!J׈ױ!?!?!@ ׿-A FFtO3+`#k```#KV F*:.8 L#h3#`x(H!0F"1FFK `h 4!x#!w0F4 +`#h;#`#Kh j?!?w!?ؗK-C簛h$3 KhNKhK`KJ`Fi`[`h#̱!ih)`[x]?] =+Ѓ" F##dh}NyM`h[`h<"ih2`xR]"` ` /Q]=* F"dh"hh1` 0a`3h`Xh`h`]K60K\Kh3 +¿S< TK0K +@#d0PKPK$PM='DhHK0h 3.5\kh;k`+(F +hZ*`p9FHF Fб#pph DCh;C`+ hY`hZ` p'pHF $ *6h-M\kh;k`+(F }+hZ*`pph $ 6h"NhM"F)F0F 7mh( $Lch;c`+ F \#hHZ"` "p ;x'NI!>!>!?!J!@!!IL%"Fhd0+9KB5 $FJVG-ѐ-рx p(,F F({K$  0 $+ѽd0+dD#d0[hlKhԽd0Z*W@;+bJBaJB@`J!h3`[h ^# h(VH-VK&0+gѽd *cSKh`"RK`42EFа:HJh;h`3 FlFHHGKh+\&vXCKh+BK =Jh`4(?KOqh &` #5K  hX,5 4K` +K`+Kh*O`F F #F F'  |(@ K`Kh+ Kh[4!CJ`Kh+dp/#ׁ/@Հ!D !G7-'=!?w!I!>!?!?!> !?N9F!5Fhwq+h#`# L:2`3q2`"h`2"`Jh` #h;#`#Kh & |Kh+!tL! F+h#` 8oK! `pK`oK`oK`mKh &`Kf0 ;eJ`dK`eL! C#h3#`zaH! UN#h;#`3hOL33` MK F`NK`NK`F+h #`JK`k3h;3`CIJh+ #`GJ`=Kh+@@@J# + =K"Z`h`@"` C O30K&h`# 4Jh F(u0Kh3B* h+K`d0+ !FOA h#K`%J3`$K"`##J`#J`"K `G K`TJBJBK!h`#8 !G!?!I!?!?!>!>!?!@!?!?!k!?!I<!?!G!Gx(>@g !?!@ AD XKh++UKh##SJ` SK` RJRK`RKSJ` # OK`OK"`+ MK`BKh 3GKB++ѽd0+@K"`?Kh+&a+J:KhQ`hR`"`?6Lh+ ! !hh[ W/KhF FB%,`h)F $hL##` # c ` +`4 `K"`Kh +gOBH m!?!> !@ !?!I!?!?!k!?!?!>KhpG!@KhpG!?J#`J`pG!?!?( FHh^ H! KhB+ F"hxc*J !!`J` !@!?!?K/!0hF3 F4"!FHpCOH!FuO!FH4 X(F"!FF(PCO F(F)0!I<#K(O F`Fhh!F K0F` M K/hh3+`_/`@ h!@ !?!@!@(HhKhKh+ KhCF J;h+""K`"K` !@ !@!@!?!? pG pG-CH !F F)FF1FF:FIHh . 'Kh }pG!? FFF4h-ц v1F8FT K`K` F 2`!G!?-OFhFF)_* F%',F.F;SHF *J0 :+ПB%FhEݍ2 JB @FDZF,/*/" IF@F,J!`)xB`&F+ :*2xHF:*6`" 0hOcF!@hFF F/!FL$ F:F)FQnh$> @Fn")hkF(0+:F)F6Rh+Nh+Hh, K ,>*~""! F`-hEI*FF !> P7!@ -CF F*Q) >K Ghh3H="1F@FF?ah5H HF193H 1H 1F0H */H 1F,H ,M`h+h3+` FhF4+h;+`#%Kh /$H  "H 1F HOzL hCh;C`+ -"hhY`hZ`*"p hCh;C`+ KhhY`hZ` "p5!I<D\ejn!?!?x~؂8F L hpx+xB%+`h8)Ft(488FL hXx+xB)F``h848P K"0%h LT"0K)(۝rh2*0!@-CFK$\\hF2`(h0ChB +0Bh+`vF4|,3h;3`C!?!@"K-AFhO4Bu&3Fx+B:*:)2uF5F 5F%*a9FH(4F<:+6 N3h+b4`3h+c%(F4`!I<ءK-A&XFh2`=hu0++h;`hh [(F/F6|.#h;#`3KhA總!?!?!@FF F/ D!KS!@D)Fh 'F$hN(F3h33`D0 #Or)F8`F`0< ,3h;3`#Kh K F`!@!?!?!@8%L4T 8!T <C`8X L#h3#`Khhh`t#h;#`@!?!@-O F/!FF 0F4 (h+h+Os#+O3-,`/Kh3BD'ՕILD !0FIF豰 **b! b   шI h)ښ *O F ~J@h20FF(@𮀺к * sJ0hO3̱OO9"1FF(|  :x/*dH00FF(z^H(KEܑ 8F3|(Ph*Jh*F pBO;LKh58FIK0<h 8FAF0FF *:F1F?H!F8FRУb(S BBAAB AAAAAAAAAAAB BABB&'O O$%DJH;C3ChF $O F'Fh&FF[00 (F#h;#`#Kh 0!?!?!@0+@h 0 -O'F=FO ;Kh3HF!G'5<|\Q_o!I<uTْ٧-OPNFPMF3hF(h443hO\,؁,/,%:, ,,؄,, m : *p3Cp0L~#h3#`"p0hx[(HFP3f &j O{? 0 +#h;#`++hZ*`BC+`#h;#`++hZ*`p2C+`pF@F !@!Gl(K-GF/L#h+X.KhFB#,NF8h)K3h33`3h;3`+0+ZhB `#`."#`h2#`$HhB" F#`ONL#hh3h33`h;h3h;3`+0+WhBڝ`!@!@!?!?7Fx F!+$Kh0 @@+*+ Khh(7-4;S(0x*+0; +(# "` FFhùx =+Kh KhB Dh h+x_;F .  ( BF"F ! #D+0;0)sD O 0 9;0+ۄ4D0+Fc] +04;0#<04;0l (2 \K`CFaK`+h;+`# Kh 9!@!?ML!@!?!?!@!@!GlDK-OFhF+ s?KF%ZhVh;K3@TD0SDBS#x+4+ P c#FF{ 9FLF%9F*HBFLF.%FO #pLFF```VDB#x+Ё+ g'F;xFPHF|'F|&F 3xC F`0`!@!I$!@MLN(h#hh3#`#h/`;#`+3h+K`K`!@!?!?!@8F0h)FF  aKZhD``X`8!@)F+NF"3F3*F-h#1F`F(FFahhhh(5`.F+h F,`4`&F#h F%`F!1hſ-OO FFG[ غ*`к?>к@-غ\%#8F+#x+cx4#x+'@4#x+4Cx"xKB#x+4"xCxB4#x+4#xbF)䀁)3Y[x]+9!*?0##x+> CxF+?*+Ё+܀+ހ?+ۀ[+؀"xBԀ)Ӏ*@ЀbxBɀ44Bx!*^*у;F Fx-Y^*8F#"+cEx#+pи~и[.+x:+4kMIFF*؃BF 8 D6O,0FP&0FC.;и\ѕ5+x-+'kx]+$Ё+\+kx] $# (  # (ؿ#E#5Fk]FB?F4#x+4#xSE40+?  LF0  F_F*2 -OFF F"#x*+K?+I[+>cx!+^+c  ](<[(-Xx:(x/(5Р3x.](/(Ё( ўxc/+ 3FXx^(:(ћx]+3x:+ѳ狱/+" (3{( Ё+4"#x/+"g4QL+F h x. Ё*1xp xF1B hiF h2(}BйB F+(Ё* FYx;7KhFB CBx/+#<0H0HF(S0B/#<#x#&4l&;FF(Ё)F Kh;HF톻/#<,HF(C{.+Ѻ. "8FYF(FYF(FlT*FF F/#!Fp'!@!?xF0+)+Fx(F)F23ppG-GF/M0O.F,W`hF;3kh``hl`I[+!;۲+'0300SloO`0ah#00;0#Kh shE"`h Fp`$h!@@!?!?!@8FMx+< 0 +;h;;`++hZ*`"pC+`#p;h;;`++hZ*`QxpC+`Zxp;h;;`++hY)`Qxpx+0SC+`Zxp;h;;`++hZ*`"pC+`#pUKLDZhRJVhRK3xKKPK-FX)[N .LO  x)JY\ )9)HcA9) HCxpJAK xp9)K0Cxpx)Y'AK xp/Q-:óIy\ ) )29)$H p#l!Eh!@ !G!@!Gl!IL$MKpA!p9)HpFAp?A(;-8 x)?49)H p%Ap0; +|# "`8FFh+mx =+h/4Kh b3KhB^Gh?S'08 .6,K',J-N-L-FFx+E\ +3h;3`+#hZ"`p`C#`p3h;3`+#hZ"`QxpMC#`ZxpMLx+h;+`+#hY!`Qxp1C#`Zxp!G!GML!Gl!@-OBxGK=!x8F\ O O  #@r@E НKXh 8F1FXF8FX x+ LF$HF$ FLF$K hԹK~0+;x@+*+𪀸 +:F9}Ho𜀹>л"xJF 9_F!h;`+rKrHhY`p C00p  BF8F hbKh]Kh[_I `\I hD `Z\J[KF ЃFTIF)E h; `+.0X p;+1*\ ++ h; `+0o~Xp " C0o~p  C0<p#F#Q 2 :x@*,Jh*B@O O 2 *ww!!!!OF9h@8`|d ,t(FCK[x+@h,e O4;h;;`+0Z "pI!I!Gl!@LM!GC0#p(F 0 BFIFVx 0 ;h  KD ;`\BF9F(F(>&LpJ$ KhKh'H)F#*x*5)F*Т.,hh`*Jx*3*;$(F !@!@-O F FЙJQhVhp ~*PF)F8FNO L# ػ𢀻=ػ:ػTػ𓀻 кO F)ЯF * њ *ښ @*њ0=+3h;3`+#hZ"`"pC#`#pO<3h;3`+#hZ"`1C#`*2h:2`*"hP `xB"`3h ;3`+#hY!`cC#` >Jh3`h 8F)@7*F @h h u8FFp2h:2`*"hP `.B"`k]0~+X=+?Q#)F8FI Jh3`3h;3`+#hZ"`C#`?.YFHF(?' J#hh"YHPF!I!Gl!@!J$!@?K-GF^0F "h':K)F`07LF7J06Kh#`6K`6K`ih`#h~K#h3#`p0p;#`+0Z pC0p0 Ld`F!Fdch"`*d`)F h hh + wchG````ch"`#h#rh` K[hs`!@!Gl!J!@!@!@!@K" F`FdK F@hKhR!@-OOq5L5M0"h+h3N 3h;3`+F#hZ"`"p C#`#p+hPF @FS+h h K@FhFFZ*h#hRD"`3h D3`+K`!J h-!h F+*ѻ" 3PF+DYk#h8F=+D#`3h]5` !@!Gl!Jwi-OF1NF0LF3hO11` !!F+KĠhFs!hQ#h3#`p pI3` h0 DлX;x+H*FI -J9HKFJFHF")FB #h P#`!Gl!@5!Gt!@-OFyOFFO1;h9`)sKhFpMı+!!)hQ+h3+`p pbI;` h0 DDLк к'FO 'F 4i2F!FHF(aч77OE 7O B 2F!FHF(C:F~B ) !Fx(11B8F 7B2F9FHF(9y~B ,* "Fx(22B8F2F9FHFv:x*77BӮ:<+hCJD 9Q [+`OE#;? L*hpR:*`*z"`":pQB"`"p +h: 3+` !@!Gl!@-CFFM K!L&t`+h#`Kh0K`0;0B#hZ"`p C#`p+h h"9FFh F!@!@!@!Gl-CF/LFA.H& hCh;C`+"hhY`hZ`%O"pBW%5DHAF hCh;C`+dKhhY`hZ`H%O"pBW% hCh;C`+F hY`hZ`5 nHBH<Kh#hB`pGJh3`Jh;`pG!D!@-AFLFMF#h3#`+hi2 <+hi` Maa+hC`Kh`Jh`hB`#h/`;#`3 KhA!?!@!D!D!?KhKihDh1`I `hI `hI `Fih#`h 2B-AFYN3hBWKh+VL(i hC!RH0 `0%(F5-(F0f `0 hTGIHM ` hB((`DH,CK"F 0 +hB! ! !! ! 0 6KhFB 00 h~~"!)h h0Ah~q"F(H0!KhFB 8F00h~["FH)h hL0h~J" ! O30! ! 7`!E !El%l!E!EhF0+D"K$'hF2`0B  !Xv0 0B h~FH4 OpO4'; QhсBT`p2+h;+`3Kh@ɿ!?A!?8FKhBF`@! Fv+h;+`3Kh8@8!?!?-OFFF0Ih.:Ԑ5QHBݲ IFPhShBF]  ++ +F 90+Ѐ 0E'тK IhMh!C#BC 5 "B "-"+" "!rJqJ!sF lJ !0XFXFD0XdIX$@#3_J!(D3\J!X,*OqB"?+ TJhR#( "YOJ!(D0 XZDIH@YO XL!FDch;c`+ F#h5-"`!F)ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"p:*F#I F5# ch;c`+ F#hFZ"` "p FZ#00+s8F72!>Zdiqzgۉۘ-OFFرx%+T HF'(HFBCHfx۹kx%+س++-+=K=HZhU;K[hZk;J!;Hh# H6K $@Ԗ0˱0+kxР?+ YF ,G4F HF(6焻H*((F$JhQh9ԓ Z *`bR,B3* KYhBh$3 2G)F FF HH۽۞!>ۭ-C1L2Hzh0M.F 0H(̀Ch;C`+H hY` "p'8FT3hh*:[h*`+h!h)0FH!O!hO A H2A!A0E H 1hZ` !>!G ۘ$H&K!OhhF0B  H4X8hCh;C`+ ;hhQ`hS`0B̿ # #p !GKKFhH!0hdB F!>۽-GFIMhkP>Ԕ0 F4#`hh,hF;J?N3h33`(Odp(` 0$`CAF FKF!QE  1B03@F+h$jh@t@4#FF3B!2j`3h;3`SKh;_ 4M! F+h3+`#000Kh0/ xC@+h;+`#Kh 0 F!>!?!?!E F=JFFh` F F 8K`/e.=6KF0S00F0h)F 0"ꎹ-K)Fhx0 h~@2F&H!F u!F q. !F !F ű0K60[!F Y!F U!F QK"`F(0)F H0( I H.!El!E !>b NF JF :A * """ FBFO00-O_LFFIF(FCF h+@#h+Х(@TN%3h33`RKhFF0!#BXҔ0+R0! Op2! FB1?*gE?i  фE ІEbOPO5]`OP%F?  фE"!3q*##BЄ0! F4%0/Kh;K60+ """MERP"K)Fh7#0h;`S Kh;E8F!H!?!>!El!?-OFF !&F! !(/KF04-L h*F0B$h0F F0 &h~OrF!HO O M&O ,hFjhB&ܔ  2 ҹ F Д *ް:F!F@F64!>%H# l( %%K60 E@LN#hh#h!7hh*FF8Fy#h"`[h+)F0h^ ٰ!G6L6H6Oh+;hh+^ ;hh$0M/#h%F&Bғ  3 Z0++h0Z#SC D\h $600F;h3;`;hh!Fб0+1F .00+OrB$4$ F !>!GpF/7M+h3+`F0#!F 00K1Fh0 h~n@ BF*H0+'K%JhRhC#CB! F0! #S<& (OrB&6 :OrB(r0+ F]+h;+`#Kh 0Fp!?!>!?8Kh 7H0F4H)%2H&10B .H51+M(hCh;C`+*hhY`hZ` "p!O%&0B  8hXD00B ^h}@FH5M F F+h3+`+h;+`F# Kh F!>jۘ!?!?HtKhh@o!G FHe h@b8Lhùh#h"ahBܓPUP-H#(F`8238 8F8!>-OOSbJ$0!FaKhFhF-񟀢xF+Ѓ+L=+d$+'+}"++\+Vu+K؅+tA+JFӊ+yH"#GJlCx"oAx  BK0F *SFFF03x0; +HshhP !Hp!L#h3#`/ !#h;#`#Kh -'M@|`&#0@4K"$ &F ^0CK" #0p@2p!?!?8!LF#h3#`/(!R#h;#`#)FHKh '8@!?N!?8F FKH,Lhh ` h 8!@ RH;8H;F0!F0L #hBN/FOw83h33`bhFC+`3h'`;``3`#Kh bhC`#h]%`!?!?0 "I /Kh`h D`HKZh`hhB``Kh`Kh`apG!Gl!GpKpFhFi2N`J`ph"hKBhs`bh`h` Kh`+h;+`3Khp@p!?!Gp!Gl!?-C"M.Foh;OIEk$'KB$N!8F3h33`;hk`;kh`Kh``h,`3hBуi3h;3`KhsC F2JFAF*3hD4``!Ep!?!Gp!?K0 hD`h`pG M Oh.F,h( ۴o"Fh]HvW,)F FFF F"F8H Ff7%$iFh.$0Ph|F/H<вHE EiFh.(16h|F#H"EHEoBBO3BH'h)F FFF FHH!FO5oD ݤh!Gݴ*|j!:*;;+# ppG8?++B pG pG#Fx0; +!FH "T+МBx+C@*+H!F4Fvދx0; +?+ pG pG JDq\y,#F3oyBq+L6*F@-A FF(l);KHCKNKILOYIM;3JHyy\cHI4,GL hCh;C`+"hhY`hZ`:N$?O "p)YA3$-A(NMȿ MLFO ȿ#`Oؿ!`3+EOqч  g#hh+AKh#060+ јp/ Z(8FV6p6 1K*ѓ *6 F ,K*6 F (Ky3)B2h"K!O` Fj9hY3hN3`#h"`h(`q+h3`;h#hI hH `Jh`Zh3*` `K "h Oh`"Zq"h F1h2 :``A!G!G!G!?!G(-CH HhYF%L#hBHNFh[#`2hF22`#yh  %uh;U+C/*3h`;3`#Kh M *!G;!?!?(F#FF@ L #h3#`xR Khh H#h;#`#Kh  !?!G!?x0; + "!(K"Xq`!G-GF FF;h x1h) hZ3h$?%4`FO 3~x-+TxS,11`Qx-)ђx*xFxBĹx:+ "FFH@PkFCI*FCH`!F?H?%K:)2Rx :*2Zx3hѐ: RF/HPMF<F'*F-I+HTF0QF'HhQF$HEO33`$O F"!IHF3hO 3 #FF0`J ! OrHP%*FPC@FT5`=`  HFQXln߃( F HW I( K hIy)`!aYqKh`h;ߊ!G!GJphF xL!h h px-+VxS.1!`Qx-)ђx*xZxB HO:,0@x:( [xCJh`hHK`"*`Fp!Gx!G߭!G| L M'F#hk++h&;+`+p0F0p:hk;c!GlBhF"h,#FZh:Z`F$hD`8FDhcC`+h #`C`Ch "!RQYщفh`8 !"Jhi`TjQk`ka IxBS+Ё+т[\ +F pG pGMxJ\?\ pGFpGIFKHhYkTvpF FF"a(F (F`p+x-+kxO3`pH ap-OdMF+h;BF;x^H^J]I^N ht1`+ ,!F`:x*B FJF;+YИBWg ,JC\,&2h:2`*ۊ@   p (F2h:2`*ۊ    p*h2*`2h:2`*ۊ@   p ,*h2*`AFэCFч**h2*`$JhhaB ( (d" @Fl ()h1)`haF2h$:2`* @Bph K(hhaɄ!GlKFFhZi * i F#F (JJKJj"!hF!hF~3F J-K Jj!hFɄ-AF FKhU)F FKhBF&`N4hGBٷ_, $Bd!Fph( 8KhhñKhF-- K H-F8 K Kh0( Kh%`8H8!D!!I!IxK` @!DpLMN#h;#`++hZ*`x\( ( 3h33`Khhk2c :"!HCp@wp!D!@-GȰKhh#KhKh.ꐱ q~K"!h`|KF`<{Jh3`+ FKuKhF^FoK`pJh;`;6mKh+gKjOjJhjKhF`0i3 W0"a`(F^Jh;`+bk"*pUJh(#JF!X (:\(A=IKQHh4i (F;h3;`0ha\('`(%$(# "[h[",0;0+\#5< \#Ep;h3;`0ha0;0+,p5Ep"Cp%h ,F K ``h` `M /hm-hF#Kh j( #h+\K"ha L#hB!?!?!?!Gl98Jh01F F`0FD00̀030#0;0#&Kh %Kh`#K` "[h[!Jh;`+c""p&M "Cp*h:*`*p3<Cp Jh;`+ۄ"c"p"CpFH!?!?!Gl!?-OLFO# % h:h:0 PcHc BJ60 8040K !:hJ `"chJChBXFF@0F+FbhCh # (ȁ?Wb,4HBCۉ+с0 ;0h3`;hh ")C[@0  ;0# <2B 0 ;0\#0F (h3`;hhk2c `tchC[\(`($("(0";0[F+ : \" FFK\ + + 0  ;0# <"08J;0#00;0chCۉ  %h  ;`# <0;0(KBFK0  ;0# < FChF`&^;Cۉ+ FJChFhB@ۉ+0;0#0  L!GlJMK9Cۉ+C:[ F bF*@[ FVChFۉ+0;0#0  XChF`"Z0;0#XFFp((F@N_C ډz[ F0;0#0F0;0@FfC1CCk0;0chC:a0)(FGXFahA : F b F0;0#0F : p# YF Cډ[0;0'#Jh;`+۵JhY`Fch "IBhB FHIB* FH "C݉E F;hHhZc0;0+ P{pKh+u)<+o+l+x#+xCO6 (F(`(FF e>F.&>(#|(#+`=&(##4r&v<(>()&()# O<#`F 0;hh,j]`aM0j-("` ##+`;h F`b;h ;h@Fc Zb;h Fa;h Xa%{(  8QJ\40;0$#0l ((HF FK: "F +bhBR@kh:`"#iFI #AF FFF {.2 O+h  O2 0:#(F2}(F0$I0A\J"Kh3  ?}(5HRF!0+F%O "O !D!@JWMdI!GlHr!>(^FO yH1\9)ۈ`pL\F 40 (9)ۈ`p/FР0 )  9`F FPHAO= 9)  %%.:.#.FO F 1F@F( O O B   }./H+O chCZ I +&KI@ J h? F~BhFىفOI`h3FS3\3[BSh:` #Cp FS JChF`""ځ~IMJ!Gl-C&N3h[h+EiOF73h]h-<*hGDZ`i3 @0"akhhhhZBZAF #" F3hi'a`[j`kh`h+:F!"I0i`[j`L-CSM+hi"\iai# +ha+h"LO4c4:hZc0;0+0Z xF&.- ."re .h .#.c;.5(.C).\+h$@\.@|.T0g (;h$3;`+hha*&(+h$# $+h|(+h$$+h&(;(+h $ +h $$+h+h$\a+C (*h;hh3;`Sc k+h"Za0F"ICO FM!D!@-OO (O;h B;hjF*B* .3F ..=h+k[LFFZ ix xB 60naTF+hi!1F`h F*FF F;h :h. CF#b0F p$L#h&Fj (!O0,+h+(#hkj "*`h:i(FHHix )2a(F 2hi`##`Sh T`ph F`p;+#h(F"p@i`pUKhi3a-CFO $EM;9N ( jF0i`Zj`[ka(`0Zi *ќj<`'w*+B(#(AF %!O3h:hch/!h2FH##`2h;hk#a/3h``ci1a2#FO0vO #`F`3h`[ka F-OM"+hb#F= (+hj3`*hi3a(jj '!F`Ft``y(! :!FFFf`k( ! FFUx`Z(!FFK`+hZi*!FA " i2a>(u! i+h![i+ # #F`F ``%!( F`(Q!  (+hOOkiLH 7 #`F;hi` (';hk"DIiTO ( +hi`Zj`[ka8`#;`c`+h[i;+! #`0K`#`C`+hZka``Zi:*i2a+h"b((@''!F`Bހ!8Fg #`F*hSkk` (! U #``` Khi`Zj`[ka#C`}(/h{i +IiHI#;`#;bb F*hSi+g F0[i+LFO #J; xO *hQkai`Qj` 0( )O 0Zi*! [kYFXF;a 0` (Р +@KYF h (O #;`+h`"b #`03Kh$ !#F`F#```h(й!F'K0F(! +h"b*h0Fi3alF++*h$i3a#!O0p (+hj3`*hi3a#3`c#h+ #F` F-A%(N"(L3hbx(є0#H52hi3aFd( "#F  FD` F``<`'FH(##`DF2hi3a] p## F pF"(( %%F J`D``K Fhi3ap-O";MFF+hb &ఱF#5KD0+8F^#hZ*#c`^(>/N+h"&FbXD0+CF(F+O#` F> `FF`S(#*hi3a[ W !O0**hi3a FɄKp$hFa` +h$ Nay(2h!F i3af3h[h;hiHP0Fp Fp9Kްh6K@"!02Kh#(0+K!,L`#` 6'I"r!hKj"J i" K  " F iKhKJh3`K`K M K`SJh;`kKhS Kh ^!?LQ!?!?!? ChBhpGpF FFch```F``psFhF,,(%H#h+hh0FFF1F;/%!"FF8,r! ! !F ! 1F #h+h*Fhh_ ,,JpwKh0 pG!>4 FF:)O]K, FF]K,-CF{OhF;h -;`ܿ#KUh;+$RXcc1FHF+."!+!  F+{iOr@!8`KN0Ki!0F+CFOr@!'iF,0 dh F+^`_pCOO F+R#`Q&iOr@aiOr@ !0F+7@h( - ( \#KU)F ""a(h$hz*F!FF2H(F+;h;;`+S.Kh+OiLF -&##K0۱#K"`!h1FFHxK$`!FhIFFHB"B")F F( h F+B0Fz-)FF H F"! F+"'!?!?!> `7BpF FF+!F(F,B h(F+ 0Fz!FFH(F+ Fpu-AFDhF Nah3h;3`Gh(F+ FDFl`!>4p! N L5h#h(F3#`+h(F3`#h;#`3Khp@p!G!?!? KpFh&1F Feh5h(+-h$hp!GKh *ܿ2`h# , !bF+z(+d! FK ( X`!>4pFMkh +jh ! F+X۴B F+b0Fph+kh +h+"! F+: Fpp!>48F F(K`D`h``8!G KFhPhBh`Fh F@,!GKhhBFpG!GpF F(O3+J! F+AF -hyFH!F ! F+B -xhy!FFHKH@@FpO-AFFFCFE/#K*F#IhM"K"O#Mx.FU <+U,B :FI8U4-OFF #"3ZT 0  N#C`FVKh``pP-𑀬h0 FBȿ@+h;+hB"! F+(tlhy!FF@HH+^!Fph&(X0300 +% ! F+?F*Dh** * ' ! F+ .$K$Jh;h`#"Kh ~(Fy!FFH("!XF+vZF!F0FKJh;`#Kh _Jh3`:F(FCmhk 0 J K`0J K`!G!?!?!>4!?|K"-O$`zKFzOFFF`wJAF0F@Cs(v(l@g (>D;q@e!?ʀFF F)[ h;+Y.N0+TRCh;C`+#hZ"`p+hlx<+ѫh+ >+ѫh+Ъh FI+h!F0lD+h;+!FH!FHh* ch;c`+ F#hZ"`-"p I Fc(i!F F FʀnLSF I X,Kh@K"UJh3` !G!><!HFpB>*JhR BJ !HHHFgn!>|RK-CFS 0F+x+%%%KKhc)-',,,,,BK6 AJh0+%% ;K609KF0+ %%%F6Kg]FjF F0 +-JF!6 b K,Ф))#!B---#!K#F F CF*йP-! F>/O#` { "S,:CC,"iF +0F!G!El!G!H (-OF FUNhI0FZPH$0M FFHU ,?,ђH!(hCh;C`+*hhY`hZ` "p4@, YI0F*MFN/FV$+h3+`x!F$ F;h;;`#{Kh f4@,(6vI`h4'=4- 'qI h(]=4-YhNFFV%0iH(F4FfH ,[H$5@-WHYO$%FW%0VNxZH(F4FUH ,JH$5@-FH$V$0sxcKHpY FiFGH4@,e/@ h(@T0-+ј0F-#F(6HW(F5I(FF`"2I(Fv50J&hR&(Fȱ6@.*KT,*IhM#T[-r(F((FtF?./?HY& H0FFH4jFLr!?!G!?mD`{m'2;g030@FFY&JI&!0F0;0+Kh+3OR!?-CFLNy7FTȱx3h33`%`DE)F;h;;`#Kh LEѽ!G!?!?KpEFFZ]:*! #cUp!H-CLP'F#\23@+ K` J%`TR#@6)FFHFK`!><!H!G!@ K@ 8\* pG!><8FLlB ! 0! ,! (d8!><}@KB`C BF+XK`Jh+x(F`+!?!G8F I'!F(F (]0 8@FBOp 8(8 M KhhF2` B#`k`#h;#`3Kh8@18!?!?-AFFFF&- *F9F@F*(-- FD6 .`h+O0hFhBа( R(cCch#`hc`0pFK`#C`CCC.hMh+h3+`+hc`+h; ``+`Khӱ3Nh3hi`F33`h[c`3h;D`%`3`ch;c`p!I,!?!?8 FF;sch;c`+ F#hZ"`,pK[iB F8@8KiڿKYiԿFH!FdR]pGKRi]pG Osp FFR%0DP;B:Zp0B#<p@pG-G F'!F8sx+[I0F3\ch;c`+ F#h!F0FZ"`""pQch;c`+ F#hZ"`""p3xKHI0Ff7\0Foxch;c`+ F#h'Z"`'"p=F'FO'O\ Qк'ch ;c`+ F#hZ"`];c`+ F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`5x-0FF(ch;c`+ F#hZ"`=Fech;c`+ Fw#hZ"`'"pK[iB FGP(KYi4L F=@7FFF:F1F(F+ CFh+ Fh-Ah h:x0B; K=! M8Fh Kh+`=!F@F~B̿FF>F6̿F'F?C+h;+`+O%p=++h;+`+3x4!JI-C#FQ#@O5ZVAF0HQF-H BXFGF"F4x=)8hBh:B`*9h hP`hQ`p0 ԹH\P3KhCh;C`+:hhY`hZ` "p !>!J!"B? B=+ pG=+Ѱ@ pG pG-AFFF )F;#:`=+@ F'! K>`S!@thB*FAFh'>`&F$h F!JBKFy F XAiF0FF(`BhW `0F$ fԪhh4HHa`\0F@*.O;h3;`i;h00DGkh`Ѩh*ikh2R"*a!`T#a#ck`khH$$t#Ck`KBJB[h o;h;;`KhE $@t``D`ha``!?!I!Id!?F-AFF"JF\ &&F \$ =(& F\&*F!FHH8FD0F#FBF;$s=!TP#Sp9F(`0FA#I0Kǰh#l#K`K`G]!?Lch`Ѡh2*0JK(FF4ch#`c``* K"I@BFH!IHOCVKpFhFF2`=hhh1F-h#h;#`3Khp@p!?!?7MUL U gh"``U U <#0Cc`U<#a`5 L H"FKh hD `"D D,u0ˀ!IZ%O4hch "h2`Ԡhch F[ՠhch#@c``&F5-ѽ@!J"FFBhi3՘Gh4 Dhh0D FK Fhmoh1F8F(=!8F0-h0F*F)FFCh 2i20FGh3hh0D(F F!?-C$ hF'Fxr+&&%F9H p(x( n(+O%,C%.#'.$&'-Khh˹-*Khh+Ch*5M)h1)`#c` hh D[xI8F^ch#c`chCb` ћԠhn"h F`h,h<,`,Kh+Z$ F!?!Gt!?NO4h,2#heh3`U:hhH h>`h+!h#i;@hh0DGkhԨh"hk`h`#i+a F!I-A&5FFHf(e(&5Fv(x(&%%OXKF%h?Wh%C-1F8h8C Fe!G( Fܽ@(HXh"h j-AFEL F#hF3#`;x-+F |xT>M(h*h=I 4a`\"8F'F=!8FH8F%AL%FB8F"h#``3a6hi`Ch2aH%` #C0C`h\=+8F%  !8FAh CE`KB h\=+K"j2ZaKt`h2``0;0# Kh 0!?!I!>!I!?8F F,`h)F\$h88l$ H8N( x( I($ H(DDM+h*`h!F38!G hxxpG hxx[CxPxFpGӵFv# "` FFFjhKhdh"+3O0fBoBB!F HxQ0I3 BH!F9F0Fнr&̰ FiF*X & F*R(#6BB8BԿ  Bp L̰ FiF*2 & F*,(6#BB8B  Bp L̰ FiF*  & F*(&#BB*#BB LF F*" CC'iBѤ".j*RB!F*T(̿F'x[FF8F*F8V +jB0Fh @Fx-+Cx x+K"I#x˹K "I#`; K" I# Ip( H F ۝ۧ5pL `pF౰0chXhh^@0+3x)+ sxC%(ch[h %`p#' #`p!>8MkhhFXhj`kh$( Xhj`8  8;k` F8 8!>"(F ѴJShQ`Xh;(ހ%(Mkhj`Xh&(Ҁkhj`FXh&(ȀIHb+h+ *@jhi`Ph(, , , GF lQx@ LxG ,iF )(@p@ O()(@<,W V#)/5VGV;?CVVVMQ!!hF !p@Op@O  p@_p@Op@_p@@O  @ #+r5))B khULXh+h+̀0+@ǀbhFPhS[c`bh#ha`ThKIhQ(FF FFBv F0;+R#/cKc!F(F%!F(Fn!F(Fk!F(F(Կ  b(FQF FFLBB T(FCF FF>B B F(F5F FF0Bp(F)F FF$Bp~!>8jO(FF FFBv !F(FG!F(Fh !F(F khhx0 '8_LchhFXhb`ch#( Xhb`0( 8;c`(F8!>8 FFI hBX=IT%:HD%-M#`hk`jhh[ APhi` IG 8F8ia!>k-GF!.HF `jF(I)D(`.P&P&$%FFHFF`F( -F +#DB$I8F$%F ,5K"FI8F,FDDRF%DH4I8FEI8F,$@thFL jFHKh 4KhHIFh "!?ӵ "F xcoC[OBA&BoB"FI *Fн&-CF F ~Iw.S`hux-+@Cx-+^+E]l+s+5Xx h-7%nJ#xh320Z. F(Fȿ F5(F0(FF *F`I _H^Kh x  XHlhVI0F X0F^F(0B0FJFxp~0FJF`BJ0F{xh320[VF F|0=-$;I =&X;x%+ 8F/F/H- "8F 4xO)oBBO3BBB0?)IpIFII:FHt&F!F8F)0&HH,,!8F)=0Fr@5Z-`{{j0"K#JaZa!KhJhh3`pGpG!>KIhKh!!?ZFxFFb,_7,0,)",j',h,^\,ca,Y$_r,Qf,Jn,Je,N$Tv,Hx,'t,F $L(H'K".F\$`BBx#@ xF "hF0x DIJ(Bx# xF "hF0`mFIJ@D$ $ $ $ $!FHK"`0FF+O FF x(O\(4Ibxc*%JhCs`A0*a F+ >/7*-ؙB0FB%M* ѣx-+x4@G^+ ^* \x?+@C`2F )FGr!>-AFF @,9F H,$ M9F2F,D.D vj#3t#s!>-AFOl;mZ:ex ,NJeCh;C`+k hY`hZ`p0hCh;C`+X2hhY`hZ`p!>F x:B H!F H h"( w%!FFHK"`P7!>JshhԱ3`%*F` FFF FH!F(F0F Fp!>Jshẖ3`#x"+'+axz"` F F F F0F)F! p!>-O#-FO FJ`0ѳKh,"mU#0`x\-R\- F" MF(hCh;C`+*hhY`hZ`$ p2%-Zx%*ќЗN0hCh;C`+2hhY`hZ`pI Fe#\ *+J  FO6IHF0 .+ ј **2FFO4@FyIuHd[xOSp\ظGyظB+иEqb΀)X oAظg@^i8u3x/s@YF UFxmHF n0FKFXe(𙁄FIHO\ OM uо -ؾ 2ؾ"о.Ob] о %OvT"Qؾ оOeG'Dо\AOa=Of:On7Or4Ot1h10[Ռ     O^pO?YpN@^!-!ppcFFs# pr!>g rm:J#Fme2KO ZFI\/zK vKFe(ڀRFx! p Osp a#F2F)FlHKF2FbKF"F)FfHJF)FcH0𯀻m"`I;e9m^Hhhx3`s `1F(F{F1F"F(F{ta!FF(FrkFFAF(F$se"F1F_X[FRF1FYRa[FRF!FPIhhx")')4I3`Sx:@  2# `hhh `h@KH # s `Ѝ "F1F(FR;1FaR;!F(F(F )FHh\F0Sp #FhBh+ Kh p H !>1!?j5K hh(>h"-CFF #E (F3IFP #"0I(FF(T;h:`_hAF*H-ehu'I<&I8F 5D1+ "8F(FHBFBF!Hx#HAFch3DH^5D {x?+-+##H0H bX<%Ch7FhhhHdM 5U9U< H#D|X FF F)FFH0@(d-AFF:!F@3#p@I@F'xc/=I F `+l9IF(ex+b=!( F i/l/o/ .M8.I F 3`+I F ()I@Fsb&I F (`#I F s` I F (I@Fb xB 5)h) F (kh;+ I@Fkh3Dt+h+ѡlXK#K0#M0#P0Cl# CCCdk#cc#bpGjkk)BrCc#"rcc#bpGlBl`3CCdB3cK@CcCCd#c#bpG@$j 㿂kBRBckBcBl"rBbBd"bpG hh(#dBj80]F@kl##cfF@kb##cdjF ##I h( #bt`"pFFH( G,[Frcncl dh`d ,"8(F0F(- XBReP f#bp{F@kF8#bF@kF8#bf dH(mk80@FH(`9׃jF@80#l#SC@s#d#b IB ((I ]t I(|(I  tn I(l(I  to h"phF F#x-+ ##bbK@ MI #4ȱhԪj!F H  3h2`[hkc+H!FTCh(FG ppFFFF1ha(F 0h#h##`rh 6.x-. 5C#` (F 79h)-."h{h"F8 FhJh@(F b8J8(F$( JD(FT(J<(F<(8xl8FL#h# ##`e`8!J) F,h:*J!H CJM!JAr-!Qr 2+F^#;?#+@3F^  SpQp# pHHn!J!JpFL%h-FahHT (DH( HL1F HH01FHB#hD `p!JP7$jm-OFFFFDxF0Fp)FBFбHH,F@f HDAFHD'9FHD zHhO, ԡK0F,* ԛK0F,k ԖKo0Fr,/ ԐK0Fe,ب ՋK0FX,i ՅK0FK, ՀK0F>, zK0F1,o uK@0F$,ب oK 0F,ة jK0F ,- -cHcH,j `K0F,+ [K0F,د UK_0F,ب PK0F,)JKo0FGH5ho,q sa@  Qi [6H*8,C2H,ػ .H.H8},غ)H8q,C#Hg,FعCK HCTcy &/:9BJRZfovw~H8,;zH ,#wHCvH,ظ sHsKXF,3lH, jHjH/8,j fK0F,+`K0F]Huhs,#  THTH,ٸQH, NHNH/8, 5JH,GHGH-8,-DH-8wBHh),c3 =H=Hg@s s9H г@6H6H6HQ6K_KJ0iF8@,S5 (H+8-,ٻ#H%,FغCK H JH8,عEH8,ظ@H8,?JcmBI1H'0BKU<+Da)I1HU<2F7I$HhU <2F4I!H`p!J!J AdeAdrksF+L,K &F#b0#01+>1 !I(Fp( h+ h+H##1sI(FX(HtKH]`\(F1 JI(FA(H  p!JȂVEWdfdmH!J聘dgFHBOr , F@!JKJIXhH!LdmF1 B3+P@pGFQ rJOa FX x ( h ! F~8#pO0  @pGm L 4T)T,H mAdr   *Fgj zFJOazgz'z'&zz{zgzzz{P] 5-sC FSF!x$)ax)x FBtxT)2 G),C)_M)"S)K)Yk)c) g)Ps)t)m)JP#zg{'{P({ &{%{#{     zg{kPKhF FSk"(FO3F (F!FC3F""F" H H HFFO1O0(Fp@!L   Kn:f*oB² *I&񫹚mQeppGmm-OFFFF.I t!F-H>$'FB X'E'7 BF 4$K$"1F(F!FH f(F!pD O@ FFWE# F[)0IFNEF FB3 #D 7(FO&4Qm-CF MHFFJ!FHN|FI+#X# TBI ("IHf%Y% 5-(H砀"I+F&C^("(F:F1F F |IGIpyIF(wHr0jsIF1hmI.(mHZbjjIEhbI(cHDbaI"kAhVI(ZH,#ckWIBhKI(PHcbkMICՀh?I(?HcckCIGh4I(5HcJ 8InFp(I(1HJ0L -IUEpI('HL0$IN 0#" a FL)p)pkB aOH|Z  F  HI `B?hk" F0 aC? a;HO3BOr 0k @FKEOr0H a"1F0*K:F!F*Hh?)K[h+?ˮ$OO3& B*xZ U,BE<2F;h!FHU,U <D65H MoPC+Es!lm!Lh;`+ڊiBò +%ٽ hZ `ppG FPIF>誈 F*MKMINIS" 2"KI F,"HI F$!FGHDm!FDH>m!FBH6m[!F?H0!F pjhh -IF FhhkB!F+ k !F* !F NY0hhkD8D {IB FY0hhDkB!F+ k !F* .!FH!F )'0>xLTYl}eFFF $ IP)F Hp0B"F;F1F(F4(F@%pG@pG8Fh`Ȉ؀R[B@[(R[B@[шjbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHm FXeRXlFEXRBElTuBBmic[UJh"B!F@:.28!LFh KB FOr F # F0 VEWF JhBѳ Bѳ JhBF!F@޾VEW!L KFhOr# F0!l(#(BrۙBp O0] I LFF H I H4T,2T<IH jnPKL(sF F(LhI F I F # I F #I F (#. Ih (C3 L I h%0+h bh IpGwc@!p̀duP7s+M,I(h,F%0jh (Iih&H ih$Hah"H!N!Mah2FH*FahH2F*F~ah?H2F*Ftah?H2F*Fjah/H2F*F`p!p@dtkxf8gpL("F F ! hjFI h%F0bhI("!  X..jFahH "ih  I h%&0bh I >khjFah Hp!p@(d}7(d~BK"-C%`@KFF/FF`>JAF0F&Ce(q(%'#hB$2I%0  -I B#B1FnF(  #II%HW 5K" FIKH* FB(#!FH5#*##r4 (>@g d|*y(9!p(-O]LhI F (9ѠM4 OSF I(h%H0k ,#(4 ;#TgT;F2FH D +I F `LI h%0@bhI ( FI F(@vM(hF$0yIEpC_vJwIwH ,F4 OS fI$0bKlIZh 4F(F :ľĞF ( ( rF(! D +Oq (AFO O E #J h[bE3BTAE#BH5L#[FRFd5I$r0?`ahF9HVJ#4HHEfoFV#Br0#2F;F+F"F0?$HH#H$Or$HHH5DwF ]GT!pdwt dxPnP`6Pe m(-C F"IhF("7I "!i.<(4I" ~"`h(xFFh+I nh"+ 3O0fBoBB#I!/v!I V"`h"xFFhI Fh"+ Ѹ??I MI*g(h,$|0#h jhI H\7w5!pdyP7O(0F MI(h$J0jh F I`( H(0,#H#.#90!p@dziz(7 FLI h$0(FahH0!p@d(7 FMh I(F( I(F K IB h$0 FX0r!p̀dw( F(# I`h`#KIh$0 F3{!p̀dv( Fk"IhhF("I KjFIh$0 F 4!p̀d{-CFhFl$%U )0F6042FI LKD`hOc2Fhx0 `0bh I@Fh9Ff`G hC$!pj IFFH nP-OFF#F F!BZ܍"*I0F"F$0(I O "I ("FI0F$0EK -FF$I QFH%(D#BF)D0F4B%B H5 Duu9p FF([О.KB0-KB9}SBD F(K(J(FF&KB c#3B/ F\ F(p@F FH$;p@$? FFFHh Fp@$ F2FHD F)Fp F IF H  dictaray\nmbrjjnP K!* ۓ!* ۓ!* ۓ1+ pG pG pG pG pG!t-GFKFFFbRuC)F1FF@5@FB,F@$?6?4COrD8FOpO0%1!t-AFFWKFMFCF)FH F1ERB J"K;F2F)F H O0Fc%G!t%e('K-pC)}FFF"NFYCFH1F(F1\" F"I F#H(\"! F #BEKEh#iBK2chS#1F H#"i\h }p%F%%!t%8F LiB hf("! F lH#18!(!tpGu0OmO0єQQ `Q`A?`QQ `Q`A?`F (D80`hhh(<`hh D0hBO0( !t I#XL hDD!BFF!(-OFF%J$N  KF +S2!r_C{F" K @ ;FAFO AFIrO#F;F" @ ;Fx""xA# wHH "# #sH #:qOd!qJ8F~pI PoI8F;\: +$+Rx *gIZ h1 W-+d "^H FF`I8FF(U +RF[I8F(@CSFFLKOYh32|2\ D@"& FF|2TDU XBB%F$ 3K2D 2d 2dGD/I8FX;;\ + 'HT# %I0D2*H #Bt"#Br"#"H# ##+F"FHFQF"# F)FBFI8FH(?yBFI8F@(е/#!t&&&:!vmM!r&Z&]&{.&-OFJMFFi(h1IFEI `iO(`E@FZBv0dz R ,(hOr!PD:)hU# 1oU1tFD!Fcr Dtp!FQBBJh"@ h##q##pbhFhbD8i@F3a!(&!tsLQ Hch;c`+ FF#hZ"`xN(F (0 ch;c`+ H3hZ2`x I % YXBXAp@pGm&M-OF.LFhC,I rehkBoCrvD x#KFBF0?O05bhQFhO#Կ`h #$chB #BFKFhz0? =/@OrQFbhAFh#chBOp&!t-G#:K;NhFhB 2C7I#(5H2M! *F}BF0H2#! $-Mr#uw/x@"FaCF$H!+h4DF iBg*h @:DC?F!FHDF$# 0B 2CI#(H F!t؀dm&!(&'p0L1N1M01i#0Hb,#-H#0 V.#(H#2"H$K%Hip@#"H>"H$qh 0,H(H."2H"|Hp@#Ӿ!!t'$'-'V!('}'''( (4(8FL2kOr#q F#2tH41U#1oU1U%p"! D5@-8!tL#hK!hD[u DrvwVBBѢicD(F:Ri;a!(-OFFF)IU>K H,#KEr0#B- !BO 5 0bEx O DBt  ڏJ */FP3+щKF!!(;*9+)@I#FC {K0+߀/i/Oq sKrI @ER!ERaaAF" FaE+!)0FaKi**h1+YK0+@ZH:(@XH6PN#F BB@#[bA# .3hJ+1+PF FzFuO B{ DD#FBOr0+L/PF/P+KTE]E?Кi h!:B A'CHD@1q5qFRxi;a"2)F Fh3h@ HHHH H #E[bAFFE !!t!()))H(())")`-OF>MO ;Kb OEvFe#J@##BrS.K L ԣE K)!*XFDD2DBOv F#Bpں+cXFO1HH!t!(!))-pCFh}(:K,#3B2EEHO0!\")FhF&jFIF@FD # I* H+ KFv\"1F(F }p!*F*J%-O } F#CFAK2+ܲH{O F"FF()і KJ "I #AhIH!#!FH#J#CHЕKO [hF !#Br# OFFH~K"r2Bѻ jIF@F"YFPF- *" @ 1@0) 6A)oHnH `K23=DiH!1?!!F\Jt!1?!ZH!FSJ`1K[ GK2+@D*р+΀?K"*)FBJHH < 0YFPFBF0BJBHBK)ȿF6J)F&hqH[FRF;H# JE3O."ESBt+J,K*H)ȿFJ)F.(HI2+oK"F*ݸJ)FH2+[ 3 ;F)@𴀓B<!t*7X******++G*y+a*e+i++JK"IF#GK)FGJGH@FV0)+AJ)FBHr0)+=J)F?H|>D1*+c:K2+8Kj+Z7N0+U/J!F5H` YFPF{0IЖ%4#CTF_F+F"JAF)HH)F[FRF 5-і4#C'#0#JHK)ȿFJ)F&IFH"K2+O! F(sI B }+++,!t!(!,A,c*y+a*e+)-CFFLF@L%$E?KB=K F=N>Nh11Fd"F+9HC#7H"F1FF3H|HFF"F1F+H1"F1F)H1!1F%H"F1"F1F!H1"F1F?H|1!1FH"Fn1"F1FHh1"F1F?HC##!!t!(p,k,{,,,,,,,---GCFZL@0XH%0)FUH&)F#"SH54-0PNk3j OHi#0+?JLH %iB0)FEH3ho(F, FF!@F2+:H0(FD## FF!8F5(F-H,H0+:!KFF&HG#y0۱0F HKiBHG#m(FhE$ FF! F 0FHH#")FG!-*=!t!(-;-_-y--------OFFE?жKiB!hF'A&{ INF"I{# #'#"I #>FF I'>FFO9#" #K Fb? JFH #9F0F*L0 E- D"F#5?,? E-DUK! F2FF #*? "F#0,gfgpXN+KiI%Fi# hHB&FVh EږqPF## FFPABpWI` FFBpVHS-DL+D  vETA;C@CK BO"F#BFt %$U,+|1"BF#t #BBt%$3 E#!O 1#"F # #Bt #BBtFFO33+ I,#BtpH!(p!t!.6.W.vKp/@OO#OO CF H F)K2+CK& K&! ,# # ##+F"FHKFbFF#Bt#[b#$#4K%ihBjکEД1(F#Br: #Bp FF #5tME$1"F##Br 4 FBpFF 46.#B##BFF#Br4 4# EdUXH#CgBt/F&FNK"|2. E!BOSE#OJ O OBOSE;F2FO>HE8и'и$и!##HF#+F"Fx|E۹##AFHF#+F"F"HK Rp/?FI OOO0+JѻFT(+7и4##HF#+F"FBH?IHFE!.!t!(p.M. j##AFHF#+F"F(/HIF N#+C"CFFU"!XFLHFSKN# B EE#)F F 3h@#{+      (F  XnM 82+@,@hH (0OO aH02;F2";SFTHF ?2F"F!KH0 0`2&?AH;?C`F29H;F! F2 ? F"F!,H`&??C` '-0+KiF<+hD#1+ FX_F #BBpޭ?8F. j!t!(....///-AFhF(FF0F@D(F!Ft3FJ!FF@DFtHF=`צ-O]KhD)F hzdhhLIpK# Kh $ !F U!FF Hh !,!E E R]pG R]pGHR]pG R{ t-C]AOFiFAH%`"B>Hpr@2 FO 1F!C5T%F5F&(F!()F!(pCO(0#B*FB+HOah3`u4F)F&HL!(1F#HNpC_. H1F+_ѹ*FOa0FuFO EF)FH(FB퐱hOa0FsF(I Hd0F F ]!,F(!8FGF7FaFjcFH J! H#!H#JH]F!8FKh G !T!0"Ih !$K! "``D(!h ! ! `hF Nhcih iGJ03h+ ph3`!-O 'K FF K ȹIH(,ZFF9FH@݁/i+큷F( G(*hOa>s"F(>yH +<2FvIvHO xh! b FkhOcuAF lI!0(F.&F!&F0FFeKhCF3DB xX21 RFSKheBF1FHF0-h t:F0FtKFPJPC _0BKPPMF[h0=KSh3S`h^!Fh !F@Hzg6h t F Ftt t`0+i0E@р7/!x%O{h@,Сh"Hh-h H-h z$h{h$PBF Bf(F(.EF-h4!!FFFjFnP@dzr!FGm4Z@)hhHhh!i$+b#hbh+pZ`bh`l##`]KK [hc``ZK\`h#sa;h;;`*@UJUIRh:J`-\ `TF0`./siB6h!GL#hhGIHJHK( FGIHH"GM$hGNh!h"ih) )F1FBI?H$h PFcXFa=H|OqB+O h7I2Hh"i2a iRhN FLBzhB -h-Fh+ki+(F($ՂEFO J,?&#!FjhhGF(?EF,'-0F G#!!G`GznPFL=GGG<IFH HnP9KpFhð7MC+h+Z(Z5HVHGOq0Kh#+h.M.F)h-K.J.H)F(h@ =+hZ*`x ,&H~%Hkh;k`+H|Fsh;s`+Hr (+hZ*`x +г y, Y,n,N,  FYXBXACp@pG!!Hr!mrHxHm𵣰#LFKMh#`+hFH #h"8F+ !F!""hF8F!zH+h ##`+h z.9FqH"0F00F!( h+h3+gHhH0F"rF0F!  +'B:F0FC;F?C7+hNH'C+hIHCb0FUCZ+h@Hv0FCMD:I P@0FC;D !HAC .H  *H!Ԣ'I $  $H#0FpCHD%%%T0F!fH(F%#!!!HnHHHHHIIBINIIIIJ -A  FOrF)F йHm!U*ѕ1+ЕHZ t"! F n{O3dzf`(&0F(1FH{)|{`#` H|k|)}"|h~#cbk}}"aca}!+~a#~a~e#h#b+#Cc!b 0#"C#cbclCcd`lA% $0"&0B'0b(0eDd*0+ "F+sHv-0,3!.0A/0ac100#2#c!ac8F#h"kZCF"BB]HOb a8F o"WI `"UI Pع6ù66U+ѝ6+ ѝ8S88U+ѝ8+DEH|DI 6(:BKU!"8F4S!h 35#68#k&KC&((&#h"kZCF"BB-H?Ob a8F o& cF#k뱝%5#%C%c%c5#%C%c#dck"!h8FKC#hbkZCF"BB HJ1JKJuJJJJJJpRRaAKK, xOr8FAF VѕA0O" ! A0ak 'DH]0B9F@H7e/Fm)F*F!Fsil xBKx?+=эx-:OuBx-sopDB$]x, y, Ly,ьy,y,TOtBx,opDBx, y,Ly,ьy,y,/OtBopDByyHyyxxSHSIxxQHOIxNHKIMI s(@$ $lOrB opBB$5O*55lOsOjxB+xop@B#)ѪxQF5C,cBF@0FG 0 CF3mE3#QFG 0BF 0F5C BFG 0QF 0F3mBDҩx hx5 0FP;DQFkC8F#0p F MMJM(MqMMP  JK FFpGHpGHpGMM=-GFF FFO&P0B)j QEJ 3 J 36 2   F1FF7H7I (R#YFFPFF F/H1F.I y(<:F+Is(;F1FSFF&H:F%I aX#I 3PFF FH1FI NI:FI# FH1FSFI ;+j#b:F I#j+b#H654q@FMpMNN$N7NNNNOO/pF$+ mB khBыYl`Q`p-AF F IFFF(2F)F8FI3F F+ O30` :mB0X O}L-G"FmFFBAjj 3F+؁b BPB 1X20O%;mBtQhBmёh*F 4X, a 1 F)FF1HB@hB Q)0F"F, 'H"F)FKF*F1F8FlH9BB)FH F#F)FHKF*F1F8FRIRFF E 9mB $3ZhE=4Y]`,RF1F8FI H 5@FOOPPFO}-OFhmF FF^C0FF 1FxHWD2F!#flbi!ipp*pOrBopBB *p!O|opNZ#)qpiqqqOrBopBB O O O l!F8F"ry (F JF(FQFPF l `E'pE6Xn0f2X  8   0C<1#mB=Xn0fFX0 SpFX n0f1X Pp mB2n0f 32XI X0 s B(1#sprx* C(18 aHFFH1I (7(1"AF#(1zK 5 RFh(ZEoK 5 "oK@!nJoHB +DDD iI((1C(1(1DD#Dsp D 3{+krxR2=FOr!KH f{ {B B 7/F=F'C; # F9J# ! ( ! ( ! 3KB 2H' ;F/FF2~S#*Hl-' Or! W3F FhϘB#"` ͼ 3p3X *"X : ⽱Q1!QdQQGQL!QQ=FHFHI p#O3RFAF+F  Crz *. D3srzD3szBszs"sDBx ()DZ 1F#ZB/RB۲B ';F/FF2~LC#opBB[Ѳ}q}BBC[C#rC Cc\gOrpI emJ#pO30L-A;FZFRFbH^I :pAF RF+F} C@_EPK 5#LK 5#HDD\[Z'[+FAH<@I (5wopCvQFL @FDDBuuuD[#[[Q2IX0h)P0B  Z0 3+ChB pF"H$[FHZ0#FH 3[FZ)FFHFHZ!I (Հ#spQR*!R1RURrLTRRRRSI f PDDwopCwDuw5wvL BOuuu\D[- P0B? hC`Z@\˱FFHtI .XDD#D 0wwsw\DI訹[ 1BHF!FHOI (V 1=I(P0+ڀh[׹*րHFFH.|I [opC7wvL B(ѷuwu% 1BHFFtHnI ȱ0 1[v[ 3wL opCBl1sul1uDDDDFaH1Or^KP8 "(@%YHChWJ5m-#XP0B hdP]C\B+F\FKH>I p(\+ uww+ -w P#1d0B+kF=H=I S(d '[\FBOZP7DZ QF@F.O3J0[ `##CHDDh03h0% ;F/FFFFF/F 63D00+J!< [ # # #BB HLS(MSDLTSqSS!T}ST T/QJ9K  d B$DO ZP0Ed  /FHFF)H)I x#O3RFAF;F CD00ù V # #BBK2F B$D$@  K5`C`K;_!TIR*-GFCh Fhi_CvB>F0FF 1F6H 8FF8@F1H9FAy/N0`H@F HF+Hy2Or! `lBСk)#mB#HJ X( + ShB hHE #FH;H) I (k" P khC`3h !TT!TTU-UVUU!p!L5%+Xh!Z`FF %I"UF% hF[h `Yhh]`"F F U%` Upl UQp!!K-AFhFFF M%Qhh%P`BF0F9FC F!!-OFϰ F wIFFO(quN5tKFhh5E,_pI ch5E$ k>hncK(dH?* 4B"x*,>5 1+ 5(*mB%Қ)h+nhnYC"@F #BBjn@FknB E,%knDDIEHEH1 v@ICH pnOr!3fKF=J ! knhO ,(SCLFF F  !"QF KvK vlopCBѽ,1#u,1cuL@F#wL cw01w01wLhfC`###BBHjn@FknB ,?U 5XSOU!!UUUUVKUKF$#5!KpG!(KhpG!(KhpG!(LR F!F  .nP-GFFF4GKZhhHM+h;K^h&hH.`QFHF,@FmFH짱 KZhF ch[Khl!FF H !(!E E R]pG R]pGHR]pG R{ -C]AOFiFAH%`.B>Hpr@2 FO 1F*C5T%F5F&(F()F!(pCO(0#B*FB+HOah3`sbF)F&HL(1F#HNpC_. H1F+_ѹ*FOa0FsFO EF)FH(FphOa0Fq,F(I Hd0F F ]!(F(!4FGF7FaFjcFJH J! H#!H#JH]F!4FKh G !D0"Ih RK! "`B4`G!,h ! 0! ,`-O mF.$FFF\B0pC_,/!(F`hCxr+*уOaCzJTn!FDET@@.(4O #`.0F. &. F0pCOT [JOa(F^F,(F< %F_@! ]F&FOr@! %F,z. F(t>.#BEKE###3C F(b a ([Xt%p2" Fl(K ##& 3F/J!"!8)I( Hh+- F6 F I F I Fz(I Ft% ~$##%O4p @, F~ FO0 mV%V-V;F F@FpG@pG8F FhHȀd(i ahi`aiaia(j bhj((X`bS BB heZheh"fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d  lcdlYd mU(e`mQhemMemI``peQ BC p`"54S+BE+8#FBT#"A#38 FF88  FFSBB2sl2sXX\\dsJdsfs@fszs6zs|q|pc&cccccccccXvcbaXSjBBb\ V $P$(J(,Dc,cccccH HLLPPTTXX\\8-OFh FFP``hh`Fh`h` `H`iHaiaia jb`jHbjbj#FbS0 FB0SBBTK\%BF-L53)P#V"G`2)D*3Or5q5p`m|heFmweFmre nn(f`njhfnffFnaf o](g`oYhgoUg"#KE" 8FHF0FDF@F@FD#$%BQ#3H#3\5SE/D# BQ# G#3P54D5DZC#B4%3T Uc"0B Dѓ"@ @CpGp FmFlF*hKB .Ob)F F&&qfq F+h#`h`h`*"B+гftO##t##DXt"2"2 mpLABL-AF M#) F2?$hF(FzOb!(OpF F##rL"crA!r#r"papB!p2Fp)F`&r FnYKеFhFFi#a9F0F `н!Kh ݼpG!(Kh @pG!(KhpG!(-CF F@F-K#F BBMҨ(K(Kh9FF kByB>۳<Ѹ6 Kyhy9Jh""2"2)I hFFFFB FEx)5*FSB `/(x@  !0!!!(bK-OFhj[k^C2FY0/kFF8F )Dѹx?۾B=(F9DkF+h+ KI(F Z2FF..kFA I@qqKhkRF#  FzX5K3LhJ#3##"###hkI`pmI`p1j 1E!b#hk`pnf f#hk K"`'8F Z!Z$Z0!!!FF%F pchK x+`hF#BB%h( x+ `hF pch+#BBРh(-CFFFF9FFgg0FIFCh`D`@FC-OFH M)yH#CvK hh Oz C +FJ2F2NC`D #hO"j;h^kVCF@ #bp  _Kh{2F\KhFEiP @@/yqh# 0 #bp) pD#c FRFF-jШ)FoO`FFX0S0;0 0  F#dchGF?0k.KhS0;0 0 2FxJFF ki8D " ORhKh 0#F# 0 FF #+r  (F MZ7!!!!!!!(!@MFFFF(H)F F ,E;F2F@A,-K#BB F)FFx  K Ip@OF HH M!0oUtlZP FF]𵗰FFFX"!FhF#H0Kg## Kh `h o h`oiF F!()-C LEBB *+ӢBBҽC_ !0-OFFFFBB&F,) F~O#"#|N;hFZkRF##F luI h :Fd0 `F\@ W SjKBh0(F(FK`@FF)F` F]KhF"(j4FF0Zk BiF*L"ihiD iRk DB "0FCIhD" x,-)F FUFx#P8F" !YPFAFDx+ PFAF=x+)F FlD+F"F8Fv)F F8)F $ F AFFPF)Fx F3px+)F FFxAFPPFC3CAFPFXF@0PI F)F F!!!!-OtMF F#!X"!F(FO(NFcKIpJHOF(F!F;h3h# 0 0C ##+@恩HH'(#CC3CI#FC@! K2hlF!`I!F ptXFO ##bH;hL0"! #N FFS#B|H(DvI l!HvJh3`;hktH,)! v3h FX8XaIF@F=#"#;h Q#"%SK#CWH_OOFBp@OHPH)PHb(K"g! L0#Q!H o"##`09F9K0Fg19F0F#C$Nx++H'*K`)K rQ #" p 7#F3hKx`CH(K"`-!H!![n!oU[t[[[[!pG8F M+hk% FF#C +hk?+h!kFi2 F8 8!Kh @pG!(KhpG!(Kh CpG!(*-OFF@Ȁ)pÀKBpT`%FBpzIFOx hkB \p@Bt pI hA;;@2F;FmH9F0FhTF4FSF\hi FcIEii$2ZCF 2FF OrK gEF#v ZF^ hHEii$2ZCF 2BrKErDKh+=ЎEii$2ZCF 2PA FF;H#;F2F6h\5BсT ii$ZCF2FFhBF,HDtKFE >b H2KEr2Hh(ЎEYb FF i$iaCE]bkDrPA FFH#;F2FBFHh0KF !!![T[\ \-\F()-OFF]K#BB;F2FZHzYIpp#FS ЖBB o[BrBBu9FLK0F\%B FOr @JC TD0CtsFjC"TDsF2DmDA 9F0FFFx FF` &0@p0I`Ai"a0 g09FxEFCF"F0Fh2LC@D#K@hk09F0FoFRi 09F0FoFDi!0\k!T!!! FI-OFHEEEѤI@EIEҢHKgEE'K9F0Fh2`KK\%B[FOr @JC TD0CtsFjC"TDsF2DmDA[F9F0FFx FF` X0d ȡ@pI`ALrK FFhT!oKnKnKnKh"FmHFvgkN+Fh1hhKh+gKh/=07hO KEO9F8Fa81p@ O  w rFjdEZE 3h9JT h(@Jh*O<CF#TB 9H+F"F1hh5F9T p@ OЩ0 *ѸY#BB7 RJE` JFRB`2hK`KJhh+ #OsD`! !@\!8!,!T!H!!!(!0!L!!8!!$!!!-OF5KFEFCF"FS;F2F-H#-I5D4tAE)I*M#")Kg(Kg(K`+h+:F`KhkW#F F"FOiS!F !!^w-OFO=hKhF-BO 2m2 )FxF$hF 10k[Aq;hC,q D#$6kYFO '0F H8FEx 4 h 7 /D#|H zKhk@puKhSB<7*fY0F]2& FFS-T#@F(?~[Khk[AqVKhC2D#FFF(F2F FYFPF"CKhFFk FRFIF@Fi FRFIF@FiS!F Q;F(?&/Khk[Aq*Kh[FRFIF@Fi [FRFIF@FiB!# 0i#a5F i&#aKhkFIF@F[FRF?FF. H&nO ]"F# !!^^IFH ^nPsFFFF FBx+3F*FI <p_a-O"K LOp#hk9hH1JHDHAqKh{#hH)KxH#H.d#hH'#hH #hHm#hHfKh3#hH;hxbcE#kSC0DHH#K###;hcOzsBFOsKFH@O1 @ #"#d#BFKF"FH+FhHh0+SKh @ c#^KK#`FF\  FFVHB0+?hh{kFziFOz FjFjF  ˃D KX AF FFDNkHrOxFF{C24KvD# D bFKF`S#)HL#hk'H$h,#$H P"L#h+M!H$h,D#H!H!!_x__!_!_` `.`L`m`!``!`!0a$!a8aMat!a{a!! FK$FMFO`FK`FK`+h F>hBLfOR9hi~>Kihx&C>pEBr1@{cQkYN'EH0D3+DrFFBt'-+Ft"FDCBs2hB+r 3c305CD0X"! :K:I" F 8I 1KhjB0SCFFF0'K(Jh\5B SC622Dii$ XCSC622DBrhNBr0FgKiHFh KhKh +KIFih( Kh˱x0!!T!!!!!8!(!؜Kh0NFOz3hKhj)FFd XCd#F:FIH#3`Kh+LЏKx+HЎN0B3B!FH50B 5r\0 1J0C@s3D[ %-" J:ӲJ0"! W ;VJ:@O1EEOjKhC[ #s`OF"EE[FRF|(Fx0)F\H *F!s`g F #*+FF #3B#BBGKg7Fg9KhsFEEWBBQJC"DBB?fv'&/L#hCpWPhd#hD#+EE)кF BB;F2F#H^F  )FHQzEER!XB#hD044C4W%K"`!!!dnP!! Ue!eD!e.eh!i-OF&jiFR*5")F Fp(&߱BBJE Eh B Jh ?hh B5D0F i!!pG-OX"!:O#P0O 7KF^FF5Kh5K`;hjBZ0(;hj!FFd pC3F*F+I+H#0\FEF  B4,-5D)F F}F(KEh @hoKh t )F Fx*XF6FF!a!!enP!!(!h hPk[kpGKh @pG!(KhpG!(Kh 9pG!(vK-O,FlqKh hpnKF gBB&Cxq&FF#C@bO1aIjFPPFF @EIEZJIF@F$h `VH(UK&;h+𲀣y+PJ #qOMJIF@Fh;h#OrAI0#0;hSAKh;0 0 p#h7'7s8I@F 8AF6Hr/K"`j@FCB0HdG :F F@"H(N(:FO  F,#YB h#+r##0y0B hO y!KJFYFFPF0Hq(K&0;0 hZFHF# #`& ,eg-g!egGgo!gygeg-O!|] xK+U5WT5H8HqpK"` H-Hf! @"#FF()0ЪHK`HL8  ,HH?(ѢH:(! F @@ HKh;! #p#CpL"NK!h0hX"!#`0K7h\#hL E@(0ñI3hhO!FF XCCF*F}I}H2#0WKj++wMvJ-h)FhCbgHH*h:BR#@A]#ljKx[+h"iIiHj ]n *hcIdHj]q0_H-hj8)F(D[KhhCb{[jFx0LRHz(9K"` Or!(F(jO@((@F(F%j )F(O E2Sh  @? )@0e0e0+f( j( *F( ##B3 *@G$#4##(#8#9gZ!gZgc3geh!!D!P1mh-nP!hP!|hd[![!!ؓKh*7hTLj"H`EX(0+Or!TFtT(?pO@,PF5 p8FM%B4chB?### #&5 p - 6B##89WKQѻESj+#BB2?#C#FD HH7GK"`#k;k#F2FbIbH#0UI#*+#xC))UKhTKxTKx)'()C3x+0B 7FQfi0B !#@F1F(V9H1F8H(X"!F"X /J -J h xh8oF hxo?8F>!H#@F1Fa(?FK%@F1F/C3CK'C;C* }!D!PhnP!!H!hZrM!h!!!-ONFiiK8Fh[FJ\%KB 0!F2ZCF 2 H[BrXF3h F nKhKh +2h!F}KbhB#BQFzH$+jF O ء# D+@"IF@F(@KFxBFH @)OpGBw1a1 F]B@XKhFEEhFhOI `+@LKh# ]# bhIFAK@FB0vw'n ?F+#rBA@q@D)p1a1;x"@C;p+O#1B0 FF#H0+#"#0ZkRRBF#+mlK*jhkBдcj`3cb# L3B Dh2`# H'!!T!8!( Ui!!!!l+*7h*jkB%i3a;F @L3DZh2Z` FFF:n^#8F F!FLOR1hi Kih KhiFS% PL F? P !@!!(!pG-OX"!jK'FiL#hjBȀgM+h#hj1FFd xC;FBF`I`H#+`#hO@|C%F0XE,-)F Fc)FF FNKEhF ph0oKJh hzpo*mpn L""X xB*UZ=@N`)F F85Kh+J+F"F3H )F FH.Kh+=.H+F"F71F2Fq#BB ##h0 h"I2isihhC ##"II"F+F"FHf5D^73!!i8nP!!(!i`i[niii!!-O=NO! 4h=hC#!p 0Kh+zݢm*7$5+sݨKhFH0#$5"K1h`ORFKhKh[FH(# 0m*?$ݐE8ڸ@Z3T*"H!nH L$%H-CC"kB@/IFvH$uKh#P%JC1FB:0HHD$5+\O?h32""nAHRK *LJ)ћ5OsrO sT#BH3##Or!.KhF:0[IF;H:H (ĸ0-@]0HH$%* #nAH#D%Dl(DD8hAF$FH/K"O1h`Ki`ORlKihKhiF# 0o =!lk!!@!!(!!jGj3j[!! Z0-AFF$B!F H%5H- 4ljlo-CNL#h 5@LO%TF#h#*A@r#C8;hK0AKAHS% ?H-HF<(Hpr@2 FO 1FrC5T%F5F&(F^()F!(pCO(0#B*FB+HOah3`kF)F&HL<(1F#HNpC_. H1F+_ѹ*FOa0FkFO EF)FH(FhOa0FitF(I Hd0F F ]! F(!FGF7FaFjcFH J! H,#!H#J"H]F!FKh G !0"Ih K! "`|`VH!th ! x! tf`?#K0јB;"KB;7B KBK M Lh I!JAB (`# +`#` ``0KBKBKLIhABKJ ` ```0 `##` ``0O00KBTTT!!(!!!8T FpKh+FH4!FH@b!mhpF ` FChK`j bˆ6q2p"6p200000000mekc#l+dmeH3OrH3L3L3P3P3T3T3*q "*pn)F Fp@hpF ` FChK`j bˆ6q2p"6p200000000mekc00#l+dmeH3OrH3L3L3P3P3T3T3*q "*p\AP"\@4ah"`44444x 5n 5cnkf0000P5P5H5H5ccccH5H5cc)F Fp@F:L F$h|@, L5+]K]KAhhBYhhBUiiBQXiQiBMjjBIkkBEXkQkBAјkkB=јllB9llB5mmB1XmQmB-nnB)XnQnB%јnnB!XoQoBјooBBB B\5\  ]KpG!؝K-OhF,MONp1M#FH#OS#ihF(@iO1\(&ڍIl:hYFPFFOS FFi@??NiYF\({O;hzKh zIzKxyI jxK@BhBvHABtH1sHjrN3hrHr;hcMiFnLORi h<3h#[K!hi$h\h ZBZAbK_`aI@F$MM)h F#KC2!`kcn@/(`F,=MOS+ah+@jE 3т ii#HCFFFh>LJr Fci+;hiFĐܠi0TFn3h+-Kin!hr(['Kh#'I@FMS%HtKhn# !Kh TE"h[?BHar4!Vx!!@!Lm!8!m(!,mG!mfmm!(m!!m!X!mn"!8n8TLl!F;hORiB!hi3h# KiF J# 0 0K$pI@F F !!@!X!Tng!-O$K$ OF"FpO3;`FKxB hd )FFHO;h!(FK(`hd)FFH$pC_ГH)FH)(yKx+vO300H)FHK"`K!H"Lh`##OPO2 O3## aR OPJyKF`OPDaOP>tI `*B+?й<(:AF(F$(7h:hhL*>H@F 06  0#`(@_Khc$b!(F@(0+OKh+)FTH&SH@H0>IP7HO44H!hOR 5#s 5,Kh*Kh#*KiF9&# 0&Kh+#h%HZ$K"hh +&M.DKh+KJH) FF!Tp#ppgpppppB!q!T!@q*qR!!(!@!q!8n}q GHC"hO EMc0 jXC@KFSok> @xw8D HXC0K 0Dh@Fg,N):,Kh+6ݒ0+20'H&H!(?r1h"0P%ORc0#X30Kh'Kh#KiF^# 0+h+l Kh+h3h0+c0 Hq!!0!!!qq!!(!@rH(?!hO0F0%h"!Wp0L%P%0Or#X30d9F(FOR!hB9hKh#KiF# 03h !@s#;HAHz(~Kh@3 %@OR 5rKhpKh#oKiF# 03h0+#mHlHM(hKORh#0]Kh^[Kh#[KiF# 03hkc)"[HXH%(TKORh #cJKh7HKh#GKiFn# 0JL#h+@3hL%2<)0B4BH3h" 0>Hd0OR1h-Kh+Kh[*KiF4,H(# 0 0#h+\3hL%2W0B۱CN#H3h 0H 0OR1hF Kh Kh;KiF! H("r@!!(!@rc]!rrr!rss# 0 03hlkB2ЧH.Khk[Bd0H0OR1hKheKh[KiFH5(# 0 03hl[kB2ВHKhSk[Bd0H0OR1hKh-Kh[KiFd}H(# 0 0yKh*\3hF\HX' 9}(F( X 0뱙B oHpK*FoHF0 "5I+-E?="H% "7/R0WH20OR1hXQKhOKh[OKiFMH(# 0 0%h-3h,%*@13hc#BB5CHO7Khc02H0OR1h-Kh+Kh[*KiF(HS(# 0 0#h#3h(5x+3h(5<+U3h#H( "h3h* <"x"(%0H0OR1h Kh>KhCKiFu"s1!s!!(!@esT!$FLswssĩH(# 0 01hcl#CFBB7ОHKhalCF#0HB0OR1hhKhKh[KiFH(# 0 01hcl#CFBB7ЁHe{KhalCF#0uH0OR1h$pKhnKh[mKiFdHg(# 0 0fK"`lbCFalCF#\K`#h+P[Kh+L3h,5+G0VHUH2(?SJ1hxh`3`l#,5cCx<#(5F#`lCF#OR7Kh&5Kh#5KiF]# 0 0#h+@0Kh+@3hL53@0-H,H(?,*J1hhp3`#L5#P5OWsT5OcX50-B\0HH$%**nGH es!s!!(!@t!!t7tW!tst! #D*"DDl@OR0KhKh#KiFJ# 0J 0 0#Kh OR1hKhkKh#KiF3hniKIhD5h @!FLL%FP!FzH008 bBLCFDDd @pzF F!FhiKh:F!F F/3hbkZnhC KyQFHFZFZH F!FhSKh#:F!F F3h5kDpE#NHMH(LK ` #B)pBC@s3B[OBRO3\ F9K`!F8HL,@! F5K`4H@33OoOc;`0K:hFM@BB8JO<'K`"H-(!'B)?:+/+ ?H6KhF8H0k7'i#8F;q{qf# 0/H(7# F#qcqSFiB)HKhFH`;h[i# F#qcq:# 0H(iK"`KhKOb`0!!o#!$!!!LLABLueu!dk'uv vv!sv>vn!*K!Or`)M+h#&K(Hh0h&L 5s4!"F!p) Kk_p3BqF"!p"H@S(hH%x$!(F~K!`F(FvK`PH J#p$` J`J F $ !!v!!v!!vKh IpCOس_гOг_ O г@O гOKh(H  !(!wF3Kh3H2I0FLF \/Kx.Kh+1F-Ht1,Kx<'Kx#1F)Hh>(M/F1F'Hb'Hkh;k`+!H^IJ+hZ*`x ,{h;{`+ HN ( лK p+hZ*`x +y,Y,n,N, Y, !w(c3!,!wG!wPmHm!HеF KFFh H;F2F!F2Hk Nн!wZc3-O$1K`1K`1K0@F-H-KO7>FaO` @``a(&KAF&MFaO @m`F-`%F @``a( F( F0F05Ea#`@\` ``P-+- F!!!wn!!!h-OFJKFFh 2 C44:F4BKFBFI1@x)1a1B&pK@FFkO BL0FqD;0#7KhB6ng;LK`O3AF$0`qD[$0#[bFhF]`MORiKih90iFq H& `^!F `!!!T!!!8 Ui!@!!(!K-AFF@P&P%kiE-i± 2F H,")FW&0 F#aG&@(FF!y KKi@P"0B i@"0pGiBF iapG!K0h 5sCKBdsEBB fr#BB 0F0 0 0!F^()-OFFFF g ED(@IF@F(:Kh(6JShF[i[E"YFi#rA##[bA#0[iSEK"QFhM#VA#gTAE!!!pG-OFkOAHtP$$@\O@ 8B(!DJ4I%F[$pQ$`8BB R$%D @ @DB$v5VXXn+'\XBXA R۲ [۲#@۲\C  FHy Fn)'\@ QY\#RY\#B  X\@H^y Fn) !TP! !R!\!TH6y Fn) !TP! !R!\ CTHz-GF$F E)D@π!Fn!F5ncI+F*O)1aO1A*O)1aO1.)T!F0o $uIFNF  E(F DD\$J @*2b2F`EB 1BF!FX'U!FDQ*H'X"!FH!FDH" 0RP">. !FX&.!F*H&-G}FFFFJFlF(:FfI (dIHFf(FO7H"F_IHFCF hh+AFZHk" jk`j`#k+ackakaa@0+bB0kbclb&MI0"QFF(F*FHI8FFI8F DI8F BI8F@I8F.c2F>IHFh0\"F2IHF`0BF8I x"!0Fp@F*0E@F!0|aCE9  ҲB3E,gEc|Wh#0 :h0 #"(##*#*#0f "Fn'8F }z?@dAdezVznzwzzzz@dzz-Am$OcFF!FFgCF"FF@FF(F\9`2"# F m-O mF.$FFFB0pC_,/!(FhCxr+*уOaCzJT!FDET@8@.X(4O #`.0F. &. :F0pCOT [JOa(F^F~(F %F_@! 6]F&FOr@! %*F,z. F((t>.#BEKE###3C FB(b a ([Xt%p2" F(K ##& 3F/J!$"!8)I( h+- F6 F I F I F(I F% 믱$##%O4 , F FO0 mV%V-V;F F@FKh @pG!(KhpG!(-OFCKFFF@FIFx@Khk%F+F"F+F"FFFIF@FFWF @0F! iO`d"-N3hY,K) F @+O3c]3B"Hc%] "Uh*)XK@FBHJ3hY]CUKhHHiK` # ##"# !!!{!{$!se!Kh 'pG!(-OFFFWo0kFBv2F;F0kB[i1HX0K9F0FhkF @F 2FIF;FGB" 9BB" [EFF\E " \EBi"a Py\FFFBУi#a {G!-Om Fh"!F T"QFF(F @##FBBF IF@F0#BB1IF@F&#g###RFH&KhHHJK` {^!se!-AOB F !FFF 'h"(F#0kBSi#9F0F-MK)hxr4Fi" i"agOR Li Kih+hiF8# 0!(!!@!!-GFi FFyFFW=TKhjF@FFF8LHcLKPFJKhJKhkF#;F2Fi F"" i"a>FFWKhO 3F&3KF`#Ba!h+& kF+K! 0 J##BZ! O3 C1@d!ll!||'|G|w!(^FF^|!]]!|ZZ|!!hNO3 hD=8F#F(@E2#F 8F(@3#VNF B@3h*OO PkF JK#4$OTEu R! \A`?H?Kh>Ht=HF F9F 0+hB@ʀ#O5 F# #F2? # F(,###F(mEEFBFTI FFFF6 F1F"HIFBFII F(F1F F"?IF06PBPB;I+#+r$4"@### FHF.I#"# F###7F 'I F76[F:F)FPF Fw0+1F F[F:F)F Fo0;FJ!i# FI###r. I  O07!g $B]n(-CF jF FF&m$B 2F9F(F6V ## #JF9F(FJ)F #C #:F@FCŸ-OF FF' J1F FCL(A(@߀'c(i(@؀ (F (F0KhBЦI  ~@4pCO#",F##/6I"0 +@^$Z44`44cc##$F(̀ F48 (! FF#C{IjyH0/+@F CFtJtI~(#<oI$xF0lI FO4HF!  FeI?"$0,#*Os[I F OrAFHFr-B FTIHF@FOI^CI ZIHFzOrAF0F@Fr/@""6)!B FF.Kгi+Fi+C B@i F$~3F0 3F$  F0 ѬB F"4 0O0eQF F60 I Fa>0j$!m#80XF(6iI:FI FlB F :'g D@dz/M4U~bHK+#C#BB#BByѴk-O% FFF.FFG]VJQFHFBP(A(Of(p(&9F F0 % # FKhEEI fF| FFF! FH6DDLO2B;S@۲T#0"C-GF'B67O IFEL6 TOI FFx@XOѲDFo|@\O -HB)UT$o҈B!Ҭ ?d?TTDeMpOtB% eUTD?edMppFF#ST-CG OXFF?,'XhEB!##F( $( ( p8?6Ѷ?ӬBOv O0,F %FB!04l!B OE @8  @X@! @\@! ,F-GF$F F (FF౩v# f;F2FBBB F *F!FB F-CF$4&hFTD+F"FBBO0BF @E40FC4#R7]pG3FS[Nh_)FF F 0@pGF04[ Hnt ]pG-O!FFF0TF(W"IF(@ iF#ahF FPB 4+KFBFI(F mF`m$t9F PFPF 9FO DfF F(F F.ʀ4KR FFeI(FO0QFFmB4 +8 FFYI(Fd+ݸUKTJ(FFRIROO (F ####KFBF(& ##@F F(F(иѳF `m!zPF86 mB F FF 4H h+ JSF!(FI# F F(F(?Isa8F` F\ '%~j-O!FFFF I(F!ESB 4+;F2FzI(F F$-#F)32*&+W+ƀ;F2FkI(FC#"(F####".( ;F2F_I(F* 4+;F2F[I(FDO #"#(F;F2FF(1+u+sд1")  H "   H IF@F I HIF@FQ;F2F/I(F3 $ H* !(F$I1+## #(F #KFBFKFBF(F0  4V FHO0 4+;;F2F I(F32>Zxe-CFF OaFFH@uH9F0F #aTed#$4##OF@Oc!8FdC9FOb F:]Ia0ZI F#@4pCO$4'{$BRI0PI$4 NI#C9*FLI0II#C+GI FjdF$Os$4#Cc"$4IF@FC*#`IFd"$TIF@F+F)FvF F2F)I F,4CgKFBF$I F;F2F F0#" F 0#" F#B 3F2 F0 CJ F2 F@d%@d<Rh4F  I0 I FL4"FI FZ @d8!FI!(F I!(F!(F4(I(F 84j8?d-AF jFF& mF`mACj&aehF FAF a(FBF I9F(FCFI(F4F F~$$ F(OHp F$+pOqOHqOqqOpr pOpOsˁ ȁjXm j0 F F -G FhF %0 MFIF0FK2FI&(H FFF;h#h+FFE RFW&06I#hH KEE W%02F I5 H#h|O0hnPa"$41@0F#FL+r!hI h("h I #+#r"hI(FO0 p(>D -OFF# h+Fr FOUڋjs kc#+r@  BO0j0Fr(0F|F-^Ыi+Yi*VУj BR)pPEYEF)pPEYE::0FQF#kF3 XF`$!80m#jF iF k"IFXFAFHFG0F0QF0FAFG0F0ck0FiIZ-i(F-CF FF gI $D"IF@F#FC IKFBF(FO1O0"#F9F0FFFQ;F2F I/v"#F9F0F-Az-O#"#KF FIO&hFF'O # QFY.퐱  RFIHFO6 I FDD# CC#0F(>DqpFM$+bY1FHi40,p-OFF FIFFLL@# C)x2F(F)QFYF,2FT(F&4B(F=-OFFF g F;C2CC*I FEmqBF*F#I F6: FQFaF8*FI F$O;( CC9@0@A @  F\0QF F #@@I H FO0*FI FXF" hsF F{ L " h(`x8"h0FIO0Fp(>D8Fi*s*a*)FF$@)0O0 8IO08B8FF FHK!Fh(I(FO08(>DkpF h FLKhV(`0I0FO0p Fp(>D|b*FL*a* 6s*t*#i*0(1y h+Il)# `1[010O0  1$@  Fwh K!Fh$0 @BIFAO0(>Dе!F !IFF!2F!F( H#0;F0H "н )-GF FFF)jOJO FI$$ F(:FI F#"## FKFBFP F:F I0FO0 %F-O!FFFHI! F|(#" F##"FFWњI$T1F0O2" BE)F@F)F&F@F7F7FJRO3Bv7B6 FBi I#BrFF./yI7OOO FF6;0$8F`FnI#"#g F# (FeI4dJjh+`Shk`Os`OC`4YFPF4pAj# 1B0 8 FV0W$2" @B`FE+eHF(eOCke 0O (mE AF F$0#  +D[FRF! F0 F4jg##8I FO0F$ 4$$j j 4jd4\4TPFYF Fa%*K0FhB(I Ge%H# $#H$4" FFHH! F(HO0!jHh #H #H8J!hFQiFH!mH !0g !3H_}n F$"8F-OFFF!8"0@K@JIF8FCF]f*l*R(F#Q+]`6I0FX4I0F.F02F2I(FJ0LO` -I(F #F@2!r飉ZF2F&I(FDE F$ ! @(p,DE F(F0 KJhBJ(FI  O0rGwHm|g 1(>DFF(! FFRX#gECaaaabCbFHCjj F@ο-OFDFF d#gBEx $i4["jIPF K aEp @gPF[I FBEKEiBBы+- 4Z #PFNI#KFBF a#bcbñ+-+EJR# DJ-DIPF@KAKS%0p#aIF#@FTF(] gbCbEE ci,aka aT#ea#@EE#ila+a]a%a#fFFg(ihg#rAgVAh#cigCahaeaCi,aa a(F(F IPF& xpn-OFFEF-t/+F"FIF@FC  +FD"FhCD+F"FC+F"FI`A2hC#D(@#+#rY#Ex}#h#$-t+F"FC+F"FI`Av02DYb#gC #fBr:#fBFrF/#C-t+F"F9F0F<C9F0F+F"F4hCvDg###g[BAXF-gPF +-G F irFFF ۹xsIWY4qIO0Fi nIYg #iFAg+a#i]a FKFBFpA 0 DOEv;F2FYIPF#hg[BA#fgW@#i+a#i]a FIF@FC KFFBF vD#Bv-g iѱOb Fa 0IPFu(aEaa,I`aG#b##rA#9Br5 "I i !I fBpIPFG`FF#f[BA#Y#i+a#i]a F)g@FIF0F9F)Dh iBipGpGi FpG-CEO@Br ! Y  pFBBv!!Ybid𵋰F$! FF0(F IO0g !J(ȿ  Fܿ# 4 IF K"F I IH$ I H MU$4 H), ~hnP%* ؂*  **   IbO0@pGpG*8F FF*/* * 8** 8* *  8 8 8 8F8 8+ J@! H KJR#0 F*FI 8O08!l-O3OBFF(0FdI FhaJBFB]I0F'FFj#FOFSExO nXCHE{O O334+KFBF>I0FIF@F"$4O FF?EX4+ݗ0+0J@!0Hl.K[#0RF-I0FQF 0FGC68H#)Fj$XC" b#"#5JE#B1B08E  7 F(F߂VEW!l-OO FFFF#E=J9F0FBf( A(O p(s(O #)F F0qKhBpI F F ! FF#CfI Flj& F`# 0?]4FjfaD\W4+ݗ1"MHP2BKK D02*HJ@!HHxFKBFFI F!**@* *=KZFE7} F0 F0!@"u(F#(FIF FCFI F-%(F =g CX!]7v)F-IFF) h!O!M HOM FI&jZFcF FF8*FI FO8 F?F*F I F;F*F I FF@FF% -GFFBF]. .g 4)NG 4$N2F#I FO59$$ j;hjZORL(Fh 9h(a FCF2F I FCKF2FI FaEF(F%F)F-OFFFxJ9F0FBFr-tKhBsI O FFF! FkI! F! F!  F! F4F; $"\I FT-@𞀸*VI"-Dи5$ 4*L+F! FF(=#O O" FQ@EI FO5sjBB=IF F#!f F0#"!1I F%H;F2F!+#"! F0O #" F F"IQFOr2pES2F1;F#" F#DF FCFI FN+?f(FGwg f}pF FF!8"hFK J1F(FCFiF F0 KhB I #JiF F0p Jg KSB@pG!-OFF#F" # ## aJ9F0FBF F0YKhBXI Q # F# #~F??F1 F$ gsH ; FYF!"FI0 FRFCI(Fw"$49F0Ff FbF%iE-i8I FpO0]x#EEW /v #IF@F<C)I FO=#)F F#KFBFFs?FpA1@0&FF F u0ZF Fm0g F# I#RF5 g  !pG-OhF#FFf#JIF8FCF s- "3FF F0KhBзI lF# F##"F?7@6W#I^$4";@:Ez;F2FI F! FvF#CИI ! Fh I! F_I4j f! FL!  FF 4# F#BF#}I FRp! F+ xI! F" tIy4BBnI F.j m, FPm'"S # # B"bI(FzX  #Br 5# fBp;F2FSI F1# jBpLI #Br/vL;F2F5/vE#Bv)#Ez# 4KHl>Ha>H_>H]>H[>HY#C6HZ:HX3jg"F$I @ I`ApAEE;2*,H1,H6x$!m#jF8UiF3F"J"J! H H1+і1+HFH IJ( FH=nupFm `JaH`J ^H^H(FF,# XH# UH  i.1FOH#!#"ji &jHJ!"3F9!3FEJB3B"D "AI""?HrB>Hn9J!BB:Hb9H`h$h2"! !2I!( $hh2",H@!H< m#$!8Y#H.#H* #S HOabH#1F#i"j n$iR F mpp M"*jnX0[;-AFFF$EMBJAF8FCi(a( g(Dl(u(DD)F0F.0D0KhB/I 0F!0FoFD'J &H&J #H$Hv0FF# H #Hz iHnHj #!F#*ji -i8F5g Xp M"<-AFFF!8"d&KjFnFh3SsEF*F K JAF8FdCFT*l*H (O0$1F F0猱 F0 L" I0F KhB I 3F J F!Xe%g pqQ+B@+pGpF F#F"##J1F(FCi( l(a(Ѵ F- F!0 Hi  KhB I # F##"p%g 됂I#pG7 FFhA=+FhC Fረ#z*F+r#F 4 B00@pG-OFFFS FF$ *0<0zF> /0@0F 2 3 Bљ0s+Й0l+0+K%O :" PF @:F0FxB>5-x%O "HF@:F0F^C$ѝG09F0FJ F0E0D0C0B0   #F5--OFF x+"! FG 7"F 6%I 5  3 2 1  . X ( ѝ00#*+L%O IF0i8F@AF F 5-O7AF F'8FpFN$2)FH4SiiFp0pFK$F4 F5r)F`ip@p-AF4F440O%H CF#I(F}9$F"FAF8F II(FlB#FI(FVD8F (8F $0hF1F CC00#@c0Y O0{>Xr@pG-OFO FFJ1F(FCFo,KhBФI dF( $xF(}I8F(v@FF,Di;+=; ;u;;8F(Z%jOq(FF(PIPF(IO #"#1+F(Հ*F(ʀvI0F(À 4F(oI0F(𳀕 $F(hI0F(𣀕 F(aI0F(𓀕 F(ZI0F( F(zTI0Fx(tЕ F(lNI0Fj(fЕ F(^HI0F\(XЕ F(PBI0FN(Jе F(?:I0F<(9е Fx3I0F,P F-I0Fر F&I0FыnF01FHF(@ 0FI@F]&j6h F fFp-P(F(>DPg S &Dv_jwrI(F(ОJ8!F(ЙI(F(1m F(ГI(F(*FI8F((FF(퀉F(%j#h$"j#B|҉F( F(zI0FdtJ+F!NF(psI0FTlJ!{<F(_gI0FDF(ReI0F6(L `IF0F*(? F(6YI0F툳m#$!80K1FPF53FKI0F(RFHIHFXPFJFEI8F(NHFHFPFE#53B#*+=RF6I8FxPF$i8FF(8F.IXF쀳,IXFF@@FZF)I FHF F%KB(F F: 8FO0 FJFIPF(HFpI) F?nU&pKdrHm@pG-OMF@FF'JAF0FCF(i(P'KhBЫI =c! F$d?I#! F(! F I#aI(FPK((FFFII I FZ"$4~ I FI8FF(ЍI(O3"P FI(F8F2I(Fl(Ј$AFAFF  yI(FT(Ѕ Fq*FLF3FYFPFfO 3mI@2#  8FF# b#3B2#$(`I (?F0y"[I0F(F(?VI(?hF$(BFPI F5O5&[MI(F(?P(F" FHI #(?C" F YEp Bp=I F 0F$ .F6I#"0? 0I$$1F ^$4B5]EOr $2"!0?I ]HIr9g =f.SStU!pK=/(>D$$1F $4B5BI8F6F(?I.(?􏮊OrF0FI(F (?􀮋F(?z XF*F(𹀴I ((FFI(O (FI( (FI(׀(FI(̀|(FI(p(FI(𶀇f(FI(𫀇Z(FI(𠀇P(FI(𕀇DI(F(61+#+rOs11f }ZpI(Fj(\Ї olI(F^(OЇb?XFrES"1#0?[I FO0$$1F $4B F`r$:"0D@F4F(!";I(F BI FElF&`=I(F(ЅF(RF7I F+R5I(F(Ї (F/I(Ї~  (F*I(Їp "(F$I(x$"$ I(F(ЇXB FI F &Dv_jwOpKdh@F$*FOH0?kI $1DJF HEF$2"0?\I$RF1D E$)F0FZF8 ˎOr##lOCQFse0e a\!e0FZ*F$40a0?+I2$$1F $4B#Or#5a\!0F+$20a"0?I F $$1F T$4BO50F8F(F7%ӰFFt"!#.2@%!K 'K (K")K"*K + K!,Z*F! FT9F0FRS@ixii!F"!hF:"x!FhFpF" FhF!(ah"hF_hh3SB"FF B J IjF I CI B $pi'!!KKpFx +IK&&x+@h Bx@CJ0@B?I @ AF uJwI Fbh h$IFhh qI(F`nIF(FF豉F iI(F(𿀝0+@𺀡n)"l0F 0@𒀇^I(FFFZI(F|FF RI(F0n##QFv (F0=JEI * **ѻYF JF:I H(AFJ5I k 3I 6/9F0:l1lckB(F"l0Fn 8"l0F!n 0h1+n!kQF"l0F!n 0bn#o;!F(FG0mI"k0Fm 0mI0 A# ",;[wj-AFF 0F>F(FF9FF0FF F$AF F ((F, F FI]@p-AFFIjFFF +(RCFO0 8FF(А"!Fz"9F^d I0F T0н @FI*F" F&3iF0 F@ FF>F#BF?#`O08F"FF(F2!(, FFFF#xBF?#`O08F"FF(Fp2!( FjFI0#`O0]8mF"!I F047#Oa F# J_#xKH FH0D 7#Oa F# J_#xKH F.0D mipGxBxC#xCxCcJB ~BBrB HpG JBrBHpGHpGHpGHpGHpGPPC݃xBxC#xCxCcJB ~BBrB HpG JB rB~BB HpG HpG HpG HpG HpG HpGC-C_BDFF FF(FB 9^)BF)F0FVE0FKhF0C ,"FI0FOs 1$#+*,.0z0IH6)-,˹.0**+AH xh300[Kx:+* ";H()F:H&&$'i)3Hi.7/, 5x-H#+H*H h'I F#0m%I F0f ""I F(BѽOsBXHT(i6i2i9!CLVaiox8iiycr%ii!   2FHOsBHx C0 I$jF% 0I(F F08iIF"!hFvjFI F0I n i IF0 KOq J H: I F_0I L åqKԀiIFB0I 0 I Fr0KOqJH0 F I&CF H$ Fi+;qUԀiEF!"! #  I FC J I I F0I dUigIFjF0KOqJHI F0 I  I F0 I vqni+iE#I Fb0JI6F I lhjF I F00I n ÞipFFFHF$(F< D5-d++<H - > p@ _j>pFFF!"$ FI`P*CFH$ Fpi  IFP(K!JH ! Fq  IF2(K!JH ! FMq0" F!" hH!"!(F(ObiF F ( H 0+ѝ0+ѽ0i+ F  0  IF0 K@A J Hn I! FU0I zq  IF0 KOq J HF ! F-0I X 3q-O=F"!0<I F#L0OsP0>(ڲI P0'+ @ F$*F !(2<(܄B:FF'.  # K HKFKKKKK(!0!!"F j뮈iԡ3+7O 1vL 11 QK$9;@B:@BKءg20A2B%@OСv ".&&a@A92%3A$2B١zbb2 3Q92#O1:FEkB1FnzqyOaE_JOE_JH2OI2Oc2OC2OP2 OS2@OB26BA&p2&pAJ  F;H!0:ND"0 +@#x+~+#+Q0+̀*+I2++C3x+cx!$IF$H~2x*{!J!Igx+FHI7BW;JHJFIi)Z.2c!!7!bh 'jqq3x+#!yFxO xHIZgxJ?2WOE > 3x+xH(0 H::FH4  3x+ꀡxH(@-#yx`yA!J9CAaB@MIH 3x+ŀx x  ~HFC! FzH #zC(wKGF gPF?  FrHrK (0pIpC'   F), fKB @ B`B sB `K`J`EF^J^JVH ;  TI GD3 /EQx0C!RH;2x*H#+0+'+:!+5JH6 ++.GH/!+"+(EH)'+%+BH!)+Ӗ+М+?H?H?H?H?H?H?H ?H ?H?H?H?H?H?Hbx!F2cx 3D K + D '+?gC@7B"B/JCcB@,y++@%Ž…x˜¢©P"j´¹/sE?@KC4AUwgl^PnIoH3x+?yyyjHC!>FfHg{#{eJC'CF?F F ( :F\H [J3  p+0UIC'_  ?F), KKB @ B`B sB EKEJ8`EFCJCJ;H ;N  9I O:D F /Yx04I(H03x+?"zy0H(-I!H"3x+?ݮ!z'F*HOz7yxz9zA!!HOZ(JJFѡ3x+? !FH =1'j´¹/sE?@KPC4A,PP0IFjFBF H0I (F$(F F%0i1EsF FjFI?F$0F0KOaJH FkFI x1PF J I I(F J I F~ pq+EF("!hFnjF I Fx0   (i6*I+L!FFHy] #IF 0I FI (I0F 0I$BȿB , X1F H4 P(F " ixiĂĨjsFFCF` 1F FG0*FI Fc𵉰IF0b#`O0( F0F`FIF3FI8F0I  I8F$0 I (F F MiHF  IFjF0K@.AJH^I FC)p0IB`@# C I F0i0O0 &Cqii IFjFD0 KOa J H I F?0H &&qՀiJ IFjF0 KOa J H I F0H &qՀiX F IF0 K@1J HI F6@BcK7 F F-0J II(FF0KOa J H0 F I KF@B0,cKA#7 F F0J I0I pI(FpF0 KOqJ HXI F@B0,A"KF"!TI F#\0I J ipFIFF,PFĕ jFI(FmF5ĕ !hFIFF0FlF(FP@Bpw iv0 F!IjFF0K@dAJH!F(F0O0)#+r [BbB#!  CC !#F(F I F"F(F@B 0mqw8FI?F$(F0 KOuq J H) F`I 8KбL! !!L { J HG "F:I H ?ys=0 +Fa+W8A+=8#`O0jFIF60O4#` F"YCFIH$ Fń&jFF J Im!HjOML!(=FH`K"FI(F8F+FH|Kl%kh0FG-hm!HHJ KI(F"F Hb0F  4řōœŴnP\A`pGA`pGA`pGA`pGJF `l `dpGJF `Qm `SepGJF `m `epGJF `Ql `SdpGJF aQn `3SfpG8FFH # 0 + $ A;+#`O08M(FC>+ #,T 8CK\ !Kn+ BЛiFpGWK!WH-OFhEh FOx 0NI4g MK HB0 HDF FvBDD7FXT FFFFGFFF'&025I 鼹i+1-h-Qh+XxF(Bi*ЩhWBB B(FG(! 0[Bp(FG( $0#EE E##Ex##+ I ~(F!Xa;ϲoe6-O$mF FH )F F0Ik FFF J IB I ihF츱-h-+"!:"ih\&h x*++tjh FI(khKz*oZz*qњz*sz+u3Kx/u F?FyF@F?FrwJxI ! F7"IF \ rI@FO < 0@#1F FjKx+6b"IF8F\dK:FdH)FF@F 0@0^K_J)FF ihFH(?ihdh?_hZ F#(S+ JIhh@FFF &1F F%F:JBI&0"Oa#>J]IF=H<"IF>\X>9I@F F0>7HLB5H&"IF>\B>1I@F 00B.H 1F F0J(I?#S&Kmk:!##JOa]舯;x+CйH8F0D:Ǒϲ@p!X!Ci!iiDžymDZǿ?iL]i~hp~!5:##Oa#hJ\;x+йfH8FH0D/?̮{h1F FG?hX\IXF @FYI 0WIVHrF0+Ůt0"1F FGJTTIH #+# #SAIBH#S>I=H#S:I8H #S6H(#4H# #S(I(H#S%I#H#S$IH x!Km/{h FG?hKn/?حh"1F FGiKx \ FJ0FF f (~#i=Ucl==vɁəɤ!Z!X𵋰FF0FII0FMF("hFjFI0F0Vh+I " I8F& J I+`+h"F I ̌!(i6̖̣-GF I F|F0KOqJHbOL;h  @OxTF0FF(F"FȱFPF[CFJ1FPFJ 0FIJDt ,C<`O0!sFZI F(F #`F(FF FF LF h[F``(F 6J hsO0 pB!sF I FF(K!JHF(FHF FFLF h[F`(F6 J h8O0 p-!-AFI FF(K!JHO;hF@FF0FZFF F[JC J1F FDtC <`O0̐!MIH vnPUFjF I Fr0 K@ J HJ J h#pC#p#Cs`͞q!0IF<J!hFhh#CTh#`":jFI(FC0I 0 I(F( I(F( I(F(%0̐!i5ͨ-B F[FH/[F H[F(!FHL Hj͵sEq;-AF,FaI*(F? BF[J [I("!hF"!FhF\jFUI(F 0xHFOI jFKI(F 0JI[$FHHbHIB EHVBIv) F2=MFBX?B?(F'[FHHI l6 5 F A X(i6̖pdsEX=Fh F"!@ 3-M&FFFFB50s8 jF$3FľľĞ40 40 0 0 pj(68 hkbbhj(O0p FFFh(`(h Fdp1F"FF((h.` p F #`O0p𵥰FF*FFP$"!C-*~7#F0 #`O0 ji!F8FCh ``c`%-GF FFFjL3FfBO0BFoB h"+##Bv#Br"#9F0FF0~ #`O0 j)F@FU0hPF `k`-OFF# F@#\#`i 9 (ѡ(@ IF "!-=---@@F(x6I@},@ K.FD/!8FpF4#p 8 "!HFn"%"JF 1F8FFX i",I2# X8F( #Y0#X0,+ X Y* #`L8FO6$#O " F F"x*O .O "#`O68F@O6$\I@(@OsQBـY)Ԁ@A\)@΀!\ YX^0!"!@!YP9 F FO;+6D2Ҳx^ X0O6 X .:, ;+6 FD2x#a(W<A(7<0< ,+ #ɲ C +t#x*q!Fp78FF(f kIF 9F(FF(FZ/O;F QFXF0F0+7,51FHFFKFJ IJ8q-]ex1F(F(JI "FF Fd% JI "  0 00O08FT7+E-OFFF!"0F%F9h;F:F!FXF[5g``%hYFhFG F5F00(  0]- FB#`O0 <O` O0 -GFFFF$#:Dj ,2!i0038hr($+x-+QFh ()Fh젹 iaiA8hT( 8hL( $h#`O0bh* (x  (hH (h I h FF1F8FCck s`i3a #΄-AFFFF=#`O0 ri!FF@FhC``e`(F-AFFFF&0F^(p#0FF8h #`O0ji!F@F=Ch ``c`FF$ !FF8K`Eaa`FF !FF(K``Da-AFFFhi0hkaazFFB  Fphi0hkaafO04i`a -CFF (!FF%F KBF9F`FC_a0&w F0(F F-AFF ,!FFF KF`%:FH A$_b1FCF;0 Fѵ(F-OF8!FFFFFNE O 1-  B~#`O0+h(FZ& "FhF3FuFGйeh!F64祱+h"F(F3FGPeh!F4  BO|C@`-G%FF/FOET<^h&hnAFT AFFGFPFk74(F|*h"t[hG pGh00O0 BjF#cbdi j0O0`h$h,0 FjF##bdjhiiAhk0O0 `k$h,0 F8F F`ciE``a`a# F#t8@O08pư%IF $IF0FFX`"!I!H#`O00(FF FxxFBI Or!hFx*("Jx&*("BjF I0F0 H FpΜΣ ΪΰiJIH nP1K!-Amx p%F F*F!0..эP##0#,`B#` !,F!(F "B\"T`F0 K2FZ(FpF FFCF I8F:FI "(FZ*F1F F@pF FF!"hFjF)F F$p-GmF F"!F}0 н03JH+"FJQ"Fa0J IjFI F0#`O0 I F0#0I g6i9>K"`pGpG0 O4S+E-hp(O)F ## 0@pG RVV]pGFVFH F`ИJh+`!8 RVV]pGK[hñ# #"!C -"RCFHO4 F!8Щ0(iK%[hӱBF#*F! ##+F 0!F\Ht%  $  (F0FHFPHNHNH$"F  HK"HIIHGHEIFH:  BAH/"!O0f(" "W9K`F"O0TCZh+2H;GB* OrB ,H,!(F#h+$hd" j" fKh$+OrB+ + O3 8H"F D"F >H0!8 @MAZտ6IѲ7Qs%&SKh;>+`Y T! "D!0p@pG L IFF F!FH*FI F <nP;w-0"!HFI MF(` I !H([ k`0M!@ h($$Kh&MO`O!O@ @ 0@9@ C)Cܲ!C $E K ̲-D4BK`K! `  ( hHhK! @ !CQòC #B K ˲$C3BK`K!`   (0 hHh# C C%BF#CL`BK`K!` 0  ( hHh#ò C/F۲L`BK`K!`   ( hHhCS_FL`BK`K!`   ( hHhCCOFL`BK`K!`   ( hHh CCcoF#CL`BK`K!`   (p hHhCS_FL`B"K(шh hLhòCQK&3@ C_F M` %B۲L`BK`K!` p 9M K"#IR@h]-AF!%FEE9F@&FP9F5&0F7 FhFL"FIZ F>FZ(`0פ F xn+Kxo+4&&Z%FIj꠱x!Fn+ Cxo+0&(5F  8F(FqIFFH (תnP-OH F #JFAFYHXN%h z%}VEV <BV<QKhcPK PIV,(FNHXFV <% 6kII+BIJ+FEM FCIF()FEH0F0=KE=I(F@HvUh(K(I(F,HN#-H##D#'H<+h+%JOc#AFJF8FGF`+xS !(Fp*F9FHHKI(F H  ռ!H=psEy-BjnPb~؝إ*FLe-O]F S 4E3Fh S3 S3)FFFhYFH,#1QF,3!FI F0 cI(Fl8II9K Sh+F! O H "IXF#Z"(FFP  E\F #!F8FFF(xKh $vKA #sHP/qI!nI?lIkKB 8A(F@0 G!@ Z&  S"YI8F _I F\ ]I;F[J[JOa FN`+FO@ '48SI 4FBOJ @FOZ(F0+-+H'=!HF v谱"7+CDX`>IHF(л f0!H?F(<{Hذ؝ؾF!Hu $_qcDY mG0+9v | z! 0_HV^N_J@A 43hn 4Th+*F 4UH@(>D0] d }t#!FH0#F*FI [Oa `F#J[ `<  ݔ8F F !F H^Ob)F FH!FHj)FH8@8kހީIFH rnP-OFF#MF`FJ(,x0#`+`J1F FBCo(#RFIYLI Y,+h,AFV#TIFhhOLg (>@P(>Dm c#!FH,0vh++ phU H? KFH#F I Qg@8F FJ!F HOb)F FH!FH)FH8@8kހީ4IFH nP-OFF#MF`FJ(,x0#`+`J1F FCo(#RFIYI ^Yl+h,AFV#TIFhhOLg (>@P(>Dm c#!FHl0h++ hU H? KFH#F I (qQg@8F F!F HOb)F FH!FH)FH8@8kހީIH nPd-CF F F'N#09F&J FAo(#BF"I0hX I XKh, R W#ObHF)Fph" rh IthOb)F FH!F H)F HC񘹽(>DPdg tީpm e"$F#F)FH0rh IH FjIFH ZUnP-O%gOFFF`")F F.FFF`JQFXF,C^l(.M(=9(o+G(XC U('g(Q8hO`gs(m(o()Bt(4u(>8hO  goCgoCCoC 8h#g8h&#7I8hX6I X8h%0KhEp">o  g& Z#4Wh58F4#`й޹8FH0:FI  #g cg.0gEtVCj0oCg#0+(>Dg 0M d(#!FH0#F*FI 6[$ dOa FF# JZ'!H& >b 7 F"FxB(#F*FI 0FT( FI@ݿhFT( FI@Ϳh@d"FBx ("FI #8F FR!F HOb)F FH!FH)FH8@ɿ8kހީ<KIKKKKFH &rnPKpF N%*F!0Frf``pFlF I h!Fz (Fp@Q!(-CFFH"F F!`FHH"I FNJIF8FRC28F(S M9-c 9%3Y=Kh=I ";K:Kh+6K"`i#s "iF0hHx (,K0IhicCS-JhC`4iCi# "iF0h(x (K"Ih Ni dCCmiCci "iF0hx (KIhibC3ViC@RiC3NBFI0hX^Fع I 0@(>Df!PV!Hr!T<AI hB `Bi"aXBiBbaBiB@aoЉJh*SJ!` ՅJh*IJ!`i"raXBiB2aB|J!`Bi"BaBiBaD"`ZrI(FX:qK`pI(FX2iCa`bkI(FX&iCa bfI(FXiC3a`baI(FXiCSac\I(FXiCSacWI(FXiCCa dYRI(FXiCabMI(FXiCa c(F#XniCCji#Cf "iF0h x (=K>Ih=K` "iF0hx (5K7Ihi`bCBiC>#` "iF0hx ((K+IhibC( "iF0hx (K#Ihi bC "iF0hx (KIhi cCiC#a!T!P!Hm!L(>D !8OK"`xKh/ Y#Ob hh  F$g ]=O E% 6H& )F7H0hK+  :hB"F #s+F"F+I j # EOa(FF##JZ #   #@C@FHFd"F H# "H!  ]!H[X ?8F F!F HOb)F F,H!FH)FH8@8kހީBx**AI F@h#F(FO3c`#h"!XhfO0#hhe`i#"!(F#h(FiiF(:F1F(FChFOzr FFhF!%ZCPd(+F:F1F`hO0sFF F#!F`(F##2F( K"hhBch+ ѥheh`)FhH*O0p!XP(< `0 <pG FIBð%>#?"@#A# #>#(hT$F HH#`O0 o C]-OFFFFBE&O `1FDlZFDlJ#D$0+:$&2F I@F@?F"F9F@FJiLi)IFDkd.iij``kach4laa #ai#sa !.[X[!IFH fnP#-H@B =# I ( gz f]&-OF("FF(F!FsJ$#sN+`F@`qJ`nJQFHFCg8(%30h]#0hv#F0h$0WKZIhg###ZFVI0hWTI W7h"QI8F78F#x:FJI :FGIGz &"EI8F(78F3x!?I:F p ;I:F f:z ڀ' 0 8F0#K0Ih ^##a0h#FZh  Z#Ob89ph909I CFa a ,b/(>@(>Dg 9?Z_?BF8 d(#!FH.0"FI [-H#H#H S#F HhH SF Hh H H~ 8 Wcp7 F"FNxB(#F*FI r0FS( FI@ݿhFS( FI@Ϳh@d"FBx ("FI <#8F F!F H.Ob)F FjH!FH:)FH8@Q8kހީpG@pG8F FhHȀ,(i ahi`aiaia(j bhj((X`bS BB heZheh"fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d  lcdlYd mU(e`mQhemMemI``peQ BC p`"54S+BE+8#FBT#"A#38 FF^XRL88  FFSBB2s42sXX\\dsdsfsfszszs|q|pccccccccccXvcbaXSjBBb\ V $P$(J(,Dc,cczccpcH HLLPPTTXX\\8-OFh FFP``hh`Fh`h` `H`iHaiaia jb`jHbjbj#FbS0 FB0SBBTK\%BF-L53)P#V"G`2)D*3Or5q5p`m|heFmweFmre nn(f`njhfnffFnaf o](g`oYhgoUg"#KE" 8FHF0FDF@F@FD#$%BQ#3H#3\5SE/D# BQ# G#3P54D5DZC#B4%3T Uc"0B Dѓ"@ @CpGp FmFlF*hKB .Ob)F F&l&qfq F+h#`h`h`*"B+гftO##t##DXt"2"2 mpLABL-AF M#) F2?$hF(FBOb!(OpF F##rL"crA!r#r"papB!p2Fp)F`&r FnYF1 B3+P@pG-OFFFF# "`XFxFF#Qx[FRFGI2T+ K+#B+#G+ M+S+"k+b+g+# s+t+m+##` # 3# 3# 3#D""`/ISF #FFIF@F FFh"* )F FFEE[FRF IBtKhgE+ZFQFH [FRFI#BrKh[#QFEH#ZF # IE#[FRF )F F p!KhF:fIFHP^KIFHHIHh#hL+%%T  D F0I!sZ;sR+k,BGN GKh+f1h F_ikHDkhD`gk#  Bycj'Dabk1Ick3ccE-Dt0kB2hFFShBv~n-t D OBCIsD+r 3c35C D@hbnFJ3h  HH F nP! U!!!8 FyFF(F2"2Khc h[Kh(`[8!Kp Fh!F+ OuOe*FFy1F F3#3pk1D 1(Fp!-O=ɰF FF!OrF JHOhFJ+hI;EE$ P D 0$6%#"00 II F;hF  Xk' K hcl# B r] #FEU"pnrkFX;EE P( D 0   OzsSC FI#"0K;hF Xk  FF$#CuK hcl# B r] EUR rn(rk#Fk#"2;h k #ZҲp2B3+##ZO&@;#+F#>zUKFh3A@;h"FHk0FfZF!`" FHF(FXZF!Op! ZF@5QFOr!$KPh'K\BOzsKkCk OA # "0F #)?ܮ=h #a[lBA @r[ CS"$:h%Pn #FFS!!!|T!kCOA#k"0 F #Q$?=h #a[lBA @r[ CSR R ;hZn $ #FJOzFRF;hr36. =I-OF-N|M!Kh+QЫKh/MѪK4h[h\C?дO8O O "8##A8F)F@EF%A"O18FO1F?)F F1A"8FA$FK` OQ *MF(`(O1 ~K`(}K}O`}K;hCO2(5,%0+O,%x#<#(5#0qKh# 0 5nKhnK)h4kHX +h)fHN dLeJ+h!hhcZcK BaH> +hYkK B]H2 +h2hYkBXH( +hk_ORSH +hk?O2MH +hkZkBIH GKh#hBSB+hk\# )h k\BؿF\3,h #@p^"YC;FH;J:(YFPFD aHH, +nHH#DExP FGwAF8F"PF FFYFa0 HH,(nCH!" DE, *nAH$JF!DAH +?N4ho%n@F)A#il>D`apE?ir#0 $%H -bO NOCH* AH#DUlDDsD@0Kh+ opYCcF:@ak# "#IO3"AM,C(` ' `E!!3h!ZkR,4hKIL$`+h%J/FRPT`bkTTXTB `JSS`D5SblS@T_TTȿOSfK TPhcKheKheKh0#P0HU0K @hckPX0DchbijRhp k`z "n: @F F #)F #8 b{~raFXFr Eȿ |uٿ8F9FQF@bg ZCFB0#a #!e `p044TL$ %b "b 0pUKhR 5#Cs 5PK3PMLN+h+@IF@FzIF<#kbn @F'ɚ)?HR;4h z0 zkz'zz'R;1Hj1h/O0H k0L_hCR:`:h"`@\)IB!##`#" #O3"A!h|C;;h B0Hj& p>!!!!!d!!x!!|F^!c!!!T!|K!hz{KhF*uyO#+rwH: tL10J0"hSZz8F[OW#x9FXD[xC;O`{`Khc_I#"## hU!h!'hO`9F F!9FOP2ObF"FFOb GKhOPObFOb1h^@Kh+?Kh?Kh3h0+Or!Wp+h+6H+h+)2h3K\@Bj3ф i#iHCFFFhRnIph$J!F# K IfCz0P#0++h+;+h+OC&3hj !!!!!!!!!! TNm@thX# #$4# 0jBH @'F 2 Da F QE\p IE   FKE  0" D0[D 40HD rKED!FOp 0 CSCFvBphH( Q0!dN 0h6hbKps` `[sa$%*¿:nA3g[Kh+#"#0sgo [BԿgg#"030+ j ;B^1`0s#se03e Be Hm3f$%* Hsf!Hf/Jhfn1!f$1f0:nAHqfrn0B!H% K h j Db *4YhJHBI5smxBp hj:bZhB5smxBp hj;bmT7! U!!@'F] CE@󇀻JH0hJhBnvq n:FKh$5+ ݰK!hn\CTKhi3aKh+T`pnkhIBTkm[S 2C khPBP55XCm@'pn^ FQFF QFBCFL QFD @ +Z3+R07kDtkk4tJm&hkk3kckpM#D[B%hxhBoHvw9n,!F(0`x08CphAj1Ab0dnDVJhkMi#DBKh:FnKEvq n0$5+HK/Oh;FnGK;@+3c3\CTDm +ݝKh+@0 D?f. 3KLI*F0\%B OxFChvFD i!iJCAC0D@vhZnyFp"!FzH:DDBvKh+0 j; kKhpH  _ #44C4+ [Kh 4$ [Kh ZI%ZM#)h`#WKh+303040 40hKk{CsoJI INOb0hZ4hb!`CKhF!F(h,h0+0hOr!Wp9KzthF3h:F4O0++h9hZkFn,hcbnh;hbk)L*K!hhB0+KFhZkS$K *hhd1Rk`#hK0hhB+h8hYkI< |M+?GK!T!LR!!!!!!!!!!-G}FFFFJFF(:FfI 2(dIHFz(FO7H"F_IHFCF h+AFZHk" jk`j`#k+ackakaa@0+bB0kbclb&MI~0"QFF(F*FHI8FzFI8Fzl DI8FzfBI8Fz`@I8FzZ.c2F>IHF0\"F2IHF0BF8I "!0F@F0E@F!(0|aCE9  ҲB3E,VEc|Wh#0 :h0 #"(##*#*#0U "F'8F }z?@dAdezVznzwzzzz@dzz-Am$OcFF!FFVCF"FF@FF(FN\9`2"# F m8F F!F HOb)F FRH!FH")FH8@98kހީ 5pG-OF F FF9F0FRF[FPFF FO``" PDOO` FE` # D#F aFXF-CFF F F F!FJ/I FO!`#q['L PO2O1O0 F !F F: F^^F :p FFFf2F_2FX2FQ2FJppFF F*F((mep[EBAgBB҆BB,  BB҆BB  #Bp  -OFFFF# "`XFNxFFQx[FRF8I,S+ G+B+!K+M+k+b+g+m+s+##` ## 3# 3#D""`#ISF #FFIF@Fx FFXh"* )F FFLEE[FRFIBtg[FERFI#Br # IE#[FRF )F F p LIF F !FH*!FH& nP.(#"!B ЂBЃB AB݃B pG pGKplF(F4.[nX 6J3D.mD0 Fp"HpG@pG8 FyFF(F2B2 h(`8K-GFv FH!N<:FFEFO Eҫy1F(F  3C3uD Op1F8F"H!CBFJI  F IFFhF KxB JI"("Ș FIFF h IhF K|xB JI"4"("Ș7K-CFhM+aѰo^2MH0O~i0DfpC-N FO7h9F*K#BFx@$KZi&KhSCB1B59F0KIF1@F&ObFkF@FgJRIg Z7OF6CF9F0Ft,6Ah,CF"9FF0FfF$&FF^& @#F&FFt$&0F9FFF JFL0X "1FXF0pC OѰ#F&IFpf@Fp FO $$ ` S[EBBk"H-AFBM, 0˳FB5 F|F3F"F (j0FB#!2\xD) FD+ O0F O\CJI@CT,6hd&3F F0Fx,6T8P{ K,6G0Chhi;`@D"H-O F! FKxQ|AKhkB*FIKhSBЫI .KhB;FIoҧIOc*F _O3*FIBFI*FKh. *МI(FL5 F(Fa.aVOyFJF#C 6 8a(FF8Fp9F (FoK̿O O  FO$IEp FF wIZFOR0FDAF#)F@kKhF * #0 CBf~f#de#;f#{f M,FPH #ke#K X0R IٽhKh-<(Fx(1IȽ"Ș!!"(Eo!"H"8",QN>! V")Fx#040000lJ+Bm?QhSiVj 8F"BFO3BFO<FF O@;FhA)F 6BX+B(FK&ePK V(F,I/*F!OV%F; Bk"jcil96zn(FP &2D.mD D,6HFnQ ,&X` ,&`(F B,63D:j,6 Dj 8x5,6DO3DOMKN`+h+&ݫ B2ZFKhDKO3 AH;J3jjh?HZC 6" 9N##O3"AF0Ih!!.N3h['KxKFBF(I n'J1;FH0%OhW?Co0XCOPO0+h+H+h+/ jai;J!F \""H!n"0!"8"Ș"4 "( N#KfAI:0P#3h++h+;+h+OCFqFOO&5FKRF |&!9H$+F 3 + N  ,6[Dh*K&   P(6E#IO $&E K 2   Pfl0+b-`l;cn(F_(Vи#Kh+@FD?J. 6m@th"Hm"(!"4"Ș"0bi#jIH#" K.F\D0DB0+68 ЌKhHF AFF &5p. Kh)@;Ml,F+"m@"RH`0@bv!Ozx AvzC!2 D*+indJpFdI#F3%D30+bѽ`.0$/XJZIʺ'fHFFPJSI HFF KK*F 6JJMI8FBH% 5CO 0 &DBg&=JAIxiO 0(D"B*ynFV,J1Iqxi 0;j(Dy"I+6D2K 6EI+    hYKF 6"DD K"vBH% 5"4LR"H J    . lHF@/CF:F @F2#"@lCKnAK"q!!HO@7"! (( FD`06sCb:#z06`x " %GFiIiH 5GB !(aIcHbI" '`K&XM/6F2B&!WH7UIUHXV PK&@ #""!lSAKnA#3'4/5D`0!8Mb>H{&#`z0#@xF"*I1Hf &'@)K,N"#ici(FBZp OhFADN&Q,R(DEDaiK@FF!h +FJF!8F .?A"H'  !  "Ș"(pG@pG8 FFFOb Fb(h `hh``h`h`(i ahi`aiaia(j bhj`bjbjb(k c( h`(l dhl`dldldPPRRhm`eXXZ~Zmwe(ns fhno`fjf^`^8p FFF FF(R hN`(J hF`hh@``h<`h8`(i4 ahi0`ai,a(j( bhj$`bhn `fnfnfttvvx xzz|.|GеF.8ـ3+5+-+%+++ +p-G}FFFFJF(F(:FfI (dIHFx"(FO7H"F_IHFvCF $h+AFZHvk" jk`j`#k+ackakaa@0+bB0kbclb&MI|^0"QFF(Fd*FHI8FxbFI8Fx DI8FxBI8Fx@I8Fx.c2F>IHF$0\"F2IHF0BF8I 4"!0F,@F0E@F!0|aCE9  ҲB3E,TDEc|Wh#0 :h0 #"(##*#*#0S "F*'8F }z?@dAdezVznzwzzzz@dzz-Am$OcFF!FFT\CF"FF@FF(F\9`2"# F m8E-UЊhh k:id{~@8  8AeJ B ڐhKXCKD` DP0pG"x@-'B=IFH j nP-OFO F.F!FZF(FF(O , F1FK1!FJF!0F(hBF FHKh"FIF h+RF I ihhk`7hBF8FO񗽽#(>L  -O FFh3SBF*Fh(`cz%zb) #H4Dn*F=FHz OX1Hr[FRFIFHl FFHf >FH^[;D+ݥB HR  - H T f>F.MzG|1~/ !C՘xq\x[x"!H!/!3՘xxq\[x"H! @Ѽ/#h3SBF"Fh `0+1 нHFH @ # m   "I 0I #Ј sFL1 (hJ@FH"!(h(hJ3F@pHp#j#ИxBxx#x"y##FIH~] j0A L" F34[*DBK0"@@C0" Kn:f*oB² *I񙻚mQeppGmmpF%L2+h"D2!K"`. 2;2+ܮ!"2KO2` 232+2 #2 KO2` L H| Hz˄`p#0#ѸmnP0F- iIiHiLiHgHeH#_K3B`HNk^H:{'{*k[R; "NJ({?v3?>[D%%:k{{ ݔk' KIk7E{ 1 >K1{'l)F7H){  {* R;V1..I,I@{)H@jGk[@ G z[{kR;" 0@Y?@@?6C-# #  - C T w0 ##  !  K3+Կ 2# Ki L3 I3@$Bȿ@40#{IFH1%2"DB#D.q2`C {  ܟ {  KhcC @N?ə?333333#0-OO ON-3=FIF{  ձ@ # ^BuV6{ G@CY.<@ ,:IF ((R_ n8IF F(D,L-I#h 3H13H5 Z1IF 舻 = J*IF  :#IF F LI#h+H`%`HZ#h3#`I  H*| I K ]#܄nPm5UDn#t Kxi+ H3#!pH z#x#ܘ KFIFV"Fp IF IHb IH#IHH# - 2 : B K#FJFKiFhh\4$@ KhK K J I( FF2F+F IH F%PP#܄ T8m Y-CF5KF5IFh h3$OO\B +Kh+IF)I*HLC./'Kxi+&Kh+7%Kh{gd!#J-;F2F%9F0FFxF F(00C0E F;F2F-FC@FP%P#t dm#x#܄T yI;J hh\4$B PÈ#CÀCy+e F%PP>>CtKh+7 "0F0F>ZFKF8FF$CbKh+(FF F;F*F^I\HѴ0X\CY F9Fi9F FYCcy+ F:FKIFKHHZF8FKFBÈFCÀ?Kh+̀(FkF F;F*F)6L'0Fx0FHZF8FKFFC#h+ @F(F;F"F(ICC#h+ %F0F;F"FqZI Frby*/tcy+I F F# FtiZFKF8FF8%P #t m !nP!*!<!Y FK8FjbKFbbZFF Kh8 I;FFH :FIH(F;FIF H(F:FF H ##t!{m!nP!!4K-Ah3I3H3M'؀&#BB/9F0F"7FCy+(I{ h\Bj,д00; FIFH. Fk FiKNj,jܱcy+Ѵ0I F3h; F IFH FI Fimj#܄m!%h%P" ##t")K-AhIH \M& @ |#j$cj F6+` Fb,h.Kh3#h# yq#q gїBy3#3B(00I1H0+I-Hy3#3B'I#HX0 I =D#hD+ FNEB%4<Or!hF2h4< ["!F~0 0hF4C#l%m#$ $$%#܄K-OFhݰIH NOaOJshFHFL;hpJxFR+shOaJH;h`HpB~J5I&I{H?#wJ{I 6.0OawJwH08+xR+hKOaqJpH[heKh(lH:CjJkIeIcIfHFcJFFeM#cIF#n0#o0 #l0kh P(#pCO2HnhKQIFQH`0FNH3)lMHh?!FHHOzs"YFPFT# D#p:`;aF#\k`X# #k cd#a!# ##X"+lbkhdiCe+idkie3F)I*HX?'Hc"?#?;ixak]#܄m$L%H%`$k^##x$w$$^$$%x% nP ^%%:MI%$L#CchpCO%x-GF*N*OlhOb (h(`$Kh+;#I#H9khhB#k` "a1BKhIHlPDj`Ih耱OEE ;h+RF IHN F%h#tnP%U%n%-OFMFFFF8F0#"F8F+FG#"F8F+FG(x;F=J@A0FOI`$FhKYJIFJHbHIGHEIGHk((#`+F!X"`韛R;xi+Fx+,Ѵ0Z;#*+ 1Kh+(#.H0+ F'F 0F0F0F0S0FIG0F#〣[H(F8#܄m&&#x%H$^%`^&MGw&nP&&c#܌&^ &#|#܀-AFmFFFFF(;F2F@HuOr@a(Fx*F;I;H(:H(hK7IF5H ]"i4MF?hdiF,Dݴo'F(FOg:F:0&KmF H F#IhKQ IF0:F0F0KmFH FIhK4IF H Zd(F80F6 m&nP3s#%x''J,#|O(    L4#+`#x#+H@r^BijBуibpGF+iBтiapGI4'T FFUFK#BB+F"FHO)F FzhF:hER#qbB#` KhcvjV#BBI0F%h'u##t'p FFU K#BB NrhF2hR#8#BB@jp p%h#p FFUK#BB+F"FH8N)F FrhFt1hQ#0BBYj%$E`p$ F+F"FHp@%h'#'-A!mF 'F (FkFFFk/.kpAF hi,5$j F m8/!FF 8#p(F/##pF(Cy+)FH F8'-AFMO/72yB٬1h F! 9B evi)FH(F F#'-CFH@FO: F4۹XLFHw50%[#DBD!`,D>DAF4hF$~(#(%p-GFCMFF 6F("!cj F6n)@FcqZFF2H)0!&(;#DBbb!"F(4)&./9F0FAF#H @Fr `@Fda"F! q ./!@F0a `ea q+ja,b9F0FvFHigaaW 9F0Fd H"F9F0F F#(+(M(f(%pFhK D4D#`#F0+#I'cy+ i I F#jI FQ"FI F B g9F0F5i9F0F F-iBia I F F hK&Fbb(((((#pFFFoFI FciB F~+jeaa,b/!0F^E hx(F `(F q F!hC # p(pK-OFhFmInHmKh+@̀lI(FFhhK&gIFgH)FfH'&#`#BB 9F0FoFИ  0!2#F"[F7FO '&#BB99F0FEF-("QF03#D0i 0 i 0 i 0 i $0 i #F"(!R7F+O&yhB ;hS&0i"#F!6:#0!8#K<##K##"Kh#F[ hJpIF H)FH? F#܄m)#|&nP)*#%X%H%d)W)c%hK-CFh~I~HD}O޹#"JFy`!8`vH#"#tHÈCÀ"0FF hJ jIFjH1FiH@F( hJcIF`H1FaH+!0< FPF]H"F)F@F(xhJVIFPHj1FTH0"@F(@FNKxR)r)+LK#BB%ЙB?IpFHGHf EK"AI###AI#@Kh a F]k#%x+nPKh)+Kh,'K$2IH> F 49@ FNKjFIhZ( hJf IFHX#ܐ#nP+1 `m+[K Fh3K FFHhhGKh I$+Fpl0?KgmhJ(;F2F I H FL#p%##|#%x+lnP8KLt$FB0+"mIHJKt$#e###Hc`2t4!`"8#%x++%h+KsFh F3K FFHhhGKhK*F!Fpr0KEmVhJ+F"F I HD p#p%##|#%x+nP8FL h()F48 F8\KpF`KZhFB KxFrx0IH( e`p%d `#nP, F+K,MhC|5*Kh )O)N:! F>`H D#Ep F(!I Fh I H8`hJ,JIFIH8`phJJIF >434,F!F H@s%d##h%TmrGw%,Gb #-CAL#g#8FV=IF=Ht##C8FHF7J8L8I5H.u`85KNq5N>x( F"+F0I1HL)r/I.HF?2#8F#(IFHF64#5h#C8F FJ I(F$8"KL0h)#FII0h1hH.3h[I t%,qm,[%H,,f#܀,nP,p,%,,,,Kh(K 4 pG `#-O(L$ #F9t44k(ШHKh+ %.FK9W`tKNFh3|5ZhKh+)IHIH5, EsFIHz#0)K#BB K#EEE:IFHXH2IF|HP#0TT |KxR+zK0+.F8>F%59+4tKuIuJuKiHuKuK$eItHDcIsH@aHOa `0ԝ 4 + `TIeH"."QI&bHaI `}r93A ]I3F bGH[I `}`6 .BI B0B#93C9&2FKI5H3IJHbHI0H.Hv Oa `60 XO)C)9;h3)7I7H+5K0+<3][h09- `=f#+rY=BOpr;hK"J"K#I-ȿF"H*F= `C0+#H+H8t4H#!t4`T0- `= $ #t/@m%xy/enP/%H#-OFN7F|5LBFیKx(h#FxZPF|%!Ob939939B%3a )O+% 43xYF(D#qKZFxh)Dz4F)0B ( hKhhIhHN09$-|ݢ,"0B: %D,F :XJh""FWITH,NK4I},SQIQHQK ***JIMHIILH mKIEH#HIBHGKhGH@@!x"F6 4+! F .I##FhT@CXBXA`hJ4IF*H :4$Kh!I.H4C,J9h`0 3 )FHxOb!I(DObxPF#|5939939#%d `#tm/#܄/nP/%x/00*08#܈ $0R0k#ܐ$(jKFhM+@ـiNl"BcKBBИB%_KhFB^Kh]I^H8#+` F(VKh+n h%F ``h}``hy`hu` iq a`im`aiiaiea ^ t  kW c`kS`ckOckKclGdlCdVPJ,& xx||%F%F %F#lT%#܄m0hFhF(?.Nk#BcB$KhFBKhIH^#+` ""$$&z& x t plhdOb! FP`q#`F#bqF#dq`F#0 caa 0#$00&00F # dF#F#Or0r[Ka!h[MK+L N #caF #@x3\#+`#ca7iNl#B2"idqF#fq|#F#`qbhF#bqhF#"kF#kF##"##dccc3H0Ka+h;$ & -Jh*%h+N-*Ift*J*H+ F)I&#S&I$H"I oC"#"oCBBUM=;+@  ;IH6IH3 FFI FIF H*%#܄m0T%0#t `cnP00#011(1>IH9-;BIHI "h***! FF31B# I-bi=#9``%(F MnP1a1t#-GmXN"XLYKYO5F#e###c`##iB )hK+}JzrxO'MKTT-F2-DH(=3=#BB0hF0E1H03J=3=#BBѫ+c`0#a0ca0ala##kkc# #kc# #l#d ##"ki``K## KK#eH&H"+h+?n K-F*IH#= m%H%x+T#%h11111nP%%H-A=#yK h+tKitKBsHrHqHt43`(@̀lNgMt4/F3t4X$0Btc0CC c _K/C#Oa Bp `qF#1!G#*+#Oa Bp `1#!G##Oa Bp@F#OaFG#4cB2+#rڀF0B c0 4@F|8F(#+r++h+?q"Kh+K!J!I9m H `!GHh+ FMK"t$x3%F0B54 =%HT22.# `#t%x2JmI"KFM%xL#h++%H-OFM#(eF +k k# #C###+lPppCO` س_𑀳O!г_ O8г@O гOP+F"FIH:Kh#"FIH0Kh[ F\È!FH^Kh#"FIH# FF4#}I}H00S0SqKh+"FvIpHuKh F("!FrHT(F@#C F FBF9F F)F FeKhC`CF:FbI Fp1F FkQKh#"F\IQH[KSKh F JJq FF`(hI"FMIF#C F FBF9F F)F FI?H0hSܠ \ 6HYF0hG FF0HFh-IF!H#CplpfBF9Fpl)FpnKhC`CF:FI F$K1FpbpO O HF##܄2m%#|#3onP#p%#3#܀,-A!KKjh+HJEKiFKBEHYDHUDHt4+`(p?J9Nt48O3t4FF`h %9m5H3o d5c0 B:B@F(9m&H3h+0Dh`DDJQ!3 2F"BBKHmK"t$%H%xT22.#33%h3𵩰N3hIHLM 43"`F $ +`F`(`+h+ dhHJIFHT8K"O`#:hS|54+D~Kh+@uIxFB.3#|5 4F F(hd( (hHlIFgH KOcFeIfK_H 3h:`)aITH`H_O|58F]J;|59;99;9h3`KITHoTH4OKNk"hPK)F"9#9F:I`P"2D3s93hBKxt+0@KAJs>K=H(hH9IF}"b|O+a*iSB3Iph+I1H$HKX/Kh+).IH|-H;h+I)HS(L)H: F7'Kh#"hxCp)#܄m3# `#7nP#ܐ%d#h34744W%H#l4n4T#x%%X%H444#t.45%P%%HR\]pGnPK7Fh F( hH_+F"F I H KhC+F"FI H0@g0#|5CnP#܄5hm8FKh#"O`A( hH**F IF HKh#*FIH$ F8#|5ynP#܄5mp F NF#BB)F Ff(Cy+È5D)F Fp%h8 FF,-)F FK(Cy+È5D4)F F8KFIF{"pI{x㈛IH{pI H{j㈙I H{bZ IH{\[ IH{TH%4 -555555%5pFxh%Fk I; h\A%,F2FIH (F!Fp%P5nPFM.F:FIHH(hCh;C`+4IJhZ`x 0hCh;C`+ & (3h ,hZ`x +n, y, %THnPHR Kh{ H(F H(X F:@pGnP#܈z5*FFFKhL$(%hH;F2FI*KhF(zhHI;F2FHjFH$KhS I3F J- F H IV$ F#|66DnP6q#܄66m6 FF(I(H6 F&IF$H.`i#IF H&i0 IFH j0IFHi0IFH `j0IFHayKJ H)FIhIH F@F H)6nP666666#l77$770F% B5i I F#OaH#KJ2H07S% 47B7IÈmFI^ FC FhF{ h F3 `t q FFhFv m7cpFCy+I2 FKhF@(C@bhH*F Ip@F HԽ Kh3*FI Hp@ʽp7#|7nP#܄7m-C/!F D'O/O ?۱/+'p0FVF`0F*Fh0FFC뀄FCy+I#jI F F# CrKhF( hHK"F I@F H_ Kh3"F I H@U77#|7nP#܄7mFCy+I| F# C1KhF( hH "F I@F H Kh3"FI H@7#|7nP#܄8mFCy+I< F# CKhF( lhH"F I@F H޼ Kh3"FI H@Լ8$#|8<nP#܄8dm-CFxFF.+F .LAx/)!h,HP ;F2F  h'I %#K%Hh>!h#H8"J"J"I h JkI hJ/I hJI hJI hJiI h!h L#h[I N#܀R8x88q888888, I8-AF\FF3'F+D+" ( 0 +;#{p&H&pwH)Fs0F89%%4pmFFhF!0lFE*Oa&)FHOjF (`#xF+K"Z`A+hFBhDB< +#< H!F- O0 mpP7%49:FF FF K!FFh>F FB ^1F(F@%4𵅰~SM,F`RI xQI hOIPH`NI:H(aKI N#ihZF(@K@!h(F#pBKih?+h Z7 *_+-+9H)F< Z5Fh2F5HY#4K+F$F `0F-D/K&hpOȿOpCcE=o+F&AOq hP#"E=!+F hF"+F! h>+FAOq h4(c0` hC%4)9&9o9r9%<9%d0ðFFFJOqK" FZ`*F C09%4Lbh*IH#c`%49𵉰 FJ!FhF"iF H O$B *18hH( HD(F 9>%4p FF F J!hFphF LiFF h*F1F h!H\p9%4"FJP!N"H]9)Fð JOq4"H}O0C]98 FEx--х!FF H@h!FF H`*F!FFHH8@'=== m(7((GֿHpGHpGHpG=;=H=.,L#hC#`(5(4( (@O'`Oo!?Ӱ`OpC C[cò+ oO3FOC KH`S`#pSp Y p#SpB F&F FKh.F I hC `C!+:FII2F J"!(hV+h"^p+hp*h, O3@#FS` XBXA&(&==_ Kn:f*oB² *IImQeppGmm8F"IH8@* < , !Fx4 (" xL[;E#FF3x (> 8@8m-AFFA ;H49HO57I8F "GF"@ *kex#x#;C3#DF"02 *'V'@,://#xk--"!hF"x!FhF.#J(F"!hF"x!FhF4 FFJ.! H I FFHD7 /цm=9&xjm&$KFh+x)ЍH@xKYk HHF!Hx;+2%%%wJwHwIhahi!isHrIhh ࡈoHኡd+   iHiHhHhHhHhH" fH"eH "cH"!B`H@m .g;+_^5201 403OH~G=201 <0 ;:9876543;HRj+#8H##Fࡈ&HB)1H1H8)H4 @*H(Ih6'H"'Ij/&H#I j(hx@P&=9===:t=:> >>>%>2>@K>E>MD>T>a>>CC>??%;v?.-OkN$kOFF0h!FE M<` :FIF+F@F%#"F !"#  BWIjFTI(FF! (NI5DFFLKhFBKHf;h IHv(z44F$O B:0 F4hC-@@C';hy B!0#p!F"h"CFh7+hF*H*K  h{#D0FP 1#B#HZ ) Fx F+FHx 8@0 JDhFHH&&(?7?M&?o??&??&$b&FHKIFH ?;@ nP-GFKFFFJh!`!`I/ hC `/ /lh/ / / h,h h liO ,izHh0FxI#pHF// /@؀rJ1Fh3`F+F ##pNк"Pр"! F> cFF_0_ pFaإW Aإ7BB*  pF3 " p!3 Fp3F"B#pr!F0Fm  O /!0FF/7K0FhjC U/!FL)FFH/#0 0FQFX/%Kh3@F-0FB?F0FG` /Ѫh!F@F0FXPFhbpih h2F I OO@F&( &@8&=8FL h()FL4`h8 tCy ˆry**0D@H@лCOqJHHD&"KFKHKN]DCAD-D!(F((IIIHHDYDSDI3Db0 J #FRL4" Hp 0BB Lp3;Dx00I鹅F !" F!.!hF( I0(p!hOrHVH0&&0EhLh ԍ!(FF`h 5!IOr!H.8$,OcOqJH*,OB ҲOqJH,O! ɲҲOqJ H ɲҲOqJHH0&DDDDKQ"QK#N.',<*Fxp1DYp)D|)݂BsF"Hp&;&"KsFhFOqH"` X.!H0AOrHK"!#x3OrIHex-- Fp@1F`hp@ F+FJOqH8Hp (&&DDx,,@a@m#FJOqHHD&R-AFF!)F0F*F,F HAx+F!FHAoF"F!FHAgj-O$FFFF#"F!"#% BLIHFF(FF!(BI5DFF?HH.r4FBgңh:`ѸДy EYx[SԔy0B 9Fyh!@ , xN! #;C3#DN!01 ) 0#h J#"! Ch JHFI n; f+X1 mZe "p#D0FO?7DDrDm (# ]#!"]-OFM'70FFFF,V x-)0 (((' 5hO535hO5<D%MED |# !J0@F]0+F#J^p ` 0? !J@F G 3R3x Y2 o:D.#/< FZP" ! F50 + FLIFH^L>Lr$F%FFMb W" "5#F*FI0F"FI0F0JI(FR4?K HT JI NL&I@L-L2 K I K K K KF H K FLLWLLLLnPL77LI%hF(FKh* KI hh h Jh3`0@pG 8&(&&@L&(x8FMph+ ++*+++-++hKh\hFI8@FH+h KhKLhFIF H,Kh 8&&D&&H&&L7&(-AF "F1F(F0 I ~FF(F1F(Fb0 Kh+KAFHZh.I&[ B 6 5 H I FA9M&(t 8sEM&=J Fh"Jh3`pGJJhH&&&(x 8&&M3=K-CFhM:H(=!pO0"AFF F #!FOs(F3`Os@+K0 )F(Kh+B O` JFAF(FOc3`Os+`7Ke FT# j`oD# 3F *0 RhFIFH,+ IH Kh; Kh#-I Hp M&(MZ&&&(MM&&&(t7-AF4KFFh+^1Kh1Jh ,V.JhJ,N9F(F,K"A{[,)K)HZh4,'H.&N3h+ , 9F(FA`0ըFB3h#HY3h+H*F9FH,HA AP+ѿ&&&(t&(|m 8sE&&>M(-AFLKFF h+@IKhHJh-EJhR-|DK"!F0FA[-?K@HZh-=H=K - !F0FA?h+-++>"F1F<)H|+1F"F   Fa"Hj H H"F1F#aHVLHHN-HA A+ђ&&&(t&(|m 8sE&&KMnM>N-AFQKFFhF! FO,0II F@O3oBDFe##"` FzB "F1F!F0F(K"Ak5%KF%HZhX-F"HR;h+ - !F0FA,7F%$BH4)FH. A+&&&&&(|&&D&&H&&N%&(tm 8sE>NO-GFhKMFFh!FOX ,R F F ]J ]I TBF4!OO FWI(FyHF1"PF6CFEh"+RFIIx(ѵ?FIRF j  ?IT"0CD"PyFOS#F A01 h8F0Ѵ@ Q1Kh+L0KhF/KhK#OR0F#!F #:F1F#F @40h 8F$+hKhK Q#OR10F P0F#"F1FF @40h F^ M&(INjqNcNt&&&(|&&FF " C-"80 ^:+"FI &KhKh3#" Fg%Kh!FH zHZ{je[KZfkKe[K[KR; N&&&(|&(tN-CF`" *FAFN/"#HHB=#(@O3# FlF r"F9FHFC|M$0 [B2F0I 0/#C#C #*F1F'Kh'OB 3F!$J4## |'KhKh+#)F0FKh1FH>$B H4!F#H4. (F#CK#NN&&D pq&&&(|&(t=N-GFF/lKh# jHB =#(@ǀ ("3 SCO3 (#0FF . 9F &3 ("2FD@F0 u(?("" B*FKI ?&F/FO,,S1F(" F('GE(V #7[BA#V#[BA#V#[BA#V#[BA#V#[BA# 3!+F$J 0#("1F8F (63 ZИE FGtKh+Kh9FHB#H########,&&DNNq&(|&(tN p&&0FF" C -"*0 P0+*FI KhKh3#"(FYKhF*K)FHZh#h+ OR#H0N&&&(|&(t 8sEO0FF "C-"0 1+"FI KhKh3#" FKh[K]h&!F*FF H + H| Hx 0N&&&(|&(t 8K72O-GF9JF0h<5Jh*a4Jh*]+;2Kh+3$"FQF8Ff0,'@FFFQF8FCP0B(FF#F)FH(FG>Kh+ѹJFIH*;h;+  1FH1FH1F H H1F&&D&&H&&&&&&&(|OO@OlOOFF" C-"0 %+"FI KhKh3#" F Kh!F HHN&&&(|&(tOK"𵋰8pKxBK/!ZppMpFD)F2F DH#$J KFSF4ӱ 4K 4J-CFch/J 0K-CF-L.Kh+v*KBr*Kh#*I*H'J)I)Hz(H*(K(It/ #h!k#Hj"kak!Hdal H`#h"p#H( :OrIPF(rPFOrIlT,< psE x&&&(t&&P&&P>PHI@PSP^PoPz&%@qFpp+QFOrH(p0OrIH*QFOrH(OrIHlQFOrH(x OrIHHQFOrzH(xOrzIvH oQFOrpH(hOrrIlHoQFOrgH(hOriIcHԡ_QFOr]H(XOraIYH_QFOrTH(XOrXIPHOQFOrJH(HOrPIFHdOQFOrAH(HOrGI=H~<?QFOr7H(8rOr?I3HlCF;J !(|OrQF+HZOr((HTIF&J2H*l1H$j0H /@^,Kh++KB*Kh/m)t @ HO` 8RFHFOc*Os0(V(0)F0F0oF(0 0,O:@&%@PPPPPPP) PPPPP&(l x&&Dq(chB)jBXFvF(ZF+60F(0mC3أ\Kh34m;3 ؟KhIHmC3Hf/@#h4+@/FU( - EIFHw h" 3FQFHFG# 0 0D)JF)F0FT0  ztKnKiKh#nKh+[mKh+@VdIkH[EsE&*ZZAde[𵅰#FFD="FHpF03F"FFF H`((F@_I(Fw(9FI Y,-H&MFFVF()*hOa FGh(}#4wIHF  FsIHF(oIh6 FlIh, 0yFhK hIh F(EcKi dI(,!PFhF#p F ,#+pYI 0VH@SK @RJ @w !FOH@LK @LJ=F F(!FGHmFpEC]B]AF6K5IXF@U?V:IXF8-?NϱIFPFP4KF"FOF0H\.(#F.I&F-H$PFH"FOF'HD#F%I&F!H4S @w(!FHd& E? PFJ  ri[$['&*[12[;[L[\[mzj[z[[nPZ[[-O F-"F ܳH O`hC I*F ڪI EE*FAFH, ,,OcKNOKNOCKN+;dKF#NK+#C0F@ * /FDFO 48Fg,E8FKYFJKHKKhO tO OFF8+U<B@*  U LUlD7D+ +@j3F#+JO^盛N@ aFr*FjHYF$F P #@PI\X #@P FqR {U<"FZH'{{G# #LKN@"!cJ0PI#!Z# #BRAKs60У! !:IBBR[!$0*FYF*!J0h320n+ ?+ a+%K$*FI`p+ q+K$*FI` K"1hH`: 0h F+F*FI8h  m&p`m&w`r&`&_ ```zKhKhz pG&_ &K-AhF Khs M! L#/h&h+`!`/`&`#0&w&d&_ &-A FZI&"@>\erE ЅT5h27P&$TDMNF/*/h27p9B7h7 "pCJ%\I 5d<F@8o" p/JB ѕBي\^p3CE3F2*9F"p"+J#FB#3 +рK"F!xx}$-\-"]xB"3_x0/ٓvEЧ1.DV$|Fl,7F$|oE5DEH,3B#A$RH:FbED3])J\)ЖF)[)Qx/h7p.0)bFgQrr&]|&t&&t19Q$|Ql|>QH9FaE D32x+Fp3x2x-?ή3>])#KHh0 F&pap(5MJ$N4+S<+I0hJ KHh O2 K J Ih" K`pHhp@ &psEu&a&(F$N3hB&KMh/h C+`Kh"hB3"FI ,Jx!Yh HYh H(/`4`&_X&_\&_l a&`T`_0KO2`H@&b0KO2`H@v&0KO2`H@d&b (LKJIh@O3#`&&p&]b(LeKJIh&O3#`&&p&_0b0(LKKJIh O3#`&&p&wbSp(m#$$Kh`$+++J ((J (+Xh F !KO2`7hh,Fxa+KJhK.FFNDKJhh3##F"""YhBFћh##0F)F(F mpbb&&]bbyb~&&H-GHM(O2tK(sJ D(pK pI$`!FnH0mKhC$lNlO^hrdMgNiO"FF(Q#x 3h#+`+h+!FhI(]K!F]Jh;hhqZKZIFhZK(FFB!F WK#h[ )h)RKh+OK"h`h+h3+`IK`3hK=h-V9Khs4B r3K"` HMS$h(3K*F `)Mh.KQ$h.K.IFh.K(FFS$B *K#h[ )h)%Kh+"K"`h+h3+`K,"!"O aP$;HYYv&b&w+Q&*H&\&&ct&&H&&]byb&_ &db ȀȐ-MU)I3h+F0+hf( K" Hh0UKIFhK(FFUB K#h[ 0)Kh+K"`h1 030K&H&]bby&_ &d&w&-G(mF#F%%Kh`;MKO2$`++HJ (EJ (+h F(mN>J#BF,c,a,PY&,4KO2`Sp/2HF(x0K*F-M(FF07|#z)FF;z&I(F+x|+(FF KO2`FH(%FF$#BF)F0FKt FG,#NO Mmg&]&pef e|&frfe-A.(+MJ4(JJ,(C;R#!B#AIDx|+ ;KO2`i9HA($7Ih*6K6I` !F3Hz $/M1N2O$h1;B43h+1#(K(H,;FR$ pF)h!4+h+Kh+K"`h+h3+`K U K"`B(bbr&ff-&w+Q&*H&Le&d&_ |pFm00L/!(F FA!FOb&(Kh(N F1h1hh;`+ t hZ ` "p- #KJ FhZ" FTH!FK O2` 1F c M H,`>B#+` mp&T6I&_\&p&f1fD0# 00=7KO2`g(5JiF;+1HYhk(F;+-H2Fh!F)HXF F!F FD- +!HFh!FH=F F!F F(-KHh-+ Hh!F! F!F F KO2`0&fkftf|fff&pf&8(KO2F`н8@ KxF *x K*h H8@ѼhJI`##`8&&_p&pff8(KO2F`н8@ KxF p*x K*h H8@hJI2##`8&&Y|&pef(WO2K'((JiF(HYh( Kh Kh# K Hh HYhr( K"`]&gg;&_l&pgg:&`(O2K'((JiF(HYh@( Kh Kh# K Hh HYh,( K"`]&ggm&_l&pgBgl&`M FFFObhFoF$BObV$hFBOb IhF4iFH(K"` M j&`0 KO2` (JiF.(H]&gt0s KO2` (JiF (H]&gg0QKO2`(+JiF( JiF(+HhYhq]&bg80 KO2`8 K"BhF`HSIhHN%`8&&_lgg8C+ KO2`8 K"BhF`H/IhH*%`8&&_lgg80 KO2`8 K"BhF`H IhH%`8&&_lgg81KO2`Kh3H@v&&g81 KO2` KhF!F #h!F &&#0(tKO2`Lh H|F!FH F!F F&gfpJ(I0Ft鸱I>HMF,_#x+\ЗOb)F8Ob4I!FObOb.I@F$WO)N)KhF`2hOb&I&IOb@F  >%` M+hC/! F0(`,`+h # 3h Kh;0%]I0>3 ;SxC=#xcUI F8)FSHz;h F`#=;1=1Y+h#`6 a "!NTCKN1F(FxO#Pl퐱 (h?8F2F)F7H>O4{ `4NO43O܀-l(FO V #@C)ii;hc1F@BXJF1F FRi3HVAFhh!hhVH;hi*i#i[ # F($ FO4il&qqqq&@rC&_l&pr;qr)& +21HI L h(< I   h(< Kh <~K~IhyKhT0$wHyJyI1h 3(FvI6(F'3(FrIrN1(F)FpH)FoH#CcLeH!h #iI(F h#$fIeKhSeHFxcI(FaK aJ)FF^K(F^J^I &%IKYM,FBKh3AK*FTI4hBFRI8Fv:Kh39K*FNI4h2FLI8F|JHD0GH *Kh+)KBHh @%"(т(ɂ2JhBl0IR/Kdx|+`! +I 0+P&H1ri]&b&_l&prprrr&rrrr&cxs sppcSc\s)=s=sssRsmHse&rmf1K+\@#T?КIBp@E`?ѓK#Q?ЎIBp ۍKh+KHhK#Sg?@F?}NBB}H|I|IyHQyKyI xI  wKh*uK@auJuHuKhB XhmKpLh ```nK! mKhFOx +  # O0cL-G!h`h`H1>#"1F``h^2hchBFYH .h"+- &"#`NKRHZhx3hx *33`;* LIPJH *3x*-DN3h#2h:F!("hF" #[ +FBr # # #+r #O 'h!`hB{ #F:FLF(# BA# #b :F!`hB8Hq&&&_l&pssLH$ ]&$s_!s&,L&&Xtt"t5HtG&PtlKh˱Kh#KEr~K h# 0 Hxh+?s-?o3h'9F,>(#,.`*1t#@0s)pt p+?%-?"''#+ͮ!h`h(eTH|}SI`h QH/JKhK@LHPgEKh+IK)pFKhFBp q:KB&#2?F)F F#a#G!F0 $Kh(IF F#K#+rK! # 21H +        *&&,&ptyHtt&&X$tt 3 #GKhB##16"%}####|##t# m&p"IF("I F#I FtFX"I F(#F*I FHxxk" I FF0 FFFp@͸ Fp@nUndnhn]u l-O]F S3FF%1FPKȹ !0F|(0 "xFJ3h20[@((8FF/F&FF(@t*I; "K)p$[x+}I#(P{I(x*+0! ")px-+0 ")p#Bpx/*XZx**3 ")px+WK#CUHTIб,"Fb!F(?lO3 x+e^FI kFTBI@I?HI !F

'I C&I &O>%M&N,-B):!R#~+h` #+`R#4hLI F #x|+#3`+¿33Kh3!F&4&5}&,L&0&r-AFFGI "F F3h(F#F<8D&YP&xxy&_l&RK-CFhPL/}!:F hAF@! h0w#h9FOzw#0"BKh+ο"<#[BA#!  # t 3pOzq!"rcB7h+)HC)K HxH@=BF hbCF-T*F!8Fp:0Н90+ "!8FC<-""1F h(H. h.O3 #`h+ H&_$&(&z=&S,zz^-AFxN xI#3`vKhFD*@tL"`e*؀`pLeoKh*`"h`nKhF)Or(")q#0hK~ h3ScErF–F~`JxFsF2CEB FBZK~h3SCErF–FSJ~sF2cEB FBMKpMIh$!$!`JKh(!(!`HKh,!,!`EKh0!0!`CKh4!4!`@Kh8!8!`>Kh"%I h h"K ")Fh H*KhKO2` .- @(յObiFC( Kh  & # M0&z&X@&zz&0L#!FKJhK)FKhTKh3Kh+ $$$KhB ѓH( БKHhX! F KhcKHhn KO2`@KhBхIH((! Fo!H~(ZI ~K#S{H(F xH(  x  Fq3kK#S%hHs(F"gL #h3#`q V k k(FLQH##`\IhWHO(!WH~2F(@ĀUI MPK:I`QKh0PM+h; +THKIMh@ +h H(@ 8N5L#C#"#($'& hY`x ( FOFFF# FBvSh;S`+BH]#"#p(zGwjrm&,&Ytf1H$&$s_D{&=P&&&X&_X&&P&| qM#Br9h# 8h#!h[Br#-#3B# Sh;S`+- \F , [ D` Sh;S`+( DAF ,ЇO3,+ ,сL hY`x F#3B# hY`xuI#Bp oK hn ZjK# hdh +fKO1O0cH[`H ? # G# T ;SK#+r fMLQI h~!hOH )XCLKh#R HKBJ!0??!V###0/1Kh2*F6IF F> !3H}p2KO2`'K#+r P ,I +Kh+?   +  L h(O3#`  ; + G K! ` K`KC&p&X&| tl||R&Yt$||&XH&{&]&(&,pGKHh.&p|881KO2`8M"(hF H KO2 `8@ ,8&&|IFFH }@nPh;`+ڊiBò + hZ `ppG8K$!F'FhݱFFE2FFB1FF!3)Կ8FO0 -GFhF6I0F@F ,j^,А7.K.J/LhF.K)F-K.IFhT `+h<+F0F40F!0F0XPFCF ISF2F<,SF2FIo h "PFh8FAGCh "Ihm&\! ~&p~~~k=L=M#h.hx!*$*:Jh1)!`8J` !`Z"`x5K!( FFFF2x ) ));*Jh)!`2F !`%J`  ) 3 x )")\)Yx3Y3 { F{"/ F8!2 2FF*`#`h Kh*"`"`K`0F&&Yx&&JKp`JKL`"K"``KhF`hFF(h#h3#`p&w&&4&Yx&&&8FHL h()Fv488 F8 8 L#hK H I J0 `#hOaHhK*F4H&DL&DP L4S H I $04OaHhK*F H&DLl0&HT-GCODLF;hk!hxF>I h hR#OR:I:H0(S [0!h !F !h,H؀40+(N3hhhCF!h$H !h#HCz;"Kh#!h!Hp K  ")hHF` "3hh2hhhGKh++z!h hKBI I &d&p&wmR&hh&hF&&5}&FI V "FI N@hBi-O!-FdM˰#`h1t#@0s:Uk{4TKx@8۵IF@F@{P:FFOFFFCJBKF?K'&?JOq h;J{EF YFYFF@F.K.J DFKF-JFqDOaa@FOaaF@FF q DKF JDи @P1.FF@YA.&LX&& &p&4&,1H &j&V&_l]_Pg& OB2@uS!0@3;@+r dI3B2O0 CC3BOd )  FpF@1[OBA /CSv@3OVA NJCS)FpFJK#+rDnGIug/v-۵(Br"ۻzhZ`x B&HO0p$M pc`nCh;C`+C!hZ`x + (,(\(`nCh;C`+~BhZ`x B#+p#x+? L h8I&`hp4 p&L&L-OFOFFF;x+2ЛI8F,L`fHh+&9FHT!@+.!#1l(+0K(F# Kh+ـ`n ( ((+JC (xI0F.(=yKtIh8F&53.!8FFxXkK8F*FF[].!0FjF((_O0F*F9F({]3G(@ ((8(S W(HHEIZ(ЄEIRcnE(=H=H!AS(0+0HcnBj( ,H,H2bG.(0+HFE (`nCh;C`+ (hZ`x (KHh IHXh0 `nO0Kh*$ KHh&c|Gw&L&\&wrM&p~&_Tj'#LOZCLIk 5U`nBh:B`*ABh x h2@ BF#+p (`nCh;C`+BhY`xٹ-K`*J#"+IhB/FA`nCh;C`+C#K$Hh4K%J0K#i3`hZ`x (KFJh, B30 0?30p  K Hh>:m&]r&g|&w|&p&_TKhF;CI FpHK"Z`320["I FK"`I FV K"`I FNK"a I FDK"Zar &]l8#h;`+ڊiBò += hZ `ppG?K@Mh.hO3+`=H(Lў;II=H:"T3 F</*AЫBG3+ 2%J%Ih* F"J:OTm..,&ЫB,3K JhJ:OB3KBT3 BZO%BT3T2sF3FF"T&_p&wr&_& pGFFFF1F8FF옹4 J"`,J"`oO0#`8FHC\ *"FT!>BNsh;s`+H ( \K#`3hZ2`x +0竉o#` ##`+9mK-CF MFFL(F@sBF!hH4 JFI h #UqH&RCm)DBKI h0F:JK8hhhhB;`  &w&pb~m&&-Od FFFF &u #QF@CHFP@BIh2F~I(Fd}Kh.3Й 3FYhBi+F2i FiNCF # bh#@C1iih0@BgI `4~ a`dH"! FGF+F^I7F^H@! FF0*FWH#0UKhF* !D#[Br#IFRF FAFI8h$+ gO 8,hA+l*F>HO7|d!8F#h t 3pOzqPD r!K`>Kh<=KO2=O&`;KhBq9H\xOR7I8H6Khh6Kh^4nx$#=(F !F(F#=(F!F(F| F&0rl&&_`&pmF&]ftf|fff&_&\&&]&_T&w&&7 13H޿1hGpG&DKðh#Kh+Kh,~ L !F!F H{&! ! zHwJ1 wHwI !<hGrKrLh!h)(F4 FhKA,lFx@+-hN#hx# h#hx;#hx,+#h3#`#hx##hZ"`"pVM1h1[hG(3 F+~RMSI(hrFx)hPHPH F*NK!FFhvLMBO"FOq0F(nF3h)Fx3h33`x + F>HV3hZ2`"p(8N1Fxd3x + F1H7x[x,+x +3x#Z"pNJ1h[hG F3 K1hGJK(FFHC&t&&&pD&X&&Gw&!(|K! `d& IK"`ӕ&pe!KH`z&(& Kn:f*oB² *I뽚mQeppGmm-OL" F)F hKn!F"O&FO~")F hn@Fv;h{PFF Hd>"Im&D&p&&H2! ! CF1Иz BH! ! F !F K/!LA F<A!F" F I H IIHI 2DnPHK"sLXhI1N[P+x;(F)FFph"IphK" h0n+Hp&tD&FL&*P" HiFk0 Kh K\AlF Fl(!FHH<&4DBF K!h F^!FH|Hb. &V[ K|Al#x[ FK!FFh6 D& K7FLA/! FpA!F#J F+F0DF pFx; +SF + `F+FKt , ,њB10 p3x*pB-OFFF$[$`IF@FM7F;F2FHIF@FB$0;F2F4>,FFQFH4ӣDR 9,**)Hs##hHOxjd-GmFjcL)FcMF haK"aI`"aKXh`K"`Ih"  h # 0"  h*h 0*""@ +RJ! nQHzPI HLPOF FF#h" f0+ 0O2"@"h 0*(d<2Fp(ѝ 0+ + +p 0K>1+.HAF6+J[ERFE&H##`"FBHK>1C F`HJ! K" IXh)F 2 m&&&(`&t&&&@&ӱDmq&H&0ŰOr*H(L&H$H>*Or!HsFM ! F*I rKk)F hzh(݄B!FP / Hh FE0ӱDK-OFO"FFXhIO6I (J!@F8~K"~IhHQ<yKn!xK*"h6hkD pLbOFO O kh;k`+(F"+hZ*`x;h+kCi(Ѵ1(ò (1ѓ ( c.1K  bY + ѹ>1[KHAF1+n1+(# 0=K"h *\8h  *OOBс~ +)K1 F(FF `K>!B>(13#Hf#Hf[K" IXhBJ! L HH&t&`Ӆ&@&&D&m&&H&p&ðOr9HF(j7K"7IXh! ! 2J!(F0K"0Ihb-H'&' (F<FFz(݄B$K!h ^!F !F H F8K>1C `HK"IXhJ! ! ! C&t`&@&&&$D6&&HðOr;H\F(n9K"9IXhn! b! ^4J!(Fn2K"2Ih~/H'b&+ (FFFzB( ݄B&M!F(h*!(h& !F *!F &HN FK>1C z`H*K"IXhJ! ! ! C&t`&@&&&$D6&&H0LF hI(FJ0CchCc#ch#c`! hJ! 0&S&H0 LF hx I(FC3#3! h 0&S0Or9HiFv(k7LhFDcy#cq3K"3IXh~1.M #10#00%J#01 1J #11 HHd1J#1!K`1J# 12 J #22 HHjA0@D&tS%&0"LI hF h"I@+& t{ tzF,8 !*@8F F 0)F(( 880MGI8(CH{Oa@J*F=KLAiy&P"IH HDOr@!LH( ` IH8OriF HH$ KhF!hka@&&4D0P"MIHLHQC+#FH%(%%Or@!L H JOa5hF J)FhF M0&&8P"IHFй HI( I H8@y L*FlBn1+Kh8@Ӿ8&GwD&pP"m I!HN(7LHQNC+Hj*(M%%sIF\F 1FHjKn15J5JOahFjF I F mp&& GwD!)FIH nP-O(F@K&JO~ OO54FFOQ``9`KO J@FlBF̀Jh*јIHPFTe+F+<0+9+@E+&Йa+`c+cP+@Dn+h+|l+^f+@UFp+Kys+jt+}рJ#O1`J`Jp~KHFr({IxK"yIh(F(f"vI(F(atI(Fp(^rI kKpIh Fd(XnI F^(NhI FX(JiI`Kh`n]KheK`#g0 bIWK/!PF WRF\IFH2QOKh8`KXK"`GVI紱0; "6>`<>K[h+8:O93%1O5.F,$*F(O4%GJ5Nhи  BIAIS"PF@+J`*K 2K%I"%K2``p4I 2I 0I .I ;h,J !,H>+H*IP0)IL!(Hl:,L,4HHGHE&&&h&0nP&|&&(>DN6p&t}&0g ^ 5&8 /m!H/k K-O ! R JRh "!! "l"K"!:"FI6l9K"!:"BI6bAK"p:"@I6Y/K" "K>1=HRFHO04('8"! >FO3 o =F#FO " pCO jF! )]FDKFFZhFAHD#O2c`(F#o0?"(F BFC?2H ().H$%F%$;F2FE(H${FRO3d+rO BpRO3dO5U O`)FXCzsK#!J 4DDI, ,." H, HlD^mtmKp[h{ (HK #O$$.F)F"F A$DZ H+ H  J! 2F*p&zFF+ * *pG#\Ա\.FRa/٥A/ #A- 4B3O0FKOMO`,h,` ^kh# Kh {  @ F&t&&HF(H  @GF!D!FhTJh3`pG&0FH(xNuh5!Fhhȱ-h ! F Fh` F!0"F I`shu`+`h IhFh!FhFhhFp/&0PBF@/Kh# F@˼O0&08F F@Kh+)F F8@[8&0pFFF(`+` 0F ` H `#h K#`pfFp(xX08 Kh# F@&0KhKJ!hJ!i&&0-C FxF#x1K!FYa@F N' M J1h/`NJ F1h/`N +hKE F&0&-AF]NiB[K"|`(ic #ahJJn(A2(:K(:(MFKJ(7؆(E"A(2а>":_2ذo*ذo1 "-o#а_) "%OذO "aOа?""""" " " " " """ K K` K`K `#s#xC#$0#%0"00  ĕ!Va &0&(=,&&&&7 jFIhL00P#` %H Hx( `#hL+޿K"` %` Hr Ha( `#h+޿KP"`0@th&PV& 7($LL,(!(;H((4H( ((*H (((# #L0#M0H.HHHHH8#ML0(F 0&0Ybk\_ehnq-C HkLI#`BFN(H#`#`9M HKNF`HK`H(`H0`HK`HK)F(`}H"`|Jh+`{J`{J`{J`{J`{J`{J`¿"zK`zK+`xxKp)FxHwOtZKtt)FtHxUKxtqKh+pKhc)FoH|)F|mHv#|44|4FK|t4CKt)FbH^ ax#'aca)F]HS3h`+x#`ca)FXHFx##caTK4)FSH8RKxt""'N`MICbKH24bGIHH4C#4bBIBH4C4b:IHm>N(F7Fx{".hFNF0FhN.h0F00D(`1F2J8F0N)F/HH(FFx*K!.hh:NF0Fh(.h0F00D(`"O1FHF:F)FH"Kt)FHN)F(F7FH0(F1Ft2F8F_4xK"`  ?ʃ&H &0Nn&L4 Kh3 K JxhMZ Kh3KJhMP#4&0&H&&lK!J&0KJhK޿&&0K!Jѿ&0K!Jſ&08Kh;KJhK|MKh;KJhKtMKhK M$+hB 4qK"$8&l&&0&H&,pGFK!NJ!@y&0Kx#KJhjpG&0&Kh+ -&KJhKN&&0K!JiB&0L4J!M4YK!JMv4 K! JMj4K!JM`#4&0BKhCCH@ `pG8LFJ!M: J!M2j J!M*+J!M"T8&0 Kh KD@Ǻ{ F@&&0FK4X@0c F@&0FF#XBXAK!J&0-AFFFFR PBC?<!!H;(!FH3BаB (!H'!FH$=-$XX%GCІB5B5^,AO2"H!AʇʛʲKhb``3BpG&8CFL#h3!H%`8-GAq L #hFc#[BA+r[BA[ hVCG%$O Bt!hB#BBъi1! h!YHO 5D& KhJhz$ KhFpG cpGO1O0pG! pG&&l-ON5h-L,hgB#BB04iB#D ? ; i\E#EE0$%iBPBhUE0?.ЊL"h$ՇJRh* BB  :(I $O32 $ O2#kh`ih```i`alhhh`h`"Fai `i`a($,4RBB[i J ?C?ЋEzc#EE 4@O [FRF0?IFLH}FKhcEKhJi"DwO2`3h4"D=I\wR1vF_(AF5HmFI3Khc2Kh(۹СiJF!D1%Kh`# Br#iKDa[$Kah+O=,A H .Kh+>Kh밻K #BBK#BB$K"`O0R&&4,p7&h&j&<&(&&&%Kh+3hhB"hahQ`ah `hh hT`h``h`i`y`i`a04iBD ?  `O R-& Khk,$(D04Q`@@@O1O0&8L#hO08-C#hAq0$B2 bE5DE"0$8&L#h+$KYhI hDO3#`"K`hbg6? H"Z` M0+h&&B&-O F-NF7h/<-t C?ЩBp4i AA`cDEME?3irEPEYEВhcAs@0T MEt O3hc#BrN0;h&&p! KhhBFEBt3F6hBEa E0p p&Kh 4dbB?L@Y0#h &&K-h0$ :)l)p'$7?@62iBFEOEФh1Ar@00$O0pG&(KO2 P0@(X`pG"Z`pG7.JhF+T$cO1O0GhO1O0B$hd#")h`#`##04cEU O5O4E4#4$#"0?!FH0@޽0&T#"#@0 ]KhbcpG&-AF&MF&L(hmF `Oa #"a@`` d#a `#a0dO3O24O3# 8F0"h4#4!h(h4#h$2tA3&(&KphF-34 $(hBBhhZ`Bh`$ DS4 0h$O34pK!F`Kp@hp&&(KhpG&pFFFKh;B? ;^+#x*+cxcxSn!n! F4(,F,F#x*+bx Kk* d* " s*u*""""4`4`p&:0$Bs[mhB\Q3 BZ 0 0J!8v F '?S9+0+.+ b+ c+! 0;4F!H!!FB H! D-$FKB&dt&pFF(x(M)h9 Flh5M)hi F8hkh k`p 5>H1FT pFpˌp 8I38H!(W5H xqN3 r~!(F-HF,H~Fh*HyF@)K$%&h'Kp&I Fx%I FP#I F("I F(!H}(2opLppB!HgH<JIH5JIp@ˡ˭˹r&& & KSypG&òJ+hH yJ+Ipfj+ ؃@D$y J F !p! !HVH&&++++(  pG pG pG pG pG pGFx+$F( (* O1۲Bc cx@* +*B  FxF8( (;FHx?@Hx?Bx?CHxx?B2x?C)Hxx?BBy?Cx?B2HxKy??BbxCx??BCC2 y?B4Khh )k`)poO?jc?`+pI?O2ib`*p6ODid`,p#oOgig`/pqa)p?hgM`ph?dM` ph?bL` ph?cQ`phfZ`p&KpFhh`)ݔB( x4%B# <)#F x&B F4FBF ;)FFF ,`p&IH2Bӈ"q0 pGI6B@a! pGJh RypG&(8F4I5Hfa(3M+yՀ@ !yY۲-JF!pI F(#F! !#H,,ٴoӴ?ӴӴo4## #Ot####+OI,с,A"@q:@ p;? bZT,1C,AH8&0&I3B"jq pG)J#XBdhB3 +  @*-AFFFF5WF0F'#+`0F-F88Fz(` `O1J1F( l# =0F(##+` ##`8F&PFFO1JFh$h3F*F F&P7L%F(8HBiF`+2s88 8D80&P((H8HHpG&`CsHFxI %I F( Fp@HF(x+! (F K J)F3FFb FpЌrb (Й~8FH Fd J(#h"Bh h[h2h*I(F$h8ТЯsFhF F!"(F*h#3FF FpFLO8MxRhF(D:hB 8e(D8,F8xjhF+8L8B&P&𵇰)L8BKB+K DB$O& (FD(;hsc ګB"DX 8(F|888+2= &P&%LN 8#D(3hscx4D,+x* 8Hy F/p&P&7 L8x*6hF(DKhBF;B8[x+(F(M8D8}8xchF+p8 0&P&pLXB p8\[- KO2 N`8Bx+(Fp&P-K8x &P8 L#x% X8O2pK`8 8&P-pFL F F@sBB"Fu pHYB  CB;;KO2`[0 p&P-sFEM& xx2F!(F. F F(6 Fp K"8p( (( (O2K`pG&P-K"(( (O2K`pG&P--CFO L/+x:F!FB %0C838830F1FHF0F((##D((D8F&P&s L% FFM<Dx3"F!0F5(Fp&PK$`pG&PpF xFDhBh.p! 4F0F>kh%`c`kh``l`#h`pL$0!F$8"a&PK-OFhL(&A ɹ*ON08(X 8-++(F }+08Z#DB0((o("X +'d# 8$ h# 8x7#1F8(Hh(B.@?$8+IB !!!(F (F}.(O^((@48 ~(4(@48%t(k.( (@48 8( (Obݨ(((Pe(48B488x+ +z8x +@Ձq488B@ˁ< + < +8Bط#488x+K4848(F򚁟#'48488B@< +8B@< +@f< +|^8Bt48488x +8x +@cs8xYi#8Q$I48K`h*(R`H -FE RFHAF,(K`F2HAFeH8x+&&P--48N-@8(K"8(>8xFhBuK8x{BFCٙ  *lKO ~[~ 2[FFE-ٻ#Ѻ B RF@F O D ## B * O #NFγ@DG'BD@??1@AA_@EBCgAG'CA@EkEYA?@+AC?!?cFuFuFDB@MFFBIBABqBDG'G'@A{DDD7B5@G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'G'9 #"I e%&&&ш&P&˜#+rJ`#+rrKFCKh V"!#+rJ`#+rQKF""!X#+rK! Kh+ #+rەK "FT#+rK! "F)#+rK! Kh+1#+r+~K %#+ryK! "!`iE#+roKFmKh+ "!`i  xF=#+r;`_Kh+ 8h"Fe%%#+r;`8h"Fd]GCo#+rDK! _+#>I+r#"##c#8Ie+rd#"##c@k`i9)pT+#+r$K! #Kh A H' :zKh3+?ӫxѻ"l K`(?d###`#+rK! &h&˜&P&j&(&B#`#hCs#`#+rK! ai m%%h%CC %h%CCCs#`#+rI#"#ai A%`#dzKHh`"d0+@J IhKh+@}EѮ|Kh{IFyHmyKh)FxHVxJ#xI h@tK!h!q!oHL#+r]K !`i(?t8 # _H+r^K_JFA="![H#+rEK !`i(?d?K QH#+rKKLJFA=#+r5K! `iFDH#+r,K! `i'F ( (.&.&0FF(0>J% >I$`hXFC#AIF(F)p=K` h*߿;KhrRF#7JhMEOp)Fp3Kci`)p*K` h*߿'KhrRF#$Jaih D`#K"`ch+(F#"I0FKh#cOS OsOsOc#"hS@o`Kr&&&mўyҁ&t&&&˜&&TKh0pG&FF #O2B@# 3-OFFF@FhDFJ>,F VES!2FF(BZB:<6*+-!+ 3B Zxv( FF F [K# B8FЬB< +4##pd@O(; FChhB0x&xB5\[x+?g+&4#`\xg,K,F,x+F5,$O,L34d+hf+d##3FhZ`F`XxpG-OFF !FXF(G>D$KhB:#KhB8FU5iF0F(F8+d$դ +d$z,#@/d$d,- =p]0  F&&&hF&#M2?iF(h`L&hf(hbhF0F h##`I"#+`##I#p&(&&&-O FFF0F F:8`F&K(D%Fx`zhB(Ҹ.ݡB 2FIF FTDO"x-PU% xB *%pO%4--8F F hF DkhB F F4x*ИB( 8 8 AhhB9 F9x*hB,2B;pG pGFpGKhF! h&(O1pGCO@*0F#W F)FF('Kh&HAMa(D(;O( A()o(q("d(#/Oq FzpK` ! FM#"(`#0? (hO3+` D! H Kh+HAM F0& iӠ-GFO;hB_i;hF;hF 3 (F((F~Kh$(F[ F FT2*#iFB=F&(FFF@F~F+vnI@F(mKOhmkI@F(O3ObfI@F(O3OW@FF ^Hv2HF1FtHF( FPF"0FB (F3 PF(0F*A GKhO F((*?HAm Y(O%0K(F`0K F<`Z`1I8h0KAF"/L`R-Kh#h PFH#'I##%I#%Kh`#MPF/h#+`#hK1FhOKh+* HAm0F *&(&$r&j&L &X&p&H&&&&,&d&Kh@&(Kh0H! H@&7r-AFOFF Ft}>F= F(ѽ;h,F &KF"h&(K" `&(KFO2h&(K" `&(8F$ F4F@B F8@C 8pF F F F(F F2E"!0F(pO2!(F Dp-CF!F$%FFhF!FhFJFOFFAF;FX7(-mF8F%0Fe  O(F9h;hB0FX F(F&(=KhF } F@{&(L#h;H `K#` h&ao$%!F([x0s+4 F@0-G!Fd OdO FF{h;{`+8F (F$C;hZ:`x .+2BOH!@F!FFc" FTFPF k# F+pHK(FԈ-AFn!DK"xxBFI4F#x xBcxB4#x4;5FFLF#xk/:FAF F"FI0D$0FoF0F_8FkF8Ftx+x3(F@F@F F(F F&hrԧԞ-԰-FKh#! F3F!FJF(FUFx)FFF F4FT8FR(FN F &hAK-GFhFF+j>Kh+fO0;H(]FxF3|*-*F3IHF(K(F(!.HVA(FFHF! D F*FKF!FF PFFPF5%е@" c F( (Fsx8`O3H3`0 H=`4` (FF(Fs#x+ F&8&hr"K-AFhFӻFsHFF\(HAݽ0F&F8F"F@F,D4!D F:!F;F2FF(FEF(F|, FA&h0iFF,(pDC\B\A$(FT F'00gKhFFz`(F!0)FFcVIiF(F((FF$hpCO(F!*0)FFc6I Fc$(F F'0&L00F(#" F#0(HpGFx DB,C/*F FKh ͹&8Kh 80?o[Fc? FrBB 8 8&X A1@()4 Kh"`4pG&-OF FF08bKhB aKh+۝B]Kh;B$[Kh#XKh;B}oBB@(@FXF$Թݹ 0'&-9F0FMFr?F"Ѹ!Fcй @F0?ЪE3Q3!FP83K h9I(9F0Fܹ0.Khs? )KhC)Kh+)Kh"(Kc'K"` #K"O0`OBB?{9F0FOUm0F9F Kh($F Kh HSFOb&&0&,&&&&&0 KhS Kh( Kh+Kh8pG pGBppG&& &,&-GFFF @E<KhE$$$EF 9F0FFs?FѹEE9F0F4,UFKh O0Gv&&-GFFFxf`S (G FoFb? F0KhK%K h9<("OFO  FF poFc? FG%$#"F+F@FS&&-AF FFpFc? F AO0`QЍ@+F"F8F,K(FhB pG0K(F@hB pG0F F@޿FI hB F`#hbh IZ`bh`#hBi:ahJhh;`x F@v&(0&KhpG&FN F4hBСh8F$h\0! F8F O3O2###vca`K-F+h(+h`\`+i,`3#a#hBi2ahJh3` F0&hpGipG Ʉ 0 FȄ#vpG~pGCiDAapG@ipGhpG`pG-Od FFf?FO0FKh+ьKhKBh+#O3Dp F)FF F(сKh+)F F(/F&F|KhpA (\7F69F0FF 9F0FFEx0@KFBFl H hx;8#CF (Р HO0x , F FFJaIKh+CHKh(?  dt9 ,O3@2 F%:J8Jh*0; (01K"` FF `tHFF !9F0F F(Kh#39F@20Fo* Kh (Kh (0Ob F)F&D&&&&&X&&&-O~OFFzO0FxKh+ wKh@FEz ! (oKh+ jO3RF[F4J34!FF~(bKh۱F&$ , , (;h (0;h (L@40D(EAN)F F3E?F?w5Kh p#3B (# (503h3@2@F0&K"`3h+$DF4Edt#[Er   !FF Khc##B*  F)F &&D&&&&&&XpF? FFGB ( (5D KDE65D0(&KEp-OFF F)FF Fw('. o##F F0F^ $#FpB FQKh+ Oo)F FCF0!IHO}FoF??FF]Et  =N;)F FbF`? F6Bڸ??ЩEx0KBFh##8KFj)J#`(J`%Jh"F#8+FV7F3h;B)F F FFa? ]Et "# [FRFwXKh: K F)F&`K"Fh#8+F&P"&&&&,FF=Fc? FhKh)F FK)F Fh/v F@Kh!FHHag&P&DehFN]е(!H@L7FF"h:C?! @ h8BBн@¿нՃ&p FFFH (0 FFKh)F FZ2F)F Fp@&PFF0?!HtFc? F! H@ ;F2FBp1D0Kh@՞չ&#F KFhBKhQBKhBKh&&x&&F KFhBKhQBKhBKh&&&&-G!LOH8F!F8FFձرBF(FIFBF0FQFPF^HF\e`` '`(FP &,K(pFFFh#F (FO0p (X F!Mh( $$+  pN(!F(Fh1FD 8hhD FD0Fhh#0F^ DpJ1FhD (op Fp&&HL ax K#aH|`ax Kca!O`!``O`}Oc#``&>(  pG K"`aabZbbb0 ZcJh "ZcpG&&FD F=Kh0DBh!F:J (_=-Y2KhF .(1Kh++&+:F!9KFBF60c%Kh+(0F 0FFi"M)h DD D(hKh DBt" !( :F!F0Fy$$$ F&x&&1&&`-GƲZLFF0Xs!##0 .QKhjNM+ #00MK5sGbC+d(@EKhFKFBF j>M)##d3`%#+`O0KhK hpGh+  pG&&H x K"` L$FB #Br+F"F#_E#Bt+F"F#E#BtF`1`pGBsFF F )`F1F F(7hh#k`T F*A J!Fh`^` FEMDB "F!(Fz("" K I`F* h* X` hC` O0p&&hh@ @h0 -OF@+\+YF! # [$ [BrF#ME'TJ#hBME#H[Br3BQF#)ME ! !h#[BrF#  BظE| H"Fi#hh8'F9&K"``aZaaapG&K-GFh lL&j^##bKh%O^(F TF??F PFIIF@F(FUF;h;B3&b&&&|&1K-Ogq?V-JO1O0)Kh#O%Kh OF9E*HF  Fb? FPF#BtC?ЏBv )F FHHF&OFOǼ&|&& LF H@^#j [ #b@9&\8Fh h(FKO1 `O0  8&H9H9FF Ki;EBBh  9-O FF##d pKh@#Q? НBt+ A+ȿ )F FĿ3 #C#3B#/#C #3B2#'F.F#2?+ȀEfKhk[+[Bo#8F1FdE YKh\$hD+D, $$PK 8 [ h+D!FCFF FPFB[F FF(FJ#@H0*F#  Fh! #F``#1H0H(@*F #  "xd *F8F1F  u!8Kh+ *F8F1F  ](FPFk`^` (FPFSO4DF F&&(&x&`& 9&&D&-CFF $`!L$h!LEc?KIEps?#нBtL#hEBp t?EBAh !` Jh  Kj+&9&D& KhFJhZ`h$#H`@V&&&8F F #x[ KiFH#a=*F!FHGK"`8&& & H@ & -OFFFF(004,0 e8+0F9FO (рE#  FO3O2# #P?a?НBt Bpc?]PKFFhCDt2??BpNDtBvBv#FF;Kh@FBvyfFFO FHFQFb?#2? GE4?6FF#Br8E5FF0F9FO5O4 #0"FSC+FB(#K C #?ЙBp K0b 4b BpBv &&0%Ec?olO3F F F)F 0"KbKh+ѽ@&&D-GFFN xCOEE>F(@쀆KhF(߀*F(׀~Kh+@Հ;j+@рF(tKhF2 #3by;h+ =Fs?F9 FF2aKh+ѺFPF+IѺ FXKFhFoHFFFF #FFFO'&F"(p?0EO7O6@FFF@FFFq?rg?q/0H+O0L#0FO2O39FO3!NF80h(, kKhC0h( F !H0ih@P!H KhF*;h+3j#K"b#3b-&h&D&p&\{& I.JhC`Kh@a&& IJhC`Kh@&&W IJhC`Kh@Ϲ&&FhI I I ! F !F ! !F @a,K-Ah,QСO`'! DI(F)F )F !I  K"`bNM/h3hE+hB +hJ3s[`+K"` Kh >&&&&&P&d-pC!F FFNF0F&!DF1F`]#w a (F!D4)Fa] FpL hBBhhZ`Bh`rK"`Z``90&0-OFTLMhwRI"FV/MMPF#` F:FOa0FfF(n3x!+BF1FPFt(0 + +XFFx+F ) !ptx+FF&ZYxx^)3xB ,$*  ; (\(33"p#"HF/ch`C``h``3`8F*h K:"hHF`"Z`  M90Gw&0)-OFð F(L*-O`ђJKM`HH8F(x+=-MMMM8F(FF@FF(FFHFVD6!0D+FBF}IFEHF^tI0FnF0FV-kԑkO*FOq0Fp(RnKdKBa(Fn]0F@83\ +0(F` ( 0FFa12I!FF12@5F12I6FFF)ћ0320XXFFI>KB (Fn(##`c`` e6JhB#` #c`\ Z X VI12I՛F)12I!FF)12IF12IF)ѵO2x*Л *К *XF(XFFPF{h`C``hx`3`0C&090mGwy&rKhI F I FI FI F퐱I Fx! F*(V     90rFF Fj((( !H!HH!@M 9J-Oh+dgW9F0F]Ġİ5FKh`sOr@ a F 0a0"FI r,,h'JKIhh+h3+`I' l' hq&9rf' tj낝<1~i sahOpa\K"FhF;#310^#x;+Op <#xaF11cx \+цKJIhh h"PFAF(KJIhh Z"  8QFF uKuJxIhh310XF:F+ypwwwwwwywwwwwwww wwwwwwwwwwwwwwww?Twwwwww6LiwwwJ!hNhB[ !0hYC`g0`'h #2h!{C J#b#Sbh3 K(ihK[k+(' h' ' d' ' ' xjO+@}j5>jj !0FJ#bA0Fzb##"IH#kkH##"IH#bj!jHK(ihFcjO |Kh}KB<#;`;h3zH0x#tK` uI V0<#;`;hlK"`"!&`+AF((FO + ؘ0"!O D ;h6BSKXHhQK$ &h(NK h"\XF~FXF;h2FBDK&HHhAKJF!@FVDh@!XF(BF>HjF:hB4KVF8Hh7K67I 6K -KhzO ;h B'K&+Hh F"K+)Ih`SE^DDe;h6BKHhrK$ hK hKh[@߂Kh@h<h ("FIF q' FL' $' <' x:m@th\)' P7KhsjH[K!Bjjh K h`N! (a#b IH#";!H(@~Nj}H+@x|K!BjjhyK h2jjЁ+@e p !$8F 2zF $0jK!bj8FhgK h.EbKZb@_Khkj^HS^L!Bjj#h!h YJ!hYNhB[ !0hYC`Z0`'h #2h!{C(i7Pp```'` ki&jZiDJhjiRhB i `DKDIhqcj1F:O#F(#;a{jO ;OFkih+𝀗O;h#BB :h#1F.HRh~ki0Fj;h#BBл Dj OYEp #"1DH^;h#Y3FH Dj Ozi#"1FlF([ [ZF1FU' |' ' xFL' $' ' ' l' ' ;hFFEEH# Dj z}#"1F'(s;;h!jZhp#DHki0FjQ;hh# 1DH   Ψ 83h;` ǣi`ki[hkK!$ hjK hnih#$j+3i3Or@ a0a0kibj!jiXcjBkih1ki"{IiL(#bhCc`ch+ȀtK"Z`mij+@ki3 Or@ a(i\ha0bj!jhi$cjB*ieI qt"aIhi(k"#^I_HJ^N δF\Ϭ $ ;hF;zjMK*v^j.sOI h) j!jbj DBgx +je;x00#!F#"'H# 1 S B  E 8FF($ (0H1S 0#"9F+H#D%NδF\Ϭ 8 ;hF;ƣmdIhKh^-hKhs Hj[ K!BjjhZK hgʺ/' ' xFL' j' <' $q' Pq' |Kh#Bh`~{) Rih#IHp' d' + @+h2F)I pC hYChChC`:+h+ :!(FR(#p+x B+5(F a0+#0hBC`ch+g`0FC' KpFhK`,,`h)F@ h+!  #iSBSA#iB̿## #iB#iB###iB## hp$h(Fp' (=,"0FMFL*FI pnObiF F4 iF 0I p\ F` M0j K : * B² *I\ QppGmnP I0 F;0+Bڰ1 ?0 YppGm 2L!Fh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@'K0hci1]x(xыh( F +F ( K|  t~  ɲ!vY} 0 Ҳ"Zu0(=<'Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p'(=a:iCj JhZ`pG]Kh i` {h*;apG'j cbpGj bpGj bpGj @bpGj bpGj sbpGj sbpG h+#`pG# K`pG`pGK" `pG'fK" `pG'fJKhh*B#+#apG'f'X# `pG H`pGJ K`pGb'JJ K`pGq'JK `pG6IK `pGK `pGK `pG@&K `pG K `pG# K`pG# `pGJ K`pG6I'aXJ K`pG'aXJ K`pG'aXK h41`[ 41pG'f# `pG# `pGK `pGK `pG$K `pG,K `pG5K `pGBK `pGLK `pGVK `pGhK `pGuK `pGK `pGK `pGK `pGK `pG K `pGqK `pGK `pG'IPK" `pG'IP# `pG `pG8" M F(h` h (hi 9#hL!& 8'f"KO1h#`  'fKh  'fK hh  'f-A"NL$ F3h`h3Pv M0h)h6CEP6B" x 'f"K hh m 'f"K hh a 'f"K hh U 'f0$M"FO1(h` C K"`8"!hFV#iF+h  e F0'f'fKO1$h"F` K"`y F'f'fKO1$h"F` K`d F'f'fK$h` F'fwKOb!h` 'fFL"! K" $`kK` F'X'V8! Kh*K`XK` 'f'X'V8OKhK`# @K` 'f'X'V8OpnOpje gd d` a_ ^^ [ h[ WZ T{ K` '`# "O1]"I 'M"L !F w'd~"I@1 'V@"I 'b" hH "L !F w'S "I@ 'P"I 'R "I 'Q <"I 'N<"I 'O<"I v 'L"I l 'N"I b 'O"I X 'L"If N 'a`"I] D 'Z"I] : 'Xj"I] 0 'XL"I & 'K"I  'a~"L !F w']"I  '\"I '[K$` F'K$` F'$ F `2 F $ `* F $ `" F$ F ` F F `  F `  FV `  Fi `  FH ` cc FH ` | F ` ! R ! K ! D ! = HZ. HZ$ 6IHZ  "K`  'Z ,  z  hR *O3ZЂiB##apGhJ{ZC *O3ZЂiB##apGFOAU FOAM FOQE FOQ= FOa5 FOa- FOq% FOA FOA FOQ FOQ F" ! F"! F"! F"! F"!  { +# j######apGFCi FFFi ""BKj6~j7Kj6vciԣijB-aҲw*b(Ҳx"I-6#l#:F)F FG0Fj0F8F6iBѠj@lACi-OFjF &&- h  FFF ! (FO2AFZFpF6%+xkF5Fj8.ihBiȿ80ыBa3[#biR#j DBۚBԿ"b#b#jB[#s#b)FO[i_BAEcicj F F9FS 0  SF*YFAE ck FF FSFAFFiB#j# K2Fj6biFj-Ri2F#j)Dj?jOL h =("O1 h  'fpFFFQF0FM*FIF Fp@F)4 "%(J!'J@1#J! IHF@J23 "FJr! J! J! K{!h+""j@'b'V@'d~cc'd'e'M'`F)/ %(J!"J!J@J!IH@ J23 F Jr! J!h Ij@l'Q 'R 'P'S cc'S('T'F): (+.J!,J!)J!&J!#J! IH@J23 FJr! J! J!K{!h+""j@'['\'O'N']cc'^'_'M'`))IJ!J!J!jpG'L'O'N)  J! JOqJ!J!J!jpG'Z'a`'L'O'N))IJ!J!J!jpG'Xj'O'N) J! K!h J!K{!h+""jpG'XL'J'M'`) J!J!J!J!jpG'a~'K'O'NHZH@{ll" L I3 "1Hp"1Hp 'Q 'T'll" L I3 "1Hp"1Hp 'b'ell" L Ie3 "1Hp"1Hp '['_ll I Hn("I\ =#JI  cc'd~'d I HR("I\ !#JI  cc'S 'S( I H6("I\ #JI  cc']'^ `pG H`pG# K`pG H`pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG `pG `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pGK$` F'K$` F'»Kh a 'f h+#`pG"I v 'O"I l 'O"I b 'N"I X 'N"I N 'M{ K` '`"I : 'O"I 0 'N"I & 'M{ K` '`L h ("O1 h  'fJ'Fi#BTj3hah)FBڔ5D#>a7D2(/:Oq Oq @@A @A @ؽ@= @= @˽Oq Oq @IH XnPp&Lfh.A,(?23=Hp="! >O0.O05M(h7`(h7!`(h,dOp@##aF`a!Or I#D E# 3(+#c`&&&0Fp'(=:-OF,{KiFBu[iS$@,oci b! +aO3a39vk FGj+@ci h*eh'i O O &&X  xF# !PF @ 6SESF PF BFF66J#F#`bi- mB BFhiD`0hYB (aiDљ %uY`ihDB`i@)30`Iihc6[BԿ``O WFO iEbjO X BF  0  E3:FHIHHCKhKF ?OhJDBh5P-umCF*FQF0D80bx3 3F/Ih-HR!, =HO1j.O1j5ci hQFCF*F0D8b9hjKh8bi+@;bjh"jaB Fj@O(F1T<('(߁ (b (ہ(;'Y>nP(=r(+((3(* ( B а ?(>(@ @B @󧁰@SB@ @0ciozw*΀V"UGuiiB3BۦI ]B h"ja DBt[3ajh#bg&k&I `M(h7F(h7#FF8F8<F(D99F(h8%F30FHVFFKFF+0h,"FK0h5XKF"!0h5R"!0h>0h<E *x(%d((@ q(u(iI 0h1bgK0h33d9Fi+?mh"j[R#sa"r"bj,ii DQBXh jD3D%uBȿFBԿ%b bax(ia??z(`(x( 8a8(8?1iB-cjh?&aO{p@0(F1v( :hC20/I (F<$zcii Ԡj,Njj8j9iBciRFcjh?A2hohz& FG(hѠj,"j0j8j4bj9j4#b0S'@8Fh[ nP(=r(=j,jj8tj9Xk FGj%4jjb(M4dbI@0g@0d@0a<(.-?0;q(8F38F9,8F4F ݰљ0+?ۮ0;DE kOF>( @SB@B FN0h: i= OqfO0$`"F h "9h0h 8")FhF.;hiF(F3h = F'fpF M(h: i;Oq 8O0p$`"F h (h"1h Fp'fpFM(h: i;Oq O0p$`"F h 1h(h" f2h+hL! F3PFp'fK[iS 0apG'-OFFFF($PBLFO0<!Dm`P0S$8!D ((`Ci4 C` $``aC3CacdccK*FBc FC'( KiB[iS @ci ՠj4( FD"!@'-OFlL FF!hF`h>FEahh5("ea`"afh%F0x(`KBh3@@ 1Fw 23 RF+* (  h6 !h1  !h1" " "  i ( :h6 !h1 !1!" L" @ ,GѪi"ji*$$6 D 6Eۨh6'K2qE !h14 !1BF1F5,!:Ҳ* I@ ha" " >FU Ljh6L !h1^" " ;HF' rUUUV@ -OFFP;#O O PFL!Fh+:F)F #3pИ0RFAF0F Ih5AFh5Ih5I'h50FFh6h6h,F6C# >+ؿ'B/Bؿ''#ByH+FB FBԿh5BoKh67lHpKh5|gKh=eKh;1 (F(($`((b@BE@B а:UWK1FFh+,e9*1 = =320[ 9  =320[Թ * h-LF#_,R`P3B #"F9F #O3?F  j@F1F@F98F<F&.@D4:d h5)jNC  h7F0IH !*6;h0h,jF F,0h3tF F3*" FF< F: F(=jnP`~`_-O}FF 5FF 5" %6DѧK`5*O ĕMLI "F\+h*FI TF*h*њIXF*FI F*h:*FI >KhFKhjAFH|K"`:K`[D @*F!H 5!(F*1 0ǔ-vLCs-*)F n 'f8qI hZ%`jL h@lI hN##`iI0h@hIhph 6cHxc82hFZH1F0hr^1hWH UK!!` "` F "Y D!0#hC#`O$$4 d TFĖ4QFOpbt4#`FP( ;h+@+@IFP8`򟀻h+$-Hb@Lh$b(IF F$#" (FBG,!K! h3SBF"Fh K `h!! m2`Y'XHtptb`@f'K'XD`b `5 2`'M``'` `aa *OrB  LKhRKK%`2  o`&~* OrB a` o(Fm&r $Z" B] x"0FAFS0HO!VAF f-&FDF zS;DF ̮̮- #xK;1 FJ;h#IF\8` F # "Is p0,!F8h3Z8h:~6 }'K'` >H7hF#Ld%hhF: IF(F h h##`-IHF `XhF"IF(F hKhSh$'IFS h$ IF H B 0'K]La9aJ'W@a^nP0#$"K ## #IO3 I H Kh H !F(F 0@dYnPa'K -CpFF(S+!(v #O0;`9I(hF(,OTI(gF(OT`8F8`9'(FY:C7 B7x/'/69F !0FF F0FF FO IFF(їI2F lBx%+2@+*!:0/!HFF"pHFz4F#/" pFPFjC XF|8C{.+ QFF(T%0 FE5FXF(У DiIKFRT%0EHFXFwLlD%p1| _I8F(0#(0*0P#*0UM(h*!(h6$(h1:+h O(0;(0  !FCFFCHYC=@ 0(~58NF53hBF !F 3앱3hB.H34 3'4-3hB4 345:@ >63hB5!8p:-Bg O:)F aO@F@DBxI0F1FF8FmrI0FpKh0DX)F FF8F> ( 23 RbI"O7 |.`X`32BCCOGF "O3!j *FMIFi 0F0FWXۃ | Oq"&BHXfV"@I>HX">I;H@!-Ks*E67KF7K "0 `@!5J# 0z0+%H*IOph= &Y"#F0zh00!H!l* J2h32OpHr:눻IFXl''Xa'KbnPb7xH3rI'VaabOba[XY@ j#FX6'eKxF*AhIhHFgKh,y }!Fy wbI `I0F\J\IF(F0#YJ(FYI0#IJ(FVIVI  (F3QM+]иBr9S3eJI &GII(FV# "O1F# ع0@I0FV)F0FVB.F;Ix8(` x+51Fq3F" 2෹4[Cr8F3+I3r(I8F#x3HFHf/iєW5+S I JI IO ae"'t''f'aJe-eJ'KnPe[exe'Weee'Xeef ff>fXfs |#Op"9F0T5&x I @ X HX#X6?4PF !] f-Cy}F F(HIFFn 2 ;p&#K rIF8FI:# rqp3F0>@#FppD# "K0F0BLgAIF8F:4[:C2(FC=IC2:I(F6I 7I7HF(54IF 3I F2I F/I F0#-J F-I-J F-I03*IF F(I FJ F I #H6P"I#H#H"Hq(F C'Xog'feJg+g<ug\egNgfLguggg'Wg'Vg5g'gghF+CK;,\*]#F,1*j\&O _/9%p0x 04Lx04Lx04L \,9 FKDp8F9p0CDB#p(#(BrۙBp O0]KL" hhh10a`'f-A] *F FF#F!J FOQ!CF.OS"#ORTF8F_d5JBJBѝ0+ٛB +F2F I W+F2FI P ]hTThh)FFFa%I8X!.#I F* 9F.;FP IFrT^ #F*F9F-0F Fhqh)pF#IhIhiqjFJo@hhFho@ih HLF8 ih0F pp Fpiq(KS K(FpGHpGx𵅰%+F)FHy040FpF+FHyI FfFOWo0Fz)F0F&(ѥB)F FU I FU FI0F FKhYLY6K-OL$5NhFLCh3hF 90`.JkhFIF#X@IFF FF8IF9F({(ѫj LKFdF/- F(B, /+ F6 (pj5F8FL3h KRL2h JKFRF(` 'f''X7JhF*zr I3 J F0(h0 F0'fhh-ON&B#4hZ-8#JO1m`Opx(2h I2H2hI2 %JHFHT K "! (+F( FB J#03wK"9FPF O EԀZ)4hAFJ(@ŀdL#D#|+aKh2R<3eILo`abID*ZI<+#b#c#{+@+@ +/+I0h#"kAF0F4EF,*5jb/Khj[j XF jZFF[F "T AF %F5   )%(F'fqi }i@1Ojy)Ci'iiIiqi:i~io<ibi'Z-OmH%IHF~IF(FKhFNsKIh3F0F:l ])hHT ! I FzKhj.&Oc1F(.BFuzIb@~U랩H&U(F|.b%xI FMOc)FH(CFOOoI8F:0#B B1FFP&FE_IF50 zU<%6%8F.赱@HzFF%zLI F&O9IKh#IKO9hFO9jO &E+i#=I a;Iz*Y07O+7KSF6KF< +0/////6 ,K+J (F*K *IOJ(V"U+i+@𷀹?#I F"K.FKF KOBFO >KOBF 8iFi'K'fjj0jL@dzjd|>[j'Z'`$jy)iSo<qjibBFlI hHFoeHdKF :FsFF(sFF sFF@sFF FFHI F FDI+i+BKhS_  L -FIIw:F0+6 "1FUh FF$. "!U`FF. "!UVF8IPFp7IPFH5IPF "QF V6UY-I @ 0c DE'I h 0c 1#CoTAE/L#_C Cu`S& % LT\-!F"4S(5si FO0Kl(l=FL!9WrlXla L#hzw%h9FObv0FK1Fh:#(F$hObu`)F2:;%F(F@ k'f'X-OmO3 t%K h K R? +O " Fh:! FFI,I@ d0F$@ edFe FFe0 +.SFJ!0Fz FF@! FF(@/h+иh+@e0+ 1FOc F'AFFI$0Ir8Fv >.ep/@𙂇9F Fff#gcggOc' Àؑ3Os9FFwHF "9F0F "gI2`XF"2q2F3a Ozssa093~+6FF'+ Y()7p6`T3 FGT2(*FZ] )F*"!T"boo8F !LI2!e#FHJF!bOJ JF!0F`"!FHL#;pF#M01Bs H%XF $2IG#8F0#p1l0/Нs1c #5!!8F#7A!@F#;!boo! !0FI2!e#FJF!hXF\#!FT\5|4-  'ZZljm n@dzqQl`Ql'KNh/H7HWv2h*' x Fz% )FL!O| O>' p_`3 1BCLC -+F᩸#ZOtPO3C`#`K`# r  O3BF  ~ F FM3h+BцK"o`C#3`+򠀫BۜJFhAF:(@#c` |'F3 B߀3h+ q|""pKQFB`"4!O2+lJ`0*kJ*"fK" h20"QFdH_KhLaJh@`IP @ WJ hd *E*2"e* (At hlx0*p F#*""#+r<1hѻAIh @I3 ! 3O0'FO^" JCZ` !#"#O3Ob:`#:*:SC:3h# Kh/ `0//?@p ]'Om'`('L'N'U,J#3+Й\ pG pG'K 0 (\ pG'K B/"pJ\CTpG''iQ#0Xh+K\\T ' N} 2#HiJ##6"2 J4!"FF F F4 N}Z@J='L#h+I &##`'a\m-AF)I)NS)L% F29F B(F(5K I%$K$` K:FKI F%$0%Ny+ La#00030mA'XLm'a\'a8'Mm\'J-O$ ="!F#!#6HF8pCO"H&x"IH8"IH4@MMFMF&Fc#2FIF"F?FI#@F\I@FF@F/@ x1B򙀘0+ * +xa2FI"Fp?Fu  #O"F"  # sE # PAOb©HFQb0O;,"mI 0F( #cB ##* "̩PFSt"2 !T  HFF2FTI(F"*FRI wMIa#2F(F)FS04t5,7a62,K, :IAHSw(T&\5OëK>J!F`!Fm3hFs7LFhh| 3`IF=(hG(Qch3c`kh ++)H$(H2*+ &H&H+kh+#I !I F8F8F h 3`!  3h;Kh#I@F}jh I\CT#i3#aC'a('M'a8f'gnnno '`o1')F'(ML( BF7:1 8NO1(h(O1 h(O1(h/ O1 h/(h. h.(h6 h@(='W@pFm"H8!0F@ 5vFIuF(Ob)FoObIToOb1FJo!( F<  F8(F mpտP H H(H0 o7o@oJ7FpEh +F"FIHH0omnPoT-A }AH@L"@OF)<)n(8h)8J! "3Hj e(F?hF(FFj)MBF9F t&I %Z< i#K ! "!KH##")F(F)F0F'! 89J!LH"F L L }o''gsEG}C]moJon7-AF&LPiBjyX8F1F0FRF(58F~@i)!J(1P"HjO3a 6e(FKhF(FFj LBF9F 'aG}'gC!F< @(iF O3]-Oհ@FHKhHL"!N FK"FS \'- S1q])2 3"`#MFnh'.w+h+r0+n+c|K! h2D-6!ibiY +hO D!hPoK ** 0C 00306*".FYF[FO 6rh)*(*3'* >SsF0)O癱`aB YFw (F9F(=5h@JSihB}  rf~ #ichcih!h! N2Lc{5I ( @  /I .I -I #{7)H&H.ﰹ.#BB HHb8I rIH^`<I f ! Um'XDo'g'ZPZ@(='a(op4pkpppppq"q4(=iF O3]-C]FkH${iIFB~ndHlaIF (`Hb\IF( ~T1FOp!%U|(\RI F(UnLI$F8(F@FD1FOp9F VO0sBIS 0F1FFFHFPp4I8F*FOQ,F(0=+$(FV8FT盧B0>F`%@@FO(O4*FH@$! 1FOp!F ~~~ F(F X ]nSjqOqgb! M$FFOc!F%B:F1FxB ڶ&h(F `(F F MJAdrJAdej bpGj bpGj CSbpG {apG h C `pG-GF5M*hP4I8##F  "0I!F!)o(`0Y,)N$FF4,7`OFF "JH " #"I #F"F?KL" h0dDj!F#Sbb(h!FjPL" F\hc'#db'#`'fhI FFw#K9 #I&hcYCa1x#ij+h@`)"{*+ݢj&t"b+ *.Ԣj"b_/ اj *+ *+ `3 +'f(k@𵅰& F#"O13F '| / I(F # // ")FP/##`#t p%FKj J ! Fd"O1 # +FO FUpb(FpK-OFF%nO8O OL F#DF4 #K5 hFFD K!F FBjjOB B J`+ &33h$tԡB 7$PL K`! S4X` ` `*#SPa'V8'fbbFFF$ ';S0 30DJxG*ѤM*KOh c+Kh:+`s+O(`+h cC3` 'f-OyO F;hF+ ; #,`ò3F# mK mK FmOhlJ!F0F;h "O1J  #  #F#f1F (𝀝M0L0`+B aL# 6P0  # 0 L0#L I(4 IFPDAFй 0jp1F z0IF ## FfFBFOA OPABOvF BDLE8\FBOr F hJh>#"O1# F# "2 E$c0Jkh,` l`,s 'fFL'X'V8n Fi!L"Fs -CFMFOF+hF8FAFF F+hZ)FF F)FF FBF0F)9F*# #KF%\'fCjpFFh){KTI )#(1;CIY{(ѓjLLLKFF: j"FRh;!h c{hZCWj? }hQjC wjF  n1FFBjD g%IF0F%j"Ij%jIj%j^Ij%jIj%jIj%jIj%jIjp@ﺅjE +F(Fp@prjrrrrrrr-OMh F#- F #;F`0Ʋ(FYJ!F8FWKO1K "h D # #F#cIF8F(НE0D0`+ٞB ӣaCKL!h3& 6DHFN0;Kh; # 0 D0 L O HFI(, IFCй 0:ZF y XCF 0c #Bp ڳ Fk Br `FFEO{ .("aEp1 RFWeF"h2chDB,[##` e`n'V8'f'XFL-G9F$LEڢB ФE {CheB5L6BDFL0 GhF EFEЖX0+l+PwEEwEӞDwEaa 2 j#C{bB)s )#Csh OOsOc _4OcOS#Cs`pG8 FhF(F)ؿOqX(F(!!as(FL`88FC{ FhXCB((  ``s8-OFFF #2;M1F9L P"8I8##Fr5Ib!J!+ 0|( E0+#1%M+h**"I&7F*hEݙiI FI b 6&z7L360 qSF IF@F(д z ('#`\3e 'f'%D'Z-CFBFFDL<FOq0F2>I#ORPjP/IBQB F!FFFHF:F82F!B(0=+BvBJ!D\%F0FN6}H:F!F0h;F"FIh0h& 0h0I^0hH }>?nSGw!tW'Ktltetsp}FF"! FiF O3+i@V#0-JIHJI (K!JBBHlI #x#"FI Op#! iOrV#0 a }p'P'Q 'httttt8F FEiJ T#0ha8'g"K` 'R!0pFihjF0F+FIF Fp@Su8 FiF Q#10iI T#0i(i@7T#0a 8u8F F hI ziT#0@@7a 8u/FK F*#K#F(FhFaF(i@U#0@38i@ U#0a,iOrU#0 apCu>-Gְ-(iM$iO.FFhK`Op (C(@, , ,V]Khsb[8h|h$(XJ TI*UJQIF 0cB(PJ FCFKJ }IK hPFRFDIF@Fh@FF@F|$@Osd h@Os@+a45,2J$2I 2HO5,#J!FPh3( hF$ 4C\2CC C &K&Mh4"F(h6(h$,(h4 JOsKJ#F&"F"o"F1FF FXV]'IX'Z'gufu\uu'Ku'P'Q 'h(=(={)vx-AF-HF,IT)O+NF4h<8F(IF F"H}F#HtF H!H.*F I F F#0KJ (JF HR"0h@*FI Kh"I|@ v*'Kv:vXvvvvv?!!-A_V6FFOL#CckmO'(FckD#`c85B#` hCh+z#C`FpG pG-OFhFFFh8"$bh!Zch`hhBCa".hs+`6 @F!KKp 0Oh;hE5;i+/xih~hhhfY#YK"`*h$0"XF K8"ah 0+h3QchD`+`#i3 *FQFHF]'jxKihBapG+#apG'iiK`pG'i-AMF%< +FOO8O1 R h/QA` P5C`382+-OȿkOؿ# "O3*F @hCFO0 U8F *ەB Q8# FRh3P MI@KO -G[m Flb# FO8 O1 `hvEO G q` ̮ f5s`320+-Oȿjؿ" Op#*F #O3CFO0) 0FJ +۝B̩8"[hl&*4':4'0':0'0' 2",'L [m'j<IOrF!##`Oc 1Os1# 1#$1P#(1@ F!n# "#`8'<7@7-CxFFF$O3`1hB #BrhiZCXB34 OqiO0KF J!LPM(_ F<` <'`$ Kh hhOt13]K#'j8F)4  'j@z!jOprkj@kbljOpd"l j@]bkjOpVkF(F8@8pF@SFFE"FhF .&5UAI]iuOpj/7@j'bh0Opj jFn@jjFfOpj00F0a@S[#m+1J!hFj@>OpjbmFKm+(J!hFj@*OpjmF/#n+J!hFlj@cn+J!hF`jOp n+J!hFTj@jFF FOpjnF   F1F(F#"@pw npF°@SFF"FZ.Q&2><`T4#0V<3 J!F 86BѬjOp,@jgF(F'j+J!jOpj+J!j@ #k+ J!jOp=F F#Bpznw ð#FF0)z>FNV^fnle ,t0C+h34J!F56BѼjOple ,t0C+h3'J!F56BѼj@qF F8jOpD'.j@s,'&jOp0'j@u4'jOp8'j@w<'jOp@'F(F#*Cz-O FFFkF:l%F&FhBչQhki1@X@h%;k Dykz` FGzh6= @i)O0GOmF36 # +FO< FB B3B BBOvC `O3  S`` Or"("BF!FF0FI FGF 7F-O$N m'F5F0h D~(3h"Fp#D`Qp21BYXD[kBρ By#008#)h!D Q 0۱2IP 2hI "DRD2(@3h@!JHF#DSD3KFxCF++h#Dj+J@!Fh+h#Dj+J@!FZ+h#Dk+J@!FN+h #DI3(@iJhFjOpi@j1F   1FF(F\1k1   -J!FhF\jOpB1K131!"JhFJj@11K13 1!JhF:jOp 1K13$1!JhF(j@1K13(1! JhFjOp|jFF F#prnjp"F!Occ`@#fQd!@ FIιxJrF!##`#bbO3#cQd!@ FIx!Űi ,g%5D:?JOT\b1#"@#O1 OvLj[ bj[ b$a$01#"#FO1@QPOv*T@%XOv m[ e`@dOvn[ȿ#fn[ f$L`!O4%#h!J8FT#"O1+F0F@8FHB8FB `,F FEnF3N˰ F3hZ "1 "">0`i,) $)F0h'?$5#"#FO1@/(5Ov ,5@05Ov$,` O4 $+h!J8F#"O1#F0F8FB8F(` FK_ n𵕰ANO3 F FsjZ "( ""pbi ,B $).38=0K)Fpj"`S,K")Fpj` ! +D7$B@y e@{4uOve@} J:O:3F! CF7J!2z-Kh(h2F2I3&OOFE {hChCF*IP 27缱 F h!//L"O`.65.ϮKh#P*h`O0K'`$x('Zx9x?'Kx_xxxyxxy ChFsh##`J0Ih+ h 'j@@>ChF{ 1+##`J0Ihh+ h 'j -O&Dհ4FO5Kh0D( KB i'OL IFODDOhhL&6F#IDCF(F"sVhL#asCb <@e . Т\J#D06[OpoH;FnJ!DL#CjP&*FFeML#OF~F+FDZI8F\J!cD2hj FO]F3FDNID#3p"h*g  W/R"AF0F "CI0F#Eѭj{OpH7D7hF(F" @o#h+Ѐ#{j;@|/IF(F1 3Opo3Fh@h 13FhF5#h+hj@cl!JDkOpjGhL%#k%FOF*D9F0Fhy'ZyyzyP7zjz5&`a#h+\/J!`X<W'j| 'j8le'j||FF $'F9F2F(F7/D F.KhshrhB kE.L#'I`0NEH0B$KhD`4hP"wB hEцr"Z`)200* BKh'$dhF"gkB mEц8!"ZP 280*'C3B  'j'j|'i-OMO2 0 FI,FMJ%h.CвFO л л-њ&*&*%P& "AF0FYع8$ sclC1FF4` FBF=)4K 5I@O1Q``!` L o-OȿkOؿ# "O3*FIF@kcCF8"!F8F,>`&K0FY,*ەB8"!8FO3;`8# sdSC=FPDŔ8F M '`$IFF8 xF`!hFlFE5F3h+0FyO0$$h"`sh;c<0Fy o F8H"F F!##` Kcc Kc Kc K#dOscdUhjhx)F F8@8V B7 Fi-g .MT[c! F^" .Ic(FOscd*I(F#cd(I(F#cd%I(F(5#cd2kI(FHclOroDcdI(F(cl@"oD# `#d $ Ycc% Rc%% `O5(F0$5,0 F!hFm(#8"Q3kl8"SC0P"eF F+ 00 F!hFI(-c S/ML'%*hl&"@ 0+h+4734707307#,700( 0'j} }e}_l(y'Z~ KhH"`K`H~K`HyK`HtK`HoK`Hj K`'I`~$'Q~,'f~5'V4@I'fh'XQ'f-O]Nl+𨀚ML+hT@  y `(`M+hCOq y(`M|+h]H! y(`MO+h4Jq x8`(`Kh 3%h"L! F`%a @  +5ca"a!wLPO Fl`%aOs"c` 5caa!mLPJx FV`%aH#c` 5afM"ca!#OOb1F FO(Fh(POb)F*o3Oa Fg(?#x/+0 ex%m 3 F,F*(3D0DoEObI FoOb* Foӱ ?#` 8Ft(ڱh 8F F h8Fd8Fz` M~sEF(  @ F!* "iF ( FP L 3@ B .-GFFFqhF(;.7F$8FrR`C+ "I(FHF(+FRFI0HXN.CFHF I4y8Fn FO0~~-AJmH"F(@+(Hr((Hmȹ((FcHObF((FH%(h(%H%(IF F.I ({@(R}I(^ObF ` `fFXuI(L boI%F FpHgObF((lI E cgJhI(gI('ObF `bI( bWIF ^I(ObF `YI( bLIF QI(SIF F(PI(MIF FF(KH ObF `XBI( b6IF FF(.HObF `@4I(!F `6IF(0IF0FsF(x0HObF `)I(FX&0Oa&J ` c `\0;F bI F6 .=Opd! F Jm &2<ErO[{gyJiz~_XL$hz$BQBuDB+FB(.F4,. `` O0'f)h992`ppG2+!*OЁ!!!!"! pG F@2h D B# 2]7F@kjy(* QhAh!`Bi:Aa2jA!aj!b$(*lAl!*mdB"e0+rFF KhFt3hcB bhB#hDBL"! FL4'fpFL F#h3OsK "!K#6### ` hCi)F2  p_Yip FLboQN#H3J``K "## # #Ip`g`oC)F_ p_'Id-OFOpFAKhAKhAK!hF0#F"F@:L001&F[` #01w4X4AO/IO5P CC \3B0Q@4#=O2-&04qO8Fx\x#* !"441$0$@5D04 I=#`4D ,DFh  (F `#y*+Ѣh B DB' #(sC@F6  I /.CD07 /D ' @FNE@  X X< @8D>D/ pOO hā9hFF  E1pGCB-Ox KFcJ !8F@F`K"O1h <#Op" 8F( x+Ox RB X RBhB3 2 "yE)*  !hCDBEF (B +*@b1+O q w(%Kbh1[B1#1#11!1FD1112SD2":11FSFh"D` 3 `h`Y'V0'Xn'V8-GbF F@1F.&iF*|KO oc+yO wJ!8F,KF!F"@ JF8FBxKEFBɀ6"r`*y)*""b]Hxbh,V"F,qhD"*"!F(F2ӳ!2;20!*@t! D Dq!rR[BA[""" 2x2+ D!(Ri2 +H3O3*KhOp&``$+2,@I3Bр#+p",,Ѕ,2#@O q wxh2 K(M3FJP!hF\P#jFiF 1hFTCF+(`Kh#g K9F0Fh+FF#FB J F`CFB B3`'V0n'J'f'V<8uF92F2w@"(F#1KhK 0B"0iC Ѿ?++ #CѾ@!OpOp! (](FXU@@F(~(?z8Fi$ F'f'Z'K5%'J'V0F" LxP2?ИB!Do2J !HH_'J-OFFF@-O/'yFbOp 3F1FF0F3K3IFjz82hhD/K0DIFIFF0F(FOp"x *b "vDF a B"y* "I" " "RFHF@ y| rF,!F0F"FG;x33F Ij"3FIj 'X'-AFJLFF`1K ` ~dP=Fu8QZ@jgF(y!1FF FaOpjZ2Fh(@jOh2D)Kh1FFh D61FF F1$KAFh*8FOpj22FhDhJDhK1FhF F"@j+x+FOpjh2D "BF+y+`!d!0Fz'Id'X'V8-Om#F!Oc.Or1F2{!br qpRKBAKFBK t@Kh h5peppqeqqFXF`(F`AFXFQF]D=FF@3BAF(Fp'?`p ?C(FpmQFUF(F5e@3B(Fq'?`qP?Cq4 #BESOr2OSOI#J(bfO60FO0 m'V0'JJU#@XBXApGK-OFh FMFI h*`Jhh `Hhh `JOYhO$O:<1 h#EOx0FOc<1O rtOc!F8F'FFF Or)F [JF@(F({XF+!)Հ*Ҁ!2)*@Ȁ!*@À!*@𾀸BO2&b&FFzO2s!"XF#F  *)јFF "DQ   EѹOЕ!CF;F*Fơ  "RDʡDE9O q vF(PERq!rpRBA OF,0;h d8`,8M*hL##6z*hL!;hD BUbА`&4L0ML#*hcCbAFO(FB2"H.6I0F0Khg#d'1F8Fi#aL7E3x2F/+II"6jCbwO0 F'J'f@Igj-ONuF)F&O7` yF03H4h&+F #* #OI`\F#+r/  FFH4JF;h F0  FOrFhHZF;h FF!0F hY O'V8'X-O0" FiSC H4##C&F?C##CJ@9O1h*O( "3#y+kiiO:hF6JX4 OB F;FJ ! " D O1) Kh ###C#эI0Fkkn #[b ##[BA##kcIF8Fl XD" O 8F S xM+F++%G++ &g+c+mKhm+s+ЙhKOheKO@hFB O x3?&++tSK hCF > OF KFD2F@p| D X3X4jB#X4 x++ b[ XD6Kh*FOz:F[Er FF#igEE#b# f VA[ g#C H43H4X3LBr0 FCCH43H4E9{BE6K/h0AF@B'Z'X?@'V8n'fAF8FFJSyf#(F -O# Kh;+Ob!0O 81O3/";O $+h54aOsp& WkO Tw!POaU9V!7e@'o+[t%k &[m%k(&[kf&[k)&k&g7;u&+kr&kv!1;+拄kK,h"\,o"\>*#,e"`> #,d>h& ' +{JhF)؁*xJRhBwJh*7c! X1#<BE@O34f2i#p # B #^KhF{ p H;Ft+02D` FFBp =c#L;;cp?hs+F#0+}#*? #+-) kC3 6!O{F FFFDSFFZF@pv 2 # D g #.?##-!" >vO{SFFDZFFpD vDhqg g 0 #bg'f'J'Z'Xhz#+ #r-7d 0KFF yfg0F OEKFOrvF KF gOr` VAgx@js1F0hupCgABOrrFBOyFy4n#B  0F` Kh[KhC4a#"##p?H 4c FIg#[bFFgL #`?*"B A!`1`34a o#0C`?3`?( i a01tsxK O1 "R%uKF#.#"eabpKh ;+̀0Q01* *=@hzg/v`?+p?;*FBv'be2cF CFѝB*h2*9F0FF FH{Ff#0=2d#y+r0gp/BZhqOx+FBF2DVAj:FBrFF%h+Kg'&.W+=/vK"`-/OvK]`#g #I@F#(F #g #04rA #I@F# #'J'Zٮ'f'a0e@>-OMXL%hF%:+@ցOba >!#C 0cg#f##C 0cg#rA#Khp0e#####I#h0b 2JhOF$ OsOr)F #h**/%hOb!`#L"FCEP3L#"?FO h  &*&;6 ;6#;87";`,"oI@ KhC #4+ h"!+ h"!`F#h +8''f'K'Z'f+ h"!`(#h +8'"'N hJFAF`jF` AKOb h`3hMS+hk"h#O rF_(+h3KAFh` %(F M'Z'f-OF FuxKyNhFC0hpD !FC)sKh,zOa 1hBйzqPF쐹813PF D7KFeJ!PF.  O//*p#F\J!8F FvYI8FXKFFh02h;FVIrTI $:FQIRHz:FMIt 2h FKIr3hII F*2hGI F::*3h F*:JC>I2h=I F:*"6I8O5&E/(ya  jJF.ISF  Fs+y ++ jy F+h'ISCJFc3 FBLI IV FI N I 8FvT 'Z'f'`$'KznP /H_p}\FLe!   !@FK"FIFH 2nP L#h3t `KhBJ~#hXBXA`'j0%F*FiF(F 0#BiF#a(O0 ]( # J"@BF#@+FI _F@ѿ-O?-FMЂͰ !(F ##! FK# @ #h`i+3@2##N[Er  ڔ$#4KhF?"I q Z  S! {#h+߁/(ځsI J  O FSF  ѭ7#`. FJKBD@8  )pB٣FJFAF`0 HQh+Эh#+з(;hBМx (070DiF"iF #hhh0Hh+)Эh#+$(FR #hbh Z`abh`#|+hh#``#`+jc``ki,b3h"h~0K8OrF FBF#F JV)FOr FoCF#FJD8e] ##pCF/KL"<O5P^O6B&B(""PHHB.F&+hjhZ`jhh`"ht(F(FuXP- 0Fp ppM"FhF+hBF iF FDCF F4FD F+hBМvp(0-O)M MFFF+h4$&F7#`O0[&HFBoIF6lDFB"F$+hBМ: M(0-CFiFFF@` n`&bCh``id%@=ѭn7#`h tp許t%i `C``#FahJhL(FO0-FCO30-CFP 42#C$#S2#2#W{O#O62@X;@2#2#&wWC2#  2# Cs"C2##c2#h!Z@02#CO#c"22#2# CO#C""2#2#ACSHO1 @@2# 0+2#! C gHI0@9@C  !C@F"2# G2##2C7Ѹ>p/GGC}&=0+CD%0` HFp(FFIFFJ. 9F0D C-h`2#B22#6m" $.2## C*И 0; sZFeH"e"h"9F`m0Cmy'hPm Dq2mB@\FhFFnhtB #jC>"9F0 dh  H@98F K F) F! F F!KI F-F Y F8@ dlF8FQ ["H F12#Br2#!0 F32##bCIIp"F#F0""b32 p2bd #"@3C!8@8s-pCFF #BR #n[h[hh3j۱0O32)C C Y!Q22@P20FhpFFWFh F H@329C0C2t@@42## C (h90H2#" 2#q7#Fhnht#jSZ *Qil 3 FS3 Fj0 FP30Kh13 F3dh"h (ѫh"hhnhd#jC!F(F 0H9dh0ClpFcl+ ݢlC;R#t cl;cdlt#dll+ "mC;R#tl;d mt##emm+ "nC;R#tm;e nt##fPaN(F,5d1;1t`$Q(aN(F,5N(1;(1$t$a,Q0aN(F,5801;01,t,aPp`N(F,5!0;0t`pF^# FFF$Fh#l!F Fk& g"&3GC32A12W2AA2)F2# F #@\hF #"3C I032#"C clKJ FI@+F~jF;032#"CCl3 F 032# C *O F F@j-CFj+P0O 32gXY s"CB#C (F Y@ $$$HO Y s"CB#C (FkY($($s"CB#C$ Fp EsBC$ pnhsRC0F %u$TsBC0F+%u$DsBCvhs"C R#C D%U p p p0#F0 # AC,lI @ @C&nh(FB$( ( dK"kbHmh F$( ([K)FkZH ##RCVH!'#FRJ! # AC@C"CIH0FIFHxBF(MAIBHk FtFH" n03I7H0-I1H!"!-HCF !8!(F4!(F0(F #CC #"" T0IH)FH[ #!B #(F 0\  (b :CF H] # 1C!@WCs F #@޾o-J-AhF FFnsOrI@!0#H# 0 +F h1FF8H*F1FO0"])F@"p@*F1FHpP hpU h:F1Flk F6 0BЛ(0 fx-CFFFg'&! F "b! CF)F hY FW0#BB )FH! FC*F#j3 F#"@-CF_MFnF*h F(0+32O Yj+NH0 GbFGbcjAA+&pcj7clZv+ ?Hcj F=ILoO3cd|aj F F ! F, +hBU F C" +hBK F C.?cl+< %HH0fdñnI #9F2F FnB2F8Fz! Fy#h FlkOI F)! F F +hB F C +hBЛ (0I-O`O hF5+2#Y+AlO1& zHq4FcjAA+#" h!#qKpK! bj hc C#h[n F=( h# n@nF_H52#c C2## C: # !HF 6QFOFNHJF! FmEҷm#"HFw9F# !8FoQFZFF?H:F F F0  7H 2#" 2#2## C6#j+ F2#"CC F2##"C F#j+2#!pC#C!!! F{0 H2##C #j+ F I F +hBЛ-(0 % #2hF #"3C 032##"C A! F10 IHw F@"P7-OF FhFO ,F FE V(HF#j+'BШE.0 FI322F)F F FKFBF FP F bE F 2F)F F FdhB(7F F-(" (Z(^7J8I8H Fpkcm)F#ln[(%(0(F.J%.I,H+J%,I(H#*J%*I$H#  "1C/ F+"J#IHnh\ FdhJIHk0H0@H0@)FH0@)F0@0^NnWv; Bj!hjFy!b#jK F F F@K-CF FF-FnF(#`(Fj MH F12#Bb2#chh `nJ`h F` zO2iFF;H!!FF0#`O0b nIFFj# .Hcjsb= = =0C))P!chh ` h`#c`"n[h``nZ`#jsIFH#h FlkC F|4F-jFAF8F#j[ F.ChhK`h`( @Fs E)-GF@H"' F& F0 6I6H!]#F2Jmbm FAnhFz 8FVh)F(*FO1 F2F=hFM nkhh `z`h`*nn`[h``nZ`+jK#"!EFn Fnn =\p m i F80ѫh7+ F@`h +ЫhV+H@p-AF#OnF;hFF!F0F`, ٫h7# I`HF=0)B"F1F8FT쐱<#jF!F0F F H=@"F1F8F0BЛ(0P7-OFhFIFF F"F"II FFh0j F+F!FBHFFI FFPKFJ  F}I@F D@OЫ`BX$40D(FrF(ĀFO #EX+  F*FF Fn   =LDp%QF\  XHFPFsUKK]$`F%RKAF0FQJI@Cn(N(k(Ep(x(DT#EUO RCE0B 8F+F"F!4 O B,X#nbj[ 12#CB#S2#h3X#nC|3B%  0Bnh, Ffdh8FMF02F;nCFO5(F}g 7 F3*F(C H #Ch``= )FF=D0ǒYK-GhFhF'zn*@TIP({fOJ!OH"h+IIKH rFGHh(# 0%#|fB=#AHk0%+=HtH 0 F ;Y0Fі(0{ 4H3hnh-IЕ(0+?mh5F.I&HvF $I%H ")FU#FF#IFHF2FHF0к HIHZ")F4 Ff3h'n0B К HyHu"1F((0 !j;Sx5-G FFFlF fKOqeJ:7dK@+bJcHh$jѫ#`(FsiB?ܳiS%@,G"#! '  # pl/ """# /tgap"ii,Ir`ri#F! atahl rFO0YB@#;#hbh Z`2abh`3h33`` ga #""##W#" # ##/Opl+F""Csh#` \``3FhCO c`iC"@3h;3`3i%`c``4a)$ #F]𵓰07K@6J7Hh@CiBۃiS!@4#`O0Vbi#*Phhca'a$"&"F@lg F8#hbh Z``bh'h&`#iB%0%i#`b``ha:`big: ! g*@lO"" F-O FFF8F JK@JJ2IKOqGJHHh#GK@!CJiF J g?JFAEDH7FXXBBCEԿ##Bv###:"#`MipihEiSECh#b FS``j8 *ѣbCh`( r$(-igbVE_EiE""_Ev "":Zh`B`Zh`X` h"j`B`` bO0MZ;## I]FFFOzqFF=F FOzqJ (F;FQC1F'B@0KOqJHhi%Fܱ&h'jBiBiB ghw`bgh5>`jg`<`b4F(F,0KOqJHh#ddC-GF0AK@!AJAHh@lBO8CFDO0g8@@F%F5ki 00-h@r>F(FOO *FEE 4 Z%5CCC !C,CC,%O! OH FU``abij 3 F`a$hF#FBF1F8F8F0Fs< FN80K@!JHhcdAcc8@`\-AFF0K@ 1JHh#'FOkBkkS$0;>+٫ X P,C@<42FiF 0O0 pF(?Ѐir`hhBh Z``Bh`hBhCZ`Bh`rh( "ahBhCZ`Bh`ri( "bhBhCZ`Bh`r`j(b`l F@0 iF0 'P! rF(F%C_`O3CaFC _aFC_bFC$_b#dO`d0 F0-CF0LK@s1LJLHh>#%Fdl*Ujb kGL #gBBBԿ!!Bv!!ɱ0 Z`"b `0Gj0(0fg+:"J7F6gD0l0#h+KF" F`lC ѫh+Ы|h@B( *k!l G*Zii*zhiGu;FLF F!F nPFKFFhF((R,;F2FIH+h:F1F F@`nPI]pGP7-AmLFFF#h4CF:FOahT0FV IF(F$#hBК m(0P7 R]pG R]pG R]pG Rg]pG R]pG RK]pG Ru]pG R/]pGK@`  `@K"h1 VV#`O0`ϾFmF$B+n9FS$B4  Fر E F H F FM! F F h F@{FC0C F@f0LF"!hF#h%b" hF+hjF I:%C0 kb#hBК'0(0i𵧰MF"FhF!+h%6 F0O0&p6" hF>Cl#hjF I`0н0cb %+hBКR'(0ihD F F! dhh< F u F dh"DFB;;+ "$ F  FF(Ux+RF"(F(K "!F0F (B:!0F"F"!oC0##"# "ic3:`O0=|;pO30Fkc84"1FK FhBF#x`:+ #x8320[#"!oC##"# ")cO3+c `p rKphFFFȱ $h0Fu0N 0dh,i+ F#` +hBКrp(0-OhFFF&,Bh+=ah@F(7hkx++.bi5!ich12HFBF! +z i+kz+rr0 5BF[F!HF $h8h~:<`0h iB@hb#` nh Cj@hpGpLF F"!hF#h%" hF3h HjF I-F%C#hBЙ&p(0ii~nsF+؀h+ԀYh)Ѐ B h`h`FA``nh,bhh `Y`h`-"j+jBblklB0{ZijlZ0+Yi)}Лl+z:0#Zil+y F8 F4 F((F*(^(F(X F @(F (F(S0h10 Fx(0+8h1+4(Fk(.h10[ F^()F F Ph1+(FO("l+lB 0 ʱ[h`nYh`Z`he``h`4`KmhWe```4Bp-C4MFF+hFKi +F i +CГdh,-)+FlFQIhF#),!ќh.,/,$)   h4TDEFF h) i`tih1%F!4iD%DE D nh$iBdh#` F0BЙ (0FFC "I 0O0 -O۰F F!KFOrhY OCqFHU(F}0їH8Fr I$I"F CKJF. 0[x+=h= nhmh!ܺ?/h`H! q F(~qH8FmKYhB^S%@ E%% 5E% ##RC %%$lB3m"S$[<(lB%$ 4m"S$[,4smBsmB%$slBڳl"S$[(sl+B%4  *30F(%0F5(8HGvF"H k@F0 cb"AFr Os x"OC0#I0[@񑀻0a *؇*H* 5* *.A**А*'#: +5slAF0F/hAF HF% #$(0  ki +sl3AF0F (-AF6HF#(0  #= D)=)=(0+ +sl3AF0F(% # I@@F FC e F0AFH F Fi3#d FC0#H0#ld3#d%b% F`ded#c`{h``4|`[@XF+ * **FpGFpGXxCx +? +pGFpG-pC680ñ1O2E Y ZEӲ80D"38 2Ep-OFFFF AH y=!^F(RF;It*Rx*@MK" xh1 Ѝ x1D . *b,`!"hFe p,FPF5FBT E,Ъ7#`O0M0*b*в=r*3,"0,O , "',O #p"1F" F[0 P2*Fѝ "!hF|( p,"p4 "p4nF ##p0BЙ?U X(0r-O FFF>I"(FF (,6$! (!n 0 n0`S03`C03D04``"%I(F ,! 0!3o 0so 0C3` C3`@C3`D4`` (F !3n 0 sn0`0`Pp4``-AFFF xk%#+pkppp.< 0pppppE/!FZF(;D!p" F ###"# "F!FH&1F _(m'F)F@F|^0HAFO0TitCNf M { c  $ $ - C Y 7 M c v    O 'z'55'2#C2#j,_5NKBq!#"FFF 'QG #CH1O7Dp(#"F1FA#x38I F(@E F'qV#1%5'2#C 2#,0"!Fp=' 6D2#'C#2#!#"FpAFIH6P1.+HO78/D#712#1##'2#һC#'2#˻(0Qb kx5t"F#!hwBFѮH'F,q',)@𹄃k+@ Fc'5'2#C2#,}"O3##"#" FF5F+!FHO7e,Z"oC##"#" FF`+d!F}HO7E,:!F#F|8!FiHqO7O5g([(,!F#F68!FFH+O7պO5!((у5'2#CS2#5"F!O72#'Cs2#5#x /! F.F8/!0(F#p"FN/#3p(Fr(#002#'#CS2#_5'2#B2#T,A"oC##"#" FF5.+H!FHO7)6#"F7p9CFHZ((Dz7D58q713D7q',,! FFCx;!FHCO7B6#b!9GѱHO7ٹ58'2#C2#̹7 2#C#2#3"8 "2p! ! F F,#3pTFГHO7648 0F8{Z(ѸܩV7#`803I 82FSFAF0HD5F(80+D39p'8ED5:803D8V52#CqF2,a!x)]4)ax4)CsBR2##x6+cx6+@K2#'BB2#+, "O3##"#" FF5p0+'!FKHPO7,)@l"FD0#d'5@IO0'2# @@2#5'2##C2#,Հ ',! FxF7p F 8FpF0*HO7¸#F9F&J'02FAFp@Fq5I '2# CC2#5'2#C2#451#'pI F\5#'pY%SoͰI F805 #'p`I F,(ЩI F&(5'pO!FHO7G5'2##2#<5'2#CS2#16#p1l"F#0!F0яH'Fa5'2#C#2#A5'2#CS2#5'2##2#5'2##c2#5'2#C32#,ׇ!FsO5F8!F^H O7(#(,!F-%F8!FO35"k(l1FN(?Ŭk'(d@# cC`,u)m"FL08e'q09CHWd5'2#BR2#M5'2#" B2#@5'2#"B 2#35'2#B2#(5'2#"2#5'2#B 2#5'2#" 2# FF6p"F!'(ӭl"(m1F(?&l(eZd@# 0FF,,ք!Fr5#F(?ԭ!FO7h+ HH,5hmp Fhe(HO7,1HO7!FAF!FH5'2#B22#u5'2#CC2#j5'2##C2#_5'2#"2#T5'2#B2#I5'2#"2#>5'2#B2#35'2#C#Bb2#&,:5'2#"B2#7d`7@7lh7@7tp78 #0`/@ h   4[HO7.g(WHO7$$( +1 F0!FOHO7"pO1E ! F FE 3!FBHO7(FF8=HO7# FF6#p:! F*Fб#;!oB"!FFEF)HO7l=! F F0p FFF I FF0FTFC(HO7KFp%0I FFH0F=F,(FpO5%BUfus%I FRF0FEU F(HO7UFpI F:F0FEF(HO7>FpI F$F0FEuF(HO7'FpI F EI FEE|I F(SzI F`yI FEevI FEsI FEpI FEzmI FErjI FE jgI FE@bdI FE5ZaI FE%R^I F EEuHZI F EEe>VI FESI FEE.PI FE%&MI F~E%JI FvEeGI FnEUDI FfE!F@HqO7 C!F;H G F O6K+@#6H%u8(չ2H0Fg!F/HEO70FF#p)I F"(N FF(K&Ox[bhpwDvT@#>YEUF +DF F)41[&1Y6oFo0[&0Y6oFo8F"W3KBo4 mo lo`mo&ncn;0F,69cn;cf nonn;0F,6+n;fno&oco;0F,6co;cg oo~o0Kph6ov0;0oon`0K0F,60;0oZmoX(F@VQ-OFFF( 42# CC2#4Oq` # BF q@ ##bC@,! o4 fH(#cf,! ovfH#f,! oj gH#cgP nF @H0F)F8FT' Y(TЦf  EQF ,olFXH o0F)FXF RF , 4xI@=ffF  $   *F!0FSFXF$8XD Bx + +<\+y#n0cn1n f`f$1n(1#o,1co010ff g`g000OIj(@jIILHT oVj##$F O[ 'F FC- F sF * ** *#*;*8 \ *" TF!x\(2 "(с#( p!2# + I fF  $F"8D Bx + +<\+)d1J?Hd $ <"9FXFPF|@<"F F FUmF 40LoKո;F*F!F,H*F!F;F*H8XF8PF4x*F!F"H'!H*F!F o JK!FFH*FJ!FKFH*F%hBЖ'(0IxU:AF"Cp/CgFCx/gFC/0pGpQK{!JBK|!JHdB h&ñh2]zBГAPB ]h e`M`]h,`P`]`+`0#FpO"U F0h#mFhpGF( K! J Hd p0x@O U(K!JHd@L#hbh Z` bh` nFH"! F FOUK!J)K!JHdex 7U8F(K!JHdhF!F(F87)U K! Jmh+ K!J Hd0"`C``mhx0CUpFh opmhBCh k`cgCh`(FopmhBCh k`gCh`(Fp FK!J)K!JHdBh$1F$hoZo[$8Fr( F[8UF0 KOq J HdmhxXhBh Z`gBh@`gx@Up FF0OK@AOJOHdmjh032#"C GK!FGH-F #G($A(l!FxpF([oo-mmB?0X:0Y6mmB2XoZ o[@@@$$ 0B p!F 0ѧ*h+H)F 0ѧh+H(FD!F 0 H pwIUng-C.NFFF3h 1+KOq+J+Hd4mhxF+й8PhBh Z`gbh F`AFpF(hBh Z`jgbh !`;FJ4!F Ffp\FF@"AFto<`{``g 3hBЖH (0xPU-OF   F]/OH=I= / AF0F AF0F*(O ,|#hczBДA0Bq!FHFT(km!FhpKF(9JP SQF FSmmB@@(єa 2 B` `(  Q`igPF `!FxmmB@@  FK`#hbh+tZ`bh`c``5oF-Mkz,hBЕA0BCkh c`sgkh)FHF`xm0#32# #RS__)FH)F v0 ѧh+Чh+H(F0k``P%F9FpKro`roZ`sg!@FZ( K9! J HcCx+ + d/#`  d( KO! J HcCx+ + F/#`  rF(Kc!JHc~Cx++ ۱(/#` @h@ h@hKi1Pi@  F }(K!JHcJCx++ Л/#` @hCXBXA"I0@ FF(K!JHcCx++ 㱦/#` ChHPBPAh@hKi1PiCXBXA FF-AFF F1K@UJHcCx+ сy@yF"F8DAJ3F"F)hxAҸC1FJ FC F D8 FF KOqJ1K@wJHcCx;Kx+`xkxB 8 F((F ( 8*x#xB(F(( : *(": *(" ) D8@C -AEMF+hCK!CJnGx//F AFBh*DВ +=# @;@B5Ц#,aE FґQ#!#3+A#!A42EF x2)+/#`O0$Fl"hF#0!FhFp(iF0F>0K@ J Hc F+hBЖ@(0"'j-AFCxF++#%p # %pp/#`O0'LFF8F,O4d4!8DFB&v43"UFH5 B M,x8F#+pE KOqJ Hcp,p F 'j: K@ J1KOqJHcP#Cp#p hC`T KOq J1 K@ J Hc2#Cp#;Q+B@+T-AFh$.FV 0D FmF8`U_8F9F0FFDBFx FO0 FFF(F D FmFH;FJ!F0Fa-OFF+m%;So.]=!0F:F$C0B+HF[;>IFFFF츹]_*x1FD`1FHFF@hn`4O50BHFfhF4@F!Fn0 H8FnvDFD|`O5(FF -OFFp0FIP;o+> F \(5%:I0F0F0D<6+*ШI0F(ЦI0FI0FౣI0FI0FI0FhI0F%%%%F#h #"CC# #1mdF({ Fz PFm(kQFJ0Fh HFm(W3F{JIF#h #"CC@ mhF(>oJ!FHF mV (,cl3gIhJ+ F FfKfJ! m>(#l!_J m.(H0!XJ m(cj!RJ mF(! FJJ!O FHFp#hn 0DPFmFb(RF9I#h  nhRF HFzO  ADCpD[h <0FIp'H 32#"CpbPh I0Fp I0FH I0F I0FpH5glteX- Ѹ0ñHpbH- F -G;o- F (ѭHpbHbZj*j*JiZIx$03 F$(F mJ&(sJ!KFP&~ h$(F(#hnHFh$(F$. mJ)(Á J!3FP)N 62#" C mJ)( pIS)B.p0pF PFmB)( QFP)^JH0+7nI !OrFKFt?F(0mB#(VR#0LJh`y qS"Orn0KFJ3-9Ѹ *!F 0:G'(1Dm2( 0 ,IE D0&J0N-@/𚀻o+o!F"F (@1Dm(o"FIo AӀDo %1AOalc-7Ѹ~ *z!F0(1Dm( 0bIBD 3\J00J{-!"FF(@1Dm(i"FMI)-s0Kh13 F R{o!"FF;o 4(1DmX(A{o"F;o6I C4D ;!:#RO3,1Dm41S$X%DF%S%0c4,D"C `/HL+٥#` Y  Q@,CA@<5 R Rz"` F R~j`i:I@H,]"(F_N0 ѥTh+1I8H##*I2H ( OrB$I*FF,H# '3hP +i c TCF !H#"F (F0IH-h m`=UmZmV,?Ѯp|տfP7-GF'NFFF3h)F .#DF+x+F kx+HF4DDE٥ #`BFQF8FV*x* jx*]BF%#IF;T(FD+"p FO0 3hBЕ0(0(;x˳#K"qF&F=F; +ѸB0y>02?*&D"#`4##p<#`  4#rCh FYI@qԀhB F!!!!B٥ T#`O0 F`F Kn:f*oB² *IwmQeppGmmp6F F!sB p%D  FF#x+.+I F(I F( " I FR(2##bC.! Fz#p FpdZpH8F F'- 5 chY9Hch7Hch5Hch3Hch1H:Y0H6/H2.H.-H*Y,H&+H"]*H)H(H'H]&H%H $H#H"HpchX HjchHdchH^chHX 8@S%NZagov~Duws 020@"BhB2,3 h0"BhB2,3 0F0] MF F8F+h5PK0!FK0FJ*! B!FK0FJBO0CB$7!F8FCCB8D%+hBД2 ](0-OFFX(F JI drF(~#x+ ,O ,E)V   ,6V,, *!FF (? "O3##"#" FFB *V,,B O E!Fh O3"##"#"F FB +hB1*h28Fmb# + kh8FmV#`;+O C"0y8Fm: FO0  ,5 =phxS K FF F$ k.. xY\<,pF3p3$0Z:*p4"p0pFp-O F$FQEmO FFF>xy.O+@+ѥ~V#+ъEѥv"#`O0^?{xC&  EE?.٥V#DsBҥJ7#2F(FDO.p;E9F@CE٥0#DD-B #<YFUB#< #+p< F-OFFFFF  CHJ&GKEnKi-J/h (F];! o  h0Aԥ#`Fo \,  h0Ao./, ,*\,O` =/%(FK?lpF6獱/\ (p ?00hp0004p5L67,p?56統77#`O0O+pAFPF 0Fr-OFRhFFFD3F:FCF+@-(F0@T1FF0F((3FQF(F (F0Fm3F:FOtO0-1#lp+pd  #/J0*9xA *p503-#+p୻.S.v *v %ն Qն ж S>DFBx4!CF:FFED7  pCgDF"#`,\O0ZE #4+p :50;(JQF(FC DDE=Z;;;00;;00 [ X[ J[ L JFZZFCFQF(F   FKnj-OFFF FF?FK!*FF ?ۺhDTF8FDD F-k*F h!FJ;F;FJ!FCи*F0D 00FlT F-CF#KF,{FFhF#, F)h F+..Х#`O0 H0s-#0nOb! I0 I JHF . F9F*#0BДT%(0-OFF#jd㹥jչch7"FIF0F#.F(@ #hJH.Bch #izۥh7#%`H HFH FPFB!!(D D(FkV }H #i)FzJ3#aKFKFuJ)F%F#jE^YF@F?F .@0dJfH#hహ.@𯀻00YJ\H#h~0# hF0FBF5 V0DJIH#hG  ,SDj+dлa$OFjED#h 0 #F G  , ,3EhGE_h9*.8F  D D D   G8cjOj( Vl%.F1F(F /9aAmFi,'$a+j`B4nj$,'j`B4-A FFiFd0pCOФ#g/vۤ #`8FkF`F:F@F4C FlV,` (`&z+ Cz+#C#apG D8%@ЊBؤ#`O08C% x$,%00O0 BГ 4](0x j-A4O$Fx0 F;h+6#"F"#!#R0O4?(;kF(F!0+# :2#~0x+Н~ 2""%0F*i*x*ؤO4#`hC @ˀn=F(À*Th :CKx+++x+Ъx+@ x#* ,0 D0F + Ih! 9`#Zx* [h# ( 0#Zx* [h#  x+*@"!*"AF*#0#0*;hI/0Ѥ<h+Ф8h1+ I Hx+Kx "0F CFp<(0@i1# ɇ3ˉx+"F9F@F0ѢF;x+{x+#ppHFxb  ")F0F-$ F,&hBГ 4mǰLFF#hEKOs#!(F0 J9F0F0O0E#hBГZG(0¼H:? H.K0 (FQH K0 (F : K0%#!C FC p 0$ݰ>MFH"!FhF+h[T ;0h"!FhFjF5I0F0!F2H0 32 AQ "("*CCB jF&I0F l0!F#H032#"CC(Or!r"!FI0FL0ѣhV+HMI0F<0ѣhV+ H>[+hBГ](0HilHiW, iPB iOThGiGpG8F@!hKh"!h(FO3#`chCc`8pF@h{chCc`p Fk`p!h0Hp@p4-GJN@F3hch#Cc`chI#:F(F8#!hB  =I=H(F5(.ٝ@@A CDB!+hn(К=0B"F )Bxi hB66 B2 F(@,0|ch(F#c`w'0#"F x#JF!D p#"FAF "h#JF 6`0hCi+G3hBГ(0@P7-C,OF=@;h@(00Oc0#0#08+,  )0#"FHF 8- %D8-I"F!@F58- @H0F h7#`O0;hBГ>(0j-A3+Fhb#4H#"#mN#!F3FBpED@!XP(h%K#"##!K(h! iK^&j.&FVz#BF3F[k{@9FH6{{Yi!(F<0 HAe; fI;Cjs3h+FCb i K#1FcjFH$ K#1FcjFHi(FF0 HU+haj J K)ؿF"!#pT pF`3h3 ICF0` I H$(h+FJ!F4h Fp bP7 8Fh0H8@h0h0 Hh#i#b J)FFH F8@k-CFh0!HC׼hhnh..0 vhh,ЬB"iiBѣh!bjh*ԿBFJF#FC H Phi JF9FFHZ$hnb(FCu K𵑰hFFFhjF=<#0FjJ:F F Hj 4J!FFHx+hBВ(0+M0ShC hiBњhBh#` F8 FnhT")F Fi[dh8)F F8@G8pF@F j H pO3FCO`,! j\F(Ѕ`0ha0""`(Fhhb```0H Fp@hF!h"8F豅h#F"!(h#hbh Z``bh`i FG Fk(F8@88 F@h0Bh F8hF!F F@`KipF0 F㱘hбihhB-- ѣiCi;!G[hG0Fp(0+  pG-A4NFF4H4I'3h)0CFP0I20Cн0+ѽ 0*H[8!F(FGF(2ѐ"6"  z I F0 I F0(FFhB9F@ijXha`*#I FB=0 FO0 F)3hBВ>*(0a@@BqjBl@BfBp-OFFFsO @;h#;`FhMhPFaiC+C`%a"i h3ScE.F5Fh0``h1DBADXFBqD(F*FO53D#i&Dh&aB;h C;`k(F jFI`]BgpFI h F (@,O1FQ) ""0F" +hBВ p(00"Fa`𮺱?-OFF(0+@h"I)8FP"I=0FB:DH222OOP Ҳ$O OH O@ )HFBѣ7#`#K)0h#LLCX` pp$)0#LLCX` pp0x#LX`FLCpp:D DҲ3"#,0C`0h(@ !3=0!O pp3hO S`O O* H2#`O0o ih#C L#CFPBѣ7#`-Hp="!O!O p@#FFreFr# #t@tcab`X4DL,hvFO*F3B #2"<#<h2#"sC Z0 c` `0a`,!F0/K@Q-J.H_hc`i#*F!;F0F0 hX``#*F;F0F0bh#hc`3#*F ;F0FO3`:#*F;F0F##a;#*F;F0F#ca6#*F;F0Fy#atFh+F"!?`hih "(FG(=9F 9FF(F K`KCaKai[#3`d3ih(F:(FJ FH O0 a -AF@!Fyp0KPj Ѣh+y *H୲yCF' ,+j!J !H 4y0Hy H(F2F(F,jIH0h #"CC5# #F0 Fm~l'>Uű.آ#$ `,Fmx` hB٢ "#` ,F#;`BhhB9`3,1 F03F2#"C $1+`K CaH H; O0 8#FxuxxhiFH*F1F#cU(F Fp-OͰ[MFWFFYI@FFF+hXK ZF1F hFPx1FiF0JH8FjOr;Fg8Fj 0iP IF =Hi%6#2F [F h4#2F '[F 4FT 0#'0,037'0' @#*JOq8F,) EIJ%KBF!F#H%I@ KBF!F+FHG'Nh N EI,3FBF!FHGI"+FBF!FHGK0B (FMO\K0BБM(0@-GF"M FFU H PFO, ,51, B#B U,XB 3U,U ,HFHF6,5%B&F, T ,5T,HF0F+-OFFF %F$5LEZҔ ٢t# OTDEҢh"#`O0C#.آ^7#B\6 "IFF(53h RF:K ;FT,<}+3h+(hYF:3h5RF;3`)K ;Fu,4%O64nsnB(#hPBIF;hRFK @5,4KhBБx } i(08F@4nJh"n(FO3fnCf!oK +h" oO3#g#"#8-O&@Fh$ hdciiciai#bh`ca#i&aa8iIF(Fbi 2 Q`jI|FLRF1FFHO3#cK s"C `jId1FFHO3#cKd~@0 Kd#kZ ѣccc`jIL1FFH|k+"1FH##ck zSG{k'{{z*BӸG{1FkH'{{*zkckc z~kg{'{{ zkB z1FHukg{'{{* zGco`jhB єx0I#k1FFqH`jI#k1FFlH # 1Q hI(Fdv!O:l˹ix  aii iBk##h+YKYK#h+ XKXKd#kYѣccc#UJ!ck"QJk!"MJ#k!"kbk1FHH##`@0k2# qQ%01F?HyBF~Or@a@FBF6H RFIFPF0F?(F#o3i aii iB(Fc13(FBCF g!HO+FJO??Og\ e ϡ hF #"3C F@.(pF@`4 FF` HI(Fdp@b"  20a(Fp@p8-GF@F !hI(h+F"!GϹ0O32# Y$s"C )K F #@y;kl+cik`jHh FH(F"!(F3(h!"+F&h&`ii`&aici(Ffadaia#bii0a3&bfb2!a 2AK-OװhFFpU0Cl+c7 2##rC рKS,23 HE|J|Hnm#S#RAA+r@#"VrH##3B2fL#j#!F`F3FBeEDE!XU`p`cl+„7 2##rC SKS|73,JEOOTZG[:F{k@AFIH7{{n0! FEF ?H Oq F0 8HOv 72##rC Oqh F(Xt0˱*ٹh( B  ""JBјx ԛh`#+p(0+kp+є= )p2#"SC&h#PйMOCk Ae(0[aw5~cSc;+й( s#0`#A)3B2#K D#*?(Os+`0k`2##rC@ۂK5" "D0 8!ʱx 2RE=" 8 PF x2L8!x2D$ *XDBTѹ йmt0;xԛhB +@2#"0 $00 <Q +@u6# 0<0 J<<0+[ @\6#0#0<00 <9F 08#0#0zK S BB   й@#h #"3C~ +@SFP"+" F2#"sC +@2#0#00  J<2#"cC +@t#  <# < 0#0  ` 0*<67713 B M" 7!F2N7  D3y13 B <" 2yF26  D89913 B " 9!F29  D0 +@h3#0#00  J !Bx FP!L0;cSc B=Q" x B " F" +Jp#QF@FD2g&'WРFB WF "AF+F8F 68803 B +" 8 F28  D70+A +@Ԁ|#0#0o Oo60E&V B򸀚063 D+ HSpV,V FB0V3BDF +@F7# ;CF&hO  ,2B)R(|R, йԹR,:9)[E]R,3,21 O >`,1d B.BFBF7x2)lB Q(l Q,, ?|BжԹQ,,::*[EQ,,3,0,1 : F "^ "+6pBH NOv <F33B0O !ZF8F  "zp!C"z"#<o@y FBF"8F,o3F8F?@ Hpn3;I FtCFf,Ѡhh+KHh12#"2#m I Hf m`)P7'h#FTJ'  QFhF(2F)F# {rRO3;aD#C#QF8F;{6;x"b"b;pxOpj@#~!;r8F;FObx FnF8FhF6(FhB+E h !S;SF?$?  H9h2;+"'#h #"3CI F# h#F"!#  HKUhBАBW q6EJ(0J!r 0sFP&`1 h#F"1F35[mSK1F h0#2#  qCHf1FF H r#CK H1F JF Fp@ a[J! MJ! Y8FP +h;+h#FJ!mhjH& F H:# F+`#" F#8@8 eJ! ¿p PF1FHN1Fk*kH h#J+`!#F/#"c##032 !a2 Fp@ YJ! = #PF`6+`hh #`+aʹF F(J 1H#h #"3CV,I Fd@C69F F2Fx#h #"3C !H@F9F F!2F9F ^(a Fj(2F9F F0K@JH]hg  C(ah F F+i$h F@z88h0h+*iPH0 5FHB2#"sC Fs#h ##C 2#"sC F8@B8$-OFKFFFh x* H P`E+h+&+GKFRF H= * )PF阱0#!PFuJF FHCF:F1F FQ#j+Ղ 1Kl "<H \"E2B؀@ \#Rh@E3sE5#2F ;F h0#0 32##rC YH0 +0"FUH;33FRISIx+h+u+э3F"FMIO #F"#   p B_2F ;F h(3F"F=I  ѝ0+}љ60X6#2F;F h|0э3F"F/I3F"F.I/HF1F:F h#F@F (HK0Fh>+h +#h #"3C F IHy hI#!#S#RA=+r<#"#(0=Z†¤  }*& O F   0 B_2F ;F h@0+V6R  ѝ0+3i3F"FIH:F1F hF(F H(Fh| + h;3 3i;3ٍ3F"FI"$ FdFPi'3F"FIHy0#"! F !PF h#F"!i hK"!#,80 @*h*@@2ijbhd#c 6#2F<;F ha( h #"3Cљ0 O P#:F1F(~3F"FmInH+iB hh8FgF`(:F/a1Fh h #"3Ci&hki]I Faid+bh`ka+i.aaU#h1FnCf#FQJ!0S0" F`IO O 0+A+DI3F"F8H+Ѝ3F"F>I?H+h+љ0 #:F1FP# h#+`5I3F"F4H 9 2#qCэ3F"F-I,H#2##"#+iB hh~8Fg(`(!HJ/a:F1Fh"@ h#F!_ F06G FH+: }*Kb } Eg Å× è  ø!G FH2hBЏr*pFF hG"F p@FH1 *U4"F(Fp@-GmbNF@3h5n#Cfn@l(FOcn?F #h+ PIQH(F|(l@ !p/ؠT"#-EҠN7#',Bѝ 0&d&@d 0$0 @@0@@@9FEР$#` h+ G.!FF#HpG"!FFH}kjt0iKEѽ  (F:7@,ctn#f G F HH%3hBЏ m(01P74Qp-C!]2M !R D 2&+hF FHF!`2FO S"! .F##0o">CFH#   鄹"F@F;F(0+ H *F9F F !S3h3hBЏ !] (0AđFh!-GFFV ;Oh FFnh0ӱh±nBє= *)PF6X 1FH]KFBF)F F7dhĻ8FP#Fh"!nI Fy>#"#032#"Ccl+ F8@u8lsFh`qh+G iB*@. B<ib Fy032#"Cі@ !(F"(F!< FQ(h+F"!(hK"!#ro0hBѣb F|3h+ F,(Fp@jp  F H032##rC F0H F@HNp F`)FH F#h ##S#032##rC FM0H)FJ F Fp@pP7Z Fh032E$uURobh0Bs"CUIzpGlI-OѰF hF7O2##Ch13 #hH џh0+ ЖIHHJPOq gO3(`!fg hP#"!y+`K0Fd###F" 92#"sC0F 68g#81`0f8(nЖ!2>2# !C9c"C#hnft8(T6p81"Zp81  #h8n0Yn=`6pfV8p)( 81Zp8= 0 2# aC*#"C 8*# FAH =*#) F;HB:H 8HP q#"h#gX2#`+a"C@s"C@&=08a #HD F"IP h#F2F!*0!QC  F&h(a+:i" FhKFE2##rCa(0i. ?UuiwEcSc(>i@70Fg#`+ah*|$+i F1F#@0ki1F( FFر@FfthahBF4+ing!ax0Cx0 hHhK FBg#`+a=2##rC6+k33y^hF??F #&0hEv  sHJhgv#`+akb +ckkkckch F0SEP-+h+`#"+`6## 2#Cal) TH' C Fs"C hjF FIH Fz0#Ch+0SEo/FW$F F=H"9F F!h #"3Cуi[nhsB :h9)ijRjB[h9F F F: h"#Fc!2# CЕ@ hKs"C hK!0# F%E̮2##rC?Į(O0BЎQicScřŶ ϡpOqF fF yO3"f!+F0F((FqciaS+{ 1FJ Hx I(Fdp@HmO0pP78F@&(F|ig@`ig#Hh#O#!FF3FBBDD!XTvRJ[{k@ H7{R;B(h2F K!Ae ;; б8FP#Fh! JDmx0S h!Vio h18@ 8 б-OFMi@,(coB@ RH #(FcgOI-(FO(@iZ@p 62#qCо uz"Cu0+qigci acia+`kj2K!(hdl(F22#"sCL #(F#`!#tcpp!2F X"uU Fp( @CO `@@O opGO@pGHpGXhH hhBhhB@hK(OhpG8 Fnh<")F Fdh F8nhc ZhH hhb@h"BhF[hHx0+@o0 pG pG@ "' `iSi xx ёհ JB@O0XBXAO0 FcScK-OhFFnh,8#j dhp/ۀ;h+@׀x0+Ҁ{o3KOqJH\f P"HH-bj  ,hS FF(0 P 0Cg{ohh@IL-IFzoIF$hA+` ]`03PEO @Fcj$Q h"F(uЈ")F!FHFC -h -!F@F0W00' F<F(K P#0HL=AFAF$yo@1yyo`1s3h+` ]`u`5`n` FOF0`yoXCX0O-h3rh`rhZ`s`? Tcj5h-?kz+E(?@@FȻ7hBAFxD (,B + ЙB?hpbj0>42#C#D0F0-h 0BrЎx0@<"2@FD FHH(0bnƛ2#!CїxB2#@F<" FH" FSF(?bo P D0CCgO3$KH=YFYF@# Fyo1`}khP0khp FAi F*H 1)F CFўjh1+Оdh+О`h+ ОZh+iiJ 1H<hieki hhhB#hhhBaiPah Y`Q`bh F`fMkoB#x0kgF0FpP7 0Po3&2EwW $U0! pGpF@ eFH`0a``Da(Fp Fp-OFFFFF9HEa032##C hP0hhB!< F"IF8FF`4 eF(Ga%a`% ` aFF|J F!@FFBF FH!F 0 ўvh+ I H Ff -##`shc``t` F(pF@,ciK032#RS__Дx0S!(h$(h`l(Fp@!hp@$"1FQxhjB ijB  (H=,(1F(F((<0"Xgx 1F"(F+F0 Hp@ri[*co3hcjB(F#!x0fg(h!(hJao(h1#h+ ѡl(F(hp@῞h+p:[03h#iBapG-O F@H*n# FFF(yF #`p"9FHF-F-Beй4 eF(1HO"8ha"`` 0hb```@3hhB0h`8hFrF0hC J F ! aai#a2hhB"hah Q`ch`;h;3!F(FZF!F(FK- FO}0-GF h O ܱi'h.hlX ! RF4CF0F>h"Fh#Fe F@h` 1F Hk)F 0ўh1+Оh+ Оh+Оh+HxhH`4h"9FH#hPbh Z`r`bh F`F(F@׸"FFF8F F0  pF@F̱$hVH0+єI0+"1FH(mB Fpx+-CFFFF032O iY !C!F3FC#!@*ݝ#"!0F0x#`O0"F+FRKBCKm`Cm `p-GFmFn H"HFE@e#` gj C&j#l+>xq:и  #0`"l+HJ1@0DcjZB8#cb#jX #bBRF)F;H#cb#bm8I8J8HF8IFO6JSF F)FGbj#jQ Z)F1H F)F/HX)F-H ,H!F s?F'H>gb&b-mcj#j(FbjIF;OB2!mgb#&bCe FO FPF; E  .SzȠ ]-AhF%#"f#,Em>"j  F56h"Fh#FmZ#e&#hbh Z`z`bh F`XԢl*l"m bm#H5C1F 1F FDF(F-ChF F#"#g#,`-&h chs`0ch`-KmLգh032#RS__;-#hbh Z` bh`h"Hh|FhhB Fh032##RCѸ #C9F 9F@FX Fk-4F𵇰NF3hnhE0h !0Тl;hS@Bl{hS@B "mhS@BbmhS@B$h Fmh(F3hBЍ$(0-GFOOF"F F;hXO ! d$F(vHeO3Xw0O 3FrFIFH0@R_Е Fo Ѐ. Е .#1F*H.ٝ#`, #*FqF@F`6b{Cs!\H.# |pP#.! JF`^ F HR Fe8 ;hBЌ(0&7 FFF"11@4`J)FL 0h@H cm@H"@Bњm0h8FP50K030(I" FX0BуmH%m!CcCeO3bCbK0! hJ! hI F 8# F11 |@0%`ZhB``X`O088 mlpFF(6PMphQhKY`QhF `e~h*`.(F!!f h1! h!p@y(Fe` h`#F2F!p@PpFeN@K-OH hFFFF&%,O!F"QH;XF0mH+&=/ /9m աh`RFH 1%m#em'#hbh Z` bh F`_X  mYRLC # e0 FGmC@e.(F -OCOF@;h!,t">H AFp0ffKF"FR &Qh (oj"IF o o"ˠbi`)F(0&H#(0>H")F"H8/0")FH.ȱ0n0[hK")FP > .`n` ˠa!;hBЌ#(0'j3;F"I(0 Fa F!@'j80!F d"F HBFC/`0; (F F8?-OF7F08<n*FFF(P-F(,hD"YFH $h.vБ.TmX#CCeH0+0єI *,uD#H0+ FG ##CeI0+ѣm0 Z`` `0 G@Fe ##C:.#hbhZ`bh F`JF!F0FJF!F0F.# FOƹj`#FYFPFF8C# bcb(8ˎ##`khc``l`oFPFFhLhBhB$h  c(HJO0h```C``` FMKAj-GhFF0+@"(0 32#Cil1c"Cѕ(0+ѕ=@,,)"FI0F("F~I0F V#p7(FF("!rK@"(F#F(|#0O6 Fb3bH 2#"cC"QFHF+FoAF Fd0K0d00(0+1ѕ=0+ѕ)0P0*0Q0+0S`R0#T0,0U0-0V0.0W0+*FR)?eShCedbV#`dP0 FdV# P0>h FdH1#`O6I"HHF6h. m[032#"cC3wh`H 1' Fd#`IF.#` |4{h&`1F Fc``|`F (F!(h&0F0BЌ@(0go-OFF 0 hpHˆ F)#V#T# @F# 3+$O ( "VIPFZ*FRP?;bSh{bh"MIPFH B#`| j#C #C0n0hH"1F(%(0TbM YhpFhFF!"h"!h#F^#hbh Z`h hJ`bh`)F|"9ld Fp@!pFo&m*Z"HhsmC@em[ԩhH 1`!&$hhI032##C@$\&h0ѫhp@h) pjtnF#0 hH 1A#ࣹh H 1S#0!hhWhI@ɟɹtp-O`ax&xBҜ#` p``$1!(B hhB`1,3,Рp-OF 2h#!FF! 00B@l@,[#`PKBBDE1@XU#BBBBpژ@ rHO l@)`m nU3B2 eQ \BB B Br# $$|P'-z)j)uJr#(l[PIBBD@3BXPZEcEB!!cEr !!1mթh`?H 1Y)F 0 ќh1+Мh+6HT#kb+bO m#He' b G nW3B2 g\  YZEcE BcEr # '-h4/:F!@F!O #C C0h!K !0h I0FC0F ; WtK!-O=˰h 29r@% 4`F*FJ0FO O3 0JF!"#@D EFѓH.#! {.!H_ XFF(j+@032# Czx*@;x+<Ј+@.! {H )zH!}K.#- !Fh{tFX0+!BF mHi1h,rhB"1F ([$h.cH!K] +!F_H#z+cz+!ZHA QE"!(F(= p"(FAF0! MH-1hdhB"AF (:$h! cLF(D@H$!>H /۔0!BF 8H#!0(h4I(F@G@O@n+! FG#mB2F9FlF(Ald##e#9 `ˎ."!#F"C|/0#F#m0Fc(d8H Fdp(0(Kiʌ 'ʭt2F9F&eJ KAFHFGX F{ynh0f+"AFH2h+J#gB##gh cg`n# 00OA(Fo+mBehyJMsK)FJ;++AFpHpx2x nHAF BAFjH0!@G07ɲ?x9B$#(QBhB9hAF[H3,1AFYHC03xBb*N*W*\(AFQHF-Ǟxxsh h +GHAFG>1ˇ;x++{x+AF>H BAF;Ho/;B " F(?hrhoAF/H~gsh#(#0DN$ (a'0,1BC h0S03xBHhAF1"FJF! FD#F!(F2F0𾀻+@𠀧pO0 2"!F0F(nн20 +  ؚr# `;HXFh3SsE2FFB ٚX# `.H;`."0F6hmCem#C#e8ˎ2jB1bmsbBe+ B803j+ B0NF  Hn'n(0 "CgχϬ  B0C B03#+ @BKhBЊr#"(FNF(ˎ#3`0s```r(0-C*FFFF  H&F"PC3#000O30$ bCF:FIF0F й+h+H O0)o jo2 K@ J HWCF0F:)90@@#` -OFKװ`h0nUb#3f 3x+@9 3 2#!Q@,3h+V+h" >FFO, 0O,1,3IE.t p"B S, Z@B2S(, S,, @0xB721,37;!| 39133D#F+hnL04+3nx+@ KUhB(1#ZF!O O +h #1QH0Y#00#20 D h(0mEO m 90+.0 ". .p" 002p D / F:F :j X9շ 0B3"IF zX +(HFˊ{j00O00O20#F C rF3CBC Fѽ.043.0?h.0C'#00#20 `2 *1*###q4!FYD320203 691p"200 D 9!: Fq91D+? "#0 20O D *h,q,7*h0!B"W(,W, B2xB Э00 $+2 22 3,7203WFpԱ-O`ؚ# h` hBٚ"#` 0`#3`,0BhhB1`3,1  F-O'-:FKF@F!h d3hHF#0@##0Kˈ("#n!) cn :F! H#kl+"!(Fp0$C0+00s#h+є0+є0++jKˇhK'n8xx x{xF`H=jk0!32#`Q#bjjj L!!RHXCc bQH!jB #NKBx D#bKKj+ #b#jBO OCH B"bJ:ID!b c+k  {7F{)kձHHF,IOzwJpM@' {PMOzs"FK#'j1[b/F'bF93B2# K/@Y@@(0ВПг;;e6ЪB@ IwDBB'bH#K;D#b[ Q#EzKOzw##b L@' {PLOzs"FKջ Fh+#bڝK;H:K J'bBݑK H ;D#bkl퉋+"'n 8xFL:zk{@AFH6{{xx{xKFLzk{@6{@{sKOasJsHVjk'3Fb!8Fkl+ "an n1F(\н,0+Йr#`S̀ 8  IFN,0;!;#`FF )3I2#EK D$xEId!2" OsBxKEOrIFFOq4#;"$Fع"z)(# )#*.#+$#) B C H lO0E"0 IHOj2bnk B(3F!C %Ae;e6B@; :/Jl. H 0FK3hBЉF5Z(0I 1I 1I 1 FH9F&@#"(h!#`b# ##bc#+F2F oa&gfg(F0:FIH@Ǿ(F@zP7I 2!7FP+oS032#" C Hx! "#b+`#! hb#Fcp F0  I H0@~ F hK"! #"0јP7 :I` 2I\ 2IX 28F@\#h;+'h+FJ!-# !#` # Oq b(Fbc0 IH8@-(F8@$8 2P7pFh+F!J @1F#h+HH#"#`(F#bcb # #Os"#E02FIHp@(Fp@ 1Ѻ)P7-C8NF F"7I 3h CFN # "OqG$=#;F0@O !JF#0@"#0H X h3ScErF–Fѫhi " F0#$")!# F;F0 Х@+FJ!F H~ F4дxO0 F 3hBЈ (00 A ;-GF@F mhOO! FH G#h"h! +(h+F!##h; +5;AGM h1Kh1h1Kh1 "ao o`0+ІK h00Os0#0O300rh1yKh1h1wKh1h1uKh1h1sKh1h1qKh10S` Om 1j B`IFfHF6h  `H``0{0Z :Hkg{'{{$z00^:@kg{'{{%zJKh1  AF#h ;+ # F+90IFZ2ؙE4[#00Z2ؙB4[#00Z2ؙB[ 032##rCO3003 032##rC(F!03:0#030#0,??陙  E!Q+29AIRtҝ"h *#@A_ Ѡoa#ogcogn#gncg#ff)h #"3CЗI(F#h OO+ +###`0Z2"hIN* F2F!$"_0Z2 ؂J!(h"P0X|J(h yK(hO3"!8O `.?mX3j 3h`iH 1%$Ch`dH 16mQ ճh"$F h3F43hqh Y`qh `S0F0F}VF#h  +1FMH011F0HHG1FGHGFHF1FG!(h!(h@1F>H:F@a8FOrAF7Hbo!o8Fp@,8m  *$hZ"HhmC@em[1F$H,h #1C12 qC3"C!h(F(hRg 2) 2 3U EI 1Ҧһ#H38FP*o+hZ 22 Q+;"+F F # #+`+h++ F8@h8 FHf F@Z FHY F@| FHK F@Ӛ-OFPFFF +n H x + +h++ѰH #"9F0FP0BF H,1, #,01BAY,,   C3x B #9F0F#0CF HhY,,  `C3x B#9F0F@ HCFh` , 3XFFл 𥀻@C+h;+*** ;F"1F F#:F1FCF Fr0@ F'H0Z@#"9F0F(#:F1FCF FS+h0+ +u#+`r+h+r R"9F0F0+h LK<B #HH#T+eRFDH6 S"9F0Fo0+h 9K<B #7H#\eRF2H#:F1FCF F0Ѩ :CFF )H 0F[F $H3xJF H$nB ٨n`8F_pfHy:F1Fn*f3x+k+h+h0Fm@A@1hӾ4]QDԃԝԷ )Y3BF "HqFCF`2 Hh h #"3C)#FJ!g0"! `"bb "cJ ! d F0  I He FBFIF FRo 1 :fP7-O=wN 2 \ 2  3hO(O F FHF`!.BFO30 ZF! 4F #(, 8 " F?FZH!.# 2Fx1FSH h*F 8F6F( "AF F&H nBynjF 2F BH "AF F0?H 2Fa#x + 2F:Hznh-T0;n+CF"F1F(F{mha n`xZxBѠxxBxxB nbxhx`nPEѐExpEh  H=F8CF"F1F(FBq nxxIxH ! 33h0BЈ =/(0yՂբ;!hFh8F FP"0- h!8@/8-CF@F \H\Kpzп WH:F8F!CF08FO0O o#I=`IF8FX#g`g8FcoO6X+h #"CCjє(i.f AF@ zFp?F #yf[b(F ##!oboA0Z=Д *9ЙF#OfEx-032##rC" HF&!(FE o`l##gcg+h #"CC є03. 0F+'m>ř-CFhP 13 #"3C!lBF  3FJC B32B~I&<˱|B1,Cp:C 13xC32#"#CH\cTh+H\B FTC:"TOpO3&0>`0 5\vE-ҭmU+*~:h*h*i jiڱ+Oc F *~"x+h00#`0C``6#O FFsE Юm f3.! #h O 9YN)K20#CE! FSC ј h+:"I#Hv30 "! `"b!b ! c)FH3 F0*FIHCP F hK"! # FCC A P7_ ; pFh #F J!)FH&032##rC ` F! FI FE032#"CC F Fp@)FHp@Ӽ 1ցd֚-GF,Q FF&,5O, 01, B#B XU,,B 3U,U ,HxFHF6,5%B&F, T ,5T,HdF0F:003mH*h pG pG0p FF p@,2F)F F{$h FpFnFh0 mh@,:F1F Fb$h(F F pGpF)^?] ]]]?h+U(FQ032##"CFh*$ +@!)A032##"C6Oq _n`Oac"##F"C/0&"`!la+F0"1F(FP H*FI(F(F pO0p B0k"l!h++ټpG F!-CF0FFh#32g g +F"!@,y!h)##`7>"C9 )7kl+0).),)|#!#` # b! b(Fcd0 4I5HC|(F0+Y"`(F.IC&AF(F#o`Jbo#og"g"gbgЃVW__I(FEIFo`, n`(n`& F`"#0,hn3h+ [h煹 K " O3 1P7"F?0FS H FI@- dFh#FJ!0;@$ Fe$h B(-GF FFh!ыm+j+(h #"3C`62g'&W03Ѭ09KF"F@F1GL-OFFFF++ؘ$#`K0(M,aO O, 01 `E  0O O, 3o0 `3[oE  O ,&0 E  HF PF^(THKO0KFRJQFJ#$;2t2 ++ ;Z 2KEҘ#`u00"@@ @^o hB0hB1,6+ѹ )F F FO hB ,a"0B1hB2,6疱(h9FK  D(h9F3 K D t_ F6 +%OqF _FH&F'"C!0#F0F9F FM0 #{ 2FIHqI Fh@O0P7?pFM8(h_> (`h`ph`0^(`0 #`O0p#`Kh#x4;#x:+bF;+^1`v\+x310[:+,FpFp'krpF :(N(F?KB++@,:*ф:,p#FBBxC@*F pFp:*pK`pG`0FFK0x|+:+#KBЪB T;;:+|+"FF0O00-O4MF\4 + 빷L&hֱX0Fdh`^>F(w41F,D4c\4O`^*F(cc#S (𥀺#"PF# "O@ # 0 '>FF,FKEObAFPF PFRWЗh(F_4`F 0  + /.!F;FBb'FF痹:+^4F&\+ + + &7F&F':+&F'#pbB (F iTIF_P(F_+ՀPF F.ڀO:#Otrp+b+x+#+X(F(y4O0IKh((F#="FI(FxF3*:*O2pF\4  3 SF  FA PF(F_8F(G0F:#=#F :( FCD<:+ F:#0 E(Fd _v_Dg9F_H(F_PPF` /DDDF 1F\D8F0BFHF, _2xu'k`iPF: aK`B(F_H(F_ #`oF` o&pO:&pF( 4M# FO3B]LhD#` a``a'k-C iM#FF+i)aheL##ibIh`(]I F ((h00UK"`IhQع O0@,ы0 @ \h, F"D,+#xD L2 @:)#) 2<\+#ka<\+0K"Zao,L hO 8?c:+ш0#0\+;hQRh@,zFK@`o AF/ |*"pO32F8FnF+):*+`D  'k:r8F F )F F8@-GF="F(d ^F8F 'd O:O | #`T+:pF8k#x:+ (O;4kv+^+cx:++4M\+Jcx:++У0*4#+tE06"x0:*1E+%B+C+#%N+R+F+f+c+e+b+r+ t+n+# # # # p4 p1 0F d^@ Fd 0F^00F_NoF.` FO0F=";Fгd ^=Fd# #`&J;Fp8F/A:*+O5p  Fd^8DFd# F^( F_oF4`(FO0pF#"Xx0+ CxX+00!! !8$/0޲ . ٢a+آWA+آ7B4,` pO0p#L`h#`s IH``0 'k Gw-OFGMFFJzDNOajhJpk7F(,z# F3`v !JpxhCh;C`+ڋj (0hZ`x +  0IKXFV&(<AF('IXFV%I,XFV( "n(x+0$сE+K"FGt47x,(Ѣ p3C,"т 3pC, (* FB "`'k 'k( KZhF"h* D(FFW H'k 'rHF0K 8G'k 8%L`h%`Be`8'k 8F KhF)*F %F%87 8H8'k 'rH8+FO*`0Ȅ ,`8 88F KhF*)F F%87 8H8'k 'rH-OFhFFF-ȿO ̿$O4e0Eh;S(IF(ѪERF*FBV 0E0EF*  O4d F pG pGpGpG pG pG#L`h#`s* IH``0 'r`Gw-OFLF0FFF @F k:8.@JK"0F` !@Fz혹Ch;C`+ڋ (0hZ`x +0"!(FD8I FU(`.'9F(2I FU0Ih` FU( "n(x+Ѩ`E%I FUr( "n(x+` FIU`a(I FUZ(I FUR(I FULa(?|I FUD(b(?t I FU%H QPK     t 4KpL <     Kp PK QPK QKphPKT xPH<\ -`QLM00R,PKȄ000@$p0% 48 0<0 40@0 40D0 TP 0S nSl a0CSpVnmBkjihgfedce&`_^\8 VPY T000V000 VPbY T070V070x VP4Y T000V0008 VP#Y,T000V000 VP&Yd T080V0800oS| VP (K zVPYV000T000jP iVPY7 0 `VP  ZVP  TVPaYM T080V080D< DVPi @ ?VP D :VPNY< T000V000*V080T080!V000T000V000T000V070T0700 (KV080T080V000T000l UP gT UP `h~0~ }}}} ||||t|8|Lzz -LP@P@`Md < `  \ X t@ p@ l@ h@ 6$ K`K0 @3@0tK=p- TpK  $p@ rIp@  dK*p@`X p$XpX PXP$KX00$K@ -L|Ÿ1M M1MK \ @D` PDd, h< 0"$D"Ġ "( p`+ F.K BD|p" BK4H A08\ d,@R` 0 X< X<h,R X< $X< R gHZ@(Kh.K1K;@D B@AsT<SH 0p ,1 0X< a00ppH,K`K$Q: 0 0 x#  nKpW`0 '%$0S! 0  3x 0 0 #  mK$0S 0  3x 0 0 #  mK0$'0s ' D%D#Q0 0 ġñ  ı̡&#̡ % D#!D%!D# & D% #!D# D% 0s &!D& D0s % 0s #"DdS&!D% #!D% # D !0 D!0 ! D# #z #tD`c0 DDh*Md0 p ` )Ό   lK pW`MpW`0 #KD`c0 DhMd0 p `p` 'Ό   ԌKYLY 0 #$ DR S  R SQ $0 h$% h$0 $% 0S !0 !#D$"D$!Dh%0`H`LX\0AS"Dh$$0S"x 000 ,00,0( ,0 ( 0,0(0S  R $ R w`W d0 p`qL#d0 kLd0 hL%7 bL0 $%LQ Dh$%DdSl0 &$D%#D#"D$!D$ %o XK|K'K!P D Hv.L P0/& 0/%0/#0/T$X 0/%0 \@000#C$0S?"x8 $00$03  00 0. 0000 (00 % (00(0  p hp} hfl`dQ 0(0,0 $0 %0h0 0 $DP Q\ 0R S00 00^lhhhh`h40e dpc`d0 pK딀d0 K$7 &0 %#0 $$%t`{ -LMP =P0(2 :PU00 X gK`}K 31Cpo`Z@P`po 0K v> 0c/&0/% 0/# 0 1 41 0 $$%| x t p PLtQIp1SFʄ!RC|1S@  R 1S&0# "0S FSYdSl0 &01 O$KT`rK F<0 \, ,2 L04Qcd@02 4 vND8 @D vO?K4 0RA S?  UQ UP PVPW,2Q 1 } O 6?K P0Qb 0 0 #0QK ?K82S 1T1"R1,"R1U10"R14"RK 0PQx QQ-T2% 0!E>C4" 2 @0 K'@`p` Q`x0S IOg_K0?K E&?KK@ 0 x Q0|1S qW .O?K("@0 (K82S S01  ?KrKK FP9  0 v  LpoGJ 0 , vnL `Fa =JR1 S0!0S( 0R1 N  0`VQp 0 Ep 0`VQpN0Sap`N0S u$4da`fV, ϠlaoN0  (KN#00N0S0K0 x 7x/K`Q`1 !A !A pWo/K`W}> ?KK >S 01 _6}K0@2 @PgKS`O0HpN?KoK@ rKЁp P9 0 YI@ᓜ (U0"PU͠ @@<$"0K 0PQ ?K 0K KPm3N0S ͠ @<$")N0S  0-L@SaB =p0ᑹᎹዹT0Ὸ0T00 R PQ R  /  ʄdd\00DP H0  " /0P/ /ccH00 P/A>  " /0P/ɨ| @- @TP E.   P K -LM 0KK #  K?  P K <-LM K00"KIP K^00 P,0 00 /0 H744 0-LPBU@ J,,0 ? P5/0^\ 0-LPU@ J,,0 ? P5/0|^0 0-LS@P 00003/0 ^ 0-L@P 00003/0] 0-LP|eU?o@20S 0 003/0t]| -LP@CgTUP`Q$ 0 @4/] 0-LPgU?o@20S 0 003/0\ -LP`F@P$J,,0  @Kh/H\ 0-LP@P 0 0 003/0\t --LM  p@ K 0003/K|\ 0-L˓p@ 00003/0([ -L MԀP@(0K 0`@p=(0S I@(0 ` ,`@:62.*&" x/p/h/`/X/P/H/@/8/0/(/ /////////////////////Z2[@[0[[ ZZZZZZZZlZXZ@Z0ZZYYYYYYYYtY`YPY@Y,1 -LDMp@` WPP00 S S S H0 (K>080 X `F 8 tP V0F @@ 0 W S R-W p< 0D <L 4 H 0 W pGw pP W p WW  4 <R  V>00ą@X0000 0(K  PP' \< DLPP a0b @V> ̅V Ԁp08 0d 0 0 @V@< ̇<Q2 p40<PQLPDV D ą@LP pP W X+ 0Q(\DLP a0b @V> ̅V 0 8 d40 40Y0 @  < <p4 `0 Vpą@pP W< , 4 P0 V pą @X;080 L;080 X 0T P K<< 4 0` Z% :Jp,Q]= l1 L> XP Y0TPPP a00b X  Q@> Ʌ\ p08 0 d*<00 0@Q@<ɇXQpg 0 @ A paL L`H l>gL` `p@p\p @ @ LXpp6̠6@ KD QWdKp`fK5 Y0X TPPP a00b @Q> Ʌ\ p08 0 d<00 0@Q@<ɇXQX`\ 0`PQ0` ,\04<\PPPT T 0Pą@PP FZF H0`P pPW0 X Y~QTPP `0b @V> V 0 8 00 d~00< Z0@c0 V p p@PWX0` p00S=0@0D&K 008 gYP0 0\Q@X# 2Z6,X 4 HQY0TPP` a00b ` Q@> Ʌ\ p08 0 d(< V0@p00S=00ą@0 Vpą@r0` < X <4 =Z HP0`Xp )Y-QTPPp `0b @V> V 0 8 00 d00< W0@0 Vą@pPZq X0 Vą@<Xp 0` < 4 740<PQPPT T 0Qą@PP H0`P PZ0 X4 Y2QTPPp `p0b @V> V 0 8 00 d00< W0@0 V@PZ0` ,X 4 0 Vą@0` < X <4 0` Xp 0` PX ,4 X. HQ+Y0TPp a00b X  Q@> Ʌ\ P08 0 d7X< P0@Z00 QX=ą@00 QX =@DX < ,4 HQ.Y0T PP a00b X  Q@> Ʌ\ p08 0 dX< P0@00 Q#,4 @U00 Q#,X @4 H<< 4 ,X4 ?<XUU| 00-LM@0@$K0 p-L M@`P 0  4/Kp -pRLMP@`  Y1`P,/Da`P d0P  p" 0(K0S 0  PpD0S 0(KȠ D0S 0` P  00`  PpD0SD 0 D 0 F`I8 DHHt -L M@ ~K8y #-@Lpp` 0/S /jP g0P S 0 S / < -L@AKJMp @`P* /iKKAP9p 4: SU | 0f`PP KP 0 KD@O00@D@00FFh -LPAKJMp @`P8 /i@P 0rSKKAp) 4: S T 0f`@@ K0rS CP00KP 0 }KCPO00PCP00E` -LM 0KK #   K  KP K80Q 0 080/ -pRLP@` %pT p-L M|0@P`S  |3Kp( 00 pP0|X -000-0LM  0 K --L M  K -- LMI4 P(0  0 Kd 0--LM@HP  KQ0 00-L t 88@ 8 080880088  00<J 808800`X/ 00-L@@00S x00p0 X d PP P00 ?,<0000&6P0Al<0 8 00-L00 @x?P80@0800` 0-L@k?P80@0800 0-ML   K 0-ML   K -LPpQ>mM0`1  @P >[K!K͌V @PH>QK!K͌U ?P>K!F͌(T ?P=GK!F͌(Y ?Pt=K!C͌  0S ?Pa(=K!B͌80S ?P=<|K!̌X ?PPa ,p-1P㘑x!  A10bpaFP  pQ`W, 00000U e? PX"BP0wsL<11 >,`0 1P0`1 2C 0P%]UQ @0E1 10x1 Qr R| QEࠑpሡ0 P  ``V|1,0 x\?  tp PHQB  D1,00x=p1 ,00P P0?3300wsp1Sz!B,0ADa1P , 1 SH0P?33 @0fD,00x=p(K輑|1S% 1SQ,0q0` , UH0 ?33` I0DpG,00  xo=p 1PS1!01 S 01 =t0 1 0P0|1 @=01 P x! =L0 1 0P01 P=q0e1 P0P01 =P``0f1  R001  T|"!B!  崑21Cp1 =1 V" ,pPpA0 0P  p(_W,p000000 U e?- P @V1!Rp!p0 p! 1 TK P @ 0\|K P @ 0\ PK @P   0UK @   0YuGK P@   0TSK `P   0U1QK p`   0V[K 0@p1 pAp  0\@!,0A10:|q1W|,0BAD0P , 1 WH0P?33 @0jDp,00x@<ph?xq^  Y?K|1 0㈡ p@1W|1|1 / ! Zp!P@?\ 1OK ȁ `@1V11 1 1 Y`PW @0刡0 @ȁ\8!10b!1 S0x!1 Rx"p !Bม2! 1C1 1q=1 01 V( p1PA,0  P  ]Xp1, 0   U e? P @V1!R!0 ! 1 ?Q E/K!  q ؑ p`PV11  VYP`0q Pؑ?#Q  X K0㴁 Q Pء @ ` Tq @*YP2 00RX |1S' |1,P=p1 0 B AD0 1P0 P4]U,P0000  0Y i?3=0|1 S11 S) B1,P AD p=p1 00 1P0 P]U,P0000  0Y?3=0s t1 @pGSx1S+ 1P,qx1=p1 0BAD0 1P0P `\V,0   0  0Ul e?3=0x1PS1P1S-1B,`ADq1`=p1 00 1P0 `\V,0`   0  0U?3 =0[ t1 @IS *111Z1?3pQ00 K|q 刡 p`P`FXP 0V0000000 Pሡ|qex?3pX00tK| `pP@`!XP 0V0000000P p|rP?3pQ00L K0x |q pအ `P@@WPt T@` Px倡|qxp?3pW00`KWPR 0X 0 000000 8 00R80000SV `@ ᴁQء -LC[Mp@p Pt3[/Kx! ?K͌lal (3Q/Kt! ?spK͌DpDq 2G/K|! ?SPF͌(qPQ 02PK ?c`F͌(p`` u82`K?spC͌ ̀pp 0h1pK ?B͌8褠ᤀ Z1|K?̌| | 0MH1TK ?B͌T@ T |1 t!px`pPy(K[?Kx1 !b Q?Kt1 n G?K|1 0{ PK  `K 0 pK  |K 0 TK  p-LPML`@ 00  P`@ Kph p-LPML`@ 00  P`@ KpX0T 0 H D R #@ R$ 00?H/,L0 D D 0 R #@ R 00?H/(, <1-L4 00S7 #@ R 1#@00 ?30DRH0P+ H0Xl@c@`hpT,010^  \ 0 T# pW?SPHP0$0000?30D,0 00xP P0 H-?30Q ,@  Q0GX, -L M0`\S (Kv8Px@q8P#T? p@00 RPp@P0U0 T0 UP W@0 @p@px0pD0T PY@Ud0 ?3 R #@ R<   0?33H0UpP @xp,0 00h0 -S`L@P` 8P`0 ?3Q @Q8   0H0s 0,0 00 0 H@-?00S t@03@ 0 S00x0 DS  R  0S |,0 00P 0-LP \T@0S@0T0 0 0 /4 2-LB$MP@040 0S00 | t0`p:h"h8 \\ƒTTrH LLŸ`b @`< `4"b `b0`0 00$0 0D0 0T00X00\0 0`00h0 0i010p@0 jp4`z2P ``8`0H0b`<0b`$`2`j`T04` D`h0iX`0`\```@01 [ 1 0 %  0 0 W0(K耐倀p `x8` `t|0H` ``h <`  D P0H0D0 @00@0 8d48   -PlrLM`p V@P @2Z 0#`` b"" bbdbhb``c ````ccc#`TPV c pQ )p|L 0p RR `b0` ``#'P: `0` `'P/ 4p+ "p' ``0 'P  J%NHr000S :3S $K|$WW$Kh0S+Pj@ -jL$@|}JWW,P, P00 T  KhW \1-LT M` + PNO0 S:< >|:^0vp!0#0 'R0111-0_1111|0o1*0!1f0㄁1 Q 81 Q 0S KQ 40 0>h0 U  K4(0h$ 00A  S/ <5-L4 M pPk@`+(@t0p0,0(T4P. 3b P4!&,@-0.@@*+0@`af@@@ghi@@@jkl@@@mnq@@@@ p <8H0υƅDž8DžDžυυost@@@uvw@@@x~p@@@ryz@@@{|}@@@% 3$`1P5,(245x2523e1d2`2=h@303:|Q R 21@ (  R \(KQ 1 0=1o{hI @@ \  0(PU(`00(K>Jx<u^rvo8#l:i0'f#c #`H#]p-Z-W`_T|QoNpKrHyEzB{?@|  0c 4S4X &6 0(Kp PP? 4t&P 40 /.000b40P ?!PQ&0 ;0n TQPaPaU 0 4 ;0_p@ @0SH4 @ @ P?>PP0c4 4$R\0L%0 0(KS0 ,5E00?c pc 0@P0 8 m @ pV 0 i4 4PT0 ;T0 np{ P p 44 00 $ ?000a 444 P?Π  0l4S0l#0 e00S80. S0 3E00?c p K0@Px0 8  p 0$4R!< Rh P00?>PPPcTS{(0@PU 1 `0$0Q L 00+PR040 04 ;0p44P 0/.000b44?>0c4 4.D04H P 0A?o2   `$1E00?c, p 0@P. `000`00ĔTnQ  H0100A4 01E00?c p] 0@PY 00@000! 00#@0s4 44 00 $ ?>  0c 44@ thPD$ D <  0*- 0 00044 4~$ -@LLM 80`P$0S0p7 PS0:Ó\>Q A䃃300StA(Kh30h0 X T300S 81 X0`:2S P A2Y (KTPK@ \K 0\ X }v `TpK@ \ 0\KX   p  `K p' k`1JPP00AP0S  BX9! `Ka0@ 30S0:3S \\00V 0*`007 0@l2Y W/Pl2<l280S 8M/P`LQl2U?;~0l2\8p2Y=3@t2! PX  4/P<3@t280S  */Pt2?;~0t2W  /Pt278t2X>3@x2! P\Y  /P<3@x280S /Px2?;~0x2W .Px278x2<0c(K00@l280S LQU Y-80S`0S   )Pp0 D0|4|l0|h0|4|0|<5|20p|2$ 0!00@x200@t2|200S0X0 K?T0L%R+4S 4S$0?o2!0t 0rr B|2S < H5S 1S0פ8 8  0 00<0*00@- $@ P@T@P XP@h@xP l@lB`pT@tBHx’|@00@5K8 4x8 80 0Q $0X0 /4 -L M\`@PpT 0S"!0S S0WXT00(K 0  -LKP , 0 S0 2 t" ́ -LMPaP`2A$K p `•RA  R 000@@  000( (  p,0 q( N( ,0P ,0 ( K( ,0P   QpG\p0  0ϸ t | < -L@+pP W`GPH`0 |"0V00"1@pG 0 l 2@  -\`LP@T 0S1 RT0S@@QO0SLOKhHO -lL`@pT 0S"Q0S S0YpT 0S0 0-MLM0Pj@BKP @K~H 1@pPPP@W 0|" QU B+ P*#@' VW K<D 4k\ - PLM  R  *0K  KP Q`0 00-L@H00S T:  0m000 0-L`@0S) :#RA# # PL0pP :#sS#:# B0:#!BA##p\0 -LP0 M 00S ʃ0 K Kɀ8 80 0Q $0T0 /  0-LPឩ|@@p00@ /0ST0P0:3S < <0 00  :#0085 -L죟#p  3EM< 0 @  3S040 0Pଓ*8 B `P&W[ p p P@W Fp 0 ? @#>  0c 00@0/"1 RC P\ \v \W00e S 8 20<03`p q0@@Y0  |t" ,@0 ? @#>  0c L/o00"Qp P@0`00(K R` ! 0 R    (K4`00 RG 00?!#>  0c0S0000(KS0@@ `000 A? @#  0n0S  i8 00<03`Kp 0@@p 0}[(K\008 H0D006Dgggg eedd@ 2-@PRLP`0p 80$0SJ = Pc0:#RQ#R ` B#0Q0Si42Y $200Sn _8D \ 0Sl0 2,0!0s0 S>00S l R00CQl0S\0,L0 L000S.p  h R0 \00S0  pL0 P \0S,0 P0 J0 l0 l@P\0,QdP 0PP01` p0 0,01`00 R0` 0P- 0<0 <`@D$Px pV P0Q?3300d ,0000JL0 <d,00T0 0PU0UT0 00S@0 y<00QC@ QTA@,d`LP8  "1B@ 0CDP @H` Xp 0`<@0h0 P 0?3U ,0 F00V*` pW <0@d DP,0H`Xp00T*L0 0H0 Q00L0D0 @0U&<03@,t h00 T00S0?3?SO 8}PJ Xp 8@@puP 0P `S @WXp `00S\000`0\ 0 S0(00Q`0000:3s  Q p00Pp0 0\\l00pl PP , @P0tPL0P 0 P!00LPs l9 @08@00900S0@0 0 (P !R 9 0@ 0,@   8P !R 8 0@ 0,@ T!R   P t8  @0;@0  00P 88 s @0:@0  00P 7 d @0:@0  00 P 7 U @09@0  00P 7 F @09@0  00P H7 7 @0;@0 004P 7 ( @00@0 00P 6  @00@0  00P 6  @0 0@0@ 00P X6  @0@0@0 00P 6  @00@0 00@P 5  @00@0 00P L1S 5  @08@0< P0U P BR L000S 0#=0CS a006S 0  @ `D8P T00 @0SD0H 00R0SB @0~, ?R 00TP l4 (4 0@00@0  00P 4 m3 0@00@0  00P 3 Z3 0@00@0 0 X0 幭X0Sh ?3R< 0XP  ,xP 2|@ 1Cd  0ChP8 `  0@ ?#U @D X* `哭V 0<XP, dX x|@`S0n `0C1#Dx0 sH x0bX Qj:<ASd*Q  QD `0@2< 8 3080 00p 080 X1 0$L  R <080 <080L00U 1P00U R 0C0@0Uz <0 U0Bt L0<00<PAQ 0D0 x000<0 T21C`h `<0H 0D 80 @PB`D4,$LDX <[8 0 0gp;(KLP< 0, 0@ 0@000cL C1 H0 8@ Xp 4K40 KsPZL0 00 :DP@H`Xp<080L000S 0#=0CS@T @T<0L  0AP U  CtP0  3<0L  0AP P0C0 20Q L0 \080 c\@,0 0  L00#p`(KP \,0 \  RXp8 ,0A0# 0pS P21C  Y  Y0PS  `v`V8&0  08 @ 8 -6&!L00<L 0 0CP0 0[@0 H$@0 R(D$@0 D RL0 <0 @0UPP88 `hP @P 㱫0X @?330L0 %\00S00 B ? h#@@ ! R / @0@50p0 0h0 0S@0 h0,0D0 0H0 080 . Hp p0C< T 80 P 80`80  T0,01 Qh PU @@ U   CP<0P08p HpH0 @ 0Rd0 J` OT t DXp !<  `P < P02`<  t , 0 Qh pPU @@ pU  PP TXp`d 8@D RP` 00H 1V00!@A0 3@0S h0 PP0lbaF @0 P  U @@ 8R0t 0P C10  aX Rnt x ` D1T 0 0|p 0 倐 t0T SRʌ0H0 t0d0 0D0 t0@0 @0X `S`0,H0D0 0R)D0H@0 @@T0Vh0d @pPH08 <` U@`0  @Y `) uP<`V8 D @0 D T 0@0 SH d0 H T 0d0 ST X0 T 0CX0 Sx|p倐L0 C80p080 <0S I`y`5@0p``Wx|p倐0X SP 0lJQ0AP0 `0@ PD9U @Sl(P @T$ 0D,0xpL0 \00l0 l0S\0,@0x|pd0倐80 0D0 ch H \p0Lk0`@ 6TB T> `P PEU 0D@D0@c[AP p000 6H @ t0Rdb P`,@R0b0D < t0 Q,<儠  p0 0`` h` | 0 p @ 0 P80 0p 0PP 00PPX   p 0P 0 0 B  P0 P0 0p 80 P0@Px0 0UX0 I l PX0X @P@@ P l P-X0xDW 6H0 @ P lHP B V 00$R D</o"Q Rp P  RH%RDe< /o"T  0 8< a005@  P0<Pf0 @ M00$R_   80 @w< /o"QQD  0 8P *00Pu p Rr $RY P P<4@ 0 8P0 0p 0P< 00P f  00p 0P   B  0<P PP  V 00Q 0 8 P< 2@0P 0 Vk$R < R  Q Rp P  RL5SP@08P0P0 00P p   R P fQ1@ I 0  < 00P f>1 7 80 <9P V p1@` @ ( @00@0 00PJ V $1@  ` 00LP: p0P 00S4V 0@` @  @00@0 00LVD L  0`0;H5S  R 0 8 PP $00@0P 0H V@X 0-LPM@P`0 R   K80   0 0 n0l/ ?00  K8p t  p0pPKPp0 00 0-LMP@ PdPX\ `0hl \PPP K080 8 0 0 n0l/ ?0K0@ -pRL@P `` @ PPV 0-@PL0@T0 !-L 1P00 0SHpp?spR,,0` 2aC@`T:pD否x+p0?330 @V D倦0Z?#R R  R D0 00, -PPL`! @`0`PU0@ TP 00`@PUTP P!@UP @!TP 0-L0@!T0 -RLp0,S`P P @!T0` PS RQ 0"2"#,,Q/  00C0/00 -0L0S  )- L9$M@ 0P40 0@80 pP 0<0 ^P40S40`chY80P l pR b R Sጐ```Y`V ) 5 <0 )@ ^ ( PU/ Π   l(` Rf( Ra e P T ^ѹt h8hXhx0dP`Hp00 0 @0 P R( R  R  lP R# OP70 R4  8  (KQU.``pbPf40S  !\g `g 60 R e Pwgp`T @D^P0@0xP @P0S  @PP! Fp@@Dl R\ \ D&@ n<0 ` B ^:&  PB4@1%0  @P40aQ``% L  Q % 7UEP@0 04P[ 0 CS<0 Rz@`(5(U0$P<0 u 5p000 0`@P 0S @4P@0@20TVU00P @$2 1C ,@? ^ 00P e<0@000S P00Q |#4@0<0 !Q@AQ Q@ t@ 30@0 ,  @ c@0@p3`@ dRT#P3P0D0 H3 0< 8H p0 <0`00@PU;nO N@d d@T"00PD0 0S lP t" fl  X"  RW D0` iHRU@  PJ " G! `!qQ pP@T 0@D@0xP 1@` T R}T ^ R 0S <1 @ 80S59@` PP R q z``d 8x8|T,phhTPpdhH|d, 3-LS M|CP@0p`00 W a000岽0pVT   p`@0T$CQ좟  0@DS00T" 00lP  R " v20 0Q0hP dB@ i`P 00 00CSY  PT 20  (KP @ M!` 00S&T ڌ1 2@T hP  PG $  8lP @T(10 1 0 0p0 S  C b@ @j@j0 00S00h0S0 1 0 [ @ML0V0S`00  _  0x8`4$dX<H8l -L 0  -L 0 1!0G- @ *⤂Xdd!0P U- U/ 0S(,p`pG@\  \03@0^0 000P 0P  \0`SX@TP,bAaF0U  03@ 0^P TX0 00 0Q 2S0l%R h%R //!R!RtP//H` 0 000 0/` -LUPP 5p0|  % \2̠`sK s0!S@ 1\ p0P\`  P5 0P ,5  5 *l"0@ @ l%R h%R 0 h20 d"2s% |202,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d2Q/\0S*nfg~rfQ3 S*zo|v`~fQ& SQ" SQ SQ SQ SQ S{Q"[=B0Y . 0 C C S0/nBS p" ڃ=,0,0 C Q@"n 0@8@1 :σ@p"bV, h2hBp@0P! <200P H0Y 0H0JX ,01 0 78 00Q ^`V1 0 *vf㊆po:/f z*`v`fl*vf㮆pp^*fj~fP*fvfB!R 0 h2l0 0 !R 0 h2%R t5S 0 h2t` XPp1 00-LG\ PBP0D Q;\9, 00ʃhœ\ 1:p“ ^ Onpƒ 0n^Onpƒ 0A\ B\  0    X P01@-0G$ 00` PAʀ: nOh0^000 @P)#0000CS 00000000000000000 -PP@LM@'\U! Lnf pvrf 0 P |P 00  ,0 KK|`XP`0@- T\ P  nVLpFrPP 00 010-L(0 :h2S 1@0@ 00S 0n008!*?pB00 R 00@S0AS 0l h0 000:d/ |00-Lt@P@00:h2S SL0000P040 ( @000@000`Xx 1- QL#@P`@0# R!@C@@pȠ hQ Q?!*?QFn23 B|20 $1  1Q%*|20t!*?Q n23 |20l 0  1Q*|20h x0 @0780@0v 1Qm 1QX/\0\ 00000C0Sp 0/ Sp Rb800C0Sp 0/ Sp RM0 000>;??-RQ,0 !000000000 0 00 0-SL@0  P 0 na@0S01@-` 0pP0000s0S5 0@P0^000C.U 0*S /SR000 00C0*ST S-Lq$Mp`80 Pa 8K  80@T@ J !FD  q H L  5/8 8 @T7 $T <RT! .\  ""1><0 ݶ<0P , KD0"080 nY00S PH 00 R0SL0?@P 5/@TY @ 0FRs0  S00S (KL0`0@0@P 5/@T(K$ "l ! p-LMP@` 0S 1Q 02S0$0R  `@VKp00 -L$M0 0 Kt( 00-L@M<<@ P@ P .K0, Pp-LHMDD `@P0` Kp(@-000\SS ^Sq " %@@ 1 cS{8E AETB0@@l lLVAva`@f0@@L LL}T A! 0b0000 ' CrQ!  @2! { S @T# 00DS2@!0\S# '  00 000 0% @@ + {t00@00s0S 0 1P00C@R00 B Z` -LM(0KKPG(p1$`N;AL 3H gMM%1sa1cb00T@`0`K   0-LM 0KG k<7@CSL33@>Cdb@LL3?1c2cK0   -LM(0KSpG(`$@-( ?,D` 20`qb*E4ccAb0 9 0n0`K  0@-@%@p 0  -L$M8  4' pP 8 70 8  0  |\ P S@  @`< H n m D @ ,S} 8 @000 80 8 0SS  Qw%S080 + HGRSQP8NMLIHGFEDCBA@>=<:876543210/.-,+*)('&%$#"!   kTH0 S\R 0S0\S 0 S000 X Ph0@ T 00$ <0  000 0f0 />0000 00 0 00 (K8 P0 R!.S R*S8 0P ; 0 S\0K 8K00% +0 @00c @0 000 00 0 80@`fv`70 S@0@000 00000 800 0 SD0@0k   000 00000 800 0 S{ 000K8K @0  0000 0 000o0  L 0  0 e<00 L0@0 @80 0 0 SK\Q 00dX% @0 `f00@@ 0 d 00v`0 800 S.\= 00%`f@0 c 00@v`0 8000% iX0 @00 0 80`f80@v`3T 00\ @0 wp 00(K0K 0K    0p-L@ M`@P0S PS 0  0 K00"cP h00 R  QH00<40x 0 Kp`lH -LM0 S 0K0K0KP0S pKN$P0 `V$@PU @ 0PfSFPKKD`A`6P  7 K `  -LM0 S 0K0K0KP0S pK) P0 `V$@PU @ 0PnSPPKL`A`P 48 0PK`  h!-L M0pTS(0K0&K'0KP0SA (`K?1P8AP.0< X' PU $@2QCP @U 0sS @PUXW @T dPPP K@ K@ K` 40  -LTMX lpwPP P0KX K\ @$ h0 :0R0K& @P 3#0 x0 p >,0t0 d 0l0 0SN  R T0KS K`V{ #V =V =᧱P```  0`0 00`Xd-P[  YV 0 0SS |pP Z0 0,    EdVP ?d`0 PSE :\ @PP@lb0Khp``W` @T@,00 0 0 dVP=0`@0@dKWP 00(K,0K 0$0 T@K;$Pl0倁P `` p0``  <@xT`K P$們 P, `0@`0 aT`K1Pt0倁P P 0`0 @`C`0S (K` 44x0< j f # L\  40 0 0S0-L@*,0QP P2,P,0P0Q 0-PLP@P040, 4P0 -L,00 -L0p@`P %P0PpP sP lP0@TTX 0P P10BS 0@B0V`!D000 -pQXLsM` Z P] 00S040f yOK$ K H @TzK 0  0R ! TK0 K1 0i1 gQ %Qp gP! Q, 40,(KP@%U K!p.?Qi 0EXSWTC'zP iP@0lP \p W p1!0E]Sfdcba^]Z}X{VUTSRQPONMLKnmlGFiDCBA@?>=<;:98[)543210/3-,+*)L'&%$' =9 . RP \  01Kp^ -0 0Bixd:0000{ 10E07Pg0p!1Ktpi `10As R0 pORWP (KpI@`V P` 00040v P, 0000pW/ 0G, K00 !p!U ~UpOS ,K000 ,0K1p p 0PU PE,0K0P QUP pQ ppQ %Q0 0?R ;RP@pua0As R~0 ORc,K,K1p ,0K1 0 ]1S101 1SQx1p0x1 O0PU ,0K1PE0P XP0 j0OU ,K,K!P0p0P 00300S , K!0C00 XX% NW!P{PJ ,04 p 40p0400PU| PE,0K0P QPa0As R, Kp1 Q0PUf PE,0K0P QP Wp pJP ,04 Wp 40P4 0pWA pG,0K0p 1W` G,0K0 10&PEVU" ~}|{zyxwvu00pOS ,K,K!000 000'SS 0S'S'SpcY00S 0C, K00 10SKQX ppQQ %Q0 0?R ;RN PeR`30000s0S0 0@!0 0 0 OR,K 0 , K!0000}SS 0S}S}Sp P 0Q rOX ,0K000 ,0K1 p A0ASpP@oA0AS3ApQ,K1 0 PT1T000OS3A ,K,K!0p00 00Q ᅭ!SõaoSaQS0orK00p0E00A00=p007 00 200-00(P  $ 00 PR pd0 0P y4 - -LM 0  K - -L M  0 K - -LM 0 Kp@-p@00/Sd -`QL MPp@ 0S! WM  P( X'  x00 X3T   `PT00g 00 KTd KTƵpp0 0 R0S TH ೵T0୵UPpT ࡵhD, KZp 2[S "[R1 000ST00P 0 `cuhP 0 PXu<k0g T  Qp L (  L0R -L MKG@P K -LPp`PPP |s@P0e V PpV vo -LP`pU@  P T  -`RLM@pPi 0Sf%  p@ 0! p9 0!p2 0FpQ & P'     0R 2K2[?s0 "K"[/r R00  "K"[/r R ( K[qQ02K2[?s0S02K2[?s0 S0^2K2[?s`V$ `P $`0$K00]0 $K` 0K"[/rpS ${ 0 p$0 0$Tp 0S &K  p $岐 2 aCఐ2[?s0 ` 0nX sX fX0/o`S"p R0p 0qQ:2K [qQ &K0A qQ 0 02[ "[/r R?s`Us`00`Q02K2[x2K 2[?s0Sd 0Co`&Ksp 0 Ⲁᰀ2[?s0[0q桏p R02K2[J "K2[?s0S? 0C&Ks   0U Q02[?s0 ^ṖQ   002[?s0S U````t`0p02[?s0/U  R0d0 -PPALL!M@0 '(qpPC0;`P> 8@K4K0 ;p 4 R@;(K80S 0rP@?P Q P@X X0 00 0 0 019;P84 d " c -LB~KM pG` M0$ 44 0P:SS @T:T@@a R  Y R _,0K 0$44 DLvP P`0:S (Kd2 -LXŸ0MP MH 0@`p04 p/P2 0/Sr P~ p P 0 (K0P BK! H mP0 /pW |0 d0P 0S/SpFP  X  Y P Q# ZPBK  @hp 0,p,  hWZ 0$p000(K0  pU0$4000     H    -LpPSP` h@d@ @ @-P Y , 2 C 0 $KkG P --LM@00  J K 0-LP@T0S sP0 -L M ^@KfQ^ 001[?s0S nQ sQ0^0[Ͽ| 0 K0K -L M `0X&PKfR0X @00r[w 00P  nR0 sR0X02[?s0@00 K@ K -L M@`pP;PU-*0<jP, ,0K< / c D0D0<0D0D <0nWP D p> sW' fWD0< DH00H0(K0 *(K<zP0PZ 0 ,KD1u /Q0,K!`   .,0Kv /!cQ00  !0S+ ,Ks 0q/!nl   ( R 0,K!a 8 R.,K!a H R>,K!a `(K, K01b 0 ( R $P,Kr  /q l ` 8 0R 4P,Kr ` /q l `,H 0R DP,Kr ` /q l </ ` 00 0@- 000@ 0 00@R" 0S  Q \T  0S R@ \RES00:Q00Sx  00 \ 0-@PL0$" < ,K0h -L,0KMl ,#d0 ,:00 @@P ||PP0P03P`0`0LP 0<0 80 pP! V l0U l0,doP 0S l  "! h )|  0 0p0t s`0 _ ` s,PY ,dJP 0S| h .S  ROSA = ߥPP# ڥ@P2 P ?p`Pv  nsP @Kro@00S@Pv LP ,0K$uP _Qc,K0t@OA`0$0 0$0$ (0 $ 0(00TSl0 0@`4` p0 <KP < 40儠 0p删'\`  0 WP W^ 0&\W00S> p`@PW0  40b4 Q*<0 Cr` r ,P| , K4,7[?2b004 3[, ?2a04 040,04 40<=4 804080 4 CV&\0%0S0^W0Sz pPW ?Wp ppp@\p p6p@0 00@ p00@0`Gv0S"0x0 @u 00Np \|l uUx0a0`F@SVv```H`peE0G/S񏐪|sq~}jf]p40000  0p l& @0@Sn p@tP ` f:P P , K t0?1b00 00P000 0 l 0 lz<1 (Kl  0s0  gg 0p l/ 0\p 0`p@\p 0\p 0\p 0\p 0\p 0\p 0\p 0p`\p p@@ \p@t p @rO PnP+P= ,Kt0 $?1a0b0$0_ 0 lNP"GP0l 0 f0  l p@ 00  n0 @< q(K xp @r' ,Psp`PVP ,K4,t0 ?1a0bb040, 0404 80 4 080 0 l'0 7@lX 0P     d 0p-LH`KP4M2 @P KpU0 00S  R2Kp d L!-PDQ@1LP@ `p9 0$1R0  ,0PpXW 00|0PgQ DZ Q @9T0@P|00PE400pg0j P`p 0-@PlPLP  $,(00 T 000`0 000/`$0$ 000P/ /p` p$P0!B0//  -LM`00K 5,p0!N+AKt R2gM%PAងd1sb00  |?@Bc$d10C>P K  P0`0K?// 8 -LMp00K C`40,k,'@tR20K@Cl ᖂf 0" ^?AcB@d1dP K ԉ1P00?// H -LM@_(0K 4(`$-( ?,DRS20d@0b *ED?L0Ldd4bQL@0  ~?Cc$d1PK %  -L-@ h0h 000s@ H PJI K KHKH  Kh8 0@-L-TH{V@(M   SL59"`M up/KiQ)pH1 ~}|{zyxwvutsrqponmlkj{X3~Xt5oY52 D \4 ?>=<;mM876543210/.-,+*)('&%$#"!      gcP0D0 ʘ$ 4@ P0S /2'L"KDK1 P0S !00 $KKcP0D0  $ \4@ P0S/2'L"KDK P0S4 00hd!00 cP0D0 ʘ# 3@ bK00sS8 cP0D0 \# 3@ P0S/2'D"KDKPF0SL3 0040!00 cP0D0 " 2@ 00S/2'D"KDKP cP0D0 ʀ" 2@ KP0S DKP'0S h2@@@>$0 "00 fcP0D0 ! 2@ KP0S DK~P0S 1@@@b>0 "00 ?cP0D0 XX! l1@ KP0Sh DKWP0S 01@@@;>0 "00 cP0D0 .  0@ KP0SP DK0P0S 0@@@>h0 ~"00 ? p       |   < <  H     h cP0D0 4  00@ KP0S  DKP\0S l0@@@=0 B>"00 cP0D0   0@ KP0S DKP30S 1@@@=0 "00 cP0D0 T! {V<4@ kF{ { 00S DKPP scP0D0 ʐ# {F3@ {k{F{ { 00S DKPF ZcP0D0 0# {3@ k k P0S DKrP0S03 00!00 7cP0D0 ʬ" {2@ k k P0S DKOP0S2 `00!00 cP0D0 k(" l2@ P0SX/2'L"KDK+Pu0S2 00}!00 cP0D0 Xʠ! 1@ P0SE/2'D"KDKPi0S1 P00]Y!00 cP0D0 2! L1@ 00S/2'D"KDKP cP0D0   0@ P0S/2'L"KDKP%0S0 t00#!00    (   P        8   0 cP0D0 P  (0@ P0S0 "KDKP0S|0 00!00 LcP0D0   0@ P0S0 "KDKdP0S1 00!00 )cP0D0 _X! @1@ K00S~ DKAP# cP0D0 ʨ! 1{F@ {@0S/2'D"KJDK'P cP0D0  " 1@ P0S/2'L"KDKPe0ST2 X00gc!00 cP0D0 ʐ" 2@ K00S DKP cP0D0 " 2@ 00S/2'D"KDKP cP0D0 4# 83@ 00S/2'D"KDKP cP0D0 ʄ# {3@ k k P0S DKP0Sp3 800!00 rP0D0 7 ~P 20@0 $3P0Sa0 "KDKP0S2 00!00 McP0D0 t" 2{F@ {00S{kF{ { DKaP 4cP0D0 *" 82@ P0S/2'L"KDKKP0S1 00!00 cP0D0 ʌ! 1@ P0S/2'L"KDK'Ps0SX1 <00}y!00 cP0D0 ! 1@ P0S/2'L"KDKPc0S0 00YU!00 cP0D0 |  0@ K00SDKPJ G $     P       |cP0D0 0  (0@ P0S/2'L"KDKP0Sx0 |00 !00 xcP0D0 ʴ  0@ 00S /2'D"KDKPI bcP0 D0  ! 4@ P0S DKyP0S3 00!00 >cP0D0 X# {3@ { P0S DKWP0SL3 00!00 cP0D0 q" {2@ { P0Sd DK5P0S2 00!00 cP0D0 X" t2@ P0S+/2'L"KDKP0S42 00gc!00 cP0D0 \! ik1@ {F{ { P0S/ DKPQ0S1 00C?!00 P0D0 s P @10@0 H1P0SbK <{Sk k  DKP?0S1 00!00 cP0D0 qʰ  0@ P0S^/2'L"KDKP0St0 `00!00 f l   L 4 (    P     cP0D0 +(  ,0@ P0S/2'L"KDKiP0Sl0 p00!00 . ,{Sk k !00 "# SOK"00 `# X# SOK"00 {Sk k !00 " SGK\x"00 " J" " " " {" QSGK[!00 l" d" \" T" SOKD!00  " /SGK6"00 ! ! ! gSGK""00 ! O{Sk k !00 x! GK;JS|"00 x?00S[ :L ??00T00CS0STU 0PEd@ 0S Sk SW A?0"a@Dn$0SV$   0z@6?`0Ua 0PEd@T$0S`0  0@7?`0UL 0PEd@T$0Sv  &$    0^K8?0` @`U1 0PEd@T$0D`S`< 00`@9?0 ldph\*X P" B010T :50PEd@010P+UL,0@ S80 0P<`@@< R 0P/ST M R S00S <0 8 @ bPR?01@<0 @dP00"1D0 Pe 0 0 0$0? S@@0R00 GBRR ,H H @0T ,0TRPP0SX00 0R(K0 Sd >0 N?6b@0dU 0PEd@T:z H ;@a6a H L?08 Rt <H0 bRQ*0 bRz;S ( T0SG?0_ H?08 1UR00XP z;0T :0PEd@00SU8LQID0z;J?0\0T 00T : 0PEd@00SU  # D0Up1p!W $ R P  0cQ c Z  0GD0Pg0gD0S 0D0:?00LP0   U  Hp$0pS Q D0S2D57YU0 YPg 0D0;?0:$Q$0;80S @H/D0C80 0 @ LQ,  R=0 U 0PEd@T;0c?o20)$0Q000  B(@q&20b0#22cQz0SN % 0  G$0SO Q  RUg 0PEd@T 0S- L Q?`0V0LP0 U QO?0UL 0PEd@T<08 L bQ1R00S 00 00 0S@0b  L 00S9  R,&4 &,<0 04 S 8Q#0<  L  DpC?0W U8p1Y p1W  @Pg^D0@  g8  pg@ 0DpDpU 0PEd@T:zD0@a+106aD0`l0Q\   BTU PEd@0Ql0@DaS d 0$0C 8 S 0l0S> 0X p0/P0X p0 t0PP0 + ! X : U  Hp$0pS $Q (D0S2D57YU0  0YPg~ 0pWU hph U 0PEd@ 03>0\hz6n@l+0.S5S S  T:0PEd@T*U 0  @`M4DR ab,080b80 R0 1z@6c@cy @" U l 6`@`7| h D?0QU S0h 1l0 0390 ^Uw p hhp lpUp 0PEd@0390 ^php6i@lQ6c@cDM?0U T ?/0;0 MLp@ < 8 P <`@@0?/ S Pz8 <`@@@ +2&8vp<#0#W0 $ $ K?HL0w@`TD4Q 0XP00T\0G?0La@D LQ0$ @d $ T0DpSB?01 @`  $ @80`<0  Ra0PEd@T[*U 4K&44`K30K 6`/0/O ` 0@c P9  qr0 Sl RC0PEd@T=*U  4K&44`K30K&8&l20K1`KrFI?L0\ 4K&44`K`30Kc@ gLP?00P0 \6`@` 0@D0&aP0l0F?0T6`/0/O `0@a(0 S@`0(04 4K040Kt030K,5?0O80@`<0 0QSF ?0S$L0'  p; L@0 080P0<`@@@L`( &b0@DR0"S(0#( t0h0 p0l0 彟S>0Xp0XP0 0 0PP0 & L0|(  pSS 30 ?/=?0L `@00 4K&44`K30K{1p d\hT \ l0h 0PP0 m L0T)  pLQ/l900 Q?@L`LQ/900 0-L@MPP08Q $0(3/$0(3/000P -L`P2pP@0 VR 408 c4 08bU000p -LP`pP@ 0 S>? R  P00R   0P ppR?p0 0-L@P0  $000L2 H"0-LMP`0(0 Pp^u 0SSv @0< 0Q3@<0'A,K 0R#4 <0@ 0 Q00cS R#2Q SQ0S0l0^@P D R 00cS  Q # 2R S R0S  l0S 0@00a@@??0( 0R $K@0Sl0SUH -L=P0A/Q@o -pL@*WPO 0+(`3/PPI 8X ( 0(3/P@ 0 0@ 0Q@ +P SpR *S>0p X a0p08Po=RTS>0 aa P T(0 8#($03/ -LP0 :+ 0-L@P0Q    00 -LPCʁ0+S(D LS;D`O -LP0Sp0`@G-M@`@$00 SR 0`P0U0SC`0tS`V$ @0` 0 `0 Ѝ0@ 0QY ^P0@0tJUS 0V0P0S@\P0d0^s00R0@C 0S0SPRCRP P9S#0 4 8< $ @ (0 0C,00 00qp 00R0 0 R b80`0P<0u0 00P080an 1 P RPp00J 3 0S C0 4R0Cs04BSZ{ 0 00᳠0Zl,00 Sg 0X0 @hZ 100$*004S0cS   0bS@0 R:(0 4(0 00R00S:40%R00S4$ 1 A   0 bB! tЍT @!Y10  080@0<00 c/o9"0 S  R @/o"4 %S  RB Ѝ hK08<0P @!p0$ (0100 ب G-@@M XP\`aUE0&0 0 N @4` B8,pP0C$ 0< @PT,pp ``(4p8` 0@P@0P@3 00A1PS@2%e@30C0@a1PS@2%es  P0 U0؅ 50C0e2%0P@@@D@D@@aAP`2%e @T pPT p؅%tPpGdpPe2$@T@|Pe$@T*0@KT @T,@S(`@e@ p0e`N<pTp@<@dS`P pU0CS@PpF`pUpFpUpFS PSP00@ 0@X^1a:@0 0a@\ 0  0c0 0a0c0^0%01n0c 2n"< @@Ѝ@ ??01Q00@P`@E a@Q100@@d@p`0CPSppppVpES PSP00 @T$*@d<@`4@S@eP(`@x`0epPN`T` @  4< 000ӗ1х1&=  6lx 0Ct40 B6bxt00 8 VAl:80Hp0XPD0@ 5#Tp4P0H0P0PppQx0048 Sh ` Bl w\0S c80ol0\0900S9 t ^ft0 Sa@ R. S\ SZ`0p S`x0d l wh0S" 8`ʄ`6vVP`!V9096&0CR l0t 0Nl0Rt-(Kt`0l`Nh0t"\ l0R8 bl0\0P`0Sl  P x0l +l p00c Sx0%x0`"h Rl0@S 1 #P&) &R \ R8 b0l0\00(Kl8& VP0P V) )h0\ R8 b0l0\000S(K=<L x4-L0$ML 00 t1Yl80H 0X T0D"#40 H 0@ 0Q ,0 aA?C0CR`P@p0FpP 0cs0#00CƊ0s0S !I.p# 0  30җ1Ӆ1&=  0`PtU& e00 BYat0oSe l0E8 @@80 H0p4 `H 40 T0 XD@<0 <DP P40 `4 `@ l @P9, 0H0  `@4HDP80PlPQq \ 0lR8 b l0\000S](K8 P6F !PƊ90960Ctal0oI0tl0l 8P`0lP0XT H0< 0H0t0!S/L R S S(`lA8l` 0 c ` V:& 0` `.0Sx ` V* 0`j f 0 ,0 S R j0 r0 0 0 ,  Q R I   R.   0` `0S0  0 P,0SQq: R)00, R  Q*0 a0.00 [  $ R,  $ 0` `0S0  0 P,0SQD: R00, R  Q*0 a000g  ,0S 0 Q0S0  00#400q00s0SJ 0 a000 a00 0 `t0`0 0  R ,0S00Q\$00P0 \s0s000 0 0#400 0 0 S0 S00P0100 0 R  00 0#400, R. E  P20000 #4P tP&`Pl8P 0@ 0^, *6fƒP9096&0Ct0bl ?oA t2l SL Qt QXT Q Q`Pl80^0^< 00`^`^`^`^{`^v`^w``nSoob`V `^  0b001&=6&0C`0btl ?o``P 2tl 3 0 00003X X 0  X  "0Sl0T 0Seb:X4P 6S \ R8l0 b4 l0\000tpjl 86`v!ྐƆ9096&0CtpRl0pGtp0l0 WEt0SX :Xv 6S \ R\ R8 b0 l0\000Si 000000  00#400 00 0  0#400 0 000 ' x<L0 0 0 0 0 0 S0 S00P0100q  ;0S0  j0 00.\ R8l0 bV l0\0 00S>L D0 !B Ht0S*l0\06\ R      -LP`plPLu@F U00V0B0V p: 0S: U Q 21CP  0 |0`2 1C @0 0 Rz6S S L0D1C0 060PL D!B h 0-L@ P'0PQ $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/qU0000 -LM`2 080 0\Pp00 08Q1S00P~ 0Q} $0S xV`f0V`F00GQjFQRf0 R XbFSo40 媢ZZV @&( `4/@Po * *J40 @02A0`p0 ,XC4*P  jL0wT 0P(3/ 0 ,8(3/ 0 L@(3/ 0 Dv(3/8&Q 0( @Q% DPQ!  00 60儀 $0(Ko(Kp080( 0$0S|T080$0w(K"40 8 000 -ML 0 0 006 K -PL@ ?o2PPt`0 0@ 0Q@ & 0(3/@P&@S 0 ,P(3/ 0 ,8(3/ 0 L@(3/ 0 D(3/8P1 @0S. DpYWpp( , 8 ), @@ $L DD  0&&0a ΄0 0 &外0$0˄;< ĠG- < R  Pß  0 R <#;1#0#$ #< R B2 p⪢0≒  p<@ 8PPPp` k a,a,4@,0,\|,ll \̌a`& `& Pp` ǩPa Q P%P%,,\\H|P,̠[̌ LQ ,A ...^^~@.K\̌,@     PPp@ K ̌A  (@  PHPTp ̀L\Aa $ W   PPp@ K \A   t R@@B@@@0 QP4PpP [ <̌Q1   R@ 0 0 <#T;1#5 XRG-Mk| 3P=N0'0S|`M0Se @.0Y0SZ @.0 V0S; @.0 U P 0  0  0S! @.0 V P 0 0  ܍ U VY V/ 0Q /0Q /jiR ȠG-p0 Q RR  Q0q/HS/pGQYPiఐ%V `VX HzX`dLK.K0 000\`0S` R ,K0P@ R0000F` V(K ` @-\`pPPa@@Rp0 @00R" R3 pP@0V 0 Sࠣ࠳ R^S\ \ 1>>R pVP@0 S++=°0Ѵ0°0ѴpP@0G-M0S0@@RYZ= 08ʀ1 00PUᶠ 0a?o20S:UA0PU`@`~`@``!apS>0v >0k. n0 `cpC ^0ʰ@PU 6Zs 0Z  @00Q0Ѝ0Se S 0> 0bQڧ>kBP@ p`!r p  0P#40&0b T3s00&pgQ} @Pk`pGI2s00`0 0P@@#40&p0b^3Ws00vky@Pk7 Zs00 0 0@@#406 c0CY" 6 @ U+-6Pʲ+ hSk.ڰpH@3`s00`00@#400aW3s00ἆ Xy I@kr P8s00P00@PP#406c 0CR. 6F @J pkWI2s00vk.y70/궀+ hSk.[ڴpH@3`s00`00@#400aW3s00ἆ X8 I@kr P8s00P00@PP#406c 0CR. 6kN  01s00&$ 0&0Ek.q803s00ἆs Ek.q803s00ἆG-Z M6 S6F0 $ $  |$  t$  l$  " bQk΅` BpDt@@@0`@@#40F0d@^3s00F& Y*ƕ \ `, !paWpk.  AD0 t@@000@@0 #406@c0W$r 0aqW tA0gSknd~!0pGr @ @  0@#40@a^$r L`\00 03ӕӅ0@0dS_pkn0@D00q00 0#40&0b@W3s00F #Ry `bQ n|B`kp4 Bs0000`@@#40 F0d@&\3Ys00FZ: b\- &40 Ѝ k~$r uk΅4@s00F90@kn0q00F4kn@s00F)!r z B`4@s00@00@``#406c Q& Ѝ :@-&R Rڸ  &&@@ "$ :0@-&R R0ظ @@&  B&0&@PP@@PP!ƃ00G.p@-0PJ ;&̀f,(08;0 $ˀ0VP0S  0 Q+0Q 4&&&&p s0-@ PL&` R:"pr   pp"$ &b BS1&0^ u00u0#d0  S4 ```000PP20V:0@- Q0ڸ@ P q  @PP"$ &b B^& R Ҽ&ڸ @PP@ @PP"$ & B&0@ @ & -LMPpQ00 ,0S% 0`40 &Mn@i+(+^8 0N  q/ ! R0CS j&Ɩ  &  Q !P  X R&  00 G.0 0R ,00R>+ 0Q 00S4&&&&(K \R &0 Rʼp"r  Q(˕< 8  @pp!r p  p"$  a AP"r ^ڶ[p.r   p"$  a AP"r Q0Cs0p!r p  "$ Ɩ l LS2Ɔs l0pM0,r   0#406 c 0CQ6pk>Z0ڰ Ɩ0 \kʶ0̂἖(Ko $0 S&Mj@030#X0S-6 SM0  Ɔr 30,N.V  #O0  Pu0Q;S;S <S IE/Q 0 S 0,0pp"pr p  pp"$  a AP"r 0  r 3s00 00#406c 0CR!6 4p< 8  'J6Ɔp!r 7[.r <@|!r 0 t:Qp@-Ɠf@PF  AQ D !!ѕ"х  &0B`op) )  -LP`@ y1r1FP t3i4FPV0 @T 0 @±0@@0 -SL@P`y!r!FQ0  C t3i4FQ p5"W p-"Vp -L M K@P @oK -LP  -L$PKM`p( K@P @K "p (K@( T  y rF0-L@P е@o0 -LP õ t iF0-Lv@P @o0 -LP 誵 0-L@KMP !p y rFU@P0K0蒵0@K0茵0K0 0-L@KMP !p t iF5@P0K0r0@K0l0K0 -L,@KM`p0 KPP ~!p 0t iF @P0 KG0P KA0@=P0iU0 0-L@PP t3i4FP 0P0 0-L@P l?o2FP0 0[00 -PL`%@PP  P 0-LP@ r2m>FP 0 P  PQ P 0 0-LP@ r2m>FP 0 P Q0 P 0 -`rPLF @PP  P -PL`r? @PP  }Pn 0-LPB@R r2m>FP 0F P  ?PQ> Pn 0 0-LP!@1 r2m>FP 0% PX Q0 P] 0 -`rPL @PP  )P -PL`r @PP  P 0-LP@r2m>FP 0 P  1PQ P 0 0-LP@r2m>FP 0 P Q0 P 0 -PL`v @PP  P -PL`o @PP  P 0-LPr@r2m>FP 00u P  Q0o @P 0 0-LPR@br2m>FP 00U P Q0O @P 0 -PL` @PP  YPJ -PL` @PP  EP6 0-L@ Pg>t3GP 0A0 -PL`@PP  P 0-L@Pg>t3GP 070 -PL`@PP  P 0-PRL @00 0-L@P  00 000 0-L@0P 0P -L 0R P Q ֯o 0 -SL@P T``PP Kh<Kh[ < < -LP@P p`P   `` 0-LP}@P P000 0 -@PL 0 0R ePP 0 00  00c`P Q "`# -@PL t0 0R 6PP 0 0=`P Q n"` HP/0 0R /xP/0 0R /P 0-@PL L0 0R 0 0P Q 6"0 pP/,0 0RP/// 4 -@PLM ?o  2P0S0S K0 P 0  P`pP 0 S  R H  rR PPp 00  X < 0 -@PLM 0 0R KQ" 0   PP`pP 0 S d  8R PPp ,00$0o 0 X $ T P- ?o02 ^0S0 S XP -L<0 0R P =o t -LM$0@`SPU  K KP,0K P ,pP  (0KP (0, S 38P nP P ,0 0 50 // 0-RL@P 0S$ R:   P0TP0 0, X0T T0 mD0@ @0 e00, ,0 ] 4 ` 0-@LPQ P0Q0 0 -SLP`@ 0S @P<P QQ P>Kh 0-L@<P{P0/tP Q mP Q>eP  K0h^ 0 -SLP`@ 0S N@P<FP QQ ;P/5P >0P  Kh) -`L@Q 2>Q# &Q P Q' <QP&PQ  PhPPQ PS 0-S>3  0Ls0S<\ /S `(`  0Bs\000@3<00#/R>R  R `@R  0Bs0S>30 00#/R>Rpp0aU0 P ᏉP0/Sj 0$00>Sn SZ 0`S 0Cs0SE` 0As R000@3200#=Q00S Q @P  @r R<"   "=P  R0f`00"S 0R 0 "R= R{  "Q@ Qt`FVq0Sn 0(0u @23  0As0SQ] 0 0 E(0SQ0$00`>SK0``000 0 0`r  >R:00c0 ~ `@-P <P RQ RP <PG &P@aT lT gTtP4 @mT' pToPsP;P'tP;P<qTuPoPtP;P"@pT@;T;P>S0SQ 0-L  ፈo |1-LMKMMp0H1 O?KP1 N?KL1 QKDA P`@H Q/  RkPT% D  0 3/P D1,@K PLaP1$D<18S  0-S0>SSS @93@@@@ | | | t -PRMLM`phP5 @T2 @W /R ~/R 0A QW/R 0CW /RW  C/QW0 B0gC0BKSH@1 q$0K@04DBK.<H0s 0 S*,100 0 &p@0  rU P߬0P K٬0?  KҬ0  Kxp PPp up0P 00 y -LMPI@P% ,=pPD KpE dKW?p`0 0P p``j9p(  8$K0 `Pj&p  % ` 0 jp 0 $Ka$K  0-@LPK0hm -L Kh(8xW 0-L$@@ 0W` 0-L@K0h p-L M@P4 00RAS,0 S R 1`V. P` 00 PKpS 0b 0 joKp40, 0C40P `R d0q` `0 KP0L L0 C<0a8 80 ; g e g g e< g< g e g g d f -@L`,PdpP U 0 !ߟ,p0`,p0` -LMP@ pP D!0 >`P (0S; 0 2P (0S `q00(K$`V 00K  P 00S`  P  P X 0` P B( <$0$ 0 చ c x b e d 0-P@L@0S 0  Q<0  0K0hC0 -SL( $0$ 0d Kh b eD d (0-@L0R -L M4`0 V! ,@PᄁQ" p `Fp¦@T` @P煁Q  ᦣP00S P(KP00SP0(K z0 0| 1 ` dD b0 -SL  Q< Q  4R ,010D c@0@ 0 , (0( 0 @ `8 c b0 ` c b 0-PLP X0 0R @P0 {0 0 ٙd _| bT at p-@PL MP 00\ R WP P KpKp`  EP@ @T Kp 0 0  ^ b8 ` -L0@`S dPPKPP Khh 0 0,x ] a _ 0-LP@P P L0 0 ~UP 00 0R<0  00$ -pL MP@R40S6 P@F(K ?o2S*1 0R0P00 00 0SR pp 0`P2 U 0 S 00R 0@(Ko` ,P P 8P P 0 03/P0 00C 0S 0`S DPH@4 000 0.Ș \l0 ( [ Z [8 _ ]040 -SL , 0C40P Kh@ <0< 0-৘( $0$ 0- Z ^ \ Z ]D \ -L4P 4 R @,0Q q`,04 Pq@T`:804 80| -PLM@`q80 lK KP 4 0Rp` S"*,P' a!J4 <0 B4 0<0ljDKd F`0` 0.0L GH0H 0.'4 H000 0. X \ Z X \ Z X \ ZP -LP@pJ `0VHVP7*  440Q `V/ ;*000,  0 0,0 000, ,0P 0/o0"00\ R RcP 440Q`D }@0@ 0^/඗, (0( 0^/ୗ V [( X V [, X0P 00R /$0P -L 000RP80080 0-P@L80080K0h} 0-@PL <0 0R 00Pl4@i0\ 0-@PLM h0 0R K0K0P Q00S@#:J @~ 0-P@L<T ,0 0R@@/0~d -PPL 0 0R 4 `40S @40S ,0@ pP +~ -@PLP L0 0R `  @}d P ?o< 2 R  R00 S /} -@PLMP" x# Q (K40 Q8 `0 K :pP @P(K䂟 pP@ 40 Q1 4X , <0p0P<04 ,00Q~  80 ş80P+H c@!a0 ,0 4<q1 P4< Pwb ,Y<Y6Y@S0C00 ! 6,4 <0 pP04 <0,ㅽpW 0 080 0 ~P )(z p<epǘWuYp| x0x 0.d `0` 0.L UH0H 0i/ޕ|Ch#z,AH O Q Q O S Q O T Q -L`SPp@ T  P C000 $Kk0 0 0o/ N S PP- ?o82 ^0S00 S w0P/ 00R/ w P/?o, 2 \0S/00 S/wP- ?o02 ^0S0 S w4P/0 000R/v-P <0/o0"00^ R R v 0-LP@P P 0 03/P P P00 0-LM@P K0  PP  $PP  Z 0P PK0h K\ -L@PP  @P c0`\,` 0-Lw@P $P0P J 0-L@P 00 000t 0-L@0P )'0P -L 0R R0S0S_{o804 40 z$0 0 r O N Ot O4 Nx OT -L 0@`S5 P. @X1xqPp P  P P XU0UH U@!?#2"#B 0@PP,Ko4X$ XPp0@p@#%1AP 020{P X@=sP =nP ,Ko I$ N HL M( G -L@p<8ß 4 M@0 000 040 080 0Pb@Q`<0 `@@" 0As0SK<Q} =Q ]P UD5$W Yi*0  0b P Q(KW 0XT4 b ! PW 0XD8 b " PW Y6*<0Pc 43!1 0X xP<P  @ 0B S/=R<P 4 P@ <303 <R( R 0BS(KU@0S0S P U>303 R<R~J<P < 808 0X " L` LX LT LL L J E, Kl I@ Jl J -LP`SPU@hpP  Ɨp P, 0-LP@9P0P0 @00 -@PL 0 0R %`P 0 00   pW2PP  吗P00mP/0 0R /lP -L0 0R PU `V @P  cPT BP0P 0x , F(0( 0x l G H@ G F H4 GP -L`0 0R 0S P 8 W404 0 gPk FT G G(P- ?o02 ^0S0 S kPP -L400\ 0Syoj -LM$P@`U P' !0 cP 0SKr KPp$ B  0 P0"S !B1 0  $0K P $PPPpP   0KP $0R it P @P PUp $0 0@&0"SOP G@ D F E ? / 0-L4P4@P@ 000h/0S >( >P/?o8  2\0S0SP//h H0-@@L T(@@ @0@@.. 0-@PL (0 0R 000gP/0 0R/gP- ?o02 ^0S0 S gT0 0-SL@P 0$0S 0 pP 0 hP ppl@ @ @5@LLL@ @804 40 h A C C At B p-L M@P400 S<R,  R S 1CaV( P` 00 bP400C40`KpR f0 0 F̻K ȻKpS L uH0H 0 14 d000 0 ( @ Bl B @H ;| A @$ A A -@L`,PTpP U 0 !ϔ,p0`咻,p0`0 -SL  Q< Q  4R ,010D B@0@ 0L ܏, G(0( 0L ӏb > A4 @X > A\ @440 -SL 0C40 0 0t ຏ >l A ? -PLP x0`0V@ 0S R<0  0Kh $ ] 0  0 Q` = @ ?, 0-PLP X0 0R @ xP 0 Z0 0 m`D =8 ?x > 0-LP㠸@P P L0 0 sUP 00 0R<0  00 <_ p-`L M@PG 40S@ hP@; Kp ?o2S* 1 0R@P 00 0S00 03/0P P  0 0C 0S@ 0@S gP dKph@@@, (0( 0 ߎ 3^ 2 2 ; 7p C 0C0@< T50c0 8KL0S@< j  E80/d"b2#80 0@000 8K80A/@II<@ @!b!b0b0"@0 0  Y@< ,K c0 ! 8dL0SvA A8 @< %!E2$K/L0"bc8 B0L0 `@0 0080h Y@< Y @0 0-0 A@< Y 0 y0 S@< 00Y 0j< Kd㑒?"cbR#c0c?o2K/dP?c.n^3c #c/o"<  MRm <@ \ @P 0 R#\ R @ R @ R 00@ 8K0  P @0P 8//O `P<0 @($  h 8 ಐx <0  S8 0A R00Rm R%Ϡ!Ed2"0l c;S80 1@2!\< TR R @<  CR R @w \0 @(00 0$0w h  @<@ n51E㑓Ϡll  Kόd`?RceU3cb/o"0  2#A 100i80DSd080   L L ŕR:^L >10@Q9h0<@S0a 0$(0/Id@ *L *H &x & #  `8 ABLB^p^ P)Y@ bPA bNB QM B$ <0 @0(0$ z H/o<K"PzX @<@ 000@8 <0 8JR @ <0 (00c$0 < X A0P 8 ObP<0 @!0 (0$|! < 'P 8 @1 0!< 0( 0c$0 0 0 0R 0-L@T 0 0-L@T000 , 0-L00S JRt\00 , 0-L00S :R4\00 , 0-L00S *Q\00 , 0-L00S Q\10@-0?^"B R  0-\ 0 @S^ڤ  \ 0\ 0 ^#@0 Ϡ,͠ ? lH"!B@P  P00 0 000" !B00/l0"B0/L0"!B00/(0 0-SL@1/000P0 -@D0L M00S   咁 KhKO\// -L⁁- -L/00 , 0-L00S nO\`o// -L KM"vH K w-LM KDPp KQ -LM Q Q i0  K H K0 K^ B}0($/(/$/ 0Y.<+ < 0/(/$/R/-~x` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@჏ P//-~x` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@P8U33a83 ?8  /RG-MA R@  B0 @S BS @L0L!,  B0 " S0 @SSSS A SSSSpS`SPS@A A@SSAASS  AASApA`APA@AAAA  AЍ 0 0l1 h!0-L,MP`@0T(0  pW ?o2T0S= ?o2T0S f( 0R4 K HK┎0@0!$K @S$R $B R $K $Q  X0$K $Q   RfLH H   X: S S  S]  S0w    S  SO  S 0?    r-00w-!-@RQ G RV ! Rs  0   r-00w-$ R= * R2 Rs  0  r-00w-" R5 0: R* Rt 0 C   /d 0 s 0 R-  0R-  0S 0 Cx 0 Cx 0 CS 0 CT 0 C- 0 Cx 0 C S A 0 ~c 0 zl 0 vb 0 rp 0 n0a -  h -L M0 PPP5 P0 06pp! 1@ ꧅P =R Q@` 0p PU1`@PW0؂0(Kс0궍 0 D8L2 H"P-0L M |Kt l lpK=; -` BLV"RM 0 p4 qP@2P-Tr +TP@0@ Ə0 jH0 KdHp8 0 `DK.9 0/0Np QaNPWNANP!7NZ| RSP \ "0 0T/ VS? p `$K4\P P8 0s 0P) Q0E(K΋0 0R0, (K0P@40 00XS00 C R @"0Pp$K` A BRVq0"p$K`w  0 0 0>:; -L M@PQ4PKT0@K個 00\p`urQXW QV  VW*"00(K VW: VW 0S"0 0(K VW(K(K (K <0-L4M @0`@0`K9H- -L$MP@`UH#0 00@ 000@0 0K0چp`0"Si 0Q+ 0b CR Z~ f$0SFp0 `0*S xS S& (" 0@ +(K0PP@ 0 0@0 0 00S+1 S p` W0H S0O 00(K$4+S"00厊=.(! 0 C+(K!0 9+(K0 0 S/?'!S%5'+S*:'&Sh 0 ` + ` 0,  +8 < 4 l -LtMp`Pd @PPK` P( 0[S( 0R K HQqG5P p-LM@ `@` Kp RQ0-LM@@  K܅PP 0K0q0K00P m>91D #0/00/ -p``aLP@GQ# GQ idX1P  U g P 0Y -Lɟ4M H T0 @ȟP 0L X `H 0S0080S ( (唨 D ( 0  8 |(4  < p(L P@ \|PC0+0C? #R| Ro #&R R! R  R _ R Q R  R *W   _Q R(KR `>#R  wR R R <0 >380 ‚ 0PQ  Q hW   ^P80<00` Rp0RY qpR  Rw  R W R 0 >#0!> Qz> Y `  plQE  R3Q*W_Q^Q Rz R+  R {R| R; Ru> 0l `cK po`P0CK@`W ^ H T $ P  RJW ^G  /%0C>@0@>C @!>#"R@D @ 0!P$ > Q 01S< >30c`q @P 00C000 000q> 0`a p؀o`P0 0 @00P>3000C00Y   -L%M @Pp4 Sh*%4  Ru jR R4Y- p0TT>#R| Ro #&R R! R  R _ R Q R  R *W   _Q R(KR `>#R  wR R R <0 >380 ‚ 0PQ  Q hW   ]P80<00` Rp0RY qpR  Rw  R W R 0 >#0!> Qz> Y `  plQE  R3Q*W_Q^Q Rz R+  R {R| R; Ru> 0l `cK po`P0CK@`W ^ H T $ P  RJW ^G  /%0C>@0@>C @!>#"R@D @ 0!P$ > Q 01S< >30c`q @P 00C000 000q> 0`a p؀o`P0 0 @00P>3000C00Y  0G-RM@ <`@! F@HvPpPP PQ>Q@ !Q CQw VQ QV SЍV>SP 8 Q`  Q >&QJ Q V8 Q  Q Q Q >S Q WQ Q >S< 1  eB̠QuPU8 "Q>S > Q  V8  Q8   > ^ >>S U  qWn8 jQg  d -L3Sw S6 Sr S@t S S04  0@ 0P EY4 0P 0 p0T:(K0@>3@1># R@004 8P  P0@ 0 JU8P0H4>SP1>SP1>3"SPE P0 Z0P  px>S@04  0@ 0P{ EY4p 0lWP P0  ppD S S S p| >S bR0/ rS 0>S R b0/ fpSpG-RM@4`8 FvHq>SU` %U 0U fU UV SЍV> R P  0 Ui / U\ F&U U VU |U U>PplPPPUQ l U U U U>Pp PP P Uw\"UP>pPPPQ>S U  P  ~XzYv P P>S UP >P>s WP b\n [ VXiU T -L4MD 4 0 @ 0 P(@80 l0H x#`P <  4 9~80A/ 0 0@@  @0 0R V  V ZPp  Z U 8@ 0 pPU@1W  V- < |20 000_VQ  Z < <20   _Z R| V 2< 0 000_`FoobS00S+A?G0CS6 0P@pS40` 4 XD0VP[  HP000 `lv0 gv 0@P8 @}1W  Z 0_ Z0 S R q@@ 0p8 o@pp  Z  Z0Pq y0\ Z,Pq\0[ !W1p00Ph S0N Vq4(K -LM`0PpV;*01>#Rv R5 Rq R@s R R0 0@ 0 HZ0` 0P 0 p`0T:(K@>3@1># R@0 0@ 0 IZ0 F0`00>3 ` >1>3"SH0 0Y0  px`>R@0 0@t 0m HZ0`0@ @@p 0]WP P00@ p0pC` R R R `}p`z >3 ``2pR >3 ` b0/ dpRm -LMeԟ@ ^h l0  (K E2 | R|0(0|0`00t0 |00h00 Vh0 0 l0 0 p 00 p0 S l0 0 p 00 p0 S|03 !/0  0-SL@ :0S000000 R [R.Q00?0 S*R .R 0S00(00000 ]R0000 0-SL@P*1 2!2#S 0S 004000000 sPP0 -pRLP@`P ! zo0pp 0-LM0@PS0S*  !K0 P 0  ;-LPM000 0@S40 0 0): q210S rP prP0W 4\  1#2\d jv40 壑)B@ T 020 T p`0V dn P&  \n P WD %:9 0<0 |9080 W+*0]S$ - S Q #R  -Sd [SQ%:0 S`*-Q  00000 P0p`W:0S008000(K0:S< =S R:0S00d8000 0-S]S0S0048000= 0000DR*0V0=Sz 0S00 ` p0S 00X:0匇S000-S]Sj ``w`p |  mP0S Z0S0000S     000S`0Sp8(G0 SH 0 0pC1q0S *q 0S᱐ 00 S DR *0V0:S0]Spp0S00z0`S0050000-S]S %0 0  ,  000  R `hp ]R@04 "0-0-00-00p0W*000]SQ'  0RJ0p sd  tdld Xx `0C BsD0S! PJp0 `0 ` 0000`0P0* @04 " 00 00 0C0 Rv @0p4b0s0pSWg00  0Ss(Ko/0^S D  ]S -S@ pE0S 002000(Kpp] 00]00]00p`-RN ]RK -\x #V0S 00<000\:p`F0]S 000(Kpp- 00-00-00p` 0 S00 **`0T0j?o20S R4 p000Q00Ss! P `Y00 cB"(Ko<`O V0pD i[Y0@00 0D0S!.0pD0  D ,l ($! 1 -LM@`08pqP 0  qP00 0S 4040 0R K t 0S p$0KP0"0K0] 0$K# K"0KpP 0#1 ( -PL`@  H0Da R % T \ !B d@@!Q_ 0` -LMP0@p` S 00$K0SV 1 V00U U0SzvNMLutsrq#mlkjihA`Fp0:`FPEp  g0  g$KkC`0 g   g70SP "00SC  PE(  `p 0 g ``0 }  g0S "0S A $Kkp$K`0  000$K  gj  Ad   g^ :-LԚE0CS_00I x R0S00 0HR *Q R\Q 0 ` 00R C  f80 S 0 ft  fP(0 `P\UC0 S0000P)1\U90Sq r*U P0S 003000u0  8Rf 0 f8 0  0 04 K 1 K ^ H0 4 K 3 K] 2 K 1 KH0 0 00 0S 00.}1U0S& ' 0 R 0 d H0 x H0 0 O {RY000S *,P 0PP0 S:0S 00P` 0Q|L000008<R\P@ R Q\P 0R }PR0S 00)Q000 0G `0(,(, J0)S|H [H R0Q P}P0`0+ zzxxTwts0 S-L|MP p| vi`S@P s  P  0KXK `@ ` 圀  Q( P0`K80 4 p(,0<@DmH 00C 00 0 S*  0 S: 딀X0A$0I8PI0S R  0SQ0 P X, P`V`a *(K4p X040wpp ` R 0 P  P 0^p \0 0MiPV `P0>#R ,R0 R R, @0P@`Rm >310>#R R "R (( 0>3S S0\>31SARP SQD(E" e2L @ 0 P| R(0DE" L0e2 @0 0100 0 t=c 100 )0S00 000 0  IV@` @pW( P<@( p0>#R0P 00R ( (E De"L00 @ nnd -ML K 4-L@!MK 0C4 50|4 504 504 504 04 3t4 nPPC  Plj00St40Ct4  j0=S0pS@ jC^KPE4 4KPAix#@ 4$K4  ڝP3h4 |_ i0#S @T Pf40 0R(KpDpTpW p W0D4 $a$a4St40Ct4  0p4 pPnCnKn `FD#t4 U  e @eTD0lT dt 00i 0Pھ0 4CKI@C  -'Z34[$S; S9 dd dd dd  Pip$[R n p4[ S  P t4SNP V0p ` Pܹ Pع P0L4P@i 0 0  , GNK4t4 !h0S"44dTt *& ` d 0 $   \ l | L  T -LdM P@K0ppKP|!`x0 0 | 0 d  Wh  t0Kl h p ^P6t0Q @,@K@d`@P 0V | 0t  @t`x00 0R(Kp[|0 0 0 @@= ,%d \ L L tt -LM@@K -L4\M0 pP@Kp`K P0 x  0  g  t0Kl h p ޡPtQ @,@L@_t@ 0 @tx00 0R (K@֠ (D%\ Z r -LM@@K  -L+KPM Dğ `0  2 ^K"  0 " 00 kl-0P %Py 1[ S S S S @#  S Sk  0s000 S S S S]0 S S0 S S  0C  S00S 0 0C  S00S@P 1[R @+SM -S51[Sp @Sg2SQ 2  02 p`0+S' -SF IdP00W0pw00\ WP{X87 Pps |0+Sp0S @S52" ?o21[Sp @S!2SGQ5 2  02 p0S @S2" `?o2 Dp` >pco`0W! 20 0R(K22 p@>1Kv m@8o @P$ ( -LP4c0 h00 0R(K0  p\ jp pX pH pH1 !0-LKM0pL1 000 _h`PPN Pa@L1`0H1 ᰂ0 Y@P/ w`POKPN?K<0 =KH0 0PM/K@8 @卂81Sሂ30MK P L`P3Ec0 L10 0R(K0  h n n n0/M0 0-L MP`Q0 0  0@K pKx0 P" C 0 0 0R K8 ! ~8`P U   l0 0-FML MmK@p0(0 v!PPBNK@Dz+w Pʈ$ b@b$R@( 0R K X p0 -Ld0dM@K Pp`0(0 < H|( 0R Kh m/l/L0M0 R8Ѝ/0: 3!P Ѝ/ k 8P00/  8P/ p H0-L@@PKM @%AZ 0K0 kJPM1SppЍ/0 0p-L$M@PQ0 0  4K!`Kx5 K0R!C0(0 0R Kp8 )0}8PP | jl -LM M( 0 0}K` pG0@00 )`P?0? Y0 0 YQ0:;S 0" U 5CK P  U0PUO0a@a@(0 0R(K+a@aX@ QNK @DDpFv 0-ML Kp0 -Ld0dM@K Pp`0(0  B( 0R K 80 4 -0LM@Px p@K00 000    @0\x Elh 0P@p`0 f@  !p !͌ "9 :E0 0IdP beQJE@ @0%p p.0pE  #p'p `A`}0!0E-0#gq\P` `$9`:E0b⍈`& X'0YmZEPhTP 0.)0*E ͌pfa0#P!PlA] )L*Ey   zEpe0&pH 0$)#*E (`͌ `D0.i 0jE`-l0# 0@P IPJE@@%F0P%! !0 P韠%_P dAP `ܜ (͌ 0(`nH Pp, 㨐`0/H  )/p } l) ` 0ᄀ)ਠ\  _HP 鯠@ `&Pgq%P `&ठ< `& ?H0P ᨠ)o )0@|`儀M韠aᄐ  ᜐ`(\  `&_H【P P `& ࠀ0 dA)0)oᬀ, 0/H ͌0)ጀp|`pnܬ `&썇Pᄐ0 pP Hp&  p'ᐐPl oH`l 0%@op 0# 0# h譊 ጀ P`@ ?, |0 0p(/H ` P p'0|Mp'܌ PjH `! dO  @`&`& po` `P! P%|``q P%< ?H@0` _ 0H$@ P)@)Pn ` $@韠` < ㈐*`?H0 * 0 @H㤐 `h0pϠP $ )P 0amP@ )pਠP@, 0 } %fa_@P /HP ऐ *) *< ?H0|@gQMp )ਠ)଀ *鯠ᔠ 0 ༠HdA (p p ( ᄐ0͌ 'pn1, ᬀ/H ( `)| )*oH` p`ᄐp\  *) _Hl * P *@  Op p฀ 㠐bLPp'`@ p',p'|@0@&-@$aa@$)P֡ bL  p 夠p%|@( p'bQ❉. 0 0 p'0$@b L  &0#bL @༠0# ,`i %|p p*͌n p'|o! @ 0p'`b*L@  P|`$ ) @ !`&lPց `&bL *0 P$ 0@ "揠 刀`0P%`@,P%) -a1@$)bL  )ठbLࠀ  (韠ጐ @ *bM_. *! 㔐b*LP  P ! )P ꯠ) bL㤠 #|0*! *0,韠dA᠐ b*L㔐 0 ()1 *)ࠀb:LP0͌ )n($p'鏠᠐ !l p'ꯠ0)`A . `& " `&`bJL@ 0,- %0#PaA  bJL@)0 P% P%ఐ嬀bL=b! (@!*o֑ ͌@$ p'c1ᄠbL| "@M ._l* (b L #)`& ఀ删 ࠐ (  *dAobLq ,bzLp- 0a p$0` P%0֡ =(bLb! Vp!_xp'@p͌`c1@0 0͇0 (K9-  v4!20AEFNI#L 00 00 -LP`p10Y00>0ّ 0?S P a$KkT@@i  Ti V0@V@1 -L 0M0pK` @P 0(0 R0 0R1130 0~? S  0~? S V`F  "0 0R1130( 0R Kz Ot OT0 0p-L$M@PQ0 0  4K!`Kx5 K0R!C0(0 0R Kp8 ),v8PP xy Nx -LQMM0 0 0I~K`pG0@00 ~`P?0? Y0 0 RQ0:;S 0" U 5CK P  U0PUO0Z@Z@00 0R(K+Z@ZX@ RNK @DpGr x 0-ML Kp0 -Ld0lM@K Pp`0(0  B( 0R Kw 0@-  v$1P@EFNI2 A3LA 00G-pM0 ,pp,03?0 R 0  E00E4@D0 P0墀Ep #!0 00" `  0a0*h0*0 0#0# 0 Kn꫌L@E``@ `& @`@8Pc9"a@,0@b+k<@ȀP#T@ )[jPEP@@c;芎` @ P,8p).fkPK@E@YD@\plˠ)  @ @$hE阊 H` @@b, @$0.e[@p @!Hn0ᢠE 0 Lp`0#"idp0`* `=b+ ᢠE Ppk,!dKHp*̅aᢠE Tp芎P &lpP*PE c; XfkY (Pp*.lˠ hᢐE \pjn@ % ) "4p`  Ke[@E@`p*.0@ @)@$`Xpj0`Kn@E@dpc9fm! @@)@$F0b+  @00#4@0࡛ٞF 9l@8@)F (``L@ , Fc[lɁ@  0@;>F0` b  0H 0#+0.F l9  "d F b-`k P\p, FcK͈P  Dp;>F0` b P0``0#+0.F lˠ<P "4` L OH@-` @#c[T`0#@ H ʌ 0"bk0\p " Hln 0,X@00,, /H<   ?HaY00 0` eˠ P< `@h?H %0 0P%f  Ha  &\ hK`&_H0@`dp8P ( P ck(, /H ܌ ˌ #<H0#lPLe \ 0,_H0`,Hp H +0 l@0b < ?H0h@hi0"܌ H "f , /H  & aK `&0D`c=P!P ck !  Hb #8p nˠ0#P@pe N]0.SYJ0`.NSJM 0 0 0pdKPN-`j0#0 PDfk;S)J!  Tp c; NSJ @ .Lpa N`*@SJ @ `N]@``SYJdMP0 8`b+0N dˠc<PS J@Xp$Nm @SiJ `@$h`c;N`KaPSJ4p  NmSiJ`  <`a N nˠb*PS JPp0.Nm SiJ `@0.\`b+0N`Kc9PSJ HNmPSiJ`Pc; P%a PlN e\S Jd`! N SJ -!@@0 0dM$0  e[ P@ pЍ -`!pL0@Pl U!@\ P@@  @lL :T@V @/@0VP*  d $KkL! p-L M0` P@#̠%K@ `R#(0K#4&K! !Ƞ'0K!4$K ` B#0K!K"K(K T0F  S", @  @ "$ @  @ 0R` Kph SZ /|Q$ 00 R$ Bx@-d Խ@4  R  *4 8/ t0 S@- d㸽@ 4 *8 R РS /$'ABxP/P R8088 S /R R//0 〽 0c <c  -LM,@K4`KpP $0pp4 0 pO p0p, 4 8 0 wpB pp 0,4 8 0 jp5 p p0,4 8 0 ]p+ 8 R B   R :0 0CSR 010! R0*0+4 0 ̠8 8p`(K(KR0 Ss1 -L0MP M `H@D.K0~KpG(0 卾p  :JT"( 0R! KK AAEp ~KpGpPP JT"(@D0@*09RVL 0 +0-L(@@PP0&R@P -LHAhMp@0SH |@K᯽P$K @@PuNx`toNh0 `d`hNPP命P@@@\NxP`tVNh0PdPON@K @ٽP@@0@AN>N'|  lt  -L`\X X0@ 0PP`@@T Q P (SpH?P\00T P0 !R 01 R@P///S H0@>S 00 00//RH -L4@KMp P``PW0E>S 0!31 00 0  uK>SL 0!31 00 0 JQ00FQ00R@/ -p-L MP@U@ `0 ` P a 0 X0X 08 R;0Kp0( ( QT  &  XQ -Q =QR-@+R 00/+QqoQ uQ gQR     +S -S =S0P00@/     0000000@-I0PXS oS; uS7 gS 0+S -S00PXS^ 00P r  R  @@PSPQP@R   # !0  Q -LLM@P\T <@KLK0 L0 H0 D0 @0 ㊻pሻ @^k`P 6 00000s0S+X0 00`` \ 0d0 a0JS  'C +Z@ 0 -SnX0=Z0X0 `pP@0X0C S񏐃~}|{zyxwvut%rqponmlji dI`IppX 0 |X 0 {IW R:d0`P0h d0 僑 DmP h I `  e \0  00 =Zl +0JV?o20S Rf*\0XX 0B00` R:d0`P0h d0 僑 mP h I `  e \0T p0 0 tW6X0=ZS0X0 R:d0`@0h d0 僑 lPd h I `  d \0  00[ V R+*\0XX 0B``Za ,Z3` PX0=Z0X0 0X0 d0`P0h d0 僑 lP- h I `  e d0`@0h d0 僑 lP h I `  d O PK0  -P00S@tO0"S 1Ds `` O@P`6nOP(K>0S^ @@-0/+0 0(K`` X`+Pp-@ +0B XR R0p0 +0B0+R XR  -Rp    X@PPQ`N`@(KN00N00(KN`` 00@N4 0-ML K   7 p` KP -L 0 /No`/00/00/00/ 00// ///00/ // / -L@P`e P% + Pu 0  UP'iPP0 rsP x000hp0+t Pp 400N@幸巸M0@  k a -P@L`rP 00p埸80p0 ` @ 00p吸а0 -0LP@`T 傸@T0rS zP;KhqoP 0h0+SKh& -L0K$M, #P1K0(0 @W0P$0 J 0100SBp@$ P B 0K$0( 00S.$00K6 K  @,0*べdM@zBh0( 00S d$l RM0@K, $0B\p    -LK$M, 0,K0 4 $10(0  0P$0 A 100S4p P 0$K&0( 00S($00K K:4 0,忷%M|0( 00S@ d$+l崷岷L0@K,౻ ୻$0A@\̘\L`1 \!0-LMp`0S581PU 0V90S P@T0S7LP00000S `KL0S   4pP k PKkKd`\0PULX@40 0 $L?\ 0-L,PKl`KLM D0%0p@ p帷p@jL0S RwPpp0S@#W k(Kp 8ipP 0  pp p p@BL0S*wPႷ@ -LDMp 00 `  xD? #K@0040 0PD; #K@ 040 X@0 0 QR000 Y0W0>> S0P2@ "0-L p` 0a3P0H0 \G0D0 0Y:0XXCK 0 G X00Z0Sp`@3 S 0r 0o D00Y:`%!E2OL0Rd!gfF40|H 加0  00FAd"|Ϡ Fla`@f@0Z(KPB; #K@040 {? #K(2040 t20H0 D0 cQA dP@0A 0 P@P@q2PU@W0P ܃K 0 FQ`0pZP (K\@0 @240 Hd0 FL!o 0 \0#0@@(Kd0P@0 0L0 @0w Q0P 0 0 @ pP0`p`pL0 `$p`d0P@0 0L0 (KGzG | P "  D $ ; H@0 2P@G-M@`P]p-*00 Q:T0 0? S2 [ S3 S S+  VZ \ V Q@*T0? S [ S S0S;P0S `Ѝ? S@ !0R00 00 R P R0 R0 SR R# 0 0P`DR 0S0 0 R pP/// -LM M BNKp 0@D`P+0(0 P0@( 0R K03/5 -@L`P ``a V00"5JP4 gpPI 0SH  p0S h0@00eP/ T ;i  P 0  0  ! 0`V*o`dpP T 0p 0S"p`0I 0 @ -KM`L\b M@`0p0P/00 T7 /T 0  0@@T/T  U00 0Rj(K^@/T@UU@/T p 0   R0=K@ 0C 4 $0P0   0S00/ 0W/S 4: S S 0 00%0CNK+ P 0@bP4: SW/ 303 101:@I/ 0@@ (03/3 -` LNM Mp  4 0P@4 0尠$ 00 IT#*0*U@$@0 R R0$0a?o24 004 RU0 S400E0 P04 04 4 4 40S 04 fCK+ @ 0@ +H 4S 0@3$04 =K 0C4 :/P 0   R  * S .R V[ R   WT: R YN4S] 4S 4$8P4: S $P 0I GS/ 3 I1$ 01 0 PG00K 4 A$0P4: SU 40 0R(K  .R R . R V R  @" 03/Y! 0I  LP 4I 00fPl 0$ .Re u ;Y*H0S4  04P%0S1 CK+ P1 0S + P@H 4/P  0 3/ 0 G0/ 00 0 >1,  6-LQ KM@$#"5 . ᠀@7a000 1a00tF+dK&TA 0 L 4  p ( $ l ެ   5-BMLM0씟L  @  H  0    +0HP08   40 4ػP BnKCNK `F@D\ @v P 0S 8400#S $TPP\ d P 0S S3P0P\ U P 0S S3P0P\ F P 0S 3 0   \ 7 0P 0S T30\ * 0P 0S $303@Fs+0c,PK `6p2D%0D4 \  @P( 0S 9PYY $;PD40S p;P] TX2X0T $D`R@20P,RCNK@DP\  PX 0S 100#S9 \  P 0S 1a0`\  PPG 0S a`P:P | P:P2 d! `1`Q0P \  0P 0S z,10\  0P 0S m 0 L40 0R(K0 0 00  00P}0  ހ ( ݰ | @LjP Ơ . ۴ ۼ lŌL  - ڰ ژ ڀĘ`0 + 0-Ld@@ 4P D`D`PP x< )D0 -0L0S fP P¸” 0-LPP 4@@%:P KP00P 0-LPP 4@@:P 4P00 0-L@@P0W 000 S-L,M80 @54 00 (KP%< @ 04p`U 0|  0s0?S [S \S<0S U @p\0 o  i0SD0 X /S D0U0Lp ^S!SZH20 0R^(K VPV 0 8sp@D H  UP9 TE ;P#nK<2 <2P gXP* Kp0@K Ġ `@p@ @<K!ᐐ!6Ka8K"",4 K` `  Xp6 M [R 4 ` 0@sqY?  X3K7K;K?KCKp   L dX pXP   p P R H KlXp   H{3 h XPpT@` T,V 10@!0` 0`A\p⺘#$#< D0K XC@K[@t@pP005T0pAW5XV2H@00Vt00 0R(KX00X0$! ,00 X510p$[   [T Y  z4  R@ Ġ 34L l 4  T Ü\ P T   x ¤L  P ( X @ -PPLB @T 1@0U /R> C/QU0 B/T@/ PPP@P`; `00U&* CR0 B! /QU 0C/Q0U C:0e#@T@!HP@P7<;:58550 0K010Sp` 00X 0S50"S 0 㚆( 1VW0(KW 0PQ050 (K5" 0 ( \ 0-@PL@ 0S 1@T 0/S0A /RS0C0/S% @@P; P000T*0Q/S0A SC  S/R 0SCc#@T@! @@  < 00-L@M4 KTK@ L0 PD0 @<0 EKᔠp 0S"KK00 -L`Pcp@ Pnp V U Hd ɟp` ᢠ០ᜠVҟ@  B 0/R/ 0b10"/  B/P/R/ 0b1P"/  B0/R/2 b1/0A-) P?o?o 0@0cS CS9 S!q`p!Q_ A @eP 0cC CL c1@SU0 Zc pl>\W `LC>V>LP@1x h:C~0q0h@PP0G-1 _! 0Q@ Roo @aQAQ: Q!#q` p00 #qBa4 0 `gpaa A` a3bqW00 Za n:~ Np:xA:n3 `p`2:0A2 00   [00#Dk{{@{7P/AC0@ -{LJ KhG{Pq  -zLJ Khgz qP -L ` Kh賞 400 㥞?0/R_//R_/?0S/R_/P/R_/ 0Q-L4M  (00  K0 KQ -00PL  Eo -L" -LPMP P P@Tt$ 0\00,K0p0`:`  @ H d00 R R吟80 4 0-LQ3 Kh ptv0 -@0L4Mp`P0(0 TK PLL Q Q Q J3 0  ,Hh0( 0R K !+0@P/ P b/ -L`pPV! @.0J@S  R DJ0U R  RS0@0D@R-B0S0 0\ RN^0  S -L Mp&Pa`WP@G 'PB  'pPB 100 5.!0 aV0 Y'0(K4 00 &004 P0 &P 0 a0P &0 00 *=00 *02 0 '0 -LafM M`?P 0p6 000 X pL 00CSJ9@GK @Y>KD 0CD 5 _^KOPE5TAXA\AkSE CKp   0 U  E E @P"P060 0R(KK ADp 6: S 2O0002 0 2 0 aL L 0-  Ԉ --L M   K -- LM0 0 A K R-Lr M`@p R00?`$"0 P @0P P0 00P01 1003V^P5 0 K4K"YP XI 40Y[VP0P0 i   0 00a$ (K4 LP$ 0P^PVP`C0 PP 00C$(K4 Y qLP  0` hLP 40l -LßKM M` p$ p @ O 0  G@T PRPcE V/P 1100-1@0040 0R(K R f R1?00 UXRY2FD @0 XRM>sV  D TD0C.K4 $  c;*0 V *0/S0IB 0C/R> V0hq =Kp 0C4 ԔY& -~p'00S4U ܔ0 S00S0 U ,P000D 4S Hp @K0 A0὜/00Pz4: S 000rAP 0@@DOoBg , -@LMI#(0SA 0 $ e 0S  0bpo<# P0Q0!K00 0pWoS <0pWo0( PP1/ 0`VQp0#0D0T 0  #=0 0 -L 8MPK p@00@K8! sH L  ! R p` LKP` D` ?P@ 0R K 0@ 000@U00WH 0-@LP"P"0 0-LM00@P !R ! !R R50KFp4 p& 0P  0 l0 K0 B !K0 R   A 0 A^ 0 00aP 0@00 0-L@V"PZ"0 e2 R0-L0 @T0 E2 R0 00R0 NP NP N<P NK0hN -L4@`0P@P 0zKhVph 0-L,@,P@P 0{zK0hV ɠh 0-L4@4P@P$0{P0UTh1!0C-M0 P0@0S0  XR0`S8) p@&  X0@I 0X   A0a0 cB! T^#Q.S!@80CSЍ0! T0^0#S@lN1SS  Sq00@ 4  R  *4 8/* 0X\S 040:8 R РS /mBx -Lp`L L0 H@P X  # -Ƭ  P-L`@p.0 :@- 4H@ | \ 40210/,+|qP^񏐽] _GJ=&0?Q0000 U =U UP,̰@ ` (701 0`S;UPcTwpq@dT 1\  QQw0 0SUx @ <0000 00 0AnSR PONMLKJIHGFEDCBA@?>=<;:986543210/.-,#"!      100ES0100C0;0004-Q0 ^Q00*,000 0  ;U 30000 00 C10PP #U 0 `0@\A#o@@,%Ao &Ao =Ao#4P 0030000   0070Es0 00Es0 20 U U 0000 e 00Es0|0W0Cs00 0000ES0100C000P00000PE0P00000 00 00 00{ 00v 00q 00l00g00b 100000W00S00A00PKq  0W0Cs0l00000   00E70Es00 00000,00( 00$dTS ( P -L,KBpPM<0 0D 0)10K10K80 X0 `0@0 <0 8@f@0S T@D( 10[`0FpP@0V 10[08 ,8 00(K, 00(K 8;P W D0 c00,0 0WpG 10[P0E0  00  q 0 -`ALP@Pg /=C1"#bbAqT@ 0S$ V2 10 R |1003/P= p$` #00 > -@PLP Q ŔP@`\ 꽔@P`V )0"SPFpPp@7H)@00@ -PML MP Q08  Q /Q P.00v Y$P@ؕ@؅/Q#}K`pGh . Qo  /RR.Q(  e   h Rk h/,! h  cpJ (* R  R/AoPl@/Q  hQ .PQU 0t/SV08 J8傎K H#e %P  # \2   8 /Qh0#8 /@q(00PG(K@U@/0000(K](U?00/00@00 WCPP X ZM(?00I(>00D(00@(00<(P00 -@P$aL`3 #QP00/CP6 0  0^ @:^0 S \S 0@ S @ 0:S@ P0P 'G@0 0' 00D|l{{@-:S 0S0\\ @0\ \:R0S0@S\@S :RS:S 00/8A -^ 0S:^|^^\ RB|S 0:SS  -LMǟ Mh T$  l P4 0X$ 0`4 Q000 \Q HG@PU P   nB`P T40S ' d$ \$ C.KH$ PP0 00H$@p:Q9 \Qp Q Qpp pPU*`R @ Q W :Q +HPɑPH4 @@T QW PFpi L$ PiDL$P PZ `Zp`c #QQ `X L$ NPUp500S `5 PL 0H4 0X4 = HpP 0:R P0R0CKpK @ pGP4gT$H8@P pP p 0:R@ @ Ra a 00S:S:0 00f iYw e P@\ X8 `EpdL$`HDd$[0 00 PT420PP4 0\4 6\4@S"TZ@ `0P4 T$0ST$ P E\4S q& 00P`40 0R(KPP@ bAP 0``\4 呖UX4 \4S1l$Vi0A0$:h4X4PP P\L4c`c pcPcCPC `pPL u:00e0X4 6X YL CP 3PՐP\4@S P̐LP>E@:EX4CnK}K`F@4 y!< P0 5/p5 P. 84PU4$0@4 0B<4 LE\4S38EP% 00tPE_oS!Rp @`P+ ~03/Pl4ph4`[P03/VP%@ D%@K%P 00GPn%P@D%@<03/P% 004 y $5( 0-ML  0K0 K 0-L8@@ P 0 00 0   0qq t3-LlSMh# MP @ H 0HCD8 Q0@8 00 @80 0S Cs c@p`P  R K A P} 8( B8Qg " R#:\ #\ RT RQ00S\S00 Q|dRCNKnKP `Fp0S6\S4 00S0 :S: 0 088 Sc04[K ASi |S:Si  A:S|S 00S 0@(AHj0@SBD8 00QP(K F P 88 0 C P\R    0S `P - `` P P  " P NP a& 8 0h;P D A.K  DqxqPq$qqq opT m 0-L@PK0h -L`= @P d?PP d :p0:SS ^S! \S0@%  RedAP 0 Pd :SSR00e@A APy 00S:S 0@0P:P 00@s\0@p\c10Lp\1@Z0B0@@2SJGCG>9DCBA@?>-<;:%86543210/.-,+*'#'$#"!   00A 00A 00A{ 00Awptq0lC0@0~# 0 y -LP= pP. d>P, pG`d0 :SS Q0@fd&AdP  `Qf@A AP 0B00# 0 0-L@# P! 0R  <, 00BaPBs QU70BABW0BQ^0 0XS 0@3 -L4ß0BM`M 0@p84 Q000 v /< PP7 䂟P  ;#00CS Uc C K0:S # 00840 0R|(KgPCK0S:SR  0S:SXh 0h@4 0@$<D   RE D4 sD4@$np i0:S Z"0S"00UP R0 00 R!010@0M@ c0 @$ 0@$;CKH @4,KH$/0<$CD$,0K0 $CQ00 @$ 0 | { { {l ] ^ ]0 00 x -0-L M0 P@\00 0 00\100 M\   0S0,00  0RK0D 8 0-L$@ q@0 y d y -LŸ`4M pP 0000 D20ZF  H0K0<@KxL0KϿ KKDK PqP  X $200SH @0 0Rs(KH ZL0 P0 oP0@P 0 JL0 P0 T JH P0 P TR"@3: < X0s W$R'@1@!w00 .ƌ |0S00?"@@ RP @@ aP! 5SX"VW00#  0 P0 e0PT0 P0 i0ST0@ @8000sy( l!d@c w4 w0, va ;- M(@L0@@04PKax z z k [k'kFK E{{://=A@{ k[k'kFK E{{:// =A0Q -L4M@ ,K 0( 0#, 0 $  T D K4P@D 000# 0K 'K 0-L M K,K, (0 $0 0 呋P K 0-L M K,K, (0 $0 0 個P K 0-L KM0 "0 0 m K } ㇌0R- 0Q0^ R0 -L`PV p-P@PV yP/ -LsM @`p|K@ g?K@ 1 0 >O9Qa a }oKTA0XA\A0L 0   @0 0R(K P 0-   -LPϟLM 3 ` 0003 q000  1S0103 3 @3 > 03 P@U ,P0 %U! 0S0 U 30 0R(K P0P 0C 0 S 0PzS*g\[ZYXWVUTST=PON*'*z~}|4z P0/.qo0)j9fe c 000B0H303 0SOX3P0 03 P3pp03 ;003 PC ,KP0C0?KA ` K0p- P 3SHH0p0PSX3S303 303 P 3Sp,^W003 @3 ?Kp@3 W t: $pZ03 P03 0# #[,0K0 #C#@0-S ]S S p,0K#[0C #C303903 0S P03 0000P  00C0S P 3;3 303;03 3# #   # 0# 0#S)# 0P3 0 0P} 0C 0 S bP p3:3 0#S)# H 0P3 3:3 303 ~0#S # .P0#S,# 0P3 !00C∀g303 c0SYP{3;3 Z<0#S, # P #0S P 0S P 3  Pc00P0X P0h000p 0S P U 0@003HS3@C0SX3P_ 03 K3P# C p03 6003 P ,KOK0CP0?KA X` 0^S p P p0S PXUCSU 3S0303 Bp =,0K3PS 3#HS0p S# P3*3pPS 03,K  #RR    B X 0S PP 3UW PSa #s  # P 0,K03SS P0X 0C B S 0P U:7U7@S 0 姾0P+ #3  # 3]Y 3 wppoP3@03 @ T  pt^P VP3#[ p! P @ 3 # 0# 尐 P P 3~33+% # 0#  PA U 0C PH uX# 0# P P3  0 Up U0H S?K3 P#7 # \003  E1 C  @0s s 4 0GpSWf/b(W8 0p B R T{ pPX$0NS0AS q4 qL]\@\8W cHPP| `d)W _WoP CPERp1*U U 003PR2 3%3 K # 0# 000S 3#bX303 X3P 03 C ?K3p3  03 <1# C003 0XoP(C C3S#00H堁q/KSc `C ]0!p0# # +@MQpnlk]\`_^]\[ZPONMLKSRQPONMLKJIHGFEDCA@?>=<;:0/.-,+3210/.-,+*)('&%$#  #S\@ 00C0S000pW 3 T]#@@TC @cyS XRr   g0#[  # 0# 3# # #0b# # ,T\@  ]@ @PX@]@+0G 0p@P S, pPNW= 80W IW{0p@PuS pX# R $ R XX BRp \T C0`@#0EQ00 @`3 3S 0pAQZT p +0G T p P  0p B Rp 3 3PT P 0p B R TX pP03 3S P]P3S3Sr0#[AQ hT P0p`@ 0p B R*T" pP0XSc 03 HP C @3cPQ 3S PP 0pAQV p P# J3'3pPS 0NPX0#0C 03 00 0S P 3 s 3 Pe0*PP 0X B 00 R P # 0# 0# 0C3 43iW nWB0p@PFT pPbR 0@`ሽW ,KK0C P0?KpA H` P0Mp P p Rp/ # 0# Pp @p` # p Kjc[P3HS@PPp# 0# Ry  u # 0# WC Cn 3pPE wUe-p{0F `C `C S Cp CP 0p @ RT  pi CP#C#i # pe Ip`p^ 0[ B R:T  CP0p@PT Pp03 T )3 CP p# .#S C # S- P2 UC C p -L@P`p 0 P  0-  pp02 0-L`@z "00S7  0Pu 1S010a T00vpP2 0S@0P P(6PM 0  0 P0@0`@000e 9 30P2 0+ BA@ #0Q 00 Q*0RW! 08 @ <  B`5 P00P0s0% pp0 B 00 o 0-L@P  P 010 00/ `-L@pPt t p ఀ ᛹T  @0 $ ∹Qm Bl V 0㏂S -L@DM``p40PX0 ? RP40P`0  0S40 0<0   9d0 @ VXP 0@ ``PV T 0P0X0PcEQUP!1`40P\0 d0S V 0\  BS\0  # 0S 00S  # 0S  00S 00 00 00 "00@\0000% (U& X``\PU! 0 8/Pe0 \P6`6X6<6(K 0S@ @s c `00`7ZD 0T0 D0S T0`P0 4p@ : 0 Lp #K@1@ C coP@cK>CK p`cKp`\L^ CK P@53142L 0|Lp@P0T 0SD p RD * TP0 P p> \`0DrPP4p 0d \SR4 00 0@ 6`6X6(K4p PZ 0Se 4 00eP0<0  0\ ]30P<0 040 `0T0 nDPPS N N X -L4MP`pE@0PD0 ? 50`Fv KP  @  K0@H @ T 0L X0 1 C c1KcK p`KTQ@T*(KK@ ^1s|0ry vWQE(~}yD0S0 S H RL R\  PM  P P Z^0@0PX?00PTw \0"#000 00 P0F0-  P@P0S\000000P050a \ P.0b \ P'0t \ P 0n \ P0v \ P0f \ P 0r \ P0s \ PT0 +P} 00Gs0Sy0\  pP  x00000  0G WS  0G WSp(KP X00f Q-L@Pp`! P= D!0D/o"]S00SlP X0T"@=0 !1 V V0 $KkY E8 EL -LPp@`0P_T !D Q( D,TRT0T"@%0 !1 I&2! 0 0Kh+ D -L@RMP`p <0  K0 p-Lt$Mp ( `@P(K$K#0K0 $ K`@ P(00RKp_L p-L|$Mx ( , @P(K`,K00$ K$ K`@ #K{ P(00RKp^ -LM K00,  K -LM K K,  K -LM@K0,0  @BK 0-LMPK@ K, P@1K0 0-LMPK@  K, P@ K0 p-Lx$MtP ( l@P(K$K#0K`0 $ K@ `  P(00RKpU\ ] p-L$M| ( , @P(K0,K0`P$ K$ K @ ` #K P(00RKp-\L ]0 0-LM K  .  K \ -LM K .  K K \| 0-L M  K \@ -LMK0@0 .0 @K [ 0-LMPK(@.  K@{K0 [ 0-LMPK@(.  PK@gK0 [X -Lg.@P 0P0PPZ `5S0Sz2 -LM @P BS QK0`K0&4 p,0S   0-PPL0P Q 0S @@@20S;2K0h72 -LpW P@PET `@P`` -L Mp0 W$ @PJ@T ` P00SQ *A@QpGp(K (K0 1p0  0-L MK( ,K,0 $0 M} K 9-L,KZK< B S,PEMM<9P0 @@,@ L R% %< R8 R$ T R , \   \0 P H0 -H0 ,H0 8H0Q @PR  B8 , \   %H0  00  ]H0PT Z ,0 P  L 0  b0S 0. S4L0S,0 00 XSP00CP0 0P 0\0S X0XSWD0L0S,0 XNX0SU p(K@W `H/V4pD @,0%<,0(K00 00@2/0 8 \ <  T D, B/P S P0 0 D  XH`@oo  @Qb b@8  v8 0\ <  T (0SX  (KoD 0p5SD@054p0$04 D @8kPQ ,D \ 505,00 < Q 0\ S  0b00Q0  R   a   R 0L \RCD 0$0WD0 t0@80+!{PF D ,0p%<,0[ T w,0 < \ 0c q0 -L MPp07,@Pk `P(V,P  P  UP1RP UZ+ 4`Pmt0, Pb P0L0U 0` ``PU#  0PD  ,PPA ,0\L0 P05YV0P 00`0P PPUYX003x!, yP , 0` 5; X .(KPR `UP1V 00V P-U --@-(K  0, `?P@00(KXJyp,00,0 0,%P ` J` Id H 0 -SLP %-L R.@T@-L 0R-P @-TP --,@ @-zp` y-(y0@Tp y~-W L@p -LPU ,,5S S+ %RE ` `-L0SA 5SePU@`T`P-L0s  ,0 @L0S,0@ $0S005`5 CRS@T d!VWO 5P @&-T05S,PyP00\` ,0/3P V PI p y0p$ !@S 0/ \, 0@ ^00  ]@P   ,@,TP,0 5 5 @005v,0@s l2@804Pj ,0<,0lf,0@(yPr(&xU xP5 S(xb0 @8 P@ V @5T0 5$ 0   0SxP,  ,NP 05s]0S\d,0<,0,0 wp(! 505,0 wp($ 505>, @@0 0   0%$0 P(w P,0<,0  0%$0 i,   % % %R %-0L 0  -LL`PEp @,0<E% R0 RP @+T V` L0S00/S ,0@ 0,0`<,0L0S  \\ P-LBM R   hh ANKX  P Pv  = " /X " >d 0- L -Lß@M r Mp`P p( O RH ~K⸂ pG" 00 ( 0R KuBNK@DP"p 0p kv0 BNK.@D !0 ( $  奯100! 48 0( 0(48P Q AA+Q-<+*)>'&%$#"4   p Q^c^DO5<  " .lt ! 8 Ȁ < !<0 ) 0-L@P T00S:k0cS0:@ 0 0-L -p@PD\Ml0 嚮  pp K0-S, U0x0  px0SPK (K@ PK (K0x0 p 0S 0S  |  0 C R` @T0`@ځT00C p @00C PZ  ERE|  00 pp0p0 0+S} -S  00 0p0 00 C Rpp .0Sp  p 00S 1 CR"p  0 Cp 00C P  p  00 B0C P`R^ P b0x0 p E Y jTpjg{ @Y  Z{ 00fk1[kk Y 0j0S { !k{'{ 0$0|0 0 00P  W00g0 ?0 < ?O @0 P ˟ @??9,$OcQPa01 0 `|0WPP  U R`bPbpbQ @P lw P  l l VlMPl  0S P U=P} W6@Pv lPq P0 0kP  X US d0/C`oG `GVl |jVQ {Njȋ:S㝋 HUH{;R;R k fdK;Bt {{ { d 0|?G0SQ l`^\ Z P%    !\KhK Pl  @P h0|S\P  pp c0a00C S6PeF00 00 L|   R-I0C%S)'&%$"!  zd x R 8 UH{{V{V d0 P{F {7;R ]0XS xS p 00S S  | 7A?|pWP `0Sd R0S?G0kS0S0S IPd |0S?G0z 0?G0kSu7Sl 0 P9C0 00 ){?G  d 0S"00 U ppP \0  Y\T p 0  0C P P0p  S  !0IS`ځ1Y Y\Y1сp p 0p0 0koO`c6 0 [`0dS~ SB 0/K㦋0s.P0 ?G` d0 Z l&$" L"00 KTK5L;B. K {0?GG{ { d 0Sh ??GR ? ?G` d0 @ 0 l _MS#2Sj#{ 0 k{'SP{ d 05&Bd {?G Gk{'{ d 0SGS5&d ? ?G` d0 0|0 \0S  ^ C0C/KCMH{^;R\ 0Sp 00S 1 CRt 5&d 0p@KvP p00(SI 0 ?G` d0 p@K`eP Lp00Cp0 \Pp00p0 0 ?G` d0 {U{G8`0SR R{NjZlP_][ Y W{NjJ{Nj-P'W Wh2{0q '@bl0Kxh K`@pK_0@ S=0pp x0  0c ![ !k{{ C2 S  Sj0|0 ջj | !{  k{'0Q|0{ S{@{ @ 0 &K00 \Pl \pKR l0h dKR| `R /G jR"*k b"R5GSr   ` Gd l |0S( ??5?5?55 + 0   |$$pWPd0 /S @Q R`0  W|dK' r{ 7 S R `Qp 1``30%0iWT ipi{0牑1 k{' 'J{@ 7@  g w>(1k0qC{ d R:k0cSPS+4S 0C` 76#d0 d DS| 0@\ KPX0\ 46d0 ` 6C ` #::d0 h Wp 0C ` 3`0  0 0 % -ML  K 0K   P 00CS   0?G1: K000 R0;0?G0" ?G P 0 0 $ R 0Q`@//0Q/0S S//0@-PP0@ S 0\\0 00@ -` BLV"RM 0 p4 qP@P-Tr +TP@0@ Ə0 0 Kp8 0 `DK.9 0/0Np QaNPWNANP!7NZ| RSP \ "0 0T/ VS? p `$K4\P P8 0s 0P) Q0E(KZ0 0R0, (K0P@40 00XS00 C R @"0Pp$K` A BRVq0"p$K`w  0 0 0> ; -` BLV"RM< 8  0S/@0Dp \aDPWDADPL7DPIq WY;R S PQ240 ,> 0/0/oP@"0U0T? R  `KK S ԃK 0  p 0gp"0!}"0!8P? Q8E<(Kj8 0R0: 0<  (KXQ0A P$ A@P R`KSN /0K p0}Wpf@PK` 0 0 0  -LM`@PUTp$  0S*$!P @0pKiTT0pK$@ #0K@#0pK@01-0 001-01- 0 001- 0.0 00.h0. 0 00. (0.0 00.0. z0 00. q0.j0 00.bh0. Z0 00. Q(02-J0 002-B02- :0 002- 10.*0 00."h0. 0 00. (P8,/,0P( 008</P,,/,0P( 00,</x -Lp`P@@ @P P Ub_\0 X 0-L0`Pp@@ @P P Ub_ 0-L@P( P 4 P 0b0\0 X 00-L0P@( P 4 P 0b0$ 00-@QL  K0hs000 0 0 |0Q 0-L@ P0A0K0hbl00P 0-L# P@0 0-L$ 0  -@QLp Q P`@T Q  o 0 0  -L M 0K$ @4/@P @K 0 0  -LM0 $̜K$@4/@P @K 0 0 00 -LM0 $̜K(@4/@P @K 0 0 0 -LM0 $̜K4@4/@P @K 0 0 0H -LMP`U " 0VS@0pK @0 $̒0pK =<;:9876543210/.-,+*)('&%$#"! aw &.@UjO +6vx0 0 0RL(K 0SntK `_ 0@TQP\ ᇕ 0PQM Q?  0S<  010-0C?o2S Z 0S0 0 R  SXXHC 5AId a5?T 2c#1B 0ca HK>#20Su Z 0S0 0 R S0 SZ8 Z0S0 0 R Z0 l|0 0 0  |0 0 0  0UQE@/`0 0II  l#bp 娀 p n㴐 bภ `TN>a` m1?d"cbRn1ȃc>n!hm1X0@5>#ab m?dc(hXn c> bm1Rn! g6? B!c!b b B`pT0p崐帠V\ g\ 0 IH@K(0  b Z@H0[S0< 0 R 6 S20j jBH@K (Ϡ K `l L S0l 0? ZH0[S0 0 R  ZH@K'0  ( ZH0[S0 0 R Z|0 H0 0  H@K'0   ZH0[S0 0 R Z|0 0 0  0dIbI0H Kax&V?  ` F1c՘ ZH0[S0 0@ R S d0IbIRH@K B0  b? K`%  F1c௘ ZH0[S0 0 R Z| 0 Fs0 lj Qg0S j Z`0S0[ 0 R U ZQ0S ZJ0S0E 0 R ? Z;0 Sh Z40S0/ 0 R ) Z%|,K 0 H , Tt0 S0t0 R 0H@K# 0  ( ZH0[S0 0 R ZH@Kl# 0   ZH0[S0 0 R Z0H@K# 0 ZH0[S0 0 R SH@K"0   ZH0[S0 0 R S0j jBH@KT"Ϡ K `l L S0l 0 ZH0[S0 0 R S0H@K! 0 ৗ ZH0[S0 0 R { Sw Zu 0  Z  Ʌl0 S|00Ř Zd0S0_ 0 R Y SU| 0 ItKH@KtK:  X Z6H0[S02 0# ܀ t H $ Ȕ < D $  L h < τ ( ߜ  ڄ ˜` h R S Z 0  Z  Ʌ0H@Kl  S 0 ZH0[S0 0 R S|0 0 0  H@K0   ZH0[S0 0 R S|,K 0 H , Tt0 S0t0 R 0 0l00 | 0 |  1| 0 W|  =(2 0  bII㨀? p崐B1cภ0 0 iHc >aIH0K0  Va>?d 2c #1Ba 0cHK 1# nH0[S00@G R C Z?H@KT#  Y Z7H0[S03 0 R - S)`޲ -LM$Kp`0 @ ,`P (0耟SPVd00$KP 0 簀Q ֖0# V(0Q Q \ K P< C, =D P H H d  -L M@ K$ -L M@@`pP,@0   K -L M`@Pp0` q KR\0@-0 P@0P R 0@0@0T cH(A-P`^ @T@0S^ p \ 0TU0S@ U@@ S@@\ 00SW@%  @Q  R 0  \0000 R QmQ ^ 0^ 0S\0^- 0S R0 R( R QQ R  0 00S00S0 0\  0 S   @Q  R 0  \0000^ p \{ 0Uv p0  0 00S00S0+ 0 \0R P R  0 R   S0 @  @R 0Q Pv Q 0Q  S  0 @  @Q ^_0 j00@-S  R 0 Ro  R| @ P QJ  @ P0S0 0S0 0R 0S R S \ ^ @ @0 S 0 00\ ^  Q)  @^ P 0S0 0R \0\ S0 00Q0Q S0 000 0 A-P`^ @T@0S ^p   \ 0TU 0S@  U@@ S @ @\ 0 0SW@% @Q   R 0 \00 00 R QmQ ^ 0^ 0S\0^- 0S  R0 R(  R QQ  R  000S0  0S 0 0\  0 S  @Q   R 0 \00 00 ^p \{ 0Uv p0000S0  0S 0+ 0 \0 R P R 0 R  S0@  @R0Q PvQ 0 Q   S  0@  @Q^_0 j0p@-S :Q :y  R 0 R R| 0  @P\J @P0S0  0S 0 0R 0S  R \ \ ^@@ 0S p^ `V- ^ 0. @^P  \ 0 R00 0\ 0 \  ^0  0p@@`Q 0 Q  `V0  0 00 0A-P`^ @T@0S^ p \ 0TU0S@ U@@ S@@\ 00SW@%  @Q  R 0  \0000 R QmQ ^ 0^ 0S\0^- 0S R0 R( R QQ R  0 00S00S0 0\  0 S   @Q  R 0  \0000^ p \{ 0Uv p0  0 00S00S0+ 0 \0R P R  0 R   S0 @  @R 0Q Pv Q 0Q  S  0 @  @Q ^_0 j0p@-S R 0SQo  R| @ P QJ  @ P0S0 0S0 0R 0S R S \ ^ @ @0 S  p^ `V- ^ 0.  @^ P \0 R00 0\0\ S0 0p @ @ `Q0Q `S0 000 0  -LM@P< ATippG 002 Y:`0=z/00 P00 4 80  ETa j  B002Q:0 U U 4 \X8 P1`1p1:<0 p`(K -L@`Pp Y Y Y KhY -P,@L@`]$0$P0Kh] R 0S/0S P0S Q  0-0( ,013̠Q0!0a $00Q  ^ 0N 0 1 $ $ 0L% H5- @UL,MP00 P0 0R00 P00 0R>(KDd@`0 p7/$0 @4/10@S4020S$ 4030S404/$4 04 @Rhd4050STP4060S@$ <4070S,404/$$$45PK 0g@ `fFL8p040K>@1a ს00cq00L3g#fF0 ଓ4/#3  0L<@4pK>@1a q00cA00LPPsLpH0 :/45K0( 4@Kp7/3 0 g@pfFL4@K>@1a A00cq00L2g"fF0 ਢ8/"2  0LD@4pK>@1a q00cA00LL2L"L0 D8/<"<2g 0 fFHpL4@KO<@1dA00cq00E1gVfVF0 8/!1  ā0L@4pK5?B1c!0 0c00F|Q|!Px 04/hh0  @4/H@108! 010(! Ǫ| P DT\ p P p x   (`S <  hS4 Ƙ ( R8 X R$  L `  Q` DP ` DPdP0 O L <-LXM P@p :`0@ p@P ?P0" TT 0RKYp`@K@ H0P@0 <05/00010S 0B M (0 -0LPL r# Pؐ(0 ppPp `[p X(@H0@@dU@XXLP@[lp@Pz[U@@ @t0PP0P Pl0pP ?0-?@lPLPZ[lp 0R@!:D  l0<M[0Pl0@ @ -@LRLPx7[HX\ T:$RPL0sR P`)[pJ $X(`PppXXLP[00W7 100S( PP0S  R$ 0SU 0W@S*D0W S *#`J VPxZPPZpPUP0S p` '0 SP0SpPVD00H{800 pPu<, 2 -0L M,`0Q1S0 P;  XJ @ XE X@00ST* 0P= 0P!$q X 0Z1\ ^00P0p0S PU 0 000@F0(K@0PF0(Kp``HP @0PP!@0d0 0$0h,` -LQ M0 P 000@$pPP Y@0T0 0 $P`*  ZP10``T*@RQEP ,$$@( VP@00ഐ T*RDQE`fP $("$, z@ TP:`00 00q(KD0@r<0<0 4/10S0 0Ep @ | H8-M@xLM8Hp@0X0@PP4 000 Y`VC>K 0C C 0Cd$ 8 @``` @ H DD ^p080'P P0??o@0,0|70T4 p7t0X4 d70\4 0ES SH70@T 0S(7000S`40' 0$@CQ$0& T0àPD@5>00@00>, aA@  0B2 (00t1H 3<000L(KCNK<@D+Tp ,0K04@44[SF  A C9R}xl`YMD=5,%0700SU P0ES@P UP0S3 06 3 05 3 04 |# $0S0C$0d# 0S0C 0L3 00 <# 00C0(3(0,0 0S B 3 02 2 03 2 01 0702 06 2 05 2 04 20,0$ 0CS $ ŋt2t0,0 0CS ŀP2 00 {@" 000u," 0S00n2 02 i2 03 d1 01 _T$84K074K厧C.KX4 B\:/S< !00S W00W044KA`WL d0D4 @4 <4 T(?X044K*4DKH3P<0P0 0<  DD0 xC4C$dA   ??H8?Dl>@>h>=T X -LAQ@PIW0` 0a0S` PP(p$ Wpp80SP@ 0@1S <o80Sh@@ WWP0(W0(S00\;|4 -LH@@`V$PU 0$0VVKh` -L``(0@! P PP xpP@V^V2Q70S   1 !0-LHMpPA`0@x(0 V0S0SSpD A@H0VT xV( 0RV$KPVS0P DPV ~SV @ H @  Vg0P0PfgS0SbVL0 S`fL``h@K@ 9|0t0 p08/d0010S Y=0P H P ФP tH7  ~ -L10(@,@3 Pd20^5P p0ia01$5H100U0s; ,100W*q$0s) `0 R0U0P5S003 R( P H0 @p 00,  R  $0 0 0⃑0Pc p 0a႑烑H,Ko}}}}( -Lr@p(P0PT , c`1$PU eR20pS  ZU0H ebXk X020(0X00P20 PSR  ZuU K1XR!B0!T@5@00 00S) SF $Kk`Ux^UPU 0SPU8A@xNU20S  Z:$KkfT P U00 S % $Kk*U  @00威0t@ U Q Q 0S )P$Kk U!|<| z 4 -0L` RW: QC*PAP%Q%R%T%XP%"2?R?o00r1Gp$pTQ \@T@0S!@^b0S* R  | Ry0S:pLWTD Q+"P 0P 0C52rqGp$ptPPTpP Tp202Q  70S  xPA$ P0%Q$%R%T%XP51/Q?o000CrqGp$p>??op .嗑' @T=0SU* P ! >P;0S:pL2Rop!"' 0z P3  pR 0@R@0! 0c130I4??op"3$0嗂'0/P/op@  "A'0pCpCyP14w0| 0-0PL@P R*Kh 00SP ``(p -TPTU P Kh}Kh(S(Q T0(0<u\.0 0-0LM0@S T0050S@PP 0040S K0@ P 0 PK0P T006PU 0040@I,0,0 4/t8ts s, h6 -0L$M0쥟`S@ P 0D00T0S 506@T`5040S  8K04P 0@ 80 GP(KP X506@TC `0Epd0pU(50 WI TD50tp@pUp0*DWii@0 Sl*H0WU( W0cc P @P  0G L hLlt@px S  R2Q-70S  T@`0W300S# C@(p 1S@ST| Py @3@畢30 4/ @l30@b@ @0@  0c 300S@  (p R@OST Z "  D ,083@0 R  @0D @P (G@ +,lS< @ p!p 0S  h 02! @$R @! 9 hR202Q70Sik ,p`@ @S b2!D D@  $  S 07!DRb @$R H0 !@0 pgpWH0 1D  9  0 0-Lp`WG_[C NSH@@O ᧁ0@a0c#S1C\0L0H p0W 0@`a`@TxD 0-LL@P@ N0S 0000P$ K0hNp -L`q Pp @N @DR0a @1100XSX?X+X!0p 004`0` 0y00fC1100 0 0`   mNX X p |0 0 p0<0` ?0 p008 CNh<t@ -gFfFFL P4  ``F@g$NAQ@d 0 `B1100T# T0P 0 P g& f&F2pgqpQL0 QH0 PM, M ` t<t 0-L$@@ @MPM00 -@L@ pP$ P`TPX0@PT(0JlXP @X XE\(AAM(`FOZM(0vXPTAXA\A]@:-00  0.00000D000{ 0-L4@@ @0cP00S0 -LP`pPp{^EX@PEa}0@aaZOLM0XPOFM(0TTaXa\a,(0(  0|\0 00-L00S" P$MP0SZ 0CX@s RhM00SP JP@ P M0tP 1 !0-LM`@QpP000 S U6 U) 0)  P00S K0K  PP JP$P0K IP I0SP   .0000Q7(K P 0  U0KT  KIP , KPK ᐀"Ip 0 @P[勸0 00KIP! ~ --LM  K -Lp`;L0L 0H@P )W  J KhR9H X]Ll 0-L @@TL ! K0hnL 0-LPr@o @i! YK0hIG-`M0T  `@y3\akp\0-C$@dF\xFetG\P @\ \@\ `\`LH,PPP4`(0P 0@\\`p\\8`\\<\\@Dp  P00 0!` 0 ,0#alȠc(0``000p.0 00n0#`P% `c:@$` ,dJeZ!`l̠  " ab,  `  0# @$ p0A0PJw`s `m0 00ᢙp@  PGp uJTp @(J RH KphG400^J((8  X -L M K@( 0T KIK d2 `" Q0-LM00 000 g @ 0T^ 00 0Rm(KVPK @ 0TJ `I@K`p`pip Xp p):jZ?p(3P C S   @z000 S000 XH0 cW#0 @ pK p0K 0 p Y0    0 嬠 )0I}Ip0K 0 A000 S 000 p K  C0 + 0 y8  t , -LM@` pK`P 9 V000 U K8I  0-L @S 0T0K0h%I -L`P @@ 0TKhI T @-/ 0SAS/0-O$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/000/Pp@- P^ 0S^ `@S 0TT0`0`pPPpp 0-@PL L  0( @ 00 "0 _P2 G-(M0 0 00$(pPD`0 0 P@ $p 0P` 05i3#L#0 p 0'$p0@0 ^ 0  "f!Pf!pP 1@N0@`0 Pp 0 @`00 0 0P0 E00d!l ! 1 @U0 0 *  0 ,(Ơ b, 1b,0  00  0 `00@ `0 @0(Ѝ ^ ] -@PLM`P $Q (p8 0(00 0` d0'%! F! K0 Sh K 08R()8 b(p@R )@ b(p8  -P$L`P @@`(TL $"(0 "`d?Vp@"@pG@@< ?W"@0F?`?0@0V (a"0 "?V(p@@ 0@ 0T "@I< ?Y"a"0 "R -L  H 0-@PL P Ό 0( @ 00 "0 YR -L pe ! -`PL \0@0]@P\  0 P0 $$ XpG-M0@H p`BP ࢟   B C 妟Ѐ#IPb@, B P@ " -%'%9)$ $)7 0'; 4؀`0; p'`&40h" p'`&j0i p`)b( 0 'Њ '200#103 0<`pj Ђ 30(  p'`&، 0 Ћ ! ؋)( ؈) 0 p'`&Ќ0 o`lp`00 i \l p <0,0H< 0 B/("iJ W U$Јb@Ѐ ip `Bj+0 @@J! Q P#A0p"dl4p境<`p!d၌0p,%`Ѐ0j8 1` p T`H D) ؃\   !Ё)( &g9!6.@0L ;()P`Y'4PPX [`0$30Dd$d@0# "EeЋP%@$ap'`&0 fp'`&Pp@`Ѐj` 0 0 `"'Π  0/Œ !l?(Π'1Œp0R  0 ` KDK P r 0D @0   0 ` KDKP ^x2Py0K\ KP#DK D @ z820p\f C0D @0 5 F0D @0 / G0D @0 *  0 ` KDKPb (  0 ` KDKP x  0 ` KDKP  %0D @0 DKi>PE  0D @0  0D @0  0D @0 d0K DK \ Kd D @ p EK0/ᖎ +0D @0  )0D @0  *0D @0 O\ M L L J I G GJJ G F F$ -`Lp@V^ A@0S *@PF W`U l 0SC PPA XpL @ 0S? P" V ! 0S01@0@W 0 0 P PX 0 0 @T T 00UU  |@ PT T  W@XPH GGx`D F笼 0-Lv@0@T 03/@T=PP |00@T 03/@TX]@0H00@T 03/@T$:@0(t -L\@M@P K0K #K  pKEt0c/ 0-P<LP@04 32C0P*T 00S<4 3`@2C0T:r0<002 -@R"0LMpP`000 Z 00S{<0S 00 0R(K4P3 C !P< K`0 !  4`0嘠K0 0< Ġ0 0 小 R) P3<XK j 1jJv0` &c4`0`` :n4`V <0T@  R<<P`0\,ݰ٘ -Ld@MP@p`@` < 0  KP<(K -LQM@P4 @$ 0p@─唠0 4`  0 Y T00 0 @fnP`P`030#? 4 00(K(K D 3 H$ Dp -L|Mx #NK`pP <0 IP  Z0 0RB(K HP 0@0S S* 3NK0  nP `0U: `0%  0p 3NK0 00S3NKP0 P 00S3NK0ꇊB 2 28 -L@ğ`P<IM 4Mp@ 0P000  0S S  P0 0R(K Q P#J K @  JK PU 'SE S0Sr0S  0S0/S S0S 00 0WXP 0PJ=K0[ 0P} P 0J-K B00J-K B0S h(! /lPU0S 0 liU 1i #5VU 000 0 z`  ksL h kP0Uꆈ< ,@ + + * * ) ) -LPKM @ p 0`000  WV 0@SV0 0RK(KWC  P> p <P 0VMK0 3KK`4K0 NK O?KH1 !P81Z<H A QVY  Y H1 DH1P  8 -` @PLp0 } 0P 0-LMPK@"P"P 00S R Q R PV_yPK0@PP@@ 0-PL*pp@@-00. SAA0Cq .S .RQ P _SQ P-S /S /p@-0 SV RR @\Q ^@ S@@Tc RL DPD0UPQ Uc 0S8 DPD U! R' @ @0R-"\\(^\ʔ 0 0 0R0b?o20S 0RpT R DPD@U pR 00- pR ^S PU 0S0S U 0S D`D V PU R0S 0Sd1@-$M`@`  000  0S  Rpl!hQp R  d1`@0S0000$Ѝ0 0-SLP0 0@0@ T @K0h p-L M0PS @K``$d 0`$@\0S  0S 0STKpKp X3-LK`QH08LMDM@(KH B00000 (K3P BK00J0(KL B0 p0(KD B0(K1< BP0$1K@A000 0D0S@ 0PU 0 0D0So K1<A!h 01f8K80C 0Ƞp PPP P8K80C _I8K80C 008K0H0C00Qa(K 8 P0 8K@0C008    < P0 R (K0D B0`V8KL0C0S8KD0C0S S S# I0 008KP0C8KL0C00(KL B0L0C I8KD0C 00H0 0H0 0Ʌ1 "X -L pQAM ` 0P0(0  @@T(0B^K PE p i 0( 0R$K4 RP @@ .RBK @ Pn$0Kt@H 0 ~.  -L0S S R 00 0S 0S0S0S R 00/ 0S S S S S00 00S0 S000S00 p-PQLM@`  R R Kp RRR Kp Kp00 T00PPV0S S p  0`  R R8, Kr P 00 `  0-@LGP01 !0-L$MP@0Q00 F Q5LK 0 `V' D[p,<0P?*,0S#  QDK; S 0 S P 0S @Q `V 0 0R(K Rp`V < L 8 H D @ 4 KKLK:K9K Rpw* P/ 00/  0-L@PP 9@6U0 0-@L P 0 @t@0@0 -L@`pPP  00 0 00 0 > -LLŸpH"LM `0@ h0 l 0@D@ 0 PPP0S S! A@@@S P@h00 0Rc(KT S@ K p p P0 @@TA@@@@0K p0  Ap0P RQ P@D 2 0 0P(0 l0P 00SP0SQ cP@D  0 l0P0 l0P P1P00S꓃' ( -LϟM    烟K2 _K" 08 OK00  "XR20 0R (KZ( 0S ;pP "000S0S0S0;0ST^ 0.1@0SK0 h0 X?K2 ?K2  0 PR @]PP0B @R = 02 =̢ 02 =崒 02 ?K dЀ9t| D:|8d)T Oh2S    "S REd"R > RQ;` PZ 4 P\//oShB Q"2 Rd PP` S 2 tP8hQ5 Q 2 㰢@0Q  R0 " 0S" 尢 @Tp2BS̢崒 kp2"0?K2 X0h2 T"0Sr "尢2S l20zjPpం W?2 ?K`Т ЀԢr b PUU 0e9us 0E8s 00 h2Sd2 S  RS`P  QP?oRP,R 20Sd" 0 0P0S2` PR  2S  R 0S" "h0 0Pf/2 Ph"R R0 2尢@R 0SMS㰢  0"S@T %PO ;0P2 < h0" 0P2 22@T. 0/K" ?K`@T" 0S PRD  R+ R2 X 00`P R3,"R0 R-`괒; Pn2S ᴒ22"00\ R`P  R갂p2 Т崒 S@ R S{ Z "  P@PTU 322 0P2 : `v, K?K@p@ hB,2 坂P,P(p2 R"  2S  B5 㬒0!a"'K0 0 P009p2`P @@ 2eP?,rHpW *H HH2W @B :P@P402 2bp@⬒ S  U@ p_D|p(2SuKp 0r $2 0 2  0"哔 2 x$ "(^/P" .P50D, K 2 l"C/2PpD)2 2|0T S% SpP*0\030 03P(2S -㴒D  DpqW0S:ZQ㰢 l  @P 2 0P2 崒 @P  22尢@ 2K"@ 02 c?!01 06M@PQN LKJ02 ,P 02 02 ,2SP 8S  0 R PU+ 0S0020P2 2@0UK.A>"QK嶓I L.PcD1x00x0],2"002 N2@k%@ P8$  XT   0dX 01l2 j Kp ,P" /KB 0`@` P R   B b< P@0S?K@PBDK0 `P 1000 R^\    X P  R "     -LqlKTM`P@px10|0  M|Px 0x0  ?PF 0  RS R R R0 T@>P0LKL p0K L K{P0p0 pY 000 Yp0S 0PP0Sx0S xT P(K( -L\MPpK@eP0(Kpl`K @*00tKxK p 0 eP P0S00A 0 x\PxtKüpxK 0 peP xoLKH LKx:P P ``0S   0-L KM@ŸM0 `K ,A 0 S 0 K*K(A, BpR KA*K0 BP K AL" K@"$A K*@D Po 0#S[ =K 0C>PU =K@$0C@>PL @I  RF p p ^P Z; R8 R R  =T @0P ]P(=K (0Cp$J$p (0J$ JsP(p W1pW) 000 P =K(0C0(=K0C00b-K B P0q=K0 ,0C00R(K=K(0C0(} ߌ dܠ 0-LPDK,M H0 xx$@Ka$$ 'P 0SHP (0S0 KP -LK&M,LM\ &KL(@NKN̟ KP@K8N` 0K0(N-K4 B00 00 ƿ0S 0!S-KP<0 B00=K0C P0S=KzK0C,pGG 0 =K0C:00`?-K: B0P=K0C00  0 PSS00R0&,KS0-&@P=K0C0  - P Pq@P $@-K B=K<0C d 0$-K, BS $* 4V'=K<0C  0S VK AQ Q 0`@=K00C03/PT>@00&K `1 ႼW800T0 uP X0 P}P 4 @@0SW X0   iP 4\10 0R(K0@h1 叼@ =000Sj  .S 0SY@Q5@!.@D2Oo1B1R[ d1#R:0  P<0p1 x0< 0t1 ]0<0p1 0t1 } DD@Q 0l1 d1 0 PM0=S; <0S S" S t1Se p1sMd1SNl1S'b `h100Sl10l1 0  Qd10d1 <.K 0P  PQ`A_<00d!"8   0 P=x<00[ $q<00Tp1s j<p10f<00H0S 0(K0 p p 0 |0 x0  0p  0 d1  "h0SJ9 5i  -LŸ`M @ p 0P000 7 "p1 P ǷP QQ ỷPW  崷P"0@S W 0@S0@2 Sp 0 0Ra(K@ #.K1D"  /K0K帋D2 /K @"?KD P42@"D2 0S82Z@2 0 @20 SH2  @2H2P@"0DZ: 0S ppZ "H" % *Z 0S   Z:pYH"ᾔPD2@"w  -` @PLpR0 ; 0PR-A00  R.CCC0G-PM@ 0A0P0 00@0T T`T4Q0<0xT  jWM@ 00#P 0P0#P0,V' \(Np0`,@L 0'p p0 4B0gz0`@% `&* `> 1L0g @' $ @@?|5O0dEP D" &$P p0"0(p $0Jc:P` %,p P!e 'FmOP`@%0P@#x nyF@pP$P4p"G\DKH@0p!8@p0.gz)D0OA #<@`%7 臇\9H 0`"`@@0'"!fe+F0 P#D@0(!-O  0.0Hp&Cc:yFJ@ . LP!!H'ID@`@.P@bP! "@J " 0#O `kb(KD0#@0@!,P4fO!`` "8ap\  "^K PP0#*D@0#0BGc8!JN!@@ "P` "dM ``0#b.(0#]0T@P4@:P!9 !M "a@ "I  FN@LP$@0#l0#oA``!nP!e଄LDR ")TO "P P.`b8,@ . @ৣ$9` )J$P lOi` p0 "  @@PÉb+[Fp 'L OH@P p!8@`}O e@PP%P0ѝ0e]H@ @$ @O>LpdK?F0! 0(P,O  " sa%sJ0p0#0pDPnDc= @`*` ^j< )SWOPB5B阊 4 ":MK @ P%N  0 ( @P `e] 0 "p@0dK0 P% 0 p@$PЍ , v420AEFN(I 00 00/ -`!LP0ّR00@@ip0V>0*  a$Kk豯 i⪯8 V10@V@0 -L0M(PK@ p` 0 0  h!7R8 bx b   0RX Kh躶[t ( ܬ," -L Ÿ M< 08 0 ` 4K1K p$ 0SP (  ^ >"00 BPs@A\%^N L  0Aal"8CP800 0RI(K0 XR0PPSU 0j0S S S <0S \00@R*40[,R3[40[2[<4 R*30[4[8< .SR W* 0` s h -LMKiP K -L(sM$ @p`P|K@ 0g/K@ }K! 00 $O$1 TAXA\A20FP    0  \pP 1@P 0 0R (KP N00P 00ns  0-   -- LM0 0 K -,-L$ M0 0  K X p-L$M`\@| P@t04 ,` 0 P $0 0( ,K0 8 @X@ᔨ8K`ᗨV Kp  PR -L Q0P:Q:0Q: Khw% s r -LRϠ#\ KhbrH1 -L<0M` p!0(0 !pP @K = ^ L!p 5 0( 0R( K, KP0X @@T PU 0S]P@<T 06P 0 r  0 0-PL@ P0 000j(0Pg(P,Pc 0h0PP 0P 00 00,,VP 0P0 08 0 0-L@  g 0 00 00 0  0 0 0-LM 0@P 0 00P 0 3?o02cK0& 00 0K0 0-@PL U 0 0-@LP0PP0P((P,P0 -p0L`P_ 1PY 0 @ S S0 S S 10PH  @QP @Up? lP1P$ @PPD 0SA 8T% 0S" S S@ 0AU 0A1 PP@P 0000P 0 P` -PPC`@v>@P8 `@k3@$d -LM` P@,0Sh:( ᄬ( TP0@T2K2[0J 00TF: 0Q@@c0@T; 00T7:000P@c@D p& TF 00T&:0 !0 @c0@Tp# 00S0AS00RP0  0(0Pdz`@³@$K!00$K(0 00P (0,@0  0-LM 0@P   p P K00 0 $$ 0K KP K05p 0$0 $EK0 -L@ULMPpK@P0\ @@ rP>Pb`P: @0@ rP/P \' 0P0\LQQ2 QR Y  P ^ QpApppR  Rp A@ R ^ QR@   @PQ A@0\0S R0PX0  㠲X0P0 ` 0@P @ T* R RJ RY R  D PHpp^ P@Q  Qh d` p`Wd Wi Pp Wo R' RBW    R4   LKd0 弐5`P HP D   @ 0`0 Ԫ d0RB d0 4 Īd0yX0 JS\  0(KX\0@@w(K   ᦪQ h0  0 d` 0K  h sOPH$'Q -LMP`[d PU< 0@P00 0P0 0:0 Z$0pP90 0073? $p(0,PĕZP3P#,PW-ĕ ( `  080 ߮80QaU%00PPVV PV`U YAW(KW3#-깱00@(K谱@00(KPWK %88SX` `T`FR`FQ`FULPF 0g`mU4U 0:0PFuP;P(KPY, %88SX` `T`FR`FQ`FU.PF  0i`mU0+ 080PFuP9P0 gm:P4 0 im8P0 0gm4  0ixm08P:P -LMp@' KIp! dK1 S0!0 @?oPu x0 0@P0  K0 K 0 0 / 0-L \),@\ \ \^:l 0<Ͽ1Ͽ|q00껰00 -@LM$P\O 80K( ]84 40垒:rph2 f7:;pb1$387z1-`7(pcVab80 4 0  V 0 0080 9| P f10>a0(K!1<Ͽ3?2/ 0 Ͽ|0 ?/s0r \ 0 0 0-SL@ 3/K0hzC-` Ma Qy 7~I@P  @D T 02/ p`6o`gbP V%e e  `P`&"Pbb"V%e e  `P`""PbbQ%e eu  gg"T },c @D`>0 p1$PPgbPbV%ee!a a  `` &"bb!a a  ``!" bb%! b'  Ѝ Qy7~I@P N ^ 9 2/0 `b fPV%e e  `P`&"Pbb"V%e e  `P`""PbbQ%e eu  gg"^ " ^ ^ , ($ 10PpT%T ,@D1P^ ^$ ^ ^" p1Pr^p ^) ^% ^' Pg@D01 Pp[|xt7~IPYQ7^I@ pp9\XTp Q6 -L00s !R !Jp@T/ZP*Z0 ` P Pe@e @{ 00ۡ0@f@ 0pkZ 00ɡ` P @0 @0 0ᶡW 㯡<1 8!0-P@L0 0pP 10@ 00d0.R0  0  0P0 : S`C@ P ph0q`0 000s0S@ 0 B10 0L@@ 0 xl$C-Pd 0 ~^  `0pB A`@pP<  @~^pP1 0@B @pP  @@t@TpP 0pB @@ppP.R @ @  pp@@E B2R񏐕~#~}|{zyxwvugsrqponml^jihgedcs`aGcF@`2RSEQPONMLKJ(HGFE#CBA3?>=<;:9876543%10/.-,+*('&%#"!  0 @ @  @0 saGcF@ @a ppP0J 0 Bd p0A  0Hq႐p0 B0p0 p1` Ɣ p-L M@g&f&FTRxP2Pd`DAE1@B!dP0AQn0 \B@]dP@Kp\L -LPAM M@PBnK `Fp 0( '-P,4[S ( 0R K.qjj X 0, -LMP@ P`-pPrP0U K00S.SK0000 -Ll`hAM B^K PE@0 pP ^ 0RKj  -PL@`Q @Q IPV 00V00 p-L M@P`P 0U0 R POH0@P0 V00KpV 00KpT p-L M@P`0S 0U0S @0SOH0@P0 V00KpV00Kp -@`LM KQT:8K, (0@0@K 0hQ 0 0|0 0w x0 -0LM@ KjQT:<K0 @$0@0K X@ -LMşM\  L Pd 0T4 @@0Q@@Tl$ 00  l40 0RI(K$50PP4 { Ld0 0D @pD CNK @DXD KNH t ` D4[SHDD@Xt?^?`0  MH4 L3PT$?oR20S \40  `4S>   LU UX4?00)S- C0P$@HL  ePP c0SPP ]0PP4 <0 Ro$X$<?+ 0 @Q(qLT2x 0|T h4 ptL fIY54P@ 0`$0Rd. V hL L TH0 P02d$@@000 .T f0 IYx|TLȡ0  V0 ߪ0S7 ۪Nt QLl40 0R?P(Ko 0 əT PtD ;L U0 T帙0d$P@@000 .XTT4SY\40   ꗪFNl  Lg < PL4 DN| H hx`P -L\@KlMp `딥 PXLK0 0 LPK w  m[`!5[` R[Ẅ[d [h  P\ ğ l0 A l0 00K`!R   ;`!R   |0  - P  !P  P   P  P  P  P  Pr`!ReYT R ВP_ `0 %K d0  K h0  K P0  K`!R   ~0 ` 0 `|@0 `v0 `pd `00h 00 (KQ ጑P_ x`0   Y  (K< 0F`!R 0 <L0 5Q0 .V0 '[0   00  Ld J(K   X8 `H0< 0-LM@? Tk TE Th 'TV TF5Ta T2 +TL T9p( T1  TE  T/L@T$ T>  T%(T+ T  T TTK03^0P@0( |tld\T4(|0(HhPd 0-LMP O@PK0 0( P0K080 0A M-L@MPPpK `@0P 0 .0 e$T @D 000 0R K$0. 0ae @  -LMp@8 4p 8PK0p p4KH @ i0K`e4 0Q R PR00 (K(KP 0`8 -\080  +\080  30D0 0pP  8 10Rp00C0d0.\ 80 @@ v @p@Tr R Pp 080 T  @ r R PR  R 080 T  "#T *8 *,& * `p& &d',0'8't  ` 0p(KwD 80080 T @ r R\R  R 080 T  "#T ND80 080 T@qQ ^Q Q 080 T!T@ %@ 080 ಐ |\ N 080 0Ip080   0 B : \ 0Q-LlM00 0 S 0& @S p8  <  #gO  4 ^-nb AS0N0X0 sB 2EDTቈYn B#ለHP`jDQ8DG`?a 2c6?bc?n`HB:`L0 W0E0\0 @ Ns2 nD hMb@A5DT/ᑓH hD3hHbEAEH7bY vT`_ᐚDȂe_ReyBaF*bP ApahQNd PeTp gd8d`<dY @Q V K T0E ,T400 $4H0L  \0PP X(p@D-Y eV aT ]0(K @ c 4 ]|0  00 0(K@  ( 0 2000(  ${{z 0-L@nP00 .RS0*S 0Q.S0P@ -LM@5@ 00 OKA 0v.  00 $ 0-K0 -0L MP@( K(0`S`p Tw(00 K ରPx 0000 ,Kpᒥ0S,0W0?o20#S0(0  @ -P@L M( K(0`S`p Tw(00 K mPx 0000 Z ,KpS0S,0W0?o20#S0(0  D -@ BLT"RMP 4 8 0 4`W ` "P-YX +Y0- ㌡P"`"p<,00Is Ra0ISW0IA0IS70ITq \  S  R p0Y( TY @YA`80Q00S00lS& Q00 J4(Kؤ0 0R004  (K080 XQ0A P@`R A@PT@`R 0 0 0e $b -@L``00C0S vP0 `] SvP UFP00C0Sp 0/ Sp RyF 0-LM@( ޟ00 (0K 0 $  "00s !R ! KဓPK0 -@L` 00C0S vP0 ` SvP U7FP 0-Lj00 R) @0S  0R0(S00020H04S*ٵPN00S 0R (@ 0S0   -LPPL` p@ p 0 Kh\  0 0 X  -L`M Pp 00p@ 0 00   B@$K  $ p -L|PxM p` 00Zp@ 0 p 00@$K # 0 00/ 80 00/ 0 0v  -LX MT P`@ p0p 0 P K  0 0燴 d -L|PxM p` 00p@ 0 p 00Ű@$K # 4 -LPM `p 00p@ 0 `00  (@$K p#  -L,M( 00  ! K T0 P 00-L@0pP K0hآF#0 (- 4  H ` -L0`P@S U P 0S .S 0@S \S 0 S@f0@fT@ -L M@`Pp 0s"P?0 R Q4. 0   c (KP  R@ 0W R .R  R R  R.R0100 -P0L@`S 冚 00d0 00 -LM<@p8 `4 P*Z3*0 T.:S, 0@< 000 00 T- P0@K_0 P  P0 PС00800400(K <0 Pj(K<H@R -LP0AS0@`@Dx`p`A0 q@DP t8 0dP0p8 -LMMK M$@D̟jK ,`FMK@D K@D K @ K@H00KA0P0KL00 K0A0 PG =K0C=K 0CP0S@P =KK,0C<AP =K 0C 00K8A B tPd H@P]=K+K0C,AH+pK 0 H+p0d 0pGP4>Pd 0=K-K<0C8 B0 PP6=K<0C =K80C 0AP)Xe j-Xu 3X2X*/Xx R:0X 1X3=KD 0CV%U%E0`2?B0 Sa=K-K<0C8 B, 0 P=K0 0C00R (K K @pP=K0C R 0S .S 0S 0S=K 0C000S.S =K-K<0C8 B\ 0 jPP=K<0C 00=K80C0PXXl |Xi ^X X X0S^ KD;A+ 0c-K 0< B0-K B=K,0C0-K8 B=K40C0%X# f!Xd #X=0Sh KD;A4+ 0cXr 47XD+0D;0D;@ : :J!P3D;0D; 0-K BS0=K-K<0C8 B 0 PVX jXo=K-KK<0C8 BA0 D PDKD;A$* 0cJ XX\*XZ )XW XK=K K 0C@K0A@C=K<0CP=K80C P=K0C0 ^P 0 P=KK0CAP 0 IP0 0 P=KD 0C00`Sx ( Q 08 d 0==K-K<0C8 B0 wP=KD[0C0S-K|8 Bx00-K Bh800-KX8 B00=K0C0Pe=K0CU0PU0#$ #(#<0=K 0C @D;  @&U=K @g<0C-K8 B 04PU6 -K K8 B@ 0 'P=K80C 00P}@7U00#$ #(#< 0!ڮ=K 0CD;0.0 .0 0Uʮ=K0CU=K-K<0C8 Bg0 PMD;P=K0CD[0SH =K$0C0c@=KK,0C<A@ =K 0C 00K8A B P*)X 4&XH0SD=K%0C 00a) X= X00SKD;A% 0cX<MKD @D ?=K-K<0C8 B0 P0S?D G5Dd 0D@=K-K<0C8 BP0 xP=KK 0C KA@0pP@C=K0C  0 Ph0 YPP 0p PjX=K-K<0C8 BK K0A@0=K-K0C B0  BP-KD; B PcQUGڜ@  @U? D;1 X2  0d =K<0C 0PnD @D D D+3D0@(  K @@=K-K<0C8 B0 PM=KD 0CV%U%E0`2?B0 Sc=K-K<0C8 B`0 P3 XQ XJ=KK 0C KA@0@C=K<0CP=K80C Pp=K0Cp 0 [P0 PQ X#0SI KD;A! 0c 0S^KD;AX! 0c+X :0X+X0SQ KD;A! 0cXK=KA-K@<0C8 BD 0 P.D; 0c X0SKD;A  0c P XU lr`8T$m `jTtHxgfte~}}|{yz$xy]]wwuupuYXs$XcX=K@0CP=K<0C@=K80CD U)0 &PiD;b D U0 P[=K 0C00#$ #(#< 0=K0C@]Xf=K-K<0C8 B@=K0CK KA@@P-K B0P  BwP/0 P'D D {D;D vD HKD q I$HKD;0D;M=K-K<0C8 B=K0CK KA@-K B0  B<P0 PD FD;B0D;@d 090 wPD 1D;0D;0d &0 dPD PD D @D D |3Dd 0P@D0 EP_=K-K<0C8 BK K0A@0=K 0C0 -K B  BP=KD0C0S@@4-K00 0D;D+Z) P0S @ @T 0X4 =Kd 0 =K-K<0C8 B0 PX@D+TPZ=K 0CD0SDd <50 =K-K<0C8 BP 0 P2D;d ED @0 0 PD D sD0d Dm 0 P D+0D;@T -Kd @0 =K-K<0C8 B0 PdZ @D;@D;Z0D; d 0 =K-K<0C8 B0 PDS&D;d $N@0 =K-K<0C8 B0 P-D 0d D~ =K-K<0C8 B0 P-KD; B0D; R-KdM B-K< B@P-K8 BD;0D;Yd 0S 0 PD FPD D A@D D <@MK< @DDP2 0D1 =K-K<0C8 BPp0 iP=K-K0C BK KPA0@p  BPqD  D; DD+@D;0D;P ;d 0@ P =K-K<0C8 B0 /P=K 0CVTD D;LK0D;f@d 0 =K-K<0C8 BP0 PnD D;0D;L0d  0 P[D @:Dd 0D 0 PG=K-K0C BK K@A0@  B}P5-K⫭K BD  J: ` P@P_ yp=KP<0C=K80Ce00Q 0P0PTK0 PKL)A 0c 0H+DHK4D; d @HK@8` 0DK@ =K-K<0C8 B0 zP㬨@D; 0D;-K B R D+P X =K-K<0C8 B 0 ZP 0d @ =K-K<0C8 B0 HPH@PD;D=K-K<0C8 B0 D2PXD =K0C0SD =K-KK<0C8 BA0 ;P~7KD;A<' 0cDd $70=K-K<0C8 B0 PaD@T;D% -K B0 R1-KP`, B04B400 0 0y 0H+NH~D TD00cH  0 =K0C0S =K-K<0C8 B@P0 P D v@D D q@MK5 @DD2 0Dg=K-K<0C8 BP0 PK0A D Pk =K-K<0C8 B(EP@D0 DPK0A D PO =K-K<0C8 BP@D0  DiPK0A D }P5 =K-K<0C8 BD@P@0D NP=K-K0C BK K@A0@P  BPVD D3 D0D+d =K-K<0C8 B0 P~-K⫭K BD  J: ` @PwTT (=KP80Ce=K0Q<0C 00P[0PToᕑ=K <0C0PL 0H+DSHKბ=K-K<0C8 Bl0 P6PrpKD;A8" 0c9Tڭ=K-K<0C8 B0 PKD;A! 0c"-K B 0c! =K-K<0C8 B0 Pqp*KD;At! 0c=K-K<0C8 BT0 PD =K0C0S`V%U%E2?B0 S=K-K<0C8 B0 kPTڭ=K-K<0C8 B0 \Pv 0mrXsxs$rqpooxnhRlxlllPtjTjNidMLgKYe@e(edYLdYd`dH*8ddbtDLbaa````0__x_\__]]<B4\[<OZ\ZNYNTYZ =K-K<0C8 BPD0 D@Pf0d @00 @PWP0 gPO0 pPFD <0<00PO,0, RC0U,001, 1 0Q7: , Q!,01%,%+:(00(0 S0 0$0SQ ( 0 0 ,0( ,  K0c P,0(p , QQQh 0 c( 0 0QG-WPS@A%Q$B( „ ?F$a@p`PPpW AP, @ Œ?%Q. 0 QPPQ QP@ , S:h@Q`@ p==W*00pSS 2-L0M00 2@040 2Q㐢`0r80 2Pp0<0 # h2000@=Qi @NP` VN-5Y UU*0 0bP`@QVG(KYP U?*80 Xc2 00ɇPS1P`Y/ U**<0`cYP U*40 Xc3 00ɇPSP`WQ @00@  R(K` V񏐬=R R @00@ 0SYU*0S RR|Rd P RHRD@-0$a0S` 00XS@0S9 T7*.C+SPP 0000s0  0Cp P7ࠃ0ࠓW0ns0 `P  0NS0 P@70`A0S M| -LP@`DU0 x0 PTP 0"p.`R`p0 @ #2 S037#0000 S037#00 R00 @ 0 0/ Kd0o/0 K@///B -LDM @\`K0P2 0( !0 pR 0 pgp( 0R KL J ML 8-E.BLLT8H$M%4 咄Bc aI DKJSDv0 CK.H< M 㔘"eFPhP%QQePeKᖜ<0KᐞKᣂD0#B3CL0 hAL#9@d<0 3paqCpg<`0U8T@XHW<00 Y0S  S 000 00000S0j(K40K0 KSeP 40K0 KW<\P40K0 KDRPT 40K0 KHHPX 40K0 KM>P I`( -L`PpK0@S4` 5T  D0.S0D0Ra@D S.P TB\PT S\P ` ` 0.0` `꜎(000 -L0M^K` @PE$0 0 PB~KpG$P +o 0RKK F 0--L@RM00  /PTK KK 0-L@ 0`00K0h 0-ML / K 0-L` M\@    \0 \ 0 0 KsK ED Q-LMp`d" P Q0 0( P 0$ 0lR  `" $Phr  p" $ t" `" pP /K0 "0lJ @P~ T 0St 0S S#Zhr`R @T d2`" b@l"  1@Th2 H:0@a P1TA:ZP@cP RᗟK`6S4  0Q`ZP@c  h2`` h  T: h@iX P`y0`Xr QP U@e `p㨬d2 0 t00(Kp(K0 0^0 S S0 S S p P` 00 h" 0C?o2P@ x2 Lx2P  X9*@SeVe 0Sb @ tr@a  P@U 00TQ 0SN S S @ SD X:(ᗪe P  P0 l` <(K(ᄪ P ex2P`R ` ~`p'xGT<1 -L00`(TM P0\p(0 + X@K.0  P) W ܀0`0 H0\K 0`0K00 0P ` 0 ( 0R Kdh 0hP `@`׫TI @4 ;B;8B -LpMpP`@T) V pp0,0 (0K 0,0K000P ,嫫 0 KXpp ,T@,囫T K~0P @:X0/ 0-P@ 0L`0 S0 caP P00000 acR00 Q-LOMPcp`D@PH 0 L1 000  W 00@/00L10 0R(K0Xp. mIP "0 ` R S . R  !G R Q.RA 0S~H0CS0H1 w 00 `B0X P1 H! m2P1P@00ն H`hH!0H 6pVV: " H1  H! 04 0S1 0S.`gRK J( 9 :P1 IP1P2 S(0Q.SH1  @A <1 8! 4 0 0( 0 p0 KP@h00e :S.S 00,""40S0Q.S:S00d@00J<.K PPUH =  -+ :4=d -LUMd˟ M@,5 P; ^8E PD% 0` @45 000 0<5 ^ ^ 0 450 0R(K:0@5 ($0P05  0` PE VS#p0  00 $ @P0  @@V:,%0B?o2d5 R0L5 SD5X5 =K0 0Cp5 8 0P0T5  B4 0h5 9`% 0l5 =K0Ct5 9 0x5 9P% 0H \5 pW(:0%T0#02S" 5 $ c PPz0 y @ PVT:7 ( 4  1 @VH: 5Sm pWP*T5S? 0%PdPP%P d SQ`850SI 0  850S 0%HU$u@e @0`@T+8e ᩩP%` a  0`R Ղ< 0 ;H505 0哩< 0 270@5 95PX5 ˅P8% PXj Px@Pp@53/PPi(%BL%o,% R  P,(%Q;  BR US P,(0X%\%- UBCK4H0 0  0P0   PT{$5 l0SSPPӳ 5 Ӂ5 D5 505 ,5 S S S x@53/P} 5 @53/ 5PE@P85'P85 XP,5SG T5S58% 5 08 500$% 0Rp5P%0R*0 P5PU  T5P0T5 CK4H0 0 0P   PT+h50%H50R055*U 0% P0S9PU $5 e0SS  ,(5 L%(5 U05 85 D&5P X%%l5- U 5 5Pz K0H5 H储R 0< XUὄ5$% c@TT58%@E 0K I( `I`|@ \H l1h!0R  p@0t!p1 S3  Q 5/oT0" R PVWPP@XU(k T5Sh @I`Ep`5@Q 0SQL|CC@`TPLq0p 0 p0p$  cP0  PTeT5S*U85P;PPU v85 0S-QK$% A8Y'8%%5Px ,HU('h5 0h5 PO 0%H 0e0h50%H50R*05U0P05 HU( h5 0h5 P4 0%H 0e005 0t D4S@4S</QPE 9 ::p)h@ -LM0@S`0= S0p0 0]PP. jP) ( 0P P,  0 `idV  00S S KV 0  K0p 0JE K3 0-CMLM0p84 0 S00 0 S#BnK⨢ `F3K0F4`K `P@<4 u d0 , (P@4T *WD$<@4 F@4P 0 840 0R|(KC>K0C<4 !0 ~(â@P& ЇPP( (< 0@ P" <$ 0 0PS`ЦV? 0 @ 0 @d0S 0  ὦẦᵇ 0  0  0 00S0  0@Tᚇ  / 0 0ᐇ 0  ቇ 00S S}D , /\/.x -LM`pYPP00 0  ` 0p @](K` 0 p@P -LM@p`/PP 0 `00  @7 K 00 RQp-L$M``@ P@0SJ 0S0S0/S S 0S  0S ކ0  Kp 0`,K0 0( 0 0`,@ $ P $P00  KpR R 0/  Kp0 0  0  'L* -LLM|ğpP\ pP `0 0T 0P0 000  (㌡P 8` ᮥ0 X`P @P @0K   L0 P úPR QP0@d S Sh 0 S S xP 0  R H H  pX@ P @  PdP E0[0Y R R R  U:(ᝣ P] 0gpPX@0P` h0dR 0NgX B\ AH   ZA: h Z<: L`~ 0 0cL0 00bL0 S): @jL~ YL`  ` 0X0T 0  @i5~ H0aS `.  8 T*L`P빅 0 T 0P00 0R5(KL P$ں0P(    X H ƅH X/L`p}PῤT 00\H0 M H000偅P00p`pB & | p-LM@P`00ɠ 00ZKp -L M@ 9 KH 0-LM@P( ɠ 0 K00 0p-L M@`V t@0@P00 000 9~`Kpᴛ`V00 !D 1!0@-M0 `P@ 0\% 0 0s0S 0pL WL0!000pL .\$T 00 0Ѝ W0 XS 0 0s0S 9\'0s0S p\ fB!R  P(Q,0 4000@0 2 -LŸ04MP` 0H0 000 Z PL@@PK @ :T  t H2TLP 0P0 00 K\P pT X P` AP C PU>b @TpW\P0@K L0T0:*$ L T0S& LQ c% R 0rR0d 0@/00H0 0 0RB(K&L0S PAPP :TU 0S L0X Q:P*4L 0p@:T`T0SL0pT0 .T`\PL00@KpWPLp ŚJA  ! -L,MpP @8`K0t  ( $P030#PP {( 0R KA  , P-Lß|M 0  0 00 000 PK  Z 0B1T0  b,@KP!"T  P p  R 0S p u00 \0S  PR p u00 Y0S PY00P`0K8"圐 2K 0 @ 00S U@:00T[ U00 STF `VX*UT:00?0S S` 0S7l ?R30 fᜐ :P?  P~UC 0S6* 0a \/:@ z00/ 00 0R0(K| 0`pf1 #WP @Tu㜐 PU  0 u0} w0S*: .@d0S P L 1 p-L0M @ PR0 0 ) ^0* KP\*`K \\ 1@K|0"@^ R KQSKQQ  R 0R Kp 0QKph??  x-LpM,K @P00SM 6u(XI U U U i00`0u(Kp`0S 80S 140X + }r`P,KP8/ 0PQ 00P @ P g00  0 0 0t(KtD 0L ;0U Kpp>P%K KZ K  0 pQ/ 0`Z <pWo80 a 0S -KmK-KS )`` mK p`SL0mK0cpo0 8/ 0PQ 00  P @ P 00 0`S0 00 RPs0Vp 0f0``t`Pq0 , e; 00 0pWoS <0pWo,K0 S,K0P;-,KS0p`3%,KZ-Kz 0ZV <弐0/0 P8/ 0`VQp0?t`  0S  0bpor Zb ` @Z ᆠ뼐0 00t`p pKjP0: S 0 8/ 0PQ #弐a0W -K-%0 lpS -Lp,M @ \0P @``#PL PL0 s00 K80 H <0 W H0@00P> 0@UT  XB*H0 R0: \V X VH @h800@ TST'80S @@T<08K0Pu < 80 D0 -yD0 < Y@s0=P08S<  (K0D R LP RV  AX QVp S00 @ C Y \ V L00 S\  D@ PV0 S @8@VT =P 0S8  8LpV V 00S080{< @<0 s8<0(K R R@@R V R@ T0@0@00SV @@AH Q  Q V O 0-@0LP0FGp 00100@@@ 0TS 00 0 -L M@P0.S00K -L0K M@#pdK R ..P A@ S.S P0B P-R  .R0S/P0B P/0*S 0.S S/ R !0B]S.R 0.BoQ 0#\R00 !B]Q//]R0S! C//0 0 / x0 00/ X // / , 8  0/0 R @R /AS0S01!// x4-L0$MD0 d4 @0@0 P4P8 0H <0 Q `V 80T T*.0@0D P0U@Vw P 5< 1EL\0p`" C!C:RB9@7>=<329876-43210/.-,+*) '&%$"!  UO0@P|]Q cKzb4Ud 6bv`;qr `0a@s`D<0!0D00DU)0@AQwX( cX0 C1 X  00U1X`0? p@W pGP`~0( (KI0UD0`8@DW W pg07""P` P`@dT@Xp0pg 'P80T H0T*00800cH0T*.0@0D/~ 0    8  `  -L,M<0 080 `4@T0@ P $D0 0 H Qp, SF [Qa m;P edpQl c;Ph e1Qp` W;P\ epWXVVp@0Qp80 0c0CG8VD8S0 V>@0 cR9<0S <00(K\Q .Q8  b B'8V$8 Q R.Q 8@ @0] ;PD ph0 X0xS @}0@(K}0( (K|2D 000  0VW$ L /R4 ]R9\Y PP0 0K~0 P0 ]RZL " 0VW\(@Y} 0 VWppp8A  @ R .R80 00WVJ \!  P0R 0 0WR V0@0cP<0S00  x H Y L "L nZI [ 0 CP  RbL ` b"\ PWV ,0 -PQqL`p:*0@S0 R2 0p0P, U)P`   R00N |`00`h``RN` @0S0a|(00 (R -LP3P#MRP3U `080  p@040 0`00  Q6 0@S S S s|(00(KV40?S h040 0D00T00P@S< < 0P8 ^@V Ppt0pGSpjp40Sh4 -LMP K -L`S,M@PH 0<0 Z ` 0S `0S PXW p0S|P(00(K{P00(KH0Tp  4 pL` 0 P0 0 D` PU 40 `PS@DtV pP00U00S <0D S!*80 80`80 V j Y 0- P? $ R``VD08 S{00{(000S 0L 0CR*0j SP0S 0P0 T0p00L0 @0 ,@00 SPP P  AB\ AL^ \ R0SY4 0D`R)4H P=Pb#=0]<` DZD`S 00P<` KT8 K@0 0 }D #p"""T"( { {  p-PL$M@0P TK`0D ` P Kp!T, -L M PRP H10DI0SD 0q@,,p( $1 000 #).10@S+0a(0000S 000000 |000 0 0`0  (Ko(00 @4 -LP`P0S p@p0SS 21C@P0S , Wa <@ 0@ P P8 -LlM`|0 XSx t 00R0#S @b300 0S_SP0S00 $x ,K|ß 00  0P  PRp @.@P<3p 00 00 $300 V@g Qd  Q_ P0Su tl 3/0 0p0pPWp@RP00Sat" 00C0T@(KgLB@@@` 820\w `0S\ 0 RW 0S!,0K <#0@0d P @@h0Sd @ d 0,K 0@ ~P 0S 0 PKxP |L nP 0 S@h0Sd @ d 0}P> 0@0C0 ,0K <#0@0d i-P@p 0!Rp0 P:, K<" d0 W \ wl vx v,t( u u u| t tlG-rE?AEdTc l\d 0Sq w:Si J JBe 0^aEdTϠ@l AL@0dv0gF_fFFƢce0C peIITg?WDAc@00pCq`FPϠ@@l1`Z0B0S0BTPNPN(@\dN0P; S@U@A@`P^0# Cc>dT 0S :S 010@10@;P@:=0@0C 0`Q-0/`PPUA@UP0 /`QW 0R /0 0S 0 0S 0 0S0 0S0`/// -LM0 0K   @0  PU0@0 RPH?2c@Q ` i//G aS  RH0S /Hb AR0a0 ??G0bP00S00J / B@!b@Q0`0 ??G0aR00S\ * o*B2 fBPAD @d@ ??G0`R000 0S +sP@T00(K J?k?G0bSQv ʔhuoGqE`bdnT00/ b#bnQ1a2bQRmQ P`\^mQNV  VGpn`P51E0 0 ➓?2cȃidch Tp`R So᪢ I@ YiPp ` ^0vN N ;S0 00 paPA㈀KĐKVW W02PlKLKѤ?Ϡ 0 a c00 SLKW,KlK0   ?OTf1DQ009DP 0-L 0N ^0N ^ A \$q0T 0\0q0 0 p-L M0@-SP +SP `K0 P( >00:S U00c0Kp;0 P  31C000:S<0 P 0 00 0-L0@JS( MS 00C S! m1 P 0/S <00  0 }P 0.S 0 sP 0.S 0 m1  fK0h0 [ -L M@P`@p0S@0  K -LŸPPM <2  08 0H2 000 0S0 0dp#>K0C @2 8<2P 1"[R@~ ^iX 0SC#>K0C Q0SU=M0@0` s,KQPbA,K !AT\@ KL0I L2  Z7 prFF. 02VV#01#0 0T S40QP  - 080 00P3 Yb \ r0 d#lt \0 _TK 4DQ@S[E4 8Q! L0SLX0L04PXA0@=0TRX 40X PF̃Ld@p P0 P$0! S!00L0^TP0X40d V<g0 ^ d 400H V<R h C 0jK`80 Y 0^  pr0 P#  X@0 K @K P pPX KPV F4R@KQK`R4p8@KPH&/P0Q8P  0 jK40 \L@PFt0 Q ^hL4@"PF,u 0 R  ^00S T `H2㉐ b0@ T 00S0 q<0T 4R00S 000 S X`V:}p80 嘮 @0 P40 40@U P  0S RS000FP0 @Qq TPE^  t zP 0S RS0080>SN m-` `QE V0*@;@\0 S$!0/0! m@(KKS2@m00@`P'P^ 0K @S$K!0/0!V:80 l& R0 l  R 0Cs"F,0"F,l  R  0SH0B0  RGL RD 0@ @P 00 :80 6S `30 V| hpG;K+JoR?40 ><0 P<0 V Uh iP$ P h01S@ dP40`ST `F0 V=-0 0R P@ `Yϰ00@\80PA\ S000!, 0}VE=0 0p ^@pA `p00> BPFLh@ ˆF̌xPR -LM@ 0 d0 h 0l0  PP00h0`V <V 00F S+`FVh RQ0S0 C+Ch00cp0 p R l000t0  S R,R00;R00S `KP P0PSPU;S,S SpWd;:l&2-^  m ``P   F lP UP}dpp2F lF0F<`eh0Q0^PcWl9` hh bx& |& l&p&t&u&&&00+t VSS  0>SS>Si9d `PV|P blfh&hppfʄtf ufxf |ffffl0k 0c `(KdK 0Ph0 0l0  Sh  0>SS 0>SS>S0bh p0 d0>C`0 "LT0K0 &P 0,S@0K0 P Qʄ 9` ,Kd ` p blWhex&pƃt uaE|l0#l0@ PW @pD‌ O/bd0{#bqa >OOQOrbR &P 0P@>0 5P1E㜠 0 0p x0 夐 |@ 700 'x0S| W`a  Ð %K! 0PRx|` = %K"x` PN X 0W@@ӈK PX0PSSd `` pΝ@@0d3aP`Pㅜ@3a,ΝSc!@@SW 0f g 0R0 hPPewX 0+%K!>Px W|@@0 =x . @ %K!)Px0|@S㜠p夐000|@x0圠p夐00gS000t0P@Jœ< 0-@L@0S xK0h PP P@ @`@DP00 0  I Il -`QLPV 0Slʅ 000 000h6l6p6t6u6h; @P 0:S;  kP5 `VVlpVLg`p`g@_&PT`Vڐp p 2FBaQUڔ<3j.Ccn!S 0TPcP@@X [Um1Un1[UT0{DA$I"IPT2?vD LB1c1ccJ%Ϡ!E2L3l@0w?CII0C0/@!b!b S0 B > b> yb`p <0rb<0 kbH X0 0 ?Ed"cBbR3cCco,"32C 0U Pc 0 S0P4  P$ 0 0:^pQV0KH0  B`Q@'2hH܃K@P@XYHVWC 0C0C@TU N@TU\H dKd0dKH0 `*^0 SpP`S8!d?OR00@-K " S000H0 :0dKH0 6Q 0-Mp@L@0P0P U0S Vp`< 0&" #KKSQ0(f0 (K0PS( 1 Q0#!Y$K0Y? QNaX@0 0 Qp`"2'>p`<0Y&" #KU&:[bhv  0qP< l6F^ P80S2 VP0(KP 08 4K:P A Y00/p`Q @0TUp0deT 0 _pS`( 0U `Y 9|8 -LP@P`@<X00 P 7x -L^:l& 20Q -  2FK1 1 0Q Q q Q Q q 1 0( 0R$KX_T 0   -L$M 00 K -0 - L(M 0 K ` 0--LM0 K0 0-L@`XQ`00C`0S vPX0 X `XQp SvP UX P X0X 0`00C`0Sp X0X/p Sp RX ` -000-0LM  Xx K  --L, M( 00  X} K  -L`PWpQ@T@@ ` W0 d@@\/P@Z  V 0 j  XQSQ jZ --L M   K -- LM0 0 + K 0-LM` KP.PpP @P ! P&?P ʘ0p@ 0$ , ( 0 0KK0 SK1^00 Lp 0-PLP@TCP0 -LP`@Y RT0U :T:0T:KhhV]R -L KhIT00 -sL@` !R ! 00 0S vP0cS0A` R 0 U00SNP0 NP PNP 0 ]P 00 -LP`@T@1U {pP  e!P]p@xpP  0 0| -LL0KK 0C6 ` 0DZSV|be2{-Hvv^}|z}S6 pv0sO @GK @Y>KD 0CD 5 0^nKO `F)5.PFTAXA\A'XE @,p0 DCK&L u @PHP@0@&0@00070 0R(KF)IP^ 0F7f  \ :L Q &6S1ӀK & & 0SR X0Y6[l6 oKY A 0 0^ YNKP @Dd06 o>Kv 0C v@Q# U000 Q00S 6[pG0Y 0 )SP@0 0  SV G000Gptɟf <0SC   Q !Ҁ & <   A0f 7 6S06 6 Sy &1Ѐ06 j.K7 BBSk>K00i.K B&Z`V 6P0f7 vF0P6 6fS-06Kv @K 0CY0o&R 0SR  f P6f Sa &傁06 x05KQK 0RQ:6 0S.K B6 & 0&6 `6 R7 @6[  S& &  P@.[@+Z@(PP@ P@![@P@f P2\Ÿf 3@@P@P@Z@ f    @6 S2 !06 @0*T 0D` Q0!@000D Q6 P@0D00!@䉐 0D Q$Tc ܖ aTf  4P07 X05K6S06 6`S &1{06 iKj.K L B0BG 00B{s `V 6S60f6 7 6s05K6S F006K6[ SR' { 0Sx \@ q $ { P ts T 4  D `   dc@0D Q00!剐0@ Q$PV 6SM &16 06 6SU0c6 +06K@N@PK6[S@ 06K@DP@Af Pf Pf P6t f S' 006 k6f S0Ds07 06 b ]Tf ( 06 EK0&K@& `& ' Y.K BV & 굆K0@7 60iK 7 P   760T6S4 06 6S t60@60@6 =K0CPPh tS 6kK@0Sp6  Q p 5[S 60K0 KS6 p Q p R @iT.TDP&p @DT0SP6  Q[@D T pʰ3P@000 p Q p 6 W6 &0S  6 Q6 0  p6&@bTTڌ&`V p @DT0S`6  Q@D T p4P@00  bQZ76 aiKPB& piKP8& p7S6S'6P& W @bV@T ڌ6 0@S 6 pQ p T@d@T7TX& p @DTH0pS6  Q  iKgP7Q6 /0 p6 6&bXXڸV0PPpHX PR0&  QHX p$7\000 p Qq piK 7 #P p 77R@P000& pV  tUi_>K p 0C& <  @6 p6 6 6S6PYNK&` @D0KP K@0p V {Up7 p@f PC0K 0C0 & S &1{06 7iK Lj.KS BB0BG { &7R16 `DiKoP& pV 7R`C0& 6 SP p~iKWP p606 Pw &\RnjkK:I` `0 p  `0V 7 V`F6 pG0C6 P60   Q  6@hTPPUڌPP   U@e@T%TڌP @DT0SP6  Qp@DT 7^   6 SVӥV w p 6S0!6 6S6 ',@K6 0Sp%d @ p6  Q p &6@bS@T ڌ6 0@S 6 pQ. p 6T0dS@Sҧڄm&`V`p @DT0`S6  Q  piK}P wQl aiKlP pXiKcP pZiK ' ZP p 'Q k60NS `T6[. & @ &  F `F }iK ' 6P p 'iK-P 6S !06 r ,@K0p%da& RX  &   R&EKR &KS =6  & 0SR/ X0Y'YNK @Dd0 )2 >(0bd@& b@ SZ &06 P6nS206 0 00 6&S R&0K6 0 & 0 Q0S60R00S 0[SNK@D M` dY?6S KT0C ࠖ 6I&jK  0[p &0& 0/0@ c \ &Q 6K&  pV 0&  0 uiK4P p% px>P@000 p Q p6[`V`fB5K-0C+0S V5KD7_K @0`0ES000 0%K`C&0`7 RL&@F ?F 6 `6[& ;66P&00S6 V p M&X= R000& p Q p 6S* '6  0 S6  pQX p 6@cTT҉ڰl&`V`p @DT|0`S6  QA  p6&S R&0K6 0 & 0 6S  &1 &  J &R 偁 & S \ &AQ6K & &XRv 06 6[l 6 @ R}  & p;@# S &06 pf@ E \ &Q 6K& pV 0&  0 lQs &6S1ӀK} & & 0SR0  X0Y ; YNK @Dd!.0 00 0a&d@0S  R 00Ac6 a000AL   S &₁o>K 0CȏS &1{06 iKj.K L B0BG 00B{`BNKg @DfFD0?B!c R100c`000aD A0`R_Kv0 @0A*D0^0@D0a0x( & b6 70f?6 iKP p606 60 6 & C>K0C ࠖ [G jK0p@ &0@00iKrP& p\ <0ScV 0 0iK^P& p6&S6K06 0 6 V 00iKCP iK ' :P6[ p '06 6P@000  6p&0'6 60 7 `I6KS =6 6KS =6 iKP  /& &@6[F F G & 65P@000  6S &1 & & *  0SQ0BV ?o2iKPR6 pV P0iKPE ğZ MiKP8 pt`TOژ406 06Kc V Y l406 |/& &6[& '@& & ' &R !& `@06 :6yS-06K X0Y6[l 6 06 @ -S`-06K06 0px05Kp07  % \ 6&RK & &0SR00s 0 # R  & p!  &R 偁 & ȏ B S &06 p@  \ 6&RK4 & &0SR X0P6[l6 Z0@6  * \ 6Q0&KpI6 0 0 'G \b 6Q0&Kp06 0 0 6606 {06 A6606 Ѐ06 ̖ @d@0v cv@/& &`6[F F & 6  V \6 V XQ p6x606 60 6 & o<006 nH Y4 ܴ ULU8USPOJ6&0 6 & 06 L06 00606 606 606 60 S6 ;006 606 606 \ &6S1ӀKi & & 0SRU X0Y6[l6 0 @6 Q &6S1ӀK & & 0SR00 R& & &6Kl0  & 0 KiK P p/R& & &6K0  & 0 26&00R&Ѐ K&  & & & 0SR X0Y6[l6 /0 @6  6[ @ ` 6 && & Ѐ & g& & & & 6&00R&ЀK &  & & 0SR00] X0Y 6[l @ 6 T660Ѐ6 o>K 0C606 606 &6 06 0& iKuP pK 0 iKhP p6606 {06 6606 {06 q06 6[l 6 iKDP 0 YNK @D c & P0095K 0o>K 0CiK)P ph&6 06 0& :06 6[ @l 6 iKP6 p6&06    V & &  6&S6 & @K06 6 XS x0& & & R& X0P 6[l@ 6 6S6@&KF06 6 XS] \6&S6K06 0S6 0 & 0 606 60S6 6&S6K06 06 0 & 0 6&S6K06 06  V (& & & R& V606 60S6 6&S6K & &0SR 00 X0P6[@lF  @6   .66S6Ѐ0K6 06 / & & 0SR[ X0Y6[l 6 w @ 6&S6 & K & &0SR 9 X0P6[l  6 T@   &R @ؖ h6 j.K6 BC pn &6RR& &  N0 @6 6[l @ 6   S !0[6 ^iDST !06 @0 D Ri```0 A R$QO &RB `06 !& & &  ȏ;6&00R&ЀK & & & 0SR009 X0Y6[l @6  `0  &0@006 0 `6&0 &  6 & 6ST 16 `@6 0 `6 0 v06 X6[Yl6  R R R V 6 j.K6 BC p 6+ V V n @V X0Y6[l 6 YNK @DPd06 g "6j.K B0C6 p 6S60 6 & -L`D@pP<4@0  @< 1 -L@P`p;0 P; -L{VM0 P@/ hPy j00 8  (Ko01  0 (Ko}01  0(Kos0 X:?C0C0Zp Z ppT`P9 0G 0 S  C S 0S  V #R   CS$B  V #RVX *CVR"0Z  Z p& @0DY@V F   CS(Kd{0 {F{&{ <8@X:0 S@0cA.838  0c pG023T :g{;R&B0@0 P 0@VᨏXh T0SP0CN4@@6@dp@0PT0  0X0 P R000W00S R00@cpc cP LQ> X0S T30PT0 \PP \&0PL0 dQW !0PL0 X0@ R0S 80S{K0S0S0\0 01::S@p0\0 d0S? h ??҇coCa?Ɗ(`ȳ?DPy -,;$|0X0 0h0 Y {P Y@@T VyX &2!{ t 0K k[S   k{'0k`0S {kJY[{{;R %Bw XQ {;@K[0q{G{6;BF[5[;Gk3kJPK_Gk3kJTY {'k:[%k0qF{7{Z `0X0 Xgh  T 0PT0 $ h0S@00C0 hP0ST0PT0  \0S_ Tp@P    !>PPl[{[;R %Bm{;BG{6{E[{J#K0@V0?0S= x1Y  0/1[@{kkK:E{000@{ Y{7{E{: T0D S s9Q@ `\ T  0 S00D0 0@(KX0SX0P@T0 P00fP0 0fL0 0d0 2kF{`F[?@?@$@7`$|X0@ R0S%d0\0 U 0`S`P0@p0P0 T9PPg WL20PL0 _ `0SRYrX0S; @LPPQ X 0pp0jS0S \ L\ JP T0DZ  s9R@  LmT0So Y S@ e=0fS !kC2 !{k& !  {k&0Y{L T [%{[L`>T0S @\ @700@0D <0L0 T0 `@100L)T0S+ T$([L{;G{6;B@{;# :P@K000 {'[kF{7@{:@000Dk[3[JCk6k@0T D0S v0X0 wT80I @d 0`` X0 0T\0 *X0ST02 WP X0S Q\0` S@  PP Xl P  Py @L`~ p0 `Pi 0ST0 P r< @0<SP Q P 0\0 L 01 `0@{01[kkK:E{000@{ (;{'kkK:E{0000j@{s SYk0L0 T0 " @X:0000jSKU P @@$?$LP `FPP X0Sh0S@00C0 hL\4PP0X0 =@00C0YT LrL \P P< @0< S.h $Y h0SoKFk&k[{[;R %BI0  T\P10`0\P 0pT S``d0S Q kPP LP49W 1pT@pDT \P _\P  N@0T D0S S9RpT p``d9 T @\P T ; p``dT ,9RT 0``pd S hv<` 80S @$@H-MC? 0ЍP R8088SR R / S /Q/R R//P 0-L@00@ RP@0 0-L@PP00S0 0 R U00 @!8 -L00 WH 0h 0SK SQ ?o20 ZTg{@W`` V{ 9 0fk1[kF{k 5ZWX Xi%0gXʘ)0gc{dK 1 [ K0k {' {'{ Pup0K0  n R-I0C%S)'&%$|"!  \  0x` t 0 0XS xS x 00S S1  7h 0Rp  d Kl06 0"  ` 75R{dK   0kK  {'{ AP t  R \ p X^ T x 0 p 0C P P0x0 S p!0GSP1W W\pjW!сx0x0 x 0p0K0 `f`VV &0{01k{'{ `6 &PD%0 kl CAL4R*65\6l0 {0{'{ l0P$Sj&oF5`F6`l0  H5  00{  R   |KH Pt k | p0jS`p` 0  p`0 | `p` 0j 0Q=0Q0 e`cV\t. |0`|` t 0 Sp K 00R0 0 0 @00X?ᠠ 0 00h0 ̐ ۟˟ P- P    !5t0" pP t0   !4|pP0d0 PP U00`e0` PPc0 aS c0P`PU  X RPb`bbS = P  P p0 dQX pP 0S ' P V  P X  P  `P 0SV@ P  @ 0R0P0S. 0030 S U e!00 00 H0| 0#pP00S00 KKH d PP Q g PXte 01Y t Pt u 0S0 CQ0 Se|0 0C|0 0S| Tp00  b/o" R (J{9Hk{Zțʘ0S0@0 O   ?@?A<V |$Up 尐 pᨀ堠̐X!00 ʘ0 @0S@T `P 3 P0@ 0 p0 t0j| p0 6Pt   0S x 00S 1 CRp  00 x@K$P x  0000(S00  t 0000S 0SB0Q0000 r @00 B;t "00kx@KPp x00Cx0 Px00x0 00 00 xp0K0 @"dK[0 Ak  K {{ P 00P00 ;"0t 00 a'PL 0 0 UP @0S@@T%00 H0Sp pᰐ 堠̐0S p0 0 p0Rt p 00S S S# t0 t  00 R05 3* Q00 O  0c 030IWPt  0 CQ0S+ |0 0|0 0R00 tPt p0 0Cp0  B LJt00 @0 S00 | 0tS@ PU0@ q Rn @DPTT@DTPbp pᰐ 堠̐t0 | @Cp@ Pt h U   ͛Z{0S狸JH9> SX@0J00c0 狸00 00 4NjLZH>țHZ0 p pᰐ 0ᠠ̐0 20  xK000t0KP y0x` 0 t *PbtWPt p 0p |0  ep 00c0 ?$Đ000 `f 0 0[01k{{ ` &2Sj`h  kl@AP$A&\%&l {{'{ 0`l SR*/B B`l    { 0Q 00 00 t0   9"006010 00  Rav@I0 Z00 00 0|0 Sft@0  00 HDtp0 0@ p0 o0  lK 00K00PM010 00  RJRt 0P 000ʛ Up 尐 pᨀ堠̐r 0S | t0S *0| |S:  0"R0!  0 B00|0 p |0 @cT ktXt p0 0dp0 X yp0K0 5 `F@ x0!PPst 0|0 00Up 尐 p!00̐0 0S-0S) p pᰐ 0㠠̐t0 00P00 p X!00 - 00#Z00St0 UCX  !R0S 0C000 dt 00 *00 0 倀 St0!  R0S000 ?p pᰐ 堠̐`x 0Cp 0|Pt 0|@@d@T|00|0 !00 q -L00L  -P0LpRP0p@PD `0`py )z *00@S8 00@^S8pgP *|@Q8,80@^S8S 0V 1 `` PP    !]0@` 3-LM< 0@000 00S 0 @ 2 180 080 <080A  AR 0AP0Q ` @4 \p# 0 QJ \4R\T#3PQ P`Q e<V TA0p\RT T0#03P0S 0` 1 c΁0V TB 0 X *  X*800Yd 08S (K P T@D 0`D@4  \0 \0\ XQ \0(K@0S 8@0  0c1300)LRoQ )\  pR R )R<0pp7 XRM \0JH00(K< 00n P -LM`< 00 4 f9)0p00S 0 00 0Q @00Q PWPU R  Q\ \PR pR P8 @ S0D0Y^L @0S40 0S S S7 40P@R``0 0'00U`  00UV< @d 0SD40@ 0 S 0 \P  \R Q8  e8 PRB pR@ YP50d0CSڣ0S`P 0@0 Z  00QUP  @0P0UG0UEYPj R 0U 0(KP 8  +R -R @ X  BPࠃ] BLP >  BLP@P8 b 8 C5@@ 00bC10BN40P`PJp408 0Rq48 0R|@bU 0S S S 5P0" (KQ W@ Sr S0S G0`000 400`< 05" b0 |0R@ 0R o0㩒"@ePp D@p 212 Q tPpp80080 qG PeP408 0 8 RGu50" (K @ D<4@@W 40 0S] S^ Sq @00< 8`00SxWDpX )p@2 Pd1@8pc40080 d@``P 80p0d80 0@0 80S u0Sq RZ P  UQ# P PP  P00c00S pT` % 0WpPh!@ 8 w @00pUU!@ 0000S0S -4000CU"@m2P15!@"@e8 IEP TP P / -L`9 CP@Ϡpl\3 \"P T0p00 @ 0V@`c`V  0 BPp @T  0 B0eP V@ 0-LM@KPK ~ 0`0c2KS K { BKJDBK k K0-0AC^ 0S R00A0  S@-A *@\ 0b0C00T00T0"S  13S /01\ *0CP  3R\:// 00 x 00s0QX0a00s0Q40A00s0Q/ dP@-2PS A! 1 ^ pa31)`700^31 d B   S000e0eC1S00000^ 0^0000C1 0-L M !S*@T 0SR @K0@K0 ~@K@ 1-Lq`p0S2 V00AT !0S*00 0PV\N@T`P0S t0hPV0!@ 0c!1S! $00\ DLh o 0-@PL0 RxPQh00AT `סH0 0PAKhʡKh4R \h0   0#1  0/sQ#8 #4 #2 #1 0   0/ -p`OLP100 " V@P0 0V1`P`=P    !+~pz 88S00000P /// 0-@LP0@00 -LMP@`pU @Pp`0Y0P40 =  180 X01 385* Q0!00 ^< 51*P  0p` @0P@ZPP@\`p@Y<Y 800C R  3RY404(K -0L@p<$A QPZ? @ PU  0P. p@p1`0S  xPP? 0S 41Ⲡ 1⭠PU 0S 0C pP0`0SYP! 0q"  0 利0S x0⃠d0~눩Z0S 80s (0R0 \hP 0-顂`PL`@Tڃ0TpP X 0 0X0  i )  \2!R @@D@=@ \ @D@20 0S!0P*3 1\ ://// -L M0` P0bSD 0 \B*32P 8:@PC  0p` @@PPU@pU`\p@p`^@pTp`^@p`0T0C3 BQ  (K0@`Pu0P   (K  -@!LPB`0 P 0`0 T `61E05F0#311P[DT* 0P BcTe cf 5310A!21 PEFP[DEF;R -LMp`@&P TZT@U, FY(@ (K(0U  0 1C^@PEP`$K,KP `(0, ,(0"30  (0 S0  U C^E50`PEPP0$K0S0/0 R / ?-PHALMP@FKt`P8 pP20 S S/ K\p$ 0: SQP 0v``0P 0$, ( 0 0 Kl`0O00 K 000000 K ͼLp 0-@L"00C0S0 P"0P00C0S0/x 0-L0rS+ wS% aS /000Ϡ@0S fSČ xSˌ0S eSŌ +S0@S 0̠@ @0 -SL@6 ["P00 PuP!U !$ 0S 3/PP೼000P @ P N00 `N00aa>"0```0PNb/P 0000 0-sL@ !R !P 0C000 0 S /s 10-LQ@P00S: 0  R, 00P @ P VN00< Q00S; 0 $0 3/0:s00P    0@0000# 00GP0Pᥝ\3᠝8000P00s0@ .0  @00 dR -L Q0P:Q:0Q: Kh&'/ -LA \S :S6 0@@ KhM6 0@@ Kh.006 0@@ Kh000 0 0000/0 -`0LSVMp00@ F$/oP"/$1 1 0(1P( VV(1 Sz R (Q R  0j 0P 0$K0S+ \: P$(0Y  0S(0  S:0  G PY$X(1s(Q0 0(QS 0S0 $1 !0$1  0 ^ (1 (q 00^" P R \00#0\0b0 n 0(- 0 ,!$1 (Q0 !$1q0 PPZ0P(Q 0S 0 0$!~ -L,ML  ` VD H0 8 1/`3/,(0 Q000 0P@0 @ 0P000S0 K< p ` aZA p WP#@TT)  80 XpP6w&< 0 ;YPC 00  P 0p PR`/WD00CS#@ 000(K 0 wP@ 000(K 8PD0S<-H0L  T@ 0P00(K0  QP;(1 CW" @ 0  QPH0L  TP 0 0Q0H 0S 0a0@ !RS(q $1 (!0$1H0  XP 0-L@  S0 K0h,00,10,00,1 0-LS@0 K0h,00,10R 0-L@ 1  0K0h,00,10,00,1P 0-L 0At 0@,00 -L M41`S0 Ka5 0@ 0  1P@3/1A/@@ផp APMOPmTP 0Q RP 0 KX,O00U,0 ,!P -L4!P]Pp@01S 1!0C1iK1S0C1bKPP1SMo@@P QK1Sp ՖHKW0 ,pOoB,p ,0p 0-PPL @-K00Q 0-LP @41S0 PS0P0100+ 0 -PL`HP@ Va0pHP V0'!!0V+@`+0@ -`,QLMMPp/ wH@P/ U0a1   +0S W?Kp+PJ+0P(K}+0Sy+U00`4` 8` *  ,  (4 D0 0 1+@ +U KiPDP W P0S400S 1P0S@4`'P31 D H  0$eQPH!62 0C ,0< 0(0Q3P`W Q U00aQ$$1P4QEPP p"0lr` ddŸp`\  P"@ p  `(KWK PT  01pE '0U WT 0SQ 1A/^pX AP+ a50@R&00CS"  13/@0P(h01P6 0 ` DN! B2.!!HOPI$SS0K *00*@P*0SD0P ,\000o* 0 0+f*Pc*`_*0`| (h( -@(L`10p0fPV(p V؁ !GP- (!1 !01 0P1!D0D0 ,0 U000,0,KoRꂑ EP   h)>I ء 0-@ 1L3/,0( P000 0-L@Q 00 210) 0 -LfSM`) p0 )00(KX `00R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/R -L Kh$rspqNppFP/P/0 0 0P/Q  A!Q0123455/000000 R 000 -RL$M@{  R Q SP4P 0P P4P 0P aVq0 R00s00 \\< S 00 Q3"A!0 11  `Vg 0000a <Q@ 80 < Y 8 0 S``k 8`e 0Zb0S0ಠS 8000JP  8"0Q0C0! 0 0 oQ40  00!0 (KApP AP6 V`FaY0 -00pW01 0q0p ?o 2HPY4 0001@1 jIP0s0J'C 0-0C!!1Q/ -LMAPpT" mT R0 X 0W P #B 0  0BAT$K@0aIP 000 00 1 01 0/ -L@;pP T ᶏp@ @#`B#`1 |!0-CMLMp@P0(0 厏P8 H10BnK@!`F@ ) P3*CKKHA0 H4 D4 @4 <4 #p@ op#  p U mp  ֍( 0R KlP 04#@?00/# P㽍@&#Pz  @<d -LşPTM @ 00p`0 0Q00  00 20XX :X "00`0 0 0RN(Kwo0 0S0d0 X 1S- `Pa& 0{ 0!00`b0Q:1S QY0h0  N Pʰh0oST T Kg 0Ph0 T h0X`崠P1! b ^:B Zg:i0 !y沑 ഑ 0a[2 0,(0 0S 1SX   X 20 2u(  Rmwo Rd0 %*Q0XKd0   p 0 D 0d SX0@K d  HpKH @0 < ^ | p  L d 0 d 0PPKSX08 KP 4 80 G j 0@ !1 R=10C00C S {?尠!Ph 2 e 0 ep] d0 hP} 0S* !3 0Rg1Z01đb RZa{/0Z `P# 0㸡h0 h 0 g O0B00CQ J P0h 0s000 I!00  -LMp(`P 0@S^ q0GM0 p a. vL1\wy 01p 0^00Q 1 C|\ Lq0^|00R10C1(0 0S (K0 R1V*0C1  p 0 0  p 0RX ( W X910C0S4K% 04@ 3K P(00(040#[0!0x4@ cK0  4K  P(00(0fXQ110C00CX Y4@ 尃K4K0H 4@ 3Kt P1(00(0Q P 4 Kp4 sK_ P6(00(0  c P 14 K0C4 00C3KF P (00(01 C  BX*  Bp4K0 4@ 尃K Pn ] / 0-@LPQQ0 0P  0 y0P   0 -L MP,p10C0S/0St P#% P a V0FV S1S I@P `V0ഠ 0  p0  000(Kp剐1 pp a !0FVw sp! 0P00́ ^p `0L0v0s0S 0Cs000 P~RL  R [P0 00(K1  1000 t00 -LM@`pQ e00 RP!W2 W)(0& (  `P 10C0S 1 10C0SpP  ;W  2p0 2(Kp00(K0K ?PP 0 R p 2 1A0C0\* P 0 P  p(K10C0 coᨂ  P 0p' \\ L10C0SP#p0C0Sp` X0 p _oR}P} p w00K p80 P `0 RT ,0RD x0@@0 <0 80 40 00 T0 013"000 , KDKuP,KU00 J0 @ >R0-L4M@D @0 <0 0 80 40 2K 1,", , KDKNP,K.00 0-L@D{K0hC{R q0\/ R/0 00-L0@0S- 0 ,   0 P @P ).0 0$0 s0 00R 0   00  0c00)0:0 H -LM@P`ppP pKzP04 :CRo  S L   K; 0K ;  0K (0S   Gp "-LRlM0P@` 0 0C 00  00 0R(Kx K|K0p0T) | {)P" 8"倀42x 0Q0 pp;P぀0ἀ 10000Z p 00SpK!@ PHP? F0B/S8265432(0/.-,+*)'&%$#"!    x xZP t0K04t0SQ| = Fl^] p-L M@0P|00Ta}V K'}0T1S O|0T1S }0`}0U0T\1\X1P u|Kp0U\X1\P0X1|0d|Kp 0-@0LPZ|U0 \A\Q X10CX1S K0hI|T1OD|0K0hA|`|00 000S/ B\\0 0-P0LP0$|00TA|0`T TAT@ |X1@0X1|0T0`X1 B,\0 000S/ A\0 000S/T A`\0 000S/ A8\L0 H 0-L4M@DK00  0RKj A   ,D4y -L M@PQ4PKT0@K 00Ip`  QXW QV  W0"00(K W0 S0 0S"0 0(K S0(K(K (K <0-L4M @0`@0`K ?D- 0-L@PP P \@00 -Lp@P`P }P FP  ST@0q @"00l @000e  0 Q:// BQ:// ,-$AL !@000000Q9 `PPN0P  QĐ  p!@P   0R` DL+@Vd@0@S C+000 !B e!$Kk P =\ 0-@PLP 8P0U0 =S0=S00b 0-L0@@@PP0K0h+ 0-LP&@P (0 P0100T80 0-0L@P0 P3#0$1 -L0 M4 0p00 @T^ `P gP0=SD @PT40SD  0S/@0Dp \aDPWDADPL7DPIq WY;R S PQ240 ,> 0/0/oP@"0U0T? R  `KK S ԃK 0 ^ p 0Xgp"0! "0!8P? Q8E<(K8 0R0: 0<  (KXQ0A P$ A@P R`KSN /0K p0 Wpf@PK` 0 0 0 #@0 000/ # 0</0 000/ "0</0 000 / "0< /0 000/ "T0</0 000/ "0</0 000/ !0</0 000/ !0</0 000 / !D0< /0 000 / !0< /0 000@/ 0<@/0 000/ x0</0 000 / 40< /0 000/ 0</0 000/ (0</ @/ /H-M 0Ѝ -L@Pp`딑 pWE$`` -_!MQ 0# "0SL @P%@$! QK  0S RP/O0?c0 ?oP/ P-LMp#KR0eZ00 CKi0 (K#KSP0S XZ 4O4C#KPP 40o?o c\^ \ l8<a7 `#Kp0S #K/?#Kᮟ`0S _#K0 0Q \pD` @ DKZ (KZ+ (KZ @@\(K0 0C Z0 00SD >o7>8 nD0 >@0 KZ(Kp00/o?o0b! \$ \) 0l8cԃK7 K  B 40o?o c\ 0l8c7 }3Zo 7#K`p@`l8!7ff)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO08 0-L@ P 0 0000 / 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGOP 00//Q R U / R  //Q0 R 0 000/ 00/00/Q0@-P S@ Q ^@ 0SQ @00S@@@0Qp@-`$ S^P  @N@@TP \^ Q@TPpPPQPSP Q- S Q  R\ 0S0 S00 U /Q /Qp@-`P* S#  0C\P S @ Q@\ @ 0U0p@PT Pp0Qp@-@P`# ST   ST PQ@D^PPQ Pp0U0pS @Q@-@! S P0C S QP  0U00Q   U //q 0/00/   /// 00/R  -/R0  S Q 0 0 000/ 00/R SU/Q 0 S0  /0 /P00 0/-P 00 0S0s R 00/S U/  0  0/ 00/R0  S 0Q  0 00/ 00/  0U0/R 00/Q 0 //0 p-Lx0M@K P`0 0 00 l l00 ll 0RKp誽 < 0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$0$ 0 R / l\ -LL0 H 0-L@0P p`U@` ////// // -L`q,MPp`@T T@K( g01 0(@0T@ L KP0 5/(Kp0S% 'pS# S0S S Sp0STWXl00\`00T0 0 @,00 00U<UTHT8T$SS/O/_/ 0P-LP DS4!  $+$ @ 0-L@@0S8 Q-L8ΟM4 0 p 000 000 }00 >00 =00 =00 =00 0%SS``=S P0@`  0EZS"l eTf$V>_3)l~y0 0T`0 ,K,K0ST5 `,KR S00K0 P @ LK` ` 0 㾺 000f 0㷺@T QPLK0@P`0C c0  ATV `\ @T^ a @~ V W`5p2 ^ 0 W B5p2RP: W 502 5p2P*) 0a 0 WA05p2Q 0T`0 QT 0K Ό 0 0`0QQ0@0 0c @`0T `9    0  ,KS05T^ K00  0SU@00Ky 0 b P 0 WL@5p2\V~ W}*0@ Z@PDžp p ^v0 a WL5p2\k0`I  s 000 E 0J T;ȣP 000 R 0 0PP 0VP 0 `P 0+`PlU 0P 0{ꀀP 0w ,0K  c`` ` 000 Tv00 0So 00K@P 0M0 E0P000 E R0 CP 0> j h d@b  0 +[ P 0' `0S% T 0 0PG c` T `P0*U\ 0 E R@ 1P@@0 E RO P 00T 000S xP 0xP `00K0 !".  c cUS ,0K Pc`  0   W05 p2 000 S,K0,K0s T,K-`ȣ-`!,> T`` ` K K`  RTB `   C 0T` 0 QT` j 00K0 W G 00 0R(K  0 _<I T`0 K K` 00ST `Tom 00K j 0T``00 )Q" 00K 0@ 00 j2@0 0Q /,K0 $ T`` K{ K  RT `0 xP`0 ` {0 `` 10@ 9 T0 `0 K` K0  RT `V@ 0T  0PT y` d\0T` 0 ` QdT`0 K ` `$ P @ O K00` 0SDGT 0   ****t t0 p 0-Lp`0@TZ tXP 0@DS XP8/t`pW  -L 0S S S 0R o 0R0`o -L@`pK0@@@P (0( 0⸜:P H -`AML@MPp000 %0` 0 0R`/(KCK JEK  0 0I4.P Ḟtt 0 zP0+ 0X4 jX4 040Kj054KA 0 hμ -L0S0 S,QU) Y&p@` V 0`S00 P@$R \ \\0S 5P PU \ 0^1S30 ^@T0S S -LBM M@ P 08 @<$ U0C~KPE`pGD4 000 &PU$:4 00jzP@V: zz84<$YP@kPD40 0R(K꡷  -LDp@BM @M`T<4 8$ 0P0@ 00 5 0^2:0x0(S0 840U @40 0R-(KUPE& CKH@V: zz<4 084 zP PU:4 00yP840x0(SI | -LϟnMM  xϟ6 & 06 000  PU0 !R  R `   h?@X@00& EO P 0 & n N R R' 00 P0Uup ```0SQS 0Sʰ00 9 SN 0S P & & .  & < & Ucv?6 06 06 60S 1S &3t6 0S S006 -1 & &021AT` KgnKg^KH}K`FPE* P6  4/PLF<&N R  & R f0P@ =eVZ 20 P x 6& P0 & U&6  & 0& & S d 6S:6SX < 0 x660 0R%(KY A06S60U&S6& 6  FPP PPP60s 6 0;F 8T6S6 PeNK=K @D 0C`D6 0Cɏp6 P06  0 P^ cK NSD V N f~K pG  :f 0f6 !cNK0@D 00G@00p dPPz U6 0R 0`1 06 R666 6@CU0&ϠL6l& &哒?@ H)c%"bP) \0S X`6t6 0S06 LK0  08䑚 `Y`F C^Kc>KPE0C p6 0V  * PPu? 6 p   Vv2Pp & 100& 0P䑚Y C^KPE b6v` Š6160[AT 6CCNK0@D 0 04t+P0& XM|7  @X@0 0R  FM<  P `1 - 7 QK  0 0 UP0`1  6 0 006@CKu`H Q! P P` U50S P p C^K PE0D6 cP0S   5" X@X@0Q 0R  L1 0106 0S: 006 4  @X0'c.K0 BV&   ` !c&P 0 \  L4 X00& & 0  4@Xg (06 506  0 +6S<06  &0  0 60AQS :606 0 @6 F T= 0  `1Sx  \aP0 S6 6 6& 6 g1Sd &36 60Sr S006 D2f06 06 0206 $206 P1h 6 tbPk0&0aP101eNK6 @DcKPD IspIv]K PE& `60Prc^K0PE6 0p0D  Tp0D `r DR `P)0@6 %  n6TK6SH 06 e6 vXw0zx 0 D6 p&  (p  @   4 8  0,Td Tp0D `r DR x`P06 | ~ 06 &R hr R  0T `r DR  R,#Q`Pʤ6 0R 0`1 k  (10Xp0 X0  KZ6 Y㰐  10X0{0xV 6 F`1!<! SB `1  1&@x&X0 \ J6S  AT[ g^KvPE*`&0tP4/PK)H`V A K0+0CSj 3f B 2 @X0666  3(X@0% 0R  Jj06 d3 xX0OcNKe.K@D B0T6 @aPP K1011S1{0  4 @Xd (06 2403L Y 0x 6 G06 06 606  0+0CSd 3`  UM0 Ѝ/ /M C0@-@$ @0 S13e86<0@0Ѝ/M0@-A $0S ^n 0S Cn 0@ Ѝ/M  0S  S0Ѝ/0 0bSЍ/ 0-L$PK M@5`PK04K4`P, ?K00K0 0-@L0M-  Ѝ/M0-Mb@AT Da 0Ѝ/ 1-LqAM Mp@ 0<4 000 SP$ \PP CNK`1`K+07>P 04[S ! 8$ 00@ 00@ 0S-<40 0R)(K`*eP840 @S 0S0S 00@ @dJ @ @kc @ |<< -L@CMß M 28 0PC~K@4 `0"D  00 H$ 00.; 0p  0   PC10<4 0$0D0S `0kPM0 D R6 !8!1 0 !QS000 0 @^` ; P0 <00;     P028$ s8$ ` 0)=sD40 0R<(K` 0Q" Q) Q" sH =x0S 8$ <8$J0 `bs]sXs' ڸ |ˌ4@ -L\XAM M@p 0`000  R( 00 0ɓV! P P-CK0@P$0@)d 0 000 0R(K|   PP P@0.SCK@4 @<,0Kd@rį ׀  - L@P`u^P KhM -Lß`CM M84 00pP@4 000 @0Pr@T 0.TP@TW@S5.@D2Oo1B1U d1#U # 1R 0 80 0PPZ @40 0R(K0L$ H4 @$@9 @L6 D DR1 @DD K 0C6 K4 0CόqWß8P @0 %`xqx|sA v   f uV`0SD <&R&`0`H H@SD ` .S`0SPPU00V0S .`FV00U0S 0 >P !  ED60 0Q00R(K1 S/O00bCNK P.P `[< 0 C0SQ M!0x3!|3< 4 m5DQ PD@PpQ_5!RO  8P k@F c<6 2  6ꎨs@P-0! $ 4 [ĔP`xP -L(M1 P@7΃`LVW T' 000 K pQxp h0 000<0KUPT 0000 K<,A-P P00R00S0@p` ` 0@PR^Î P pP` ` (0 $00-@L*0 O -L,0KQM#T P! HQ U P1`0P`1  @0d X \! PP T P cpP 均P PPbP_ ᑇP0SX X1SC0PT1 0d1 @T \Q `d XAPU  0@QU #T QKP V`e *P1 `P 0 N 00(KP!0`0 aQ*T!\\1  V:\Q0mX ,K1`bP0X1 0\1 X1H"SP10~P1 `Q 0 P I0H1 X1Sh P d!T! 0PS  :X0` X S:`ap 0 SK , 0p W`c:0pX! 0p*0V:  X1 `cTX1@T1QKC 0@p W @    V`i *jHPP1 0 h0 T`0 `P1 ` 0 XQX00 , 00-L@P0ȹ000 @ 00/ J0S [ 0 0  0-@LP00000  0-@LP 0  0 0-LM0@KP   P0 P ~bPP r 0 K0P i 0  p1 l0h!-LM`TQ Pp0 RpGS, `rp5 K A@P! 0P 0S@0S0@P0  `K|0x t  KX0T H `| |x0޴0x0d0 -0LPU# 7U#P7UP!q@@0``c0P $000 P E0`1$ (`P 02~P p7-Lh,Md' `G0@<0 Q 870  $7 ǟ0 8 $GP(@6 040 PI0S&1 `V `Va !Q & 0H6S 0S1!Q' 000SM SDL&00 00( 0CQl VQ Q \ B:Pd(K80a0VU-ڰ0e%(p10@PK]_djv{0S 00(<00 0 4 p {4 0(04 QPe`0 ( P(0P ( P PT\\$X4 @ 0 0D H0 qp @(04 00 (04 0 (030@0 ( b@0(0# (0Q3 0(03 0(0x3 0(0d3 0(0P3 0(0<38#0 (03 0@0 ( !@0(0xRP0 Sv*"` S(P0(0 0 0S e00|20(0T4ǜ\ \ QS 8W,b` R *``P(Bp)  (0PCa` R! PS(P0(0000P$p fp0HP p 0fH D0 R0C  g@0(00(  0(T P `@4LppLpHϰ pLx֔(Մp((!$1G-0 M X3* 0@ @ 0o<0000?0_^S  00S :P 000P X0SYЍ40 0 $0 0 (,00 , 0$-Lr; lX -L@@`V 0 CQ𨝈Pa[P `F PP 0`0P 0-L@  0S ^0^ P PQ1 T0@0 D   $  0T0 l 0-@PL0T  0S  T0SK0hK0h@-P0t @0 00Q,0@0AP@, @10$000 < -L@`FPD 0(0 `0S 1S0 $00 02P -L`0P-@P P(P 00 - @L0P@S  P 00 !   $  D``$p0S 4 ꨜ: *- L0DMH ( R p*p0 @ `*H\ _L L* P @Dp 0,0 P $*oP4P   < 8  00^O0S8p < P4P :P 000 P:P040S9U<9i0)`X P 8 ,< 4 T D0 @Lc04890 QP  8014S P @0ȟ0  R   SȘȈ QFLKJ+IE ( Q `80$ R P80, R @80 R 1S ( p7 Hp0p@0 00$000NL0 G<@@0TP,0p0G70  P'< T0p=(K @0\G0@ q0c0C\0 ,0S$0  q ,00PV*@@ @S M(@Te0bS P60Pz@00D0 H(K(K(KA(K(K(K(K@0h@Pb %`DPHp4&0 00  & 00PU:H B50@(K@00(K%H $ L%H X , KE@$`PJ 01Ghob` @P ApRq, R$ AQP%dP  h` P    P p00 AQ6Q``<4  0 T 4 0  1 q, @T hZ<$  @p@pm$ 0p0C?dPh` Qp1z#Z" P 1! O `  WB $p$ʄP= 01h#  pQ $嶄P 0S%$ $0 P  0q1`0 8`0  R  Q \0Xp<TpK@00D0 0,rp$ 1qb0PP@0P\0PP.10< /0S00 P0@P ^ό000@Pp! /:P( @0P0D0 H10 P81< 0 (18 0 Ip, 0 1W0pX0<Tp@00D0 L $ 6 TPD4( `tLPŐ\D0ɼ -@PPLP  Q 0 ^ p `pq^0`0@0@0 0   $  th -L@p@p`VPP -U01 PEP1S8 0 0 0! $ 00 Q -L`pAPPQU0@P 0 p``PPpP(P,P0}nj -`L@P{P U0N  P  0000P   ZW,L 0-L@K0h0/ )00$/ 00,/0 00/ l0 00/ L00/ )D00$/ې00,/|000/h000/T -L``PU @P pvq7@P/<0< 0 ($,4 (xh/ L-LDM@0 < 0 0 ੄ K (X 0-L@0`00K0h 0-L@Q Q00 2 20 0 -PPsLM@p 0p T 0KP- P       垶PP 0` 2+ "Z &= " 29 q0 005 0PQ`  Y _00\@᥺Z KTP@(K 2R<" 2 2: 2KeLP%K0A 2< 21 10 01 x100$P 0 R00 0  T 0 2 13/p0S 2: 2P 2 @0 2 001N00@l000-00PP ` 02 2WP|  ,X -L M@`pPQ R000ESR7PNM$:JB"P?o2R0S  EPH (0$P (p0 2 PL 0  K 2 + R0 2 , 0 K0PU "U00(0 $P"PU00(0 $PPU\0  K13/p013/P0"U00R0S  0 -LM@`pPQ 00U30PU/ 2U 2 0 K13/PE  `P 0p  2 P  0 K0K 0 0 0 -LM1`S8:Qr,P W( &*@,K@T خpT   0 P $K0 p PXBQ$KpX 2< 2$K#P P 0-LM`8 Xr40K2<0 5:*Q̡P@吮p@ W ZJ!P` P* ̑1Pc0P U40 80S 2< 2(K0< Pl4 0P P 80S(K04 K P (K -LM1pS8:b, V( B R$*T&*H,K RU  R00U00SR 0 [ PV U`"B$K 2< 2$K$K0P 1 -L Mr RWb-*PA24K2*U4 #0S 00Q S@ `0 0  PY Up 2< 2(K`@(K(K -pL`ᴁ@P08v` aSV`F!x0v` ! \ Q`0 A   c R Bq \~ S2A0C2p -LPi0P ` @P   -`PL@Q 00T T(0 2S $AP$00C$0:@000Q 2Q@AP 2@:0 2@ -L4M@`PQ 00 Vx 2+ R (K 6 0 0+ 2 L`K@  DpKP0K$D0 +?40  0 08/P8 1a\W:A Z$:0i⊠s011 +" 2 "0 2H0 0 0RF(K GR   j 0@ 1 2Y* p zD Kွp D8 K@ 4 @`K8 < 0 ᤶP202ꀏ Wd -L$M@pP`Q 00 2   R _1Q峽0" c!24 00 00 40 VG UDCW@?E=0PU8 U 2 Z \* 2<,0 (0 E,0K80 PS U08  2 V04 KEP0VP V$P 0   T0 K0  K0PU U0(0 $P0PUP`P,  ( ?13/p0 K0P "1! g,-AF=OFF|h,2F:I;H:h $fhpC O!(h+hlh'1F,H&K+K9F+J@i , FF9FF(j#F "IHL FNkh;k`+(FFT iF `>  ]`b@ 7 !6; 8-AFF F FHI(F I0FFHI9h"(F1t8 HH F@F;hFZ:`@# F(F=+F;++O0 HHo ( $0  -0L< A$( $0Z  -0L( 2 T 8 80 0$Q/$$0S/ JD,(<<00 R/( 0S/ ` J<0+-AF hFF#x۱/! FD M)ha F0khBF1F8FAG5#FJIH nPpFh FHI \GLGJ)F0FCHl(.b($ B(7AK"Fhbe(Of()#bt(n(Os(#`u(v(#ca#c``ca`#,4c`#ca#a!(HF&IF&H0 8$KLh,4#" !## jF#0#0~0I hKJh:Zh*hi [i(F(F-H(ipsp(>DmUnPg -O$Fh FFXFI &FF\'KO J)F8FxCHf(,L( ( H(EVFO R(X("P(;VFFu(r(h(o(/w+*&FvKhO #OqI hB:U" -ђpEђx ; `gKh/ и`I  ''.'Gt'TU#6PF`FxRFOI Fn0LI"F %9F"0FzF&EInJ8FF(`кP0; +?R#OII"QF8F4$ `\Y1F&F&Hb $ `\L1FF HV0MX (FhZF!FFG(+ H$&hI ,0FN'8`\(>Dg D^oP7jxzTz-OFhFI \JI#NMFĂĢ3` `+``9FJ FAMa(O7N(+H(!L(H+`#`'P(!R(?3`l(,f(JI#i(4 `#(r(#v(#p(+00#+``J`#+`003```# `0xJxJ`wK,)qKh{3h qI0#+hh+mI j##3hs0C+hc#Ch+#0]K <` (FH(3"h\/)F  g  |݄j( *FPF`(ЫFF(𪁴P0;+ `j%j\d)FFH!jHj+fI_h#kFDo\Hl ù+/!HF<  FI  ,j  0/+H"!FBQ/'9K`oY`4KOq4J.9Bq%H(0TTpCOn#J*I`8F[/!(Khk#Jh;`+Ph #K@?#J! H(JУm Hh C!jH(%(F<3h+ЁP7>݄[LT}|݅ wj @+K3h+?T.QFKh+?Z(WJ!jHP%NfhI 6(F3hC+h+ŭKh+,W(3h#h+?ȭ##, ݄x -OFh FI \vJ!F(F0ЗI,KNh@8L@`j%F Kbccb "cF H(bbjI FuL F5Kh*#j_ԆI FLH`j(#bKccb10@!OrcO@cF (b @ k@aOOr[hF`jG#jC#bbjkH+BjkI (fN0F fK@siV^i0(`! `^I#gBB,8FF8D(`(i8D `(+hk`#hc` #CX #C0CO `ki#kiAC2j DkiG0@N@?Ic1F?HF>I >OV>I R=K=HOR^````hZ `+0 2K##C # BEE i !hhvYFhhrkiih[jjG NFOx(x]Y/rj;g    @j  ] a e qjH3jѳk"jj#GQqjtH0x# B@EIE# B#YB0 # B # B#YB0Y # ##"#""C # B1 FihFjhkiDk`9KhG7K7JhB< 5JBD3JBL0#.MBBhh!v###&MCZ i!(hNF`#)hDf#i`g#C j-K(FkiG0h+ I(FkjhG0 I 2 Rj e! @ -OF˰hF$I [L|JAF8FNBi(2a(G(O"P(rcbg(h(l#ca#m(k(l(a#`n(t(Y#`#caOCa#caOca##b#caO##a#h jIP +xhI n+kxo+5##(FO c`,!  FpOD -O %MF B@P@^Ci+4УhBHch|#Hno# HdoYH\#HR j3b+PѫibгOгoJKhj(FF04zKzK+c #kc kixK+c#wI(c$0sjoгpI0oHjk :lH+kFkK+jiHiHJBFb# #`#[BA #$0+ki#WKOqWJj/UK@SJTHh BB 1F8F]IFF@F 9F0FP 2#3"BB 1F8F="FFF 9F0F0"BB 1F8F"FFF 9F0F vf #C # #@!##[H4QFg#HN (Y $ 0JVvaSFoHF`i#ijJhdJh _Jkj&BE AFJFF&FF j@Fwbi#ij"BE AFd"FFF j@FWvf,"qFBE AFpFA"F FF j@F4 2"#gSFJF)H #C # #@!##[F I Hp+j+ # FfSKWF !#;F2F@![;F2FHH HB3 K-Ah( hDLKH!F$KHB8F4<p#`$H >H81+:J F2K:Ih9KhD< +7H 6J#`4K"` /K"FhFTb#g tOO&KH9FH@F[K81+> ^ Tig nPT(>D 6Ae ep0 fYz5jm  4m H 0 8JKIhHFJIH@OH9F^ (E K81 >J8FKIh& nP5f TF hF/!(FtE(F[IFZM'#YJ1F F0gWKh*bV#Qh 0)F \(Fh(+L(# F(KoaIJ1F F`CCK%P(f(=#/aa`s(i(n( 0v(w(,`#k`o``#a+a/`ah0J)Yah]i-$=$- @&Iьi a`**Rq$Iyh"V y3Bh:W"P{iF(F PpC Oz#`iF(F *FI pCO?FWB")FGC Fc g (j޿-OFhFXI Z \#C&FRJ9F(FCm(p()#0F(IK IIh@FHFnCKhW#0S&yD=O) &+OТF8IPF6I 8FO;\F:T  F+2FF (+&UO,>h F (pAO#`!F+/" 1F F 01F F (۹1F(h 0)h HO@Fb(>DDg j-OFMhFSI ZRL'RJ1F(FCi(v( f(#``#``g`GK- G>K??Ia PiFT' f(pCO-ahV([ @BT'PFoFT'  ,Iv (ڳ  F6(ګ  .(3(!EH 4EN(0` CJh FVAKhf70?HF(x=K*F:L F DB=/+%1KF` 0I 7*F!F,J{3+H`/#{U)I sh;+#Kh"I sh3 K"Z`O#0nP!=!=|!=<P!=hUO!=!=!`!p2pFhFI Z$J1F(FCL(P($KhBD!F8F (B gg -OFLhF%I ZX'ga`JQF@F~C(f( R(!P(+`W(d(%ѥar(i(#e`av(x(ea#ac`%beb'Khi+@ہzI O FP-7!(F8PB/!(F HEx/*O9*x.*jx.*Ѫx bH##aKFS/C,*  ]FFZ&0+x(F(PK`FiF[h;( &&!!.F!cj Aci A@"@FFFIO O8FF(𨀵P0; +M3LLLE LLikj+hj,jZ4I"FF i3kj+?++FP0+3+5+S.hj ZxYFF$Hi+Ѫmi(j&(")F8F8#*+ѥi+Ѫmi(j (i i r(i+݀h+3!=g  P7h#i @!ii(ii+h+?^h?+?Xh+@PhZI 8Fpi)FVH##aX[-iF(F cj+N|h+vh?+rh+C Z)FFAH pCOѢi2)F;H#3aiJpC`O(F `OjF)F(F^(O(F h+(F dFiF(F(i3)FH|##ah+ h?+h+#j+?}/z(F*u i)j HX##a#j#0+?(j##` 'xjP7#-AFh FV&I 'Z&$J!F(FPCp(O KhBO;%DF `( !h%H T(/&h/!0F0Cx+3x # 0F @(1FH#C(FPg jpʰ ! KI(`Oܿ"`ZH"K0 #(YKh+++" zK"`yK`"yK`#wKhwK`qKh++πlK60+ɀlKh+ĀSgKhKYjK"`iKh˱hL hCh;C`+"hhY`hZ` "`Hpba++$\K ` VPK"`PK`FKn0+/hx-+ MH# KH#+#9K6 :(+ [0#>K"`/K@,7. B  J DBѻ F B F 4B*Hv(x+#KhKh`$ M&U$1F4d,! K0+ Kh+ Kh-!?!?!Eh!El!G!> !@ !?!?!?*!!J7T-CFЁ$hkI ZjK`0B/gIV#p8FF8FE"bJ1F(FBa8($ZN!0h F(2h VIf$$SKTIh :(OI(LI JJI &(HH.GI (EH$, hSDjg @ tB@th@tr(.tg8h 2 -OFhFI YnM$$FFFxh`oSBSA+`KOJ9F0FC+P(&H(L((+яKhf(R(##h( v(#O F#O FO FFK.  &&кtI &F&&O2 ``,: W( :!Fl.!Fh F0FKW(@#x#+UI FN` SI F0W(k   F 0"FJI  `"1FXFF&@Id#"!F8Fz8FF(RдP0; +8R#y'`j&jYx1F&F%H$K`j&jYl1FFHvKKhhiG8+!jHN&+ jhI N0Fp!J((>Dg @d!J^oP7zzHjx-GmFF^LNFa^\1a`1^1`a`1^A1`0`HFH@FxNqhIHF0h6JFIci+1ڠHK"!&IRF K"`J9F(FCҀA86(ȀS ß ßßßßßEßßßÕßßßßãßßßßßßßßßßßßßOSßßcßßgoßßßß}ßÁßÉÑ#P#1#11v#1#1QIPFANIPF(V@@XS#!v0K##1C11<##16h3`2##6B?,#F%-I hAB@BB)I (JA`i!`JѐiB ѲiBђ!ECBCA#J`##111C@ ,!J!LZL !lT3g!lH(>D6K1+&&Kh-!"..z.W#JO!!Oc_ڝJ1ds ,PpCO#11+Iv-B8F#1) -78FHrKJOaK(F2(2:BF2~H}IF(Oq(F qJxI FHwKuI FvMh* FD.F ## th#+" fH /BF aL ]H 2\I(F"FLXI WIWJFCF FYg(F(E>(" P+NJI2HF 2;HvCOr!9H FF F8F42 6?:H:9Hkh;k`++H8F+hZ*`x F (0 sh;s`+"H$+hZ*`x$ N,Q2  -H8F0# KOR 0#KOR 9F H!Jg !lUy~Oj!J!lmGz6IGwm-18FDg TD~րDD{(D| )8DD}UgtjJF-I F(F*KB1=s@3B3QF(FfFRFF1F(FVE$ P O I(W(VJFIZFF"PFFF(FNRF I H `vI " araynPD-O㰴MFLF#F0000000020O3 JQF8FF܁b(ހ*E(^2(U0(KO1(@"N3(NA(S(` F(OXI(@z0T($a(@q#0s(ei(J c(f(@a#0l(Ar(@XK`v(E t(u(@J#0w(z(>""sKZa"rN" #00hlKXa x (2hjI2|#0x#0teM$+aYdH4Zh>oY232`#0WK/!h0FF#p3x;<0F00< ?D/!@FF6#p0;<@F0< .?-/!0F#p3x+?"<0Fr0<9I#07KĀ;4I( 3h\/I 0oOc0)J3F:&I( 3h\+"|2BI*ҮJ2N/!@F2h@F @pCO"2hKa!!t0(>D/*/F/O!/l/w!wX//6h/!0F8J3FIHi 0FI |! PH`.;< F0X##OS"BrH"HOR0F #q BH, $ESBH60F 6#s#2#0K(@ K*@0+@ ~K*@0rN+@/@Z(03a2+ qK*@ *@ *@p/@!2+@@C0iBF^t(`\AFh+@\H ZKh0XKh0UISKh0QKhDKFX`F+?KI [ (yFI J 2  0+?l7K0+?j:H *?i0+d5Hsi3d3Hdr/b#<:F#=!<@0?SF(?LF!<.0>0i (=pCOK""1H7K6~!)j///g !0(>D/00=0J0|0!t0!"0i `0aKaHi&X\F\HdOr[H>g2+G(?.i#8`F& F@2F01*+ҡ@F!*@u!*@p+@Bi3a@XrK F*@h nK*, *k hKkN*"  qi0+@@ ' YK*@ *@,@0+@ V0F 6l0'+J!H0F (2FHI "@Ko"2?+#?"2Ca"@6Dg2Ko(0FO@F(t3h 3`<HFr(5<T<< 2` FFC 2 vbFCF#9F0FC #0F9FJF6  ѭ!t!!v!(12"2"SC|21F0D (ObB|"?r2BbKOQ ,#BpOc|22q+?xB?Ю6l *?+ѰH##BFF#Br FEOxډFFYHK"b"a0+KZiKiB?I_0+TH(?'&OOc"g#BFH2Os"H#BFg2?#"H##"#BF2yH(G  tiwȰF( pi2si3InInHfnJd!nHmIjHO jI@DeH:\;<*?(I"F !!!D!PD!+q!!BDnPg Y\EsEjcDE E-(>D+J,I F (F*M h4)I(F <0"F&I(F Z F D<`B"FI a; *I"F $KUm5#F I F F  #X+FXF'BFE8F !X@dz!AdeE>E\EBE-GFCO FCM&CJ!F@FC%p(f(n(P(x(y(q((#+`#;` 6K"`#;`+`#;`#+`0J`0KhN+Kh+Kh,H&+Kh! R($I LKhF I D'='T o"1FT THz%FPF T FGEGF8F!!H6!(>DH?g  HXJK-OF F ` 8# # X JN#I$`'FJ3pFK袑F ```J)FXFHBFc+[U+F+lP+B+@(a+#D-OFhF&Z|I N ,5DH#LI F F@!LO(09F0F,(F0F8(F@H40F I(F I I F0F(F F@Ծ!A-OS} $O rFFPF!F L8"!F HKOO8On #:h 3hdD44#ĕ3+ѶiL0ѓI0ѐI h{0ьIl,ahH$hKNpKpKp ##KF3yJIFXF?Fπd9ܸN;ܸA*иCza𣀸b"иWpQu*O ܸlиsиh`7sw۸zW`KpdH#3r#sr`Kp{[K"prw#rVKpYM $PuoC"!##"# "(h01`+c*h8FLIJO $oC"##"#! "8h|0q`+?p:h>I >@FCV;KlOT&lO ܸLиa2KCFLsܸmwиz>#(M:'K(&M4B?1"K@B FF( M& KNHh3x#P5+7Km ( KxKx[!hɮ!5!X!!!(>D! xg 3xP5#L m(2x ,јP5 + + #*F #` SF(х4FPJPI2F"hPF0MI#hk;"SCZ8)FFCJFI,F F- Fu?F&0F809J=I F 6J:I d0F1J7I h#6K@1-J9)F FG"! L0I F.I F6 -K@A,J!x*(" 'I F<0%H$I FF| ( KOq J H(F Fh3SB*FF I F0I "Jř$1 Ma}KOiʈwʘbՀ iuʺm RI HIH@.p!8 L I F F4(F I FI(F F8@ !8 L I F F4(F I FI(F F8@!0%-Gt(eHXdH(cHP!bH(8йxB/ع! \HF!ZHYKXIYJYK( FXIXH "0 SH!IH8 NH MK"MN !MH$ 'O 3`O >O #"!FH%2#"!BH+"F!@H&O3"!# ## # #"F "F "F F(F  # "!C4-  0Fh=%K0h]`G Җu9ҮM҉B6IaA!8-O%KFFF,FO6 J9FHFzBl(xR(xg(F(@ r(u(Dm(@5#iKIh&4x#+VL`h " 0 x+F " xF+~KIh F(wKzIhTx#+ ( " 0 x+ " x+dKgIhO y#vdKh 1`M+h ,h&4khB!F^蠹!FXHTKUHTOSH 6 4(MX?+G qPFW#pF|o sHx xc)p)b)CDCT:*O  3I CT#.I Thù  Eq#" `3h C* x+йUѺR0Kh +KZh#B7  3Ԉ(>DH[Drg !@jԔԨԸ0pA _FX  OIx h310YLILIh OF-4#HF B=GFF AI-mO O!F(FF !F8F(IRh+3I:F -(FKFBF!F8F+8F8;#BEKE#pO *0УB!F8F:8FL#!F8FKFBF!F8F( Js2F8F0 9F HV(FO HO 5rj!-O$OĢ FIJF&FF J)FPCNo((a(A(@O NFd(f(@ D$u(.r(t(v()w(@$&#0 x+ DЀI ypFD4030vK (y(-(@.RFF(J=ikI(FdPiI(F^(hI(FZ(AFh%(cIhw(=h`I(FFHxh2 zh\IjEOa*FqZFqVI#h #Fzhhw(&0Fi! F@GI x AF(D0 (Dm6B J@E QU*F 0U*  HU*FhU*tF8U* )I ( G0FHhI0F#`(7F &5[F(@FLF(7i I8Fp I8FH I8F U* I$وcg cDiٕ٠jFٷ(>D!H7heI8Ft퐹U*[ 0@FU ( GhhOa:FqZF(?#BF(F #FU* OaqZF(?uFIU*(DIEHJDOiAF0FjBF0"h+>I2F 1FOb P/! PnE U(F0(DB<9r#!+p P:CF0)J(F)I< (F(O\$ &I(F00(FRN0F0D##`!hML̂KJ)FF# @3 # JF9F0FCB84(>8<<<>J<5<<<<R[<<<i<<<<A<<<<<<<IY<<<hw<<# qIPF(oIPF(@"lKlIlHlK"`kK"`[Kh2"#"#eH##"!hbK'#"O3`H#Os"!h~\K`K B?uLKZIhq#h+`m#"#VH##"!he>K`^#"oCOH##"!hUi`O#"O3HH#OS"!hE`?#"oCAH##"!h6`0#"oC;H##"!h'8K#"O35H##"!h)aKh۱PFUh0 320Y(IRF rhPF"oC!H##"!hKY`!!  !`(>DT!nP!!F!One!u r#"oCH##"!hK`#"oCH##"!hK(#"c#H##"!h|K`z#"oC|H##"!hqyK yKh[#xJxI hYwI=Y\tIPFt#aRqIPFlaKoKoJpInIPF^iCkIPFV iCa1RFfI/"! hn (&bKbIh"oBO3_H##OB!h[KPFUX0 320ZRFRIh PF :!PF /!PFGI80 FI3#kbDKELh(Kh+$AKh2*Jh*""`x"!8H8civ.v Kh+pm## i+.IYXC@,H\(JSax#8biIhf0&IZh6 K[iZUT"H !!!!t.~z@d(>D!!Qg !`!} . x"!V"!@FhKh+FЍN3hOs3`KOh#C@V(F`CF@1hOFL#hC#@!+r!@(F\GF*FuIVX0*FrI#h+ 4FO4*FOaYF(*FjI bFOa `[|eJOc( F[_J_IfV$0XpCOXJYIRKh+C!SH QJSIJ!TFLJPIA"JIOHOr NGK_(F #"GHKYF>kYF8F 9J?I 8F(O48M+h[h+`1F*h,H 0)J0IW.K0Jh3#`Jh3 h+`*I0+\*#CJ%I;娯%I8FT`#kb +J IJ(DK +?kj+I8F<踳K JIPO4&F0!!!!P7! /BEQ!`!e|o# 9q MOKKhFvz#VQ yKhF` @ * J #+rlI 0s*#BB dIaw_Kh QC2D F0@āUK XI##*F +YbW la F0)FOHOZ̮QF FFIIRF ^BKh0KC2BKh+DKFBF)F=HSF# hxxEYFx FJFTC.I XF,KiFh)J+30+)SjOc#K OpOspOc_pOcOSa K hBJa K* ZjڱOR!!!/!I!`i`$0KKioOb~H<$0KzKh_ORxH00БSO02( pJh0`mKhF* 0+#iJjIjH bK"ahKhB * Կ`(F"F1F uЦB F0F`XKh+?ɬ ,aXhAF(5PHU MJd!F F  FHLEKzh ,a@HhTCKhSC B@Ux#80.hNF5Jd! la ,`d(1I ,bX P0xZ" ,a tp8"I Tp(?X" FB I BC  (?DUII ,bF :I 6j +?E!`!%Bj!! u!!X|KO2-O-MF`" FFFOc O J!F8FFZ($N(oF(I(SD(@RS(OmV(O(@"#H##")hKm(f(Ovi(b(@̀"OSH#Oc")hKs(v(n(@#"oC~H##")h{Ke#" (hRwK x uI'*вrK"`h3zdK"`u"O3kH#Os")hTgK`K B?cYKeIh P"#bH##")h="OS\H#Oc")h.LK>"oCTH##")hQK`/#"#)hMHBKY`" oBO3HH##OB)hEK+h2J 4x+@IOO =Khh3#K"`/s "!"!HFT%@#M`#KhOr`+hS'K@!#+r!!@ FC"FII0"FIA+h+O5F"0(>DF!",V"4"(On"@"8g NOcAF F2F[ کJIN0+h+CBF9F0F@2FI! FI2F8F"1FH 6 <% "HJQFt(jOr4QF8F JI8 8F( O5 "~Hd0{JIJh3`I !>*#CqJyISxIj(wKkJwI iL oOtN;";hy4Q";h>*eK @ #+r`I!>r*#BB XIhkЖ9h2"(F@0@ KK MI##"FQiOr(Fp0!FDHxO[ԱYF F >IZF z;hqh2hh+KFBF!F5H4[F#xEQFx(FJFB)I L hxPF6K$F*R44+TOQFFEOx,Oc7!/BEQR"(e| !l"8/IQFOPcFEOxOS4$+K$$ 'Kh3IF@F(?hF4 OF9F/FEOx 9FOP!FEOxv`*F FCkB(F ?N!"@",-O%- FF*F! &LS`BtڡI*F!  (\1F0њHP2\0їI X'b퍋LFO6=FJQF@FZBwC84(nL=*5:SXJ]aY1CC"x (gKgIh*@1Cc1I9C@10Dg #ۨ/Lj"xC+٫KIh9S1JCcH1# 1JC H1#K x+ ?KIhO K퇋K{@{ 1{H{{1IN{{tIB<+lI9pP FF###C@8G( { nI!H@HBiHj@4bJ DoC@48-aKhEEE\Os\HB6sZ%<pC`O1CS11 PJaR[BA[qOJMa$O`$OBd$Of$n` 8"j`C31#+` .ih8J)ſCs1##`2N @F BF,I 1Z)K hFFk66F1 B@B H,I>WA??zG{Ae(>D#ۼ#x##)Etg #"xrm#ۘ3hEĿP0v<XH#"Oqt0HP<սH#"Oqt0ѸH<<ճH#"Oq\0ѭH(<թH#"Oq\v0ѤH!KՃ!!!!!=!'<#<(#=-O H$pOa0P"!t0(ڃIp$FFx1oWpOiapOC#Ӏ'S0Wr+#rLch`|aQ3C 4! "@t(gI/S0k' S "!t(_I1WH# "!Lct(WI& "t(QI8F khNIHFMH6'LKAOqtI $0-O FFIxF-+4 F K"$`I F0$ONFFK"@Z`OJ)F8F CQd8(IS $ $9$9$9$9$9$9$9$=$9$$9$#$9$9$9$9$'$9$-$9$3DtDO 3hkDdDD4D$D$~O KhB('>3FS}XF /(F&FV9(F(pI(F$/DDd%dF8 SbgIF V)F FbId0њF8(Sh[NTKh: "!PHS]2FWI[h "!+MHSS2FSI OHSM5+F2FPI SnOI2F ShMJNINHS#JJ#JIJHS!F! ! ! ! ! ! 08I !O00h+1H& z !O00hh+ &H 7 /$H8F)F F HLP!hFK?F(FSI"FF G#\g jGHԆ)PsE(-OFMF]ݽHN3F(FHK`J`}h+x-+k`F8(F0F! LW+=F&O- F0 `(Ѐ0748?b("I@A9h)FH   *x  & ,.40XFW;D;+GFU%`Ok#hX%d%(>DPL 5%M+|I Jji t+яK"`I V(F PI L(F FH K`H-K?$;`+|uNr+$R+|i+@ހ   0@t+x+@̀ }  &౥ oiKiL#+rifIfHfH i_IaH#"`HcWI[H  iQIVH#"QH{NH h;KiDIKHJK"EH#a@H =H` g!7HM w 8N%W%= J FFS/5B.)#kb0 !KFBF6B W& FFY; h v #hpg %nP%pm\%X)mMP(-OF F 0F|(@fI(T SNO)FJ FhA5f( S(#L("K(T(!d("K!s(n(q("Kt(v("K#3`"K "K#;`"KK"`KhK `Kh*"!H!" K`~Kh+}I U&p/kKh+@8F 2(( (@߃ )(ƒ/(҃ (@Ճ]Kh#"QF ! '.!  (!  "! F ! !F !F j[3иKIU&0IK`xg*CK9FhEKOeO g/@` 3x-+@R60F F3*GEEEEE~qq9E>Ex{EEu4EEEEEEEE"#`"#`"#`"K`9-&0&;&&&&&$&&&g &b &@G&( &,03%e"K"KJeE%EU%UEEEEE5Eu%uEe  "   "   "   " x  0 Fh "  tJh3`X   FM#+ ++ + fL!&+%+cL@!(+ *+`L !`L! _L! _L!^L!^L!!\JPNh C`OKh 3h3# C#3hGK"`"F`##```90FMKh 1F *F*? 1F BKh#BJBICH# 8( J?II 3hx'?G7' F:F/Kd(+D(,b(a0 6J9F0FVEM9f(h(!Or(O'n(!p(F06x( z(!v(=@6#$6#(6#,6#46#686<6D6H6Kh.$&B4&*<&"<&,&BzJ8&"|H G4uJq<Y0vKwJwH) FFW#@OqI FXnK! a###x++&FgK+fJ`cxh320Y@񭀽<"_KdPCF#PA@h 2  0F:({2x,rx2pEHTF FO 8pEaL`A`6`+``"xd!40,0:"JClrra<090;3Dra "xcx0:0;3D+d3 Fsa#x !40<31;3a#x !40<0;3`#x !40<0;3`#x !0F0cxL0;3s`B? k&GG,g G:PI7GYGy&%rG}&(>D#d`)pڬI (IЩI\L@NGDO Oh0+7>F0F٦B6FW0FND8h( #3p#sp9KOb1 Fp#xB4BK "%"%HL#CФ`FH<H" H4RhzK1!oFd(fnCFrHR  (pH0FdB "!lHRO#Oq Bp tOOgHC"Br_L @]L8D#Bv4 #""IEp9F0F uHF&4Ow&T jT#Bv -OT 4 T#C<&4K=O=NR4&J0&;K* 2FF:F3J+L 6Is1R 2Hp60Hj,6{Or@a+H")IJ F'HT %H #HH<6C K46+NN@6+:K7Gr&m&&%GGGGHDGGGGH H1H;HSHuHGGHD&%J3C,H&#J3C,$& J3C,8&J3C,0&J3C,J ` Y`$H`"F0F2FIh R@1F` H!  )^HHmcmDFHH-CtFPF&ODKJ9F(FC(m(h(l(H($D4s(t(n(&D4DD$D004Kh- -W#P"0H)F8 !-K-J.H,M!(Fb*F)I (MOD0d<)h $ =@VAF8F"BI "FI8FD(h+I@Fjh8FI6(IF!FXI F#I g EsE&% j 0. tyI tCII)(>D-GFh#F&hLiNiJAF(F$C7e(#a(A(M(8bJ'b( d(2`J!q(f(n()\Jw(x(r(! YJYJ f`XKhXK`WJWJWJWJh3`VKSKh#OKh HNGK2h hHJh*hC>Jh*l=Jh*h-a?Jh "2`+ZAK$O(p`@K`@F>I 6h^#"F!F g FD 3I@F(  0I~0K`#.JF FFP+x+9F (FZ F --9FX = Kh0 JK`-і 8"U&&&(l&(t&&D&(p(>D&(&&&(|&(&&g &&H&&LUGwj&&@&(xm-CFFuIF(JsLF1FrJHFA a( t(2#i+@рlKh#a%jKgOh  hV (< FBFXIYHRBFXIVHNMLOOUJ1FHFKMBzA89("',16;>@CEJMPSZ_coci+f#Pci+a#Kci+\#Fci+W#Aci+R#@#(#a##`#`8h##bh`ciSOsci+##i 8hI a(#cbciOsca|li| Kh(:@3#@ӱ \ &* F(>Dg 2[z\nP\0\Fi,+j+khfKh+,,`IHFP_IHF(]IHF(,5,M,DМ,~,@hV' 5, ,,@,@i##*jih "-дowi#*jih mV'@ h!F(d"F:I V' (Y^kj+? F9V' M" x0-HtHC?(H4=OB"F%H@ F&*!H ڲ # B2"F.hj  iI FHI F R(AFH AFH  ^&*2[zij\\\v\\i[$\\FO F&J!F(F(C R(f(O#`& KhBO;%DT01F$(%(F&*<_g -GmLzI QhJ#IH`J#``IJ` `K#`K$JO1 Oe`KO`K`K`K`K`#`J;p`J`J`!J`J`J!JH`J`J`J`J`J`J`J`J`J`JpFpF*F8FB? Qr2F|IF FzK`zHyK`yJ`yHFHwIhZK"`tI F^ VK`VK`pI FTUK"`mI FL(LJ#`LJ`!FhH@fIF(DK"`CK`bI FBK"`_Hr^K`x,J[K`;L#h;YKhxXH%`WH\0VId $SKA@PKPJ`PK`B4@K%`$!K`#$FF CLObH!h o? $hQ=I"FF &cp&cc&|&w&ct&_l&_ &c|&_P&_$&w|&Yt&,&]&(&& &&X&P&&L&<&_h&&8&h&_&@&U&OmY3A0i#&Dq,m&d&pm(>DP7qK"pBFZCF4"@K5Kh">K "=I F/K<`$h]FIFPF`x+'K3Hh.]G$4," F0Q #K"`Kh3F##"J`"J`L h K(`"hIK`&@1&w|&_$&0&&_\&cx&ct&_ &_P(>Dr&nP&p&&]&_dp& &_(&_l&,&l&$H#F"'OhxKhRK`K`KK` "9FK9F(FXxPKh (hQyF*FIL#JH#`` x `$0"FF8F[O8F6"FF8FVH.VJFVHUH&UJFUH|TH"FSLFSHs(F y!F !FML  !F!F HI +@݀2FFAKh(F!  :!hXh09ڸ!2HpF(0I /I @!h F(T[%FFP&pg &]&\&&&@&&Yp&_`(r&c|lllll f  l5&&45}FOb̀)OF0FR &N[h # #03` 0;h+p B -")F F;h3;h+K"` I `KIh` ! H I  I &&_P&_d&_T&p'&45}&0-CFhFrK`K`fK`K`*I 8K9F F"`, %N I c0(9( v(ѓJh3`9FJ FxA 08 #5`yhHZKh.W#@DJ#xh320 F("I0FOOr!FH~+F"x;{J !{K`pKyJh4xI vI tI rI FoI 0mI!mHlHPlK`kJ`jH[jKjMhFBi igI FdI #h3io]Ki_Kx^L"! h[I 1"! h(WN VIO,TM,F/Fh#c`+hNN#s+`kh# k`#!0#wwvvkv+v ?H, N>H(>H$=I I@F (K" hn1 '*H>0;0+HR@+hZ*` Kh+O3#@Drr&H m&-O]FFIF0K"`L܂I(F(I(F(џK"`V(ܠ1+08J1F8F:Cd(Ol(c(`c``JIJIHI*FH *KhBуKhLO8Fh+x-+kx,FO h2!FRF@r 8\F FF౻hZh+ F> `F0D0XF(fH)FeH pCO!FbH\O@Wh+ Ft[H!FpK`zOb!F(F(F 0B QF(PF 0+8"0F8(0!F@ÀBH#"0F# 0+{h 0C.0F,(@{hOr@!(F(FF B?)F)HuO 0;.0F#FQF0Fu0F"H8PFH.#2?. 0(F!FH&5nPg  4BWml *@!(FAFNH)F| zQF JH)F#BB #F FBH0F(FV Fjp=HlF FrBF!F8Hhk0Oa5Jz#Fo zp20D 0Or@!zHCFz%H$H%T)F0F0Fd 0{(F^0Hr FH!FXF4R?+IKh/{h+Į!FH0F6& sEmW#&-AD h ONH;`#3`Fx #3`IK"` O68`y!c#u$`0F^3BF-/*sIl,#0$ pKpJ(FFSp#,+hx-*+* [xKUk!I(/E()`a(O /e(ZMK(h0')hFGIXF,YFPF&n(2i(l(#D' pFL' tm>nPg ' d' |-OFF IJ(ڦI LMŔ K@/! FDJ F#xIh320 K"`(ICFHMSK"x-*hx-*bxe*i.Ѥx,i*k*e*C\CC O&F%FFFJAFHFCie(.Q(RE(I(V-(dO a(d(S([n(k(-m(7i(Qr(8s(9p(J9hiH9hiH9hhH';hx^-[x+?+);hx^.[x+?+;hx^,[x+?+9h ###O %&$KKh (X#(pFO0 BO,0@Ii 0:`0 0"˱ ;`ࣹ0+ i * ݭ0;h .I0(F"F1F((P({,"IHF(\J! `V^+NHF(BI8 D,JKI(FJF3'.'(=,rm':(>DVL=Eg '@thtgT((=<'KIBFH" v#BFIH+"! H("! H("! H((KmnP-O$ROFF%FPJIF0F,Cg( u(G(;hx=h+x+ F1IzFxx+/,I (2C'7Y( X0Y( 5"HZ0>0F0I4XF0IEPF0I }h-9(F zh HLJ+F(F!F F"FI ~(>Dg q 2<T6ICj-OðK"" $N`*K!JM` K@pK`K`K`K`K`!F@rL0`6TD'V,!G]'f]'Z(='W@]  'Jt'DH-O˰NF$hO;#"#KFO%FF`AFJA6f(,b(e(73p(#z(%l(-O3oB##"9hH  oC"##"9hHF=h;h04K+8FM"(FF8*FIa/FZ 8F.(Z pC_T&##O,Mк@%-"*FuItI|FrI"FOq BF( " L ")FF F(eI MQF !FX)X) XI $VM#"#"TK`TKX)FRJRI`BNK0XF" P"`nFIIj(GI DICI XO08ZF1F8Fz>h+O BF D( 8BF1I#DBr#%FOyZO+FJE #{ѺE:O h+'j'j(>DPEXg j[Gwf'j'jnP'j@th'j!) B 8! 0F-(F@FB$ (I0I 9F    ! !F8F I#FJF(?IK(-OݰhFF[O2`MhI(F`FH I(FXF@IHHp Or!M FܲK F: bO300001>#FF ##AFbPFCJKZFAmV([N(M6(b?(U4(O T(EIP( #%%eBb #k(( g()j(f(тKhbp(n(K'Fq(x({K'Fk0tKh8ctK'# EqK'%e### ##bCZH%O (F;5k;> F0@ bee#<FF>FP ##bC$&dFSF! F>( ##bCHJ 3hB@倶(@S5HN+L@H 3B1F F># FFX!>XF(FSF! F>Y)@%@ +HT3 FZnnCL@5$HD FnnJ!HDqg lCC ###CCS##" CE@;M"K@ @C?BE#"3C%"h%(F( -)F ##`HtОJKFK+! FKJ K+!J F #C3 ###bC LHn0ьIH;:1 0 IH4"KI:0сIH(3:0|IH # ]FAC|XF;c0ƁzO:hE  XF;jl ,l#@``n(́;hX#;!F! F_HeKhE+"X#(Fn:F<`hB `Z```+xc(F(D<6+O O O "l8Fk9~)[8FO4F0$ O8FM0dB1)T)=1 C@3"C5KhX#803 803+H:BFQF(F8F(F8@,%H:cI$H[~h+I!H:/ FP F7FH:9FHF(O/;+@Z̐r ig #MUfw/C/ ,h+qH:l4 h+ШH:(FH/)/@%//\IFHd':O#"eT#K`!(FD FPX0Ձ?IFH:q(F #"3C3@H0 h+ЉJIH:G@H0 h+ЄJIH:6 FPF`B|I~H"F~H:6/; #"3C !(F8-0pItH:tH: @@ F #3"C O iKjOhX#p#ChJrFQfK9FsFeH F;0VIbHGcm+ # CCs ##FZJ:Gmbm F;f'EIRH$mO nS';N0j#7jmBmJHS :nh#j)[h窹 ##BHRCAJAKFG #"C=H:$nhG;j#BFQF8F9hn F;? #"Cn' F9 (2%R0K"7:0^ : 8' H7:i#!@C#CH::~(##C F F[hB f?(F] }    i 0 0-0LQ0@| p00\@blK0h0 ,0 010D e/ 0-LlM @TPKTT @0 % 屔,, @0੔K03=Ǡ=0@-S#* ` @ pP 0Q R 0 PpQ ` @T V000p\$00P003222 0-L@KM,PyP10_K0 cP - LMQ K 0K #Hp 0 S ,0 0  K$sX⌋< _p/$/'/y*/*/*/&*/%*/*/:*/*/*/*/*/%*/*/_*/\*/;}*/bz*/w*/t*/cq*/n*/k*/9h*/e*/b*/_*/8\*/Y*/V*/S*/P*/ M*/J*/G*/0D*/QA*/>*/);*/{8*/|5*/#2*//*/),*/=)*/&*/#*/" */*/*/*/////*/ */<*/*/*/T*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/4*/=*/*/d*/(*/e*/*/*/ */f*/~*/{*/x*/2u*/Kr*/$  0j*/ +/ja*/O^*/[*/hX*/iU*/R*/vO*/L*/I*/F*Q/A*/>*/;*/ 8*/5*/!2*//*/,*/)*/&*/I#*/ */*/1/ *//7*/>*/ */6 */*///*/@-@ȓ@*/xGFxGF[xGFxGF5xGFxGF?xGFy{xGFxGF{xGF.xGF\PxGFgxGFxGF7xGF=xGF/xGF\4xGFQxGFxGFxGFxGFxGFxGF2xGFHxGFxGFxGFZ0xGFxGFxGF0xGF$JxGF xGF4xGF"xGFxGF'xGFNxGF.xGF0 xGFmxGF8xGFU_xGFԄxGF%zxGFxGF8xGFxGFxGFzxGF?xGFxGF,xGF7xGFxGFŎxGFxGF{xGFxGFxGFxGFIxGF˒xGFCxGF4xGFvxGF xGFexGF0xGF]xGF4xGFLFxGFxGFxGF~xGFRxGF_xGF~ExGF4ps_strings missing NULL Obj_Entry pointer in GOT Corrupt Obj_Entry pointer in GOT Dynamic linker version mismatch %uEMMW+u.47%K%m;BAH5iDIE]K] 1QAW9qݕ]qhlu_{q[RQqG#=G#=&&/,H6=??EAYDEIccE+P9P9TTTkY]Y]]\ ] a9nbeiramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosgptifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory d!a-@@@p@@õ i@@9i@@unblock and -DNO_CONV?y4yypH<ydyxoflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp file& no previous commandunexpected end-of-fileinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... m:pusage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sInvalid type in GNU longlink %dFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ...  '9CO\bO\b'rֆ֚E֫Zֿ# _ ^ F < >5?H[PATH= t,%f5d<5sڭ%cI5mB5lPW rEp_ڤng5 vo< b   EOF reading here (<<) document8G}-+?=@pinsܒx~bFܾܰKgiC@iD @AYe\_babcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'!I0!Id1!I1!I8!I<0<!Ix0!I0!IP0=!I0 5lɰ  L#~oUI7  Ձb$P Gwy  KHm  !JUK"p%*&"A               6I $6I7-'=/!k7?Md7P7<Ig!tM 27g5gAp~]~yAu9z? mI>\7D   Dg{i  !!fealias %s=alias: %s not found arithmetic: unexpected '%c' (%#x) in expressionarithmetic: ++ operator unsupportedarithmetic: -- operator unsupportedarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ')'expecting primaryexpecting ':'expecting end of expressiongetcwd() failed: %sOLDPWDHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumenterror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failedusing redirections: do Node type = %d do subshell done subshell Cannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d)DoneSignal %d (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sYou have stopped jobs. ${LINENO${#LINENO${#${(($(...)"(...)>|>>>&<&<> && || ! | &if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT.profile/etc/profileENVOut of spacestunalloc p:rarg countu=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: EOF in backquote substitutionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Illegal eof marker for << redirectionBad function nameBad for loop variable2nd "!" unexpected%d: Here document (<<%s) expected but not present-o promptcmds not set: thenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncdirectnosigpipecloexecEXITEXIT trap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PScPS1-xnpxefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range%s: bad number!=closing paren expectedargument expectedmissing ]unexpected operatoreqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreadonlyreturnshifttrapbgchdirletfcinputrcgetoptshashjobidfdflagssetvarumaskunaliasulimittestwordexpPPID20160401 BUILD:20190531084359Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'missing format character%s: invalid directiveprint failed4< BFDKQU Zp  qJ = 2.:mV(u/4C4[;fFcMIwiTHCM*#3#3233#" @$@*3;o ~@w hC$gCmC$lCUt~ /@@&  :B@JR ZZYba @option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.$4Giv 6 > F@@ L@ T@ [@ c@ l@ q@ v@ }@ @ @ @ @ @ ( .                @ @   ' 0 6 A H N  T Z b j o v }   *     \a X d h m= u z     1  GAL 5@>. @4 x>[        X  8~ >2  ! ,GA 1 5 9. C G O S@> Y r"'.5<CLS\afmv~      " ( .X d h m= u z     1  GAL 5@>. @4 x>[        X  8~ >2  ! ,GA 1 5 9. C G O S@> YX d h m= u z     1  GAL 5@>. @4 x>[        X  8~ >2  ! ,GA 1 5 9. C G O S@> Ychanging %s byteorder to %sreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk usage:%s %s %s %s %s: unknown machine typeDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown archgetlabelusesmbr() failed%s: not be or leAB:CDFIM:NRWef:ilmrtvwunknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbarm64evbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn26acorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs]  oUsage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s successfully scanned %s. forceWedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:unhandled type %d QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMAND: %sdrvctl-errorget-properties: %sdrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': select neither dict nor array with '%s' *4j444445 51 5 5 5 5 66#6:56O6n66667 7777S 7o!#$7&12734576879797:7;7<8 =8$@83A8GB8C8D8E8F9G9H9J9L94M9EN9LO9\P9lQ9~R9S9T9U9V9W9\9a:c:d:Ze:|f:g:h:i:p:qstu:vw:x::;;1;P;];r;;;;;<<(>!>,>6>N>`>y@l>>>>>>??)?)?)?B?a@x?????@@@7@?@q@@@@AA<ApAuAAAAAABB>BQBdBpBB/%lu/%luusage: %s [-aBFfIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1Can't read %s partition table%s partition table invalid, no magic in sector %lldsecondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld decimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gb%s is not a valid %s number. %lld is not between %lld and %lld. cylrealloc [n] write_disk(); wfd == -1Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Sector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsExtended partition busyExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionOverlaps another extended partitiongiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d Partition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Nested extended partitions are not allowedThe data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]Eqbo<qx>[        X  8~ >2  ! ,GA 1 5 9. C G O S@> Yreturning to single-user after filesystem check -ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %srqInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinv7fs** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo blockUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFbadCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directory%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 Invalid long filename entry for volume label RemoveInvalid long filename entry for %s %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directorysize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersInvalid long filename entry at end of directory %s No space for todo listNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  WWWV        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledDIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkINTERNAL ERROR: expandfile() failed to allocate a new block bad filesize %llu to expandfileusage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %dw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-a"5@nwx.<Odv(D\t $<Xp!Xx>[        X  8~ >2  ! ,GA 1 5 9. C G O S@> Y*4j444445 51 5 5 5 5 66#6:56O6n66667 7777S 7o!#$7&12734576879797:7;7<8 =8$@83A8GB8C8D8E8F9G9H9J9L94M9EN9LO9\P9lQ9~R9S9T9U9V9W9\9a:c:d:Ze:|f:g:h:i:p:qstu:vw:x::;;1;P;];r;;;;;<<(>!>,>6>N>`>y@l>>>>>>??)?)?)?B?a@x?????@@@7@?@q@@@@AA<ApAuAAAAAABB>BQBdBpBBHFS0eC>,UFS0eC 9!haHdInotNeedEFI*s(ҺK>;Qn|n֏- q+Qn|n֏- q+Qn|n֏- q+ Qn|n֏- q+&Qn|n֏- q+4==Gry=iG}ITM;t?_jWmCĄ 3KOOuyD¢<#*=(РD3h& \M}--ıܹчH 1-ܹчH@>IZܹчHq I􍂱ܹчHo<I􍪱ܹчHe)I2ܹчH>[Da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerdestroy[-rf]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize-i index [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:i:l-a attribute -i indexType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %lsUnknown %#x[partition not found?] %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:lua%5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrtsoruxÞXÝå@äåzyzQ *GTpêðtïE3j3ġ *vͱiMMå;; setifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcapsǪizpiy   "m#  &}(X˪aM,˳  @,8DL U0^@gpuYz̀ ̆@einit_current_mediasetmediamodesetmediaoptsetmediasetmediainst63 A3`LT@LT63Ћmedia_statusmedia_constructor#̐͞hͣ#̐͞h̐#̐#-#-0,#B̐L#paddr_matchyS+msettunnelV\print_link_addressessetvlanifsetvlannxt6\stSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockSIOCGIFAFLAG_IN inet %s -> %s netmask %#xTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sVLAN_MTUVLAN_HWTAGGINGJUMBO_MTU ec_capabilities=%s ec_enabled=%s NONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x>af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstrbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagАfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@ڏ4ڜڤiګi@iiiڶڿ ڐ ؾ 5H W@ctۂۙ@ۺffsEqbo<q%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfsysvbfsefsnilfsstrdup ciڭ^/i+ؾ ڤ u ؝@29>GQUZa bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead. ciڭ^/i+ؾ ڤ iC@iDu ؝@i@ڹڶmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreload ciڭ^/i+ؾ ڤ iC@iDu ڹi@\؝@ڜ4softdep ciڭ^/i+ؾ ڤ ؝@usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %s ciڭ^/i+ؾ ڤ iC@iDu ؝@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s ciڭ^/i+ؾ ڤ u ؝@^cm s@| m@ @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac[-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %drecvrpc: reject, astat=%d, errno=%d getport: %scallrpc: error = %d sendrecv: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %su  ciڭ^/i+ؾ ڤ ؝@ڹڶusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o ,d;XDl?_%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()53okg57c_[5<WSOusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Checksum error %o, inode %llu file %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGA{AAAABB?BgBBBBC%CMCuCCCUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1LOCALBROADCAST pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtudfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, flags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsAppleTalkEncapInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecFPFP*0 XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scanUqUYUUYUUY{UYUUYUUYV VV V. VFYVYV^VtQQVQVYVVYVVYVVYVVYVW WYVW"YW4W<YWTW[YWzW~YWWYWWYWWYX XYX X<YX XWYX XnYXXXYXXYXXXY YYYYYY$YlZUU#U(U/%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x0x%0*x0x%0*llx%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)%s: this type is unknown to this program ...(%zu more bytes)Invalid port: %sPort out of range: %s%s: !returned size wrong!%.2f %.2f %.2f hw.ncpu%d = %lluuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu 0x%llx %ld.%06ld %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d regcomp: %s: %sregexec: %s: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_url||}sendrequestrecvrequest***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20150912NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (ftp_debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnecteditepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Receiving HTTP reply: %sInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'fetch_ftp: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 Passive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPASVPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N netrc] [-o outfile] [-P port] [-q quittime] [-r retry] [-s srcaddr] [-T dir,max[,inc]] [-x xferbufsize] [[user@]host [port]] [host:path[/]] [file:///file] [ftp://[user[:pass]@]host[:port]/path[/]] [http://[user[:pass]@]host[:port]/path] [...] %s -u URL file [...] Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. anonymoushttpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)xsignal_restart: called with signal %d %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. ftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbvbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20150113malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintf compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%can't read stdin(stdin): unexpected end of file(stdin)usage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directory%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzD"D#D%D'----S SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESlikrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i^^V'X o'f]^'M^'`(^'U,^$^-'[^<^D'\^Z^e'O^y^'N^cc']^'^^'_^'a~^^'K^'Xj^^'XL^'Z^q'a`^^'L__'J_!_.'a8_3_<'H_C^-'Q _L_T'R _o_z'P_cc'S _'S(_'T'_^-'b_'c__'V@_cc'd~_'d_'eahahCx>[        X  8~ >2  ! ,GA 1 5 9. C G O S@> Yhw.disknames>[I2ܹчHqIZܹчHo< I􍂱ܹчHՃ=Gry=iG}mРD3h&mHFS0eC UFS0eC 1-ıܹчHeI􍪱ܹчH@>-ܹчH *s(ҺK>; !haHdInotNeedEFI      !"#$%&  Z'j@['j] 'j^'j\/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-25s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfWhat kind of system do you have?Raspberry PIOtherrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)51210242048409681921638432768FFSv1 [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed usage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] Installation messages in Englishen_US.ISO8859-1YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 8.1 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksaverage file size (bytes)mount point (or 'none')secMBNetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk into multiple BSD partitions. You must now set up your BSD disklabel. You can use a simple editor to set the sizes of the NetBSD partitions, or keep the existing partition sizes and contents. You will then be given the opportunity to change any of the disklabel fields. The NetBSD part of your disk is %d Megabytes. A full installation requires at least %d Megabytes without X and at least %d Megabytes if the X sets are included. Choosing megabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'. MB Cylinders Sectors Filesystem Mount point?Size for %s in %s?Change input units (sectors/cylinders/MB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionAccept partition sizes. Free space %d %s, %d free partitions.Reduce partition sizes by %d %s (%u sectors).The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated to %d %s. Type enter to continue This disk is too large for a disklabel partition table to be used and hence cannot be used as a bootable disk or to hold the root partition. We now have your BSD disklabel partitions as: This is your last chance to change them. Start %3s End %3s Size %3s FS type Newfs Mount Mount point --------- --------- --------- ---------- ----- ----- ----------- %9lu %9lu %9lu %-10s %-5s %-5s %sShow all unused partitionsPartition sizes okThe current values for partition `%c' are, Select the field you wish to change: MB cylinders sectors ------- --------- --------- FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9sToggleRestore original valuesSelect the typeother types%s Special values that can be entered for the size value: -1: use until the end of the NetBSD part of the disk a-%c: end this partition where partition X starts size (%s)%s Special values that can be entered for the offset value: -1: start at the beginning of the NetBSD part of the disk a-%c: start at the end of previous partition (a, b, ..., %c) start (%s)Badly formed sector number Select file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device /dev/%s%c on %s failed. The extraction of the selected sets for NetBSD-8.1 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-8.1 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-8.1 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-8.1 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. Available CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory %s: %s. Install aborted. Delete after installRelease set %s does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Your choices have made it impossible to install NetBSD. Install aborted. The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that /dev/%s%c is not a BSD file system or the fsck was not successful. Try mounting it anyway? (Error number %d.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbols%-27s %3sSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions %c and %c overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file %s Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-8.1 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-8.1 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemyes or no?Hit enter to continueChoose your installationSet sizes of NetBSD partitionsUse existing partition sizesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryFetch and unpack pkgsrc for building from sourceNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit BSD partitionsEdit and save MBRSwitch to GPTSwitch to MBRSet disk nameFormat as RAIDFormat as LVM PVEncryptBootable flagSafe eraseUndo changesUnconfigureEditForce umountFill with zerosFill with random dataFill with crypto data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity.AddThis removes all partitions on the disk. Do you want to continue?Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG) Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. MBR partitions, if desired, must be created before editing the disklabel. To use RAID, LVM, or CGD: 1) Create BSD partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM. raid%d (level %1d) on %-34s %11uM EMPTY RAID!Disks: %33sSpares: %32sRAID level: %22dnumRow: %22dnumCol: %22dnumSpare: %22dsectPerSU: %22dSUsPerParityUnit: %22dSUsPerReconUnit: %22dMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID: PATH NOT DEFINED! vnd%1d on %-51s ASSIGN vnd%1d on %-45s %11uMFile path: %29sCreate new image: %20sSize: %22sMRead-only: %22sSet geometry by hand: %18sBytes per Sector: %18sSectors per Track: %18sTracks per Cylinder: %18sCylinders: %22sFile path?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders? DISK NOT DEFINED! cgd%1d %-48s %11uMBase device: %24sEncryption: %24sKey size: %24dIV algorithm: %24sKey generation: %24sVerification method: %17sDisks in VG: %-44s %20sM EMPTY VG!PV's: %34sName: %34sMaxLogicalVolumes: %20sMaxPhysicalVolumes: %20sPhysicalExtentSize: %20sName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)? Logical volume %-35s %11uMSize: %33dMRead-only: %27sContiguous: %27sLogicalExtentsNumber: %18sMinor number: %26sMirrors: %27dMirrorLogRegionSize: %18sPersistent minor number: %14sReadAheadSectors: %18sStripes: %27sStripeSize: %27sZeroing of the first KB: %13sLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named %s) seems to exist on %s. Do you want to use that?If you booted from a floppy, you may now remove the disk. Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?We are now going to install NetBSD on the disk %s. NetBSD requires a single partition in the disk's MBR partition table, this is split further by the NetBSD disklabel. NetBSD can also access file systems in other MBR partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single MBR partition used to cover the entire disk. If you want to install more than one operating system then edit the MBR partition table and create a partition for NetBSD. A few hundred MB is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least 5GB if you want to build NetBSD itself. Which would you like to do?Edit the MBR partition tableUse the entire disk Total disk size %lu %s. Start(%3s) Size(%3s) Flg Kind ---------- ---------- --- ---------------- %10d %10d %c%c%cYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s%ssize (maximum %d %s)Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s) %s%sStart (in %s)Partition kind (0..255)There can only be one extended partitionThe Current MBR partition table is shown below. Flgs: a => Active partition, I => Install here. Select the partition you wish to change: Partition table OKDon't changeOther, input number Do you want to re-edit the MBR table (or abandon the installation)? There is no NetBSD partition in the MBR partition table.There are multiple NetBSD partitions in the MBR partition table. You should set the 'install' flag on the one you want to use.Setting up the DOS partition table ... Rewrite of MBR failed. I can't continue.Log ended at: %s # Script ended at: %s sysinst terminated. /usr/share/sysinst/catalog//usr/share/sysinst/catalogsysinstmsgs.sysinst: environment variable TERM not set. %u:%uDr:f:C:psysinst: screen too small xfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgftp dirpub/NetBSD/NetBSD-8.1ftp prefix/evbarm/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfix.tgzdisknamemydiskpkg hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/evbarm/8.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file------------------------------sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 /dev/r%s%c%s -p -c 3 /dev/r%s%c/sbin/fsck_%s%s -p -q /dev/r%s%cdisklabel -w -r%s -f /tmp/disktab %s '%s' -i /sbin/newfs -V2 -O2 /dev/r%s/sbin/newfs %s%.0d-tffs -o async/sbin/newfs -V2 -O %d -b %d -f %d%s%.0d-tffs -o log/sbin/newfs_lfs -b %d-tlfs-tmsdos%s /dev/r%s/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /dev/%s none swap sw%s 0 0 %s/dev/%s %s %s rw%s%s%s%s%s%s%s%s %d %d /dev/%s%c /tmp mfs rw,-s=%lli swap /tmp mfs rw,-s=%lli kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/dev/%s%cdkctl %s delwedge %sgpt show -u %s 2>/dev/nullPritableSectable:no_mbrdevice %s %s (%s@%s)%s (%s, %s)%s (%s, %s %s)gpt -qr header %sCannot process disk %s: too big size (%d) /dev/%s %s ffs %s/dev/%s %s ufs %scd0adk:no_partwindows,hfs/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'/dev/rcd%d%cCD001/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES//.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xhepf -rm %sfsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%smkdir -m 755 /mnt2 /usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-ADI_BRHkern-INTEGRATORkern-IQ80310kern-IQ80321kern-MINI2440kern-TEAMASA_NPWRkern-TS7200kern-RPIkern-KUROBOX_PROgamestestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug -async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%scCan't open %s Can't read disklabel on %s. %s/netbsd.bin/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgin/usr/pkg/bin/pkgin -y install %ss,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update%-50s %-10schpass -s %s rootpasswd -l rootsource for 3rd-party packageschroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu XXX Help Stringntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s %dMlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s%s -l %d%s -p %d%s -s %dlvm vgcreate %s %s %s%s -C %c%s -M %c%s -p %s%s -Z %c%s -n %s%s -l %s%s --minor %d%s -m %d%s -R %d%s -r %d%s -i %d%s -I %d%s -L %uMlvm lvcreate %s %sPartman device: %s lvol%.2dvg%.2dgpt remove -a %s-t %sgpt add -i %u -b %u -s %u %s %sCannot create GPT partition #%d on %s dkctl %s addwedge HACK%d %d %d unuseddkctl %s listwedgesdkctl %s addwedge dk%d %u %u %s %s (%s)Cannot create wedge dk%d for %s. dkctl %s delwedge dk%d/tmp/%s%c/sbin/mount %s /dev/%s%c %smkdir -p %s dd if=/dev/zero of=%s bs=1m count=%d progress=100 msgfmt=humanvnconfig %s vnd%d %s %d %d %d %dvnconfig %s vnd%d %slvm pv%-33.32s %-22.21s %12.12sdk%d: %s %-30.29s %-22.21s %11uM%s%c: %s %s%-33.32s %-22.21s %11uM(%s-%d) on %sVG '%s' on %d/%ugpt create -f %sgpt destroy %spartmanSpecial disk %s preparing error Disk %s preparing error /tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks /dev/%s START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dRAIDframe configuring error #%d cgdconfig -g -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d /dev/%s /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %s (%s, %s-%d)%s (lvl %d, %d disks, %d spare)dd of=/dev/%s if=/dev/zero bs=1m progress=100 msgfmt=humandd of=/dev/%s if=/dev/urandom bs=1m progress=100 msgfmt=humansh -c 'cgdconfig -s cgd0 /dev/%s aes-cbc 128 < /dev/urandom'dd of=/dev/rcgd0d if=/dev/urandom bs=1m progress=100 msgfmt=humancgdconfig -u cgd0umount -f /dev/%scgdconfig -u %svnconfig -u %sraidctl -u %seject -t disk /dev/%sdraidctlvnconfigcgdconfig-t nullraidctl -v -A root %sError writting RAID bootsector to %s gpt biosboot -i %d %sError writting GPT bootsector to %s Error writting bootsector to %s dkctl %s makewedgesmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.old/etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%s. %scan't delete extendedmain-extended mixupUser answered no to destroy other data, aborting. Unknown (%d) %*s (%s)Extended partition, LBAFreeBSD/386BSDDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32Windows FAT32, LBANTFS volume setPReP BootUnknown(%lli)%6lli%8s%10lli%10lli %c %s%lli%sdlsize=%lld ptsize=%lld ptstart=%lld /bootdisk %c/tmp/disktab.%sCreating disklabel %s in %s cat <>/etc/disktab %s|NetBSD installation generated:\ :dt=%s:ty=winchester:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:%s\ nparts limited to %d. :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:sh -c 'cat /tmp/disktab.* >/tmp/disktab'***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipesetvarcontrol_handle_datacontrol_writeoneconfigure_interface1dhcpcd_initstate2dhcpcd_getinterfaces hhdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionbocYd1ef5gohiLj^kAl&mKnoRp^qsr]sdtuY%vlwxszGyABCDEPFGHI"JKLЋMNOPQ<STUVW XZ1&4/6*| ~8}CAJZlzxmZ^i;T9rB!1default_configread_configrt_descrt_headclear0rt_disposert_new0rt_setifrt_newrt_freert_findrt_kfreert_addrt_recvrtrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initsa_in6_initmake_varappend_configc I9 make_envɐ$-3"8script_runreason0123456789abcdefdhcp_envoption(X 7b,Jq@UsDVn$:Y$w *:`*rn*/Nn9if_copysaif_opensockets_osif_routeif_ifa )arp_tryfreearp_readarp_probe1arp_announce1arp_openarp_probearp_announcearp_new5( HPHHPbpf_arp( PEP HEHH@CDH``Pget_leaseread_leaselog_dhcpQ\hawdhcp_bind6â?G&O Wdhcp_openbpfdhcp_informdhcp_handledhcpdhcp_readpacketdhcp_readudpdhcp_expiredhcp_lastleasedhcp_start1dhcp_initdhcp_dumpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_sendadvertisementipv6nd_expireraipv6nd_handledataipv6nd_handleraipv6nd_advertiseipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1ױ׺29  EMax׃׏םdhcp6_checkstatusokdhcp6_validateleasedhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrebinddhcp6_listendhcp6_writeleasedhcp6_recvifdhcp6_startrequestdhcp6_recv '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_envdhcp6_dump%s_%s=%s/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version7.2.2--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 7.2.2 %s Compiled in features: INET ARP INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-7.2.2 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: is a NET/ROM pseudo interfacepicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type %.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix lenoption `%s' does not take an IPv4 addressinvalid IAID %sIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argument%s: IA_PD not compiled inunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactive(null) rejectcmd != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.c%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsifp != NULLrt->rt_ifp->ctx != NULLrts != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL%s_%sTESTSTATIC6ROUTERADVERTUNKNOWNinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=trueif_down=falseif_up=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid= - %s %s: executing `%s' %sRC_SVCNAMEPATH=%sPATH=/usr/bin:/usr/sbin:/bin:/sbin%s: %s: WEXITSTATUS %d%s: %s: %s%s: arraytostr%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s%s_%s=/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtdst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_USELOOPBACK%s: SIOCGIFALIASnet.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6%s: ARP probing %s (%d of %d), next in %0.1f seconds%s: ARP announcing %s (%d of %d), next in %d.0 seconds%s: ARP announcing %s (%d of %d)%s: probing for %s%s: ARP announcement of %s cancelled%s: hardware address %s claims %s%s: DAD detected %s/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %sbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s: waiting for DAD on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: dhcp_read_lease_fd%s: %s: truncated lease%s: extending lease until DaD failure or DHCP%s: extending leaseNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %s0.0.0.0/0MS %s: using %sClassless Static Routesip_addresssubnet_cidrnetwork_numberserver_name%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: waiting for 3rd party to configure IP address3RDPARTY%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s not found%s: if_sendrawFAIL%s: dhcp_makeudppacket%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: cannot add IP address in test mode%s: DAD completed for %s%s: op (%d) is not BOOTREPLY%s: wrong xid 0x%x (expecting 0x%x) from %s%s: xid 0x%x is for hwaddr %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: checksum failure from %s%s: invalid UDP packet from %s%s: server %s is not destination%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired%s: timed out contacting a DHCP server, using last lease%s: dhcp_openudp%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: needs a clientid to configure%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %sDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s broadcast %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsip6_address%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: sending NA for %s%s: waiting for Router Advertisement DAD to complete%s: %s is reachable again%s: %s is unreachable, expiring itrtpref: impossible RA flag %x%s: %s: router expired%s: expired address %sIPv6 ICMP packet too short from %s%s: IPv6 NA too short from %sinvalid hoplimit(%d) in NA from %s%s: NA multicast address %s (%s)%s: %s not a router (%s)IPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: reject RA (no option %s) from %sdhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s_nd%zuaddr%zu%s: delaying Router Solicitation for LL address%s: no IPv6 Routers available%s: sending Router Solicitation%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: DHCPv6 Vendor Class too big%s: extending DHCPv6 lease%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: DHCPv6 DAD completed%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: ignoring unicast option as not masterbroadcastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: %s received from %sINFORM6ITIMEDOUTBOUND6RENEW6REBIND6REBOOT6TIMEOUT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: failed to request information%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: DHCPv6 lease expired%s: no advertising IPv6 router wants DHCP%05d %s%s: delaying DHCPv6 soliciation for LL addressSTOP6RELEASE6%s: dropping DHCPv6 due to no valid routers%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6BBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~r@v .~@/etc/group/etc/master.passwd%s%s%s 646towlowertowupperalnumblankcntrlgraphpunctxdigitUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*ju,uappnduchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid*0- ).+(/, '!% #34 !#$:./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmta.m.pmp.m.dstmidnightmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagoyearmonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SXDB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'NAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs30%llo%lld0x%llx/dev/%s%s%s%c%.*s/r%sr%s%.*s/%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkadd_new_key: bad type passed Inkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar  O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo dataseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X `%Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error C00`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz taf1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist