`@# ` #" $@` `T@ ! c@ے"@  "b`  0  " 8 " D * " 0 L@ `L@ `N@  - @- N@@% N@@ ~N@@ vN@ %`n lj0123456789abcdef㿈 #> , ֒ ?L?|/-\㿘 @`"@ ` #J@  64X44@4D4H4P44@44H   44 4L4 #4 *434>4D4@M4`V 4Hc4m4u4~444p 4L44H 4` @2S <  @@p\$U:/mntoo<@`bT @2SC <  @@p\X<@`bT U2SlP(pA 2Szk 2SI2SIH2SDA2SE]J2SO22SO2A2SZA2SE"2SO62SO6B2Sf+@2SFI2SHW2SNtPX`hpx 02Sh 2SK2SKt2SKt../../instbin2Sl 2SK!`2SK#F2SK#F../../instbin2Sp 2SL !2SL X2SL X../../instbin2Sn2SM3%2SN2SNL82S+K2SN2SNÀ2SNCI2S2SN,2SNw2SNC2S 2SO+2SO-D2SO-D../../instbin2S 2SO052SO22SO2../../instbin2S2SO52SO62SO6/tmp2SAm2Szt2Oe2S /C2S$h2Szt2OL2S}% D2S$2Szt2OL2S}.}E2S$2Szt2OL2S}'VF2S$2Szt2OM2S}) G2S$92Szt2OM2S}+2S$2Szt2OM2S},2S$2Szt2OM2S}$[܀2S$2Szt2OM2S}0G2S$2Szt2OM2S}"2SAm2Szu2Of2S2S$[2Szu2O]2S.}2S$2Szu2O]2S2SA2Szx2J12Sׄ2SF$-2Szx2OD2Sܓ2SH$I2Szx2OD2Sp2SJ$Z2Szx2OD2S2SL$O2Szx2OD2S(2SN$I2Szx2OD2S#*2SP$82Szx2OD2S&62SR$I2Szy2OD2S*T2ST$I2Szy2OE2S-D2SV$`2Szy2OE2S1xˀ2SX$I2Szy2OE2S5 R2SZ$I2Szy2OE2S2S\$I2Szy2OE2SĴ2S^$2Szy2OE2S#*2S`$Z2Szy2OE2S 2Sb$J2Szy2OE2SW2Sd$J2Szy2OE2St2Sf$I2Szy2OE2S2Sh$k2Szy2OE2S#*2Sj$2Szy2OE2S'c2Sl$_2Szy2OE2S,2Sn$Z2Szy2OE2S052Sp$m2Szz2OF2S3%2Sr$`2Szz2OF2S:i2St$Z2Szz2OF2SÀ2Sv$2Szz2OF2S2Sx$I2Szz2OF2S 2Sz$_2Szz2OF2S߀2S|$I2Szz2OF2SC2S~$_2Szz2OF2S2S$2Szz2OF2S2S$I2Szz2OF2S!`2S$a2Szz2OF2S% 2S$_2Szz2OF2S*Q2S$I2Szz2OG2S-D2S$I2Szz2OG2S2b2S$I2Sz{2OG2S62S$Z2Sz{2OG2S;32S$2Sz{2OG2SÀ2S$\2Sz{2OG2S]J2S$f2Sz{2OG2SX;2S$2Sz{2OG2S  2S$I2Sz{2OG2Sv 2S$`2Sz{2OG2Sf 2S$82Sz{2OG2SG 2S$2Sz{2OG2Se 2S$m2Sz{2OG2S!`2S$82Sz{2OH2S$s2S$82Sz{2OH2S) 2S$I2Sz{2OH2S,2S$I2Sz{2OH2S/2SA2Sz2Oh2SC2Sf$2Sz2ON2S'V2Sh$J2Sz2ON2S*Q2Sj$I2Sz2ON2S.}2Sl$I2Sz2ON2S1xˀ2Sn$I2Sz2ON2S52Sp$82Sz2ON2S8ـ2Sr$82Sz2ON2S1-2St$92Sz2ON2SĴ2Sv$Z2Sz2ON2SX;2Sx$Z2Sz2ON2S 2Sz$I2Sz2ON2S߀2S|$K2Sz2ON2S2S~$\2Sz2ON2S߀ 2S$I2Sz2OO2S9!2S$82Sz2OO2Se"2S$92Sz2OO2S$s#2S$K2Sz2OO2S($2S$q2Sz2OO2S,%2S$s2Sz2OO2S/&2S$f2Sz2OO2S.}'2S$Y2Sz2OO2S>(2S$V2Sz2OO2S;3)2S$J2Sz2OO2S S+*2S$82Sz2OO2S沀+2S$82Sz2OO2S,2S$82Sz2OO2S -2S$V2Sz2OP2Se.2S$J2Sz2OP2S!/2S$82Sz2OP2S% 02S$I2Sz2OP2S) 12S$92Sz2OP2S/22S$J2Sz2OP2S2b32S$92Sz2OP2S642S$92Sz2OP2S98p52S$Z2Sz2OW2SĴ62S$Z2Sz2O]2S 72SA2Sz2Od2S߀82S$82Sz2O^2S0G92S$;2Sz2O^2S !:2S$;2Sz2O^2S ;2S$;2Sz2O_2S<2S$;2Sz2O_2Su*=2S$;2Sz2O_2S>2S$:2Sz2O_2S8?2S$:2Sz2O_2S U@2S$:2Sz2O_2S&%A2S$:2Sz2O_2S)'B2S$:2Sz2O_2S-LC2S$:2Sz2O_2S2bD2S$:2Sz2O_2S7nE2S$:2Sz2O_2SF2S$:2Sz2O_2SG2S$:2Sz2O`2SH2S$:2Sz2O`2S I2S$:2Sz2O`2S沀J2S$:2Sz2O`2Sz9K2S$:2Sz2O`2SׄL2S$:2Sz2O`2StM2S$:2Sz2O`2SeN2S$:2Sz2O`2S!O2S$:2Sz2O`2S&%P2S$;2Sz2O`2S) Q2S$;2Sz2O`2S-LR2S$;2Sz2O`2S0GS2S\&2S>2Sܓ2SܓX`hpx @2S 2SbZ2S]J2S]JT2S2S2S !2S ! 2Smr2SN2S/q2S/q :2Sl '4 . .. chown chroot update  installboot  sysctl . .. tmp . ..Darwin0PerthBrisbane Adelaide Hobart Melbourne Sydney Broken_Hill Lord_Howe  ACTCanberra LHI NSWNorth QueenslandSouthTasmaniaVictoriaWest YancowinnaN'T^x̷]ͧ@xΠzχ"xCSTN¼=T s̷rͧUΠ χ7  b)%\) p~~pWSTN TWp̷Vͧ9pΠsχpp9 %I%')') )ESTN'T^x̷]ͧ@xΠzχ"xp@ #P"?0!   Ȉ   ^>xXm8O禈!kLjMj/Ly Y!Ո"B#i$"%I&f')') )d*z+ш,Җ-(.x/tE0Z1]a2r<3=C4R5%626889:ˈ;<=>?@eABECcD%pECFRG#gGnIIIPJ+K2LHMN*OmP QWRkS6TKUV+VXΈX֛YZ}[Ԓ\]t^{_V`_]a}sb??c]Ud!e=7f>gg hijklmnۈogpqPĈres0tEuv.vjxxLybz.{D|K}&~y-CST . .. bin dev etc mntmnt2sbin tmp usr varinstbin  install.sub install upgradenetbsd.profile[, install.md,boot[0etwork_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. If you do change the default route, and wish for that change to carry over to the installed system, execute the following command at the shell prompt: echo > /tmp/mygate where is the IP address of the default router. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. You may also wish to take this opportunity to place NFS mounts in the fstab. This would be especially useful if you plan to keep '/usr' on an NFS server. __fstab_config_1 echo -n "Edit the fstab? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done install_sets $ALLSETS $MDSETS # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab hostname.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link..." else echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." fi if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." else echo -n "Making devices..." pid=`twiddle` cd /mnt/dev sh MAKEDEV all kill $pid echo "done." fi md_copy_kernel md_installboot ${ROOTDISK} ) unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 ypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (t)ape, (C)D-ROM, (N)FS" echo -n " or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk ;; f*|F*) install_ftp ;; t*|T*) install_tape ;; c*|C*) install_cdrom ;; n*|N*) install_nfs ;; *) echo "Invalid response: $resp" resp="" ;; esac else _yup="FALSE" # So we'll ask next time fi # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo "" echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp="" ;; *) ;; esac done } munge_fstab() { local _fstab local _fstab_shadow local _dev local _mp local _fstype local _rest # Now that the 'real' fstab is configured, we munge it into a 'shadow' # fstab which we'll use for mounting and unmounting all of the target # filesystems relative to /mnt. Mount all filesystems. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _rest; do # Skip comment lines case "$_dev" in \#*) continue;; *) ;; esac # and some filesystem types (like there are swap,kernfs,...) case "$_fstype" in ffs|ufs|nfs) ;; *) continue;; esac if [ "$_mp" = "/" ]; then echo $_dev /mnt $_fstype $_rest else echo $_dev /mnt$_mp $_fstype $_rest fi done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab _fstab=$1 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype -o $_opt $_dev $_mp ; then # error message displated by mount exit 1 fi done ) < $_fstab if [ "X${?}" != X"0" ]; then cat << \__mount_filesystems_1 FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __mount_filesystems_1 exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-fast] local _fast local _fstab local _pid if [ "$1" = "-fast" ]; then _fast=1 _fstab=$2 else _fast=0 _fstab=$1 fi if [ ! \( -f $_fstab -a -s $_fstab \) ]; then echo "fstab empty" > /dev/tty return fi if [ $_fast = 0 ]; then echo -n "Syncing disks..." _pid=`twiddle` sync; sleep 4; sync; sleep 2; sync; sleep 2 kill $_pid echo "done." fi ( _devs="" _mps="" # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo -n "Umounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "Done." if [ $_fast = 0 ]; then exit fi echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab _fstab=$1 ( _devs="" _mps="" while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab }  ` 3  @D, @' $$Ԝ+#@  /@@g / "% % @<@p@`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h!#`$   ǖ ? $       c       ?@ ?# @!  ?؀! ?@ ?# @  ؀       ?"  #\#`?@?# @!  09@ ! 4? ?c @ ̀@ 0'@@@ ̀@ ? ?c @! @ 0@@@! @ #d#h0   #d#h0  #d#h  Ŕ  ' ? "c  (    ##ܘ@#\#`?@?# @؀! ?@ ?# @  ?Q@؀ K?@ ?# @! 2 9@ ! 3? ?c @ ̀@2 %@@@ ̀@? ?c @! @"  @@@! @# #?B ?@ ?# @!  6 @ ! /? ?c @ ̀@ # @@@ ̀@? ?c @! @  @@@! @    #d#h  Ŕ  c ?   (]  Z 䀢 "cc#\#`  #d#h  Ŕ  ?`?2   (9  6 c$  $#$  $ @ $ c ` ?  @ ! ` ?   h    "cc"#@?`㿘#€ 㿘# "? @㿘#  € 㿘#  ?Service unavailable㿐#     ?1 !@Ņ *`:`J "J %s: %s not compiled in instbin㿘@8@ J 2@@L@@Ӓ /  @@   "@Z "    € !h b8 P@>@!㿘 ?@?`Usage: %s ..., where is one of: %s㿘!h cp @P@    '+ ) @ @  O4h@ch#@@`@ !h @c@ pwd[testhaltrebootumountupdatehostnamemkdir-shshmountchgrpchowntarlnsyncfsckfsck_ffsifconfigrouteftpbasenamechmodseddmesgrshexprsumcksumfgrepegrepgrepdfsortnetstatinstallbootsysctlcatedmvddnfsmount_nfsgetoptkillmtsleepinitcd9660mount_cd9660ffsmount_ffsslattachtipcpmount_mfsnewfsshutdowndisklabelresettsetlsrmpingvimknodawkgawksttychflagschrootgzcatgunzipgzipcutstringsmoreless㿘@ Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘@*@??@  "  =#h;#! @M ? .#@`!h#" ?@ ?@ #@) seek errorread errorWaiting for data㿘# #`  2 `  @3##2 # @`?"Ԁ #   ##   @ ""#  & & # *  @ ?@6?#`@!@`  ?#<`   @ ?  # !(@)p @3'k?#" @"?2  # $  @'"   @ *` ?"?〤  A !8@)I @3 A!T  $ ` @S#`"`  & "`$#,   !H@)b @  #d 2?# "` "@&& " "#  @n ch_ungetchar overrun㿘? @"?  @( @""Finishing logfile㿘A!T !@b !A# $? "b !(@)  !@?#d !A@!T?$!TA"!\Warning: log file is incomplete㿘 # c`g:  ') 㸀2 !@(   A!T@  㸁 2  2 㿘@ ?4=  #: #c` '`#Ԑ c " # 6 #!@q?cd #   #"  # <&"`  㿘1#` @` #"`$@:? @B? #d  㿘 # 2 # #@&  2#"`"`  ,?$* 㿘#@   @  ??#` #4 "` #` "`"` 㿘#` ?#   #` 2 `? ?#`?"`#"` #@   @  Cannot allocate %d buffers㿐# !#@N # &'b@'c#   @ܐ  # seek error to 0㿘#` ?$"`$#@?"`@@2"`!#@ #"`$"`"`"` `   @j ?#@'" 㿘 @$#` "`?""`"`""`  㿘#@ !# " @"#@ ##" 㿘  @' ?  㿘!A@ !D  $# @n ($#" "?" " " " " " " " $" ِ A#` "`A!D@c#` ?""` d㿘#    #` 2   @` #?"`  !@-#$#A!D@ 8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘  # 8 '*`:  9   06,` ."  b c"    * ?N? #`@&' @ *,p@& @ ,`  N  Ȁ , *,invalid charset name㿘 "" N @   "" @   2 @%ޒ @\ 㿘 @dgah #Ț  ؐ@J  *@ @  "*@ *@ ``؁*s<%X> J*J*"@J k@sd  @ u @@ ܄  @  ܄  ܐ @ LESSBINFMTLESSCHARSETLESSCHARDEF㿘@t"@o"t @h"В J@  0      %cESC^%c㿘   #c #@Pc1@ @ܐ @#c#bؔ@:1#"!D( @ H㿘@ϐ ȁ㿘!D Ȁ@#Q aD$aD!!@J@!@"@$!@aD,@`L@ 2 `!@ !@/?!@@.!D @ *`: @$t@`L@  @!@ @!@.?!@@#   !DȀ@JȀ`?㿘!!DJ a!D $!D@$A!@`!@ $!@ 㿘!D Ȁ@J 1 !DJ? y!DJ?`!D 1 !DJ? d!D8J? 㿘!DJ  1!DJ 0!DJ 1!DJ  !DJ !D 㿘`!D #! aD$aDJ@!@"@$!@@.[N  !DaD 㿘J Ȁ   !D@-*@# `?㿘!!DJ !D $!D@#!@!@ $!@ 㿘!D Ȁ@aD"aDJ@!!@"@$!@@.N   @ 㿘@# @-h 0;@- @# ` # `"`@#   !``"!D #%aD*aD`J@f@ $@@#? aD $aDN !D* 㿘!@# .@K Ȁ )#  #@% @\Ȁ c 2 #@c 2@ @ڒ @Ð $ c $`$ `""`@# "`㿘@# @? @# @"䀢@"@ Ȓ `#*`@MMKLLL$MN MhM|MN NDNDN\NlN\N\N4@!""@3""@""!DJ 1!DJ   !DJ !D!DJ | 1!DJ r @"" aD@1 !DJ?  !D8J?`!D )1 !DJ? "N !D8J?F @""A@""!DJ  1!DJ 0 @"", @""'@"""@""@""@?"" "aH@""Ɛ  @  @"" 㿘@M Ȁ uN!!@?@E!@ $!@b &!@:!@"@:$!@@4 Ƞ Ƞ!D* ! , ?aD: !!D`$!D@,*@!D?J? '1' L@"?@ $@!@,r!@3@+԰ 0@!א L !@$  !@,[!@ 㿘 *`:  @+L   㿘!DJ   1!DJ !DJ !D!D Ȁ@ J !D Ȁ@ !D? Ȁ  N? ? 8N?㿘!!L @l$!L"!T!P #@^!!D" @ $aP!D@"!D *@ "aL!D*?㿘    1@t!\@!\"0㿘@"  !!L : @aL"!X "b!\@9aL͒ "aX!X$!X!DaT 1!R!D!T@!X 2@""!P!X( @""@* 㿘aH "aH@;  Ր    㿘@ ȁ㿘@ !@א!@ $!@ ȝ㿘@*@ t㿘@*"!%̀ @ @*!/?㿘!Ѐ   @*"a!Ѐ! !Ѐ !!Ѐ @!!Ѐ "!!@"!done|done㿘!̒?`*"<*`@VXLXLXLWVXLXLXLXLVXLXLXLXLXLXLXLXLXLXLXLWXLXLXLXLXLXLXLWWX,XLXLXLXLXLXLXLXLXLW`@a0UL@ +"` "`A!@ "L@@L@ AB"!@@A="a@!L!ؒ@U5,!L@L` L`L@ 0(@N0%L@ ! @#, @@ @"c,@#, 2@!#,@!J!@q!@ ! 㿐!̀`/ *`@Y[([([([(ZY@[([([([([([([([(Z[([([([([([(Y[([([([([([([([([([([([([([([([([([([([([([([([(Y?Ѐ x@T  dt "a@"! #he"aJ!؀  + -Z + -  "aܐ "a*!!܀ @  a@Q J!؀ + -/*!@ / -/// / 8 r  * * @ !"  @"! aА"a     !̐?݀   C  [Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘@#(`!h@T@ B "? @ ""@` " !#$ @$#$$#$#0  "  A@ !D @ @(!"  @(@#@($"@" @r :0@(@" @~#@(less version %s㿐B#'!X@ђ㿘@#( "@(!h@"(J@"#( @ !̀   g   0 @.ungetcc overflow㿘@c( @!h"c(@#(!̀@ "@@ @  @#("#(*㿘@=L?Pattern not found㿘A!D!Ѐ! @ @ 0 aА >"a#aВ@+!$aЀ  @  @  ` `"@9  @ @ :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈 "a#< 2  : "/%- +)!A%$*!d  @+#8 @E?d d ̀ "/  ̀ "/_  '/'@7쀢 ` `i`c"ؓ*`@e<df0gdhjlhjf\edfgpffkhitflighfk(k g8e\egXhddltltkjHh|lllggghj|lleg lllllllllllllllllllllllllllllllllllllllllllllllllat `   \dԀ`"#Ԁ @$Ԓ @  0*Ԁ`"#Ԁ @$Ԓ @  0Ԁ $$;Ԁ $$>Ԁ $$+ Ԁ $$- @ "#,""d  !  @ j #d  "#,Ԁ 4%bb @ Y 0Ԁ 4%bb @  0 J@@ Ԁ $$zXԀ &$Ԁ d d$o@ 0jԀ @ t@ 0_Ԁ &$@ *c0T@ ?' (L @ؐ %!Ԁ $$fP %!Ԁ $$^0!А %!Ԁ $$U. 0d!Ѐ  ? !А ? &!Ѐ  ? !А ? &!А %!Ԁ $$1  @%!@&͞#@ @%@%@ 0@ J 0,@ `80?A@ !D@Β`H 2AY P Ԁ R p"@Y @A@0!D @X 0Ԁ $$@)Ԁ #0 " @D Ԁ $ !' Ԁ $$@Ԁ Ԁ  !' @0Ԁ $$@Ԁ  @ 0 /`H "!ܐ ` #h"a@w 0 `i 0@ ab0 `\ #h"  @t0| `D ~#hp"l j h@}0d %a, f#hX"T   .@< J*!@ %a0[a  0Ù R a  0H" (""㿘@#0@)!LA @= C@ 8@O㿘  @~  @"`"`"@& ?Warning: some commands disabled㿘A Ēߔ !x@’ Warning: some edit commands disabled㿘A Ȓǔ !@ @ 4J@K)` @ g `"$ ?""2J@ 2 J@J`g2J@ fJ@`J@?`J@2`?`@ И  d㿘  d   d 2㿘A Ē㿘A Ȓ"H"H* @㿘@J J ?i 㿐@N E27?N n23?N d2/? ' J `e'`e`x`c0 0Ð? O@'@ ?  㿘@ B @[@}   @  ?  @ r@ %?@ @ "L@@ c? L` M L` +L` Go}.lessCannot use lesskey file "%s"㿐@$"(  '"0@@ -x#h@E "@ ?  *?*? ܰ  ` ` 6 d` "  d ` ` d`  d ܀ ?@J?耤 ?0 㿘@@& @ & N@ ".@` @*N@㿘`@ސ@ @*N@  N@ "` @` `@ J"?8J?  ?J?㿐#AaD @?aD@@1!A Ԁ  A@!D @@ o $ A"!D㿘A@aD0 @-%s"%s" may be a binary file. See it anyway? 㿈A!D" A!D   " @'@{  L @aa؀ A 'A@ '!@x@ 쀤`@@ @$n @㋒ '@'#  @  @k '!@쀢 y Y @ |π` !AA"!H$!DA" "a@b!D@Yb "bOA!\`#4 A@ A!@ !A!L@|`? $!L#4 " @@ (@#  #( '!@ 㿈A!D  'Aǒ`@  耤`@D@p!A @!D!D    @= 㿘A"!D@  㿘A"!D@ 㿘A!D@p? " ` 㿘A!D@k? " ` 㿘 @K"  @ɐMissing filename ("less -\?" for help)㿘A@ Ѐ " #@] @ې !؁㿘{?@ў@Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 w@D @ T A!X "' O#@^?`0T *`@}}}~$}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~$}}}}}}}}}}}}}@}x!A"aT@ !A$!T  @  ?A!T@ !T?$!T@8 # A!T ' @%s/%s㿘% L@ !@Y@V @0  b0@@ᮒ @" @ HOME㿘@q"В  LESSHELP/usr/share/misc/more.help㿘@Z# #(@ 㿘  @ #'A%A*`:  # %2 D 0 H @ 5@R`@`L@  @ @   @ 1A'A*`:  # %2 @!DH@1`@ΐ@ΐ, `L@  @,%s*㿘@ @ c  `@@@̒ @ @X !  @  ?   @ @  @m ?  @ 㿘  @  㿘 d d@  ? $@̐`$ @` $@&,,,@  @N@0@K,۠ ,SHELL%s -c "%s"r㿘@9`@4" @. @ Ӓ @~ @`"N "@@ @   b@e@ @Zْbа@echo %s㿘 #Ȓ {@[+N @Ȑ0@ŐLESSOPEN-㿐 !?!@ H !@`X ". L |    `T @  @Z O&&@!@ ? X 1@ZN` LESSCLOSE㿘"!@Z!@͐!X P@Z8@ @s,# ( <  @m @  @eA`<   @[ @  @SA`@8@) ǐ㿘# @@㿘#, #d @ސ??{b "b㿘b @"b...skipping... 㿘   #<?4 #P  #<?   2C?7$ #<?<@$ A! @@ 0@@?@@ "?@ô @#$  @@h ?A! 2?!@#?,@)A7' ?" 0@  @N ?)@e  `! $  A!`  $A!h $  $$ @o@?ɀ #, "" #d b "b)` A"A@A"!@1?㿘/ @ 4  #<? ? ""@@` @@@X? `ڞ@@?㿘#0 "    ;@  07@??2-` #< @L ##, @:  @    @?? b "b 㿘@y ?2 `@p? wi  $ #<?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘W#!P@ 0@k#@gcH @  #ahcH@@=@q #!@ @3A A @" 2 㿘`2@A!@&& @" &@` &  Aa( "a(㿘 "` "@ђ?Aa(?"a(㿘 @  @ & ?& & ˒㿘 !A!D@'$!DԐ@ @ؐ 2AA  2 A A 㿘 ܐ  A(㿘A!! " !@   㿘   @" `"  "@ "` "   " 㿘?c"䀢 A!0* @@ G T@@,>?H  ! !##d < ??@. b  ?  ? ٰ@" !   ?#d @'?0㿘?f d"䀢  A!0* @  & @ѐ? R" &#ec鈠  ##~  ?cd 02#0/@ Ccd &d ?2cd.蕐  0+ @j@w艐)+"?#d  @?0` ?@  b 2  @K .0ۀ@@CCannot seek to end of file㿘 %!x@ƒ 0h#< #< @Cannot seek to beginning of fileCannot seek to line number %d㿐@? $  @yc04' 2 '@lc%" %"(@|㿐@@0@YDetermining length of fileDon't know length of file㿘u?%#@ (k?%#0@L 0 @@ d6?@c㿘ǐ  ? UL@Cannot seek to that file position㿘@\@$ $ @?D@| g玐 & @@ 0_@m @j?2 ? @""""""#<?  &@01#<"?  x 0' "#<?#? c< ?@@W""@M#<?       (%6d㿘#x B@G#!#a&@ba@4a  "a!!`#! *@ cX ! "cX# !#1!*!`$!*@a $a@M#X !a"!         Ll          t㿘 %?  !`  !J@` `!`!J@㿘!"!!#aJJ !"@$!㿘@ 2 # a@ @"@4K !#!D !``#J@ !J@  \ ! *@!`!J@   `]  a?"a#*@!*@a@"a 㿘J"  @b  *"  # *""" @㿘a ."a!#. :`J@ _  f  !#J@ !#J@ _ Ȑ D  # "    r 0n ͒ ! h  b"acX ! "cX%#   K! $!@cX  G 膐 5#  臐@"!@! b 4%   !*`:  ! $! N   Ҕ  a "a 㿘J"  2 J"?b!b#D  #\ # # *!*@ "#*@!*@~  "@(`(h HJ"@   㿘?"+? 2&?X?##` A ,A 6?`,#&@㿘? $!?䏐? !? #,#F  ??,  `2&@(   (  $         " 㿘""    A 2 $ @"$""""@"`"`"`$ $@ʐ ȐƐ" ""  " 4#"  2 " " "@Calculating line numbers㿘)#8@  A "a8㿘!"   d$"@ $"b` ?$"㿘#x li`q ""     ` @ @ "b""    $@  "@)   G ""  A%’ d 27 ?"4  A"!864'?0%o  ! ""  A%̒ d 2 ?  w?A"!8㿘`Z ""     I @ ""    $@  "@ !  24? - %Q d 2'??   2?  %g d 2 ????㿘@ Аq? ?%< ? @ ?   . * 1 `Cannot seek to end of fileMark not set㿘 '", . $0' ^$A"(& & aD*""( .  !)"(& #<?& ! "(& & A!D$"(   ?. @  㿘`?㿐 @ & & A!D&㿐@? "`"`A!D"㿐!@ `?2 'A!D""`#"``'`'A@!D@ Mark not in current file㿘h A!D@."p@ ?Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 &A  A0.0+*"!\ ."  A!T ." A"a\ތ<!T A.# !\'.# @1㿘A "aX’Line number is required after -l㿐 ' l@b 2/`A/ 8@  0 "ah胐Cannot use lesskey file "%s"㿐   /' @㿘  0"A "!`T@j#`A!D  @?  F 0cTags file "%s"㿐 B  ""#0#nB"c#'/!@/㿘  A "!h/"P%s㿐 (  "N@0+*N@ M" m = B " `"`#d`"@  &#|"ē*`@'/"@]㿘   !#$#㿘   @6㿘   c  Use "h" for help㿘#@    0 @ 0@  @ @j@TA X"aL 4<There is no %s flag ("less -\?" for help)㿐'D! " D € $ " J  0! J? `0Z'D*`pDDJ@ +`?`"iJ@`d'DA "!hDJ@ +`'DA"a@DD@P'DD?'D z@2  @b'0 @t    "`   `, # D&     `?"N  @  @*`? J aD@q'DD@  "@ D €DJ@ U There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@e@'1  ` @@א'1  0 `! @̐'1 P@ޒ0    HJ "  ` @A "j``  "#   ^`: 1X`M"` O`"` K`@``?C"@9"` ;`"N@7`N@@@` @c`?` *"@4)`%1  p"` H`1` @ 2``  "` `"@ @] 05`   `€H`  @Z`  "`    ` *  '`@1`  "b`  @ ` -%s㿘ː1 2@&`h 㿘@p "   S@ 㿘@d" ` 2` @ String is required after %s㿐͐'2!@ߒ㿘 J㿘N 2M   `$2 . N Number is required after %s㿐&L -    ?А ? $&'2!@   ?А* *`:` ?Р  А (. $&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe less helpful in promptsBe helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenApHp  "    J2 ApHpJ "  J( P J 㿀'''@A ""@g ?@! $"@$" ?㿘 @Ao 㿐@F%s: %s㿘 $@#ܢ@@  4c@O * 8"㿘!B!Ѐ B@ d$!B!Ѐ . * * @ d@~㿐#d  j"b  L;    0 0@  @  @ @     0 0@  @  @ @   `@ @9   0  0 @ @ @ @ z㿘B! 蠢@A!L   `@ "bB "a؁㿘B! 耢@ b܀ B@ 0"bB!ؒ"!*㿘  *` : N 㿈6 `2 @P 0, @ ` -, 耤 $?L?㿘  ,*`:  % `N d  s2N@` *` : `L  N@` @N 㿘c( "c(A!L  @ @ "A!L Bj 0!@  "@>   ?6@ Q" "b/㿘@ @ BV!@  "b܁㿘A!L  @ lu@A!L   0 @ " "b??? <BB< <2 8B*  <@ B<*` `@  <B( <` B*` `"B  < B?#<("@㿐#<`耢!B" ?@S@"#B'#B!#< $b#<"`b*  "?B@ ?<6?B<* @&? * ?㿘#< @ 4 B*   *   <?B<( "   (?" < $ <6?㿘B" b"bB"X$ B"$ B#B"cdH !"!H!%ld㿘!7b@%d㿘!7b@㿘! "    ?*㿘͐ !#<   #<V -㿘?. > `68 *`@X (Lp! ?@ 188"A!D7@c/@ ,#x#x ' 0 4!  0"ذ q? 4  08 @ A!D@  㿘?`68"0*`@(t 8DXd?\0;#`0XAP!DA!D< Jޞ l` A <А?0:=˞W?.`+ K!|`!쀢  J  "A!D .  J:" ?." \ J2 02 0?㿘N l"   p b" 0UT ?* : `2J9!*`@pd|XP&@?&@? &@? &@#&@&@?㿐`"!N 219Z" ?#*`:  :# ? %" .". a \" a $a!* N q 2 H N ?] N ""! @1 !쀦` * @!쀦&1 㿘B#d 㿘#|ę+ ""@""@ hB#lр Ȑ @ ""`"`"` "`"`"`"`"` "`$"`(@ bX"f $#`n"W $`2"O $`I $o`KH $j`"I $`C $a`Ba,C $Z !@"I $g"> $d8 $Ki`7"@6 $B%"@"5 $#@- $58!@*p"@) $*'2 $ "      $      $        $  2`"ch"b"cԐ >'̐  ?'̐ //!!'`'`'` '`'`'`'`'` '`$'`('  @eB"#lWARNING: terminal cannot %s㿐"  A!P ;' LINESliCOLUMNSco㿐 `h@5  ;`"#<@ h ";@`@ p"c<c<   "c< `h@  ;`""@ِ x ";@=@ "bb  P"bkrklkukdkPkNkh@7kDh  ';!@̦֒!#@d@d` ,` ,`@W`@V ,';!@൒̦!#@C@B , ,@6@5 ,';!@̦!#@"@! ,!"@ @ - ';!@ț!#@@ ,!"@ @ - ';!@Ț !"@ @ - ';!@@̦ !"@Β @͐ - ';!@,̦ !#@@ڹ ,';!@̦ !#@@ڥ ,';!@̦2 //Ҧ#@@ڌ , ,@@ ,/ #k//ҠА@p@o ,##  `//ѐ@^@],"͒#TERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐<@"<"@ޞ 4 <<""? /<@)"<@"""cD<@""c\<@""cp<@""b<@" "b"b"""#t"L"#"l""`" ""!<'<"@"!< $ *b<"@ "a<""a<"@ "a<""a#0 A!P a<"@˒"a<#@Œ"aa 2<""aa <<""a<#@ޯ "!T` 0a`?"a Invalid pattern㿘 쒒 @  B@A   ?#| "B@beB"#| 㿘B#| "B@bXB"#|㿈B#| @ܘ `?` &@&  㿘B#p "B@B"#p?"a"䀠B2 Bp"  "  @$ 2 㿘 ``  @ 2" ` & &``" ``` 4 &```@&@+0&@"㿐I  +   &     2J@&  J@ `'J` `J` ݐ`'J` `׀ 㿈'L='P:'LP  먒 L""`P""`P(N  L%P L# 耢` 1B@'a#p耢`2@㿘! b"!㿐*? m?@Ho 㿘"!"䀢 㿘  " ?˧" "  < ? #6 惒 㿈{+)#d r?` h`  `摒`?`2'@T#x  , $ϒa #  a@ # "h@ 2 @   ""䀢  Z 쀧 2' Nothing to search㿐`N@  2@Q#"䀢  "䀢  a "a3"!m"쀢 8 Ԑ M?  "!"쀢 "!b"!"䀢 c "!"䀢 ? '`&B#Ӓ !??  "䀢  : 0 c"䀢  .  㿘'H3a! paH?  !?HHA!0*` 'H9HH??!H A!0*` 'H!'H!A!0*` A !0*` &!&A!0@ A!a0"H?H   H H?H"!"!㿘 C@/ccd "cd" 㿘 D@`@cd "cd" 㿘 D@ `cd "cd" 㿘   C@c D@`@ D `@  @   @Line numbers turned off㿘#dU""#d @Ӓ &6Ő  @Ȓ  @Œ @@  D@ǽ`@  "b!")#<"#< #< 2  : " "b/Aa8 "a8#x  "b"#xD!8 tagsrNo tags fileNo such tag in tags file㿐B#D@YbȤDy"@%!)+' @v f@ L  %bx%#$|运'J@ %#J@J@  `'J`  * ''J ̐ t$| *$|`'J` ^J@`'%bxJ "JJ``\ '`' @*J J $"*@0 @D" "#Tag not found㿐"|   ",E! ڒ &?䚐 -+)d 㑒cx  "x@x@ d/dev/tty㿘E"@В  "b "b㿐#?b! ? ?O O "/ b㿘@,-0123456789an:oft:%07lo %07ld %07lx strings: length less than 1 strings: %s stdinrstrings: %s: %s %s:%s㿀@  E@.b'7 ?E#+) $'EE@ؔӑ* :  G* ||Ec0* ?J - c0J c0J c0 * @  7 #@1#J o" x dE0 E0vt#r#@|oE#0* @  `!hE@zc@ @Đ2 -@ $@f#ܔ!hE@jc0@  E#@975??#;, '@ E`cH @s !E $@B#ܖ  #P@E '##?'# ?'#|&# S @y ?m&㘀 l ! ! !   " N J ! 2 / @ ! )  @ ̀ 2  @ @ ̀   @!    @ @!  ## #@o ?"'#   '#&"# ; 1@h\`Xbؐ@J   ` 2 "-  E#h@#@"@E#p@@?"` bؐ@J  *`` !: !?`"@  `"*@ @[? 0۔!? "! &! * @[/  @ @㿘#`"##  @`"# @"#`" `? "`@w   "  ?usage: strings [-afo] [-n length] [-t {o,d,x}] [file ... ] 㿘!hG@ c@ī 㿘@b:c:d:f:snr%sstdin㿘@R7H H@,`0 *cH # $/ -+)'@8?T? 4M* """""""""""""""""""""""""""""""""""!!!"!""""""" """"!I!@pc%c -%c@gcI#%#$@L#0* @#܀  ##  #؀ #Ѐ "@@1@ !H#H@@y H2 `P@P|@Ā@@L`@ 0 HĀ`X@ , [-cf] list: illegal list value [-cf] list: values may not include zero [-cf] list: %d too large (max %d) 㿐)'%##̪ H@Yca'  J@ - `' J"ؐ   @U   Ȁ4$J -J"ؐ  @> J@ - `'Ā  $J  H@Oc  H@Oc(cԐ HcX@Oܖ( &$c*@`   #Ā`Ԁ 4"#Ȁ#@7 1㿘'##Ԁ`2  ? & @`& @?s `L ?` "@ , :  `"*@@YI 2  @#Ā "+  ? & @`& @?, *?` "@ , :  `"*@@Y  ? & @`& @? 2 ? " $ * @X {%s: line too long. 㷐 #5I* =-(@N   L@  @O"  ` #Ѐ H P@Eߐ##ԀDL "7L@  =?`"@  `"*@ @X L@ `?`"@ `"*@ L@ `   ?#Ā 7 =?`"@  `"*@ @XZ L@ !!?`$@ `$*@@XB`L@ 2L@ 2`? " % I* @X( Eusage: cut -c list [file1 ...] cut -f list [-s] [-d delim] [file ...] 㿘!hJ@8b@ؐ 㿘@ Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r㿘A!hKcHKHK@# file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s 㿘!C"A!hLc`LpL@#x"耢  %!L@`h@ #@ 2@㿘!C A!hLc`LpL@#x ؀  %!L@`h@#@ 2@Compilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H 㿘A!!hLc`LpL@ǘ#x!hM`MM@ఐ!hM@`!hM@`Ȑ!hM@`؁.exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' 㿘'D@'HH@ #A@X$cؠ  cؐ?M@kah Dcؐ*?DHM@ p〢 "`CH"aT! @z  @ $ ( Z@pb @m   Z@gb @d   Z@^b!A#Max@   M#ؒa@  !AC "a#ؐ M@ a M#@a #CC "a"#`Ma@| !@`$ N  )E'C%C5C1C-C+C3C/CMCDHd@*ʘ π E* ::::::::::::::9::::::::9::::::$:::::H:::::::::::::9999:9:9:::9:::::0:<::p::C"!@*#(C"aD$$Ca  "a i$$&0&!(&!(&!(%$&!(%$%a8&a4C"!,!@\#($  @U#(xM$$s%@a4 &a4n%a8@  iMA!hMa@X0C\"aL*@ ِ WMCa( 6CC!"a(Ca$ EC!"a$ED#,"@C!  C!8  A!hMa@) ̀ C! "A ̀  AE!hMb @(@  C!<  C! `Co#L"b䀤`E#,D@6C!E#,`$#,H*`@a #,D@`C@@C!0  C!8 !C`?@?!C@ c!P!P%s: compressed data not %s a terminal. Use -f to force %scompression. read fromwritten todeFor help, type: %s -h stdinfstat(stdin) OK 㿘C! 5C!0 1( C! "`X@TR` #A#C! O!O!(C! "KO!8!H!!hO`@|A!hOa@@v@  (O!X !X*( `* `* `* `* `*K#( #(* `* `* `* `* `* `*"#C!0 C!( 2R @`@ O@B!```"#?@"cC "a" 8C!  @#C "aHC@ !PC!0 C#@@aH0C+C )C'%#bT €T f 6! 㼀 ,c@ @Y#C &"aHA"#C!4 C!@ !hOapC! A#`Ȑ" 0"@!@E!h!hM`@-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s8P@` !C!$!!@} @  H<  0C!,   @ @???? ?(?0?8?@?H?P?X?@ @0C!8 2ACA!hP` H<  C!8 0CA!hPa@8(%C J`&C! 2#C! 2C!8 2CA#ؘ`  s!hPaH@(CaP B @"aP t"c#C!( C!0  ` "@C! C!0 C!@ K#( #(* `* `* `* `* `* `*@5 ! ( @ !?"cA!hPax@@ep (C "aP@" 8C!  C!@#C  "aHC!0  !C#@aH@#0C! Ra$" @ C! # C!4 cC!8 cA!hPa(@x#c CC!$`?"cC!4 !@N (  K@I ( P!P!!H!hPa@R(-C!+)C'%1#C#€`Ԁ 2C! 㼀 ,#@ @# $aHA"#Ȑ?"aH@׌#C! 2 C@ׄ Ԁ C@uC!H? CC! F@#0B!4 8C!@ !hP@aCC!  A 0`Ȑ"  A#`Ȑ" 0"@@VhC!@ C!  !hPa@۔!hM@֒`C! @ @%s: %s: warning, name truncated 8*' 1#!%C)+A@ C@I "!`@!?$ @dR@$P @d P!hax@c@dB@@ @u$P& #@ C ! C!8  P!hR`c@v#P     $P@ @Q#@#0㿘 $"#C!  C! @]0@_z-z-gz.tgz.taz.zzpC#0 R@@c "`@ %&В@@@ Ш@@ $@J?׀ /%@@ "`@  .Z㿘C#T! (@ ( ?C!  $#܀   (! (   (@c C ("aP@ɐ ( M@ߒa "` (%)C @|h@j `.@ @|[@co%!P  %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘!#@`(Z#ȠC! L .C!,  CC!0 k C!@ fC!4  CC!, 2] C!8 2X C!8 DCA!hSa8@k(9C@ÐR@fb R@`c 28,S!` !`, `,  `,  `,  `+, "C!4  AC!, CC!8 aPA!hSah(@3CaP     "aP"##@{` %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐C! C! ,#@`",# @@| /,#@ ` ,#@`",# @@d /,#@`",# @ @T/C?"aH`8 "`8" "#Sc@X   Sc@Q  C!H,#@`",# @@( $C!H  A!hSc@-(!CCf#"b`,# "`,# @  A!hSc@ (C "aP?!hT`(@(C "aPC! ?A!hT`p(@ C "aPC! Ѱ?,#@`",# @@ ,#@`",# @@ * ,#@`",# @@ * ,#@`",# @@ *  C!( "#,#@`",@| ,#@`",@q .`,# "`,# @a ,#@`",# @@R * C!4  A!hT`(@UA`,# "`,# @2 ,#@`",# @@# * C!4  A!hT`(@&??!# ,c@`$ ,@ ?? ,QC!$ 2!C! C!0 "! 8 !1# ,#@`$ , @@ސ *   ,1@Z#Ȣ!-##'T ,@`$ , @@ .*      ,@ѐ ,Ca0  `2"a0@ ,#@`",# @  8 nC , g"`#Ta@  ! , #a@  2$ ,Cf#"b@ r?ETa @   Cu "bC 8"aHTa(@q   Cp @"bC "!H'"#Ta0@`   CCt `"bC "aH! C! C!0  C"!HCm""b" , "cC!H & 8 CA!hTa8@*(C"!P!8  CA!hTaX@(CaP ? "aPdeflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐Ccl `C"cl!4 W@! C!8 3?W@ 0.?,?C!X`C!\C!4 W  `C!8  CCW aX\@CC!X`Ȑ" \"@@W@ 0A"###`1$`0# -??@  ?#$`0 $`0@Ô  @* * @*` A* * @*` "@t# * C!4  Ccp.`W  @!#AW  0@c 0 CC"!X" $c $ 0X` 0@"XAȀ2 CC"!\" " "`0\`A#Ȑ@"\A 0`Ȑ" Ȑ"@@W @fcȁ` @`?8@ @?`?`?`?` ?`(?`0?`8?`@?`H?`P?`X?* @$ ʒ@ *?name too shortcan't recover suffix .internal error in shorten_name㿘  @C!  X@ ]*?d2,X@ , "c?S@a` 'XR" ",? `,? `,? `,? `;,'X@E /  @?L 2 L 2``  `,@ `@E̒ .2L`X@]!L` @3`%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten  $"#!1 $#@a  #܀ ?2 W##C! !#  F#Ȑ#@E 2  @ ) (@cȀ AA#C! O!8K!H!hXb (!hXc (#@WCC! >!X#H7HA!!hXcP@ (  @oV   !hX@ch@{!hH O@wOH"ؐ@  `Y2 !OH y!!hX@cCaP   #@Dʒ!@l#Ȁ A !hPax@{@]%#C "aP 㿐`'` '@֒ !<`  C!8  CA!hPax@VCaP C "aPC!8 @\#ȁ%s: time stamp restored 㿘C! #`! C& !4  !hYc@&!# #@D` o C!8  CA!hPax@CaP C "aPC!8 @\## @D6 C"!`! (@D8!@ڐ ( C!8  CA!hPax@CaP C "aPC!8 @\ (%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@ŐA!hZ`@C <"aP+C@c4X@a Z@`耢 @@ #@y  /*< @o0ZA!h`ؖ@ %aP@X㿘C# C@ "c! "!C@0$ !C!T @($!T@㿘C!` @δ @5#א 㿐77"#" "C "aH " *c"#?*@ @I"# *@@:# 2 c"c#*c@@'####c `* ###`2 #* "# c*@@"c#2 * @@####c* ###㬑2 #* "#c*@@"c#2 * @2 @ @e "c@ sC@)aHC!L@7"#*@@"# *@@# @ܐ (3#!c`&c*@c2N@xN  1#@"`##&#c `* #&#`2 #* "# c*@@K"c#2 * @@:####c* ###2 #* "#c*@@"c#2 * @@####`0 `* ###`2 #* "# `3*@@"c 22 * @@####c0* ###02 #* "#`0*@@"c 02 * @@`Ȑ @"`ȁ 㿘#@̸?  @0"c`0"`0bad pack level㿘? \@Y"" # @@. Cc " ""cA "c@  @ 6@"#A"#! 4#ȟ€@ $#? "#$"#"##!1!@#!# "# ##*   "㿘A㨲 ʸ㴀 @7`A] X @S  `M ` ` @6'` @/'` @('` @!'` @'` @'` @ '` @@*ɲ`'!  >  @ ( 2㿘C#c"#$?#A?c?"@;#Ȓc@' ? "c $cAА "Ж ## * @ @2 3  * A## * @ @2 3  * # #cȐ 4 € "cc"c㿘 "c#  )%###A##'##/A#*` @ @%# * *`@2 2@" "@ Ӑ 8 0#"@@y?"$#?$#*   %# ** 2 ?2$ %#*` @ @ %# @L @?$ $  Ѐ  В" @Ĕ %! # #!c!#  #A#Ѐ`#@ A#cА " @ 㿘   LX# 5%###A##)'-A*` @ @& * *`@2`2@%## ##@" "@# @8` ##"@@8 #<@ : " @ #" $%#$*   & ** 2`2#? %#    4$Ѐ`#@ В" @ $%Ѐ` c@y @ Ѐ`cǐ`  В" @ %Ъ  $?$! # !10#!#  Z`#cǐ @> A#Ѐ`#@ A#cА " @ 㿘"#A"#"""b"r Ė  !C# "ݑ*" (6 C# *@*   *"*  "TD d #ݑ*" (6 D d *@*   *":"TD d  ݓ**"@ @?(  D d * @ ?*@* #*```2  ! #.  2  `  2` !! #.  2  `  2`!!! #.  2  ` !2`!! #.  2  ` !2`!@#! "p . 2 @   4@ (0 (0 (0 0  ""( (ٝ㿘.`.`9) . ./ *  ....*.`  .`. .`ր.` 㿐 '      #.   2  #*@* <;2 #75,c ,  *   , `2 . @ 2@ $* @, @Qܐ  &ܐ @G@ &<Α,`C##-.   . #?.  "?. @ ?2@ @  2@  ?`2 !##%.  "?, *  `&@ ܐ $4`?. x  #*  * 2 ,  "  *@ 2@ 6 , 㿘@``? " "= "`# , @  ` "`* " , , @2   ,  4)&`#  ` #`* "@ "  " * 4@ *"ܐ?#"ܐ  " " `&` 2  :   1? 1#/- #%*`@&# #%* "%*`"@,, *@@  4@  @  ,, @ *@2 2%`_  4# " #*` "@0㿘?       +? <0.  "- .0 .0`@ 0`@ 4`H`D0`D0`H         ˴㿘?        @O"-`   "A`  ,@@@1?2@&  ,@$`?#(#(@`?   #,#,@`? #0#0@ `? @        `@㿘D Pa@D Ka\D!` D!" *    ? 4 ܒ` * @"܁㿘>@ɒ @ƒ @Ò  D!" *  @  &  ]? Yblock vanished㿘"" b*#?#@2D@YDA!(D>!D"ܖ 2" 2b@ "b `  @p ` ,  "@ 0( @^ !@Ēbp b@Q D!@Da\ `~` @` bܐ " @b "b"6 㿘b̐"b#耦  * .``92?"@a*`@  2@   #>  @*  #>  @*` @ 2А`"#ȓ*`2@ bِ * "ّ* +""̀ CbԐ"b" **ؐ +"C!L &"̀/2#* A#cФ"  D d. @@@<`  @"̑2 bЀ@6`4@* "#@ " @ 㿘   "̀ J "#"C#!#Ȁ   ,`*` @*`d@od`"-`@h$@-```# @4` @*`@@@V`D d`"T$@@K"̀ Ƨ4$@C$-l used on binary file   (  ( @ ( 2``?0 0? \T 4㿘 "b@H. "@3"#""c `* 㜐""2 $* "# b*@@ "c"2 * @@. 2 " :3"@ "".  2@ #" 0`* 2 㿘" 1####c * ###2 1* "# b*@@"c"2 * " "# b*@@2"""㿘`# "c* 㜐"㜑6`* c"c#*c@@_"#6`*@@P## ##8* ###2`!* "#8*@@/"c82 * @2@5#!`&*@ @  %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘#,@"#  *   * @`  ",#A @ *   * @*` Ґ#PA!hf$`C ` "!H`A!hf`    "`D 2  "aD "a A!hf`@s(C "aP out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈  "#" Ԑ @֒ D! D! C# # * @  * @*`@  *  * @*` C!H D@U  fq"xqfm"! gC!H df# # *   * @*` *  * @*`  @ # # `*  ` `* *!hfb@ f@"А #?%-#3#' ,@`$, @@s c &c*c@ ?@Df#@uD! (D !'# ,@@`$ , @@F   .* @* @*`@ * *! * !'# ,@@`$ , @@   .* @* @*`@ * * @*` #@ޒ @f@# A#Ȁf#!/bin/sh # $NetBSD: install.sub,v 1.5.2.8 1996/09/02 23:25:02 pk Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation/upgrade script - common subroutines. ROOTDISK="" # filled in below VERSION=12 export VERSION ALLSETS="base comp etc games man misc text" # default install sets UPGRSETS="base comp games man misc text" # default upgrade sets THESETS= # one of the above local_sets_dir="" # Path searched for sets by install_sets # on the local filesystems # decide upon an editor if [ X$EDITOR = X ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi fi getresp() { read resp if [ "X$resp" = "X" ]; then resp=$1 fi } isin() { # test the first argument against the remaining ones, return succes on a match _a=$1; shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } rmel() { # remove first argument from list formed by the remaining arguments local _a _a=$1; shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1"; fi shift done } cutword () { # read a line of data, return Nth element. local _a local _n local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi eval echo \$$_n } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { # return first character of argument local _a _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir local _file _dir=$1; shift for _file in $* do if [ -f $_dir/${_file}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}.tgz ]; then return 0 fi done return 1 } twiddle() { # spin the propeller so we don't get bored while : ; do sleep 1; echo -n "/"; sleep 1; echo -n "-"; sleep 1; echo -n "\\"; sleep 1; echo -n "|"; done > /dev/tty & echo $! } get_localdir() { # $1 is relative mountpoint local _mp local _dir _mp=$1 _dir= while : ; do echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __get_reldir_1 The directory \"$local_sets_dir\" does not exist, or does not hold any of the upgrade sets. __get_reldir_1 echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir="" break ;; esac fi done } getrootdisk() { cat << \__getrootdisk_1 The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the standalone installation program. Available disks are: __getrootdisk_1 _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo "" echo -n "Which disk is the root disk? " getresp "" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo "" echo "The disk $resp does not exist." ROOTDISK="" fi } labelmoredisks() { cat << \__labelmoredisks_1 You may label the following disks: __labelmoredisks_1 echo "$_DKDEVS" echo "" echo -n "Label which disk? [done] " getresp "done" case "$resp" in done) ;; *) if isin $resp $_DKDEVS ; then md_labeldisk $resp else echo "" echo "The disk $resp does not exist." fi ;; esac } addhostent() { # $1 - IP address # $2 - symbolic name # Create an entry in the hosts table. If no host table # exists, create one. If the IP address already exists, # replace it's entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/^$1 /d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2 $2.$FQDN" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface link-layer directives # Create a hostname.* file for the interface. echo "inet $2 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 } configurenetwork() { local _ifsdone local _ifs _IFS=`md_get_ifdevs` _ifsdone="" resp="" # force at least one iteration while [ "X${resp}" != X"done" ]; do cat << \__configurenetwork_1 You may configure the following network interfaces (the interfaces marked with [X] have been succesfully configured): __configurenetwork_1 for _ifs in $_IFS; do if isin $_ifs $_ifsdone ; then echo -n "[X] " else echo -n " " fi echo $_ifs done echo "" echo -n "Configure which interface? [done] " getresp "done" case "$resp" in "done") ;; *) _ifs=$resp if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" fi else echo "Invalid response: \"$resp\" is not in list" fi ;; esac done } configure_ifs() { local _up local _interface_name local _interface_ip local _interface_mask local _interface_symname local _interface_extra _interface_name=$1 set -- `ifconfig $_interface_name | sed -n ' 1s/.**$/DOWN/p 2s/inet// 2s/--> [0-9.][0-9.]*// 2s/netmask// 2s/broadcast// 2p'` _up=$1 _interface_ip=$2 _interface_mask=$3 # Get IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "IP address? [$_interface_ip] " getresp "$_interface_ip" _interface_ip=$resp done # Get symbolic name resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Symbolic (host) name? " getresp "" _interface_symname=$resp done # Get netmask resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Netmask? [$_interface_mask] " getresp "$_interface_mask" _interface_mask=$resp done echo "Your network interface might require additional link-layer" echo "directives (like \`link0'). If this is the case you can enter" echo "these at the next prompt." echo "" echo -n "Additional link-layer arguments? [$_interface_extra] " getresp "$_interface_extra" if [ "X${resp}" != X"" ]; then _interface_extra=$resp fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ $_up != "UP" ]; then ifconfig ${_interface_name} down if ifconfig ${_interface_name} inet \ ${_interface_ip} \ netmask ${_interface_mask} ${_interface_extra} up ; then addifconfig \ ${_interface_name} \ ${_interface_symname} \ ${_interface_ip} \ ${_interface_mask} ${_interface_extra} return 0 fi else echo "Interface ${_interface_name} is already active." echo "Just saving configuration on new root filesystem." addifconfig \ ${_interface_name} \ ${_interface_symname} \ ${_interface_ip} \ ${_interface_mask} ${_interface_extra} fi return 1 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Set up the hostname. if [ ! -f /mnt/etc/myname ]; then echo "ERROR: no /etc/myname!" return 1 fi hostname=`cat /mnt/etc/myname` hostname $hostname # configure all the interfaces which we know about. ( tmp="$IFS" IFS="$IFS." set -- `echo /mnt/etc/hostname*` IFS=$tmp unset tmp while [ $# -ge 2 ] ; do shift # get rid of "hostname" ( read af name mask bcaddr extras read dt dtaddr if [ ! -n "$name" ]; then echo "/etc/hostname.$1: invalid network configuration file" exit fi cmd="ifconfig $1 $af $name " if [ "${dt}" = "dest" ]; then cmd="$cmd $dtaddr"; fi if [ -n "$mask" ]; then cmd="$cmd netmask $mask"; fi if [ -n "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr"; fi cmd="$cmd $extras" $cmd ) < /mnt/etc/hostname.$1 shift done ) # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route add $hostname localhost # /etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route add default `cat /mnt/etc/mygate` fi # enable the resolver, if appropriate. if [ -f /mnt/etc/resolv.conf ]; then _resolver_enabled="TRUE" cp /mnt/etc/resolv.conf /tmp/resolv.conf.shadow fi # Display results... echo "Network interface configuration:" ifconfig -a echo "" if [ "X${_resolver_enabled}" = X"TRUE" ]; then netstat -r echo "" echo "Resolver enabled." else netstat -rn echo "" echo "Resolver not enabled." fi return 0 } install_ftp() { # Get several parameters from the user, and create # a shell script that directs the appropriate # commands into ftp. cat << \__install_ftp_1 This is an automated ftp-based installation process. You will be asked several questions. The correct set of commands will be placed in a script that will be fed to ftp(1). __install_ftp_1 # Get server IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP? [${_ftp_server_ip}] " getresp "${_ftp_server_ip}" _ftp_server_ip=$resp done # Get server directory resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server directory? [${_ftp_server_dir}] " getresp "${_ftp_server_dir}" _ftp_server_dir=$resp done # Get login name resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Password? [${_ftp_server_password}] " getresp "${_ftp_server_password}" _ftp_server_password=$resp done # Get list of files for mget. cat << \__install_ftp_2 You will now be asked for files to extract. Enter one file at a time. When you are done entering files, enter 'done'. __install_ftp_2 echo "#!/bin/sh" > /tmp/ftp-script.sh echo "cd /mnt" >> /tmp/ftp-script.sh echo "ftp -i -n $_ftp_server_ip << \__end_commands" >> \ /tmp/ftp-script.sh echo "user $_ftp_server_login $_ftp_server_password" >> \ /tmp/ftp-script.sh echo "bin" >> /tmp/ftp-script.sh echo "cd $_ftp_server_dir" >> /tmp/ftp-script.sh resp="" # force one interation while [ "X${resp}" != X"done" ]; do echo -n "File? [done] " getresp "done" if [ "X${resp}" = X"done" ]; then break fi _ftp_file=`echo ${resp} | cutword 1'` echo "get ${_ftp_file} |\"tar --unlink -zxvpf -\"" >> \ /tmp/ftp-script.sh done echo "quit" >> /tmp/ftp-script.sh echo "__end_commands" >> /tmp/ftp-script.sh sh /tmp/ftp-script.sh rm -f /tmp/ftp-script.sh echo "Extraction complete." } install_from_mounted_fs() { # $1 - directory containing installation sets local _filename local _sets local _next local _f _sets="" if dir_has_sets $1 $THESETS; then for _f in $THESETS ; do if [ -f $1/${_f}.tar.gz ]; then _sets="$_sets ${_f}.tar.gz" elif [ -f $1/${_f}.tgz ]; then _sets="$_sets ${_f}.tgz" fi done else echo "There are no NetBSD install sets available in \"$1\"" return fi while : ; do echo "The following sets are available for extraction:" echo "(marked sets have already been extracted)" echo "" _next="" for _f in $_sets ; do if isin $_f $_setsdone; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f; fi fi echo $_f done echo "" # Get the name of the file. if [ "X$_next" = "X" ]; then resp=n; else resp=y; fi echo -n "Continue extraction [$resp]?" getresp "$resp" if [ "$resp" = "n" ]; then break fi echo -n "File name [$_next]? " getresp "$_next" _f=$resp _filename="/$1/$_f" # Ensure file exists if [ ! -f $_filename ]; then echo "File $_filename does not exist. Check to make" echo "sure you entered the information properly." continue fi # Extract file cat $_filename | (cd /mnt; tar --unlink -zxvpf -) echo "Extraction complete." _setsdone="$_f $_setsdone" done } install_cdrom() { local _drive local _partition_range local _partition local _fstype local _directory # Get the cdrom device info cat << \__install_cdrom_1 The following CD-ROM devices are installed on your system; please select the CD-ROM device containing the partition with the installation sets: __install_cdrom_1 _CDDEVS=`md_get_cddevs` echo "$_CDDEVS" echo "" echo -n "Which is the CD-ROM with the installation media? [abort] " getresp "abort" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo "" echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # Get partition _partition_range=`md_get_partition_range` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [c] " getresp "c" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__install_cdrom_2 There are two CD-ROM filesystem types currently supported by this program: 1) ISO-9660 (cd9660) 2) Berkeley Fast Filesystem (ffs) __install_cdrom_2 resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the CD-ROM if ! mount -t ${_filesystem} -o ro \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi # Get the directory where the file lives resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive local _partition_range local _partition local _fstype local _fsopts local _directory local _md_fstype local _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo "" echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition _partition_range=`md_get_partition_range` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [d] " getresp "d" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__mount_a_disk_2 The following filesystem types are supported: 1) ffs __mount_a_disk_2 _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ ! -z "$_md_fstype" ]; then echo " 2) $_md_fstype" else _md_fstype="_undefined_" fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [ffs] " getresp "ffs" case "$resp" in ffs) _fstype=$resp _fsopts="ro" ;; $_md_fstype) _fstype=$resp _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the disk if ! mount -t ${_fstype} -o $_fsopts \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << \__install_disk_1 The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __install_disk_1 _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo "" echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi # Get the directory where the file lives resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP address? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport (only works with capable NFS server)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-T" ;; *) _nfs_tcp="" ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi # Get the directory where the file lives resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_nfs_directory}] " getresp "${_nfs_directory}" done _nfs_directory=$resp install_from_mounted_fs /mnt2/${_nfs_directory} umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << \__install_tape_1 The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __install_tape_1 _tape=`basename $TAPE` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=`basename $resp` TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=`expr $resp - 1` ;; *) echo "Invalid file number ${resp}." resp="" # fore loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << \__install_tape_2 There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __install_tape_2 resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="tar --unlink -zxvpf -" ;; 2) _xcmd="tar --unlink -xvpf -" ;; *) echo "Invalid response: $resp." resp="" # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a local _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediatly. # if [ ! -e /usr/share/zoneinfo -a ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath="" fi cat << \__get_timezone_1 Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "MET" or "GMT-6". Other zones are grouped by continent, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __get_timezone_1 if [ X$TZ = X ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#/usr/share/zoneinfo/} fi while :; do echo -n "What timezone are you in [\`?' for list] [$TZ]? " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone [\`?' for list]: " getresp "" case "$resp" in "?") ls ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then TZ="$_a" echo "You have selected timezone \"$_a\"". break 2 fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } install_sets() { local _yup _yup="FALSE" # Ask the user which media to load the distribution from. cat << \__install_sets_1 It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. __install_sets_1 if [ "X$local_sets_dir" != "X" ]; then install_from_mounted_fs ${local_sets_dir} if [ X"$_setsdone" != X ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp="" # force at least one iteration while [ X"${resp}" = X ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, b#!/bin/sh # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used thoughout FQDN="" # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_ifdevs() - return available network interfaces # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with installation? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. cp /etc/disktab.shadow /tmp/disktab.shadow while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${ROOTDISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. Loop and # get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << \__get_filesystems_1 You will now have the opportunity to enter filesystem information. You will be prompted for device name and mount point (full path, including the prepending '/' character). Note that these do not have to be in any particular order. You will be given the opportunity to edit the resulting 'fstab' file before any of the filesystems are mounted. At that time you will be able to resolve any filesystem order dependencies. __get_filesystems_1 echo "The following will be used for the root filesystem:" echo " ${ROOTDISK}a /" echo "${ROOTDISK}a /" > ${FILESYSTEMS} resp="X" # force at least one iteration while [ "X$resp" != X"done" ]; do echo "" echo -n "Device name? [done] " getresp "done" case "$resp" in done) ;; *) _device_name=`basename $resp` # force at least one iteration _first_char="X" while [ "X${_first_char}" != X"/" ]; do echo -n "Mount point? " getresp "" _mount_point=$resp if [ "X${_mount_point}" = X"/" ]; then # Invalid response; no multiple roots _first_char="X" else _first_char=`firstchar ${_mount_point}` fi done echo "${_device_name} ${_mount_point}" >> ${FILESYSTEMS} resp="X" # force loop to repeat ;; esac done echo "" echo "You have configured the following devices and mount points:" echo "" cat ${FILESYSTEMS} echo "" echo "Filesystems will now be created on these devices. If you made any" echo -n "mistakes, you may edit this now. Edit? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} ${FILESYSTEMS} ;; *) ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs /dev/r${_device_name} echo "" done ) < ${FILESYSTEMS} # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. Note, enter all symbolic host names WITHOUT the domain name appended. I.e. use 'hostname' NOT 'hostname.domain.name'. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) resp="" # force at least one iteration if [ -f /etc/myname ]; then resp=`cat /etc/myname` fi echo -n "Enter system hostname: [$resp] " while [ "X${resp}" = X"" ]; do getresp "$resp" done hostname $resp echo $resp > /tmp/myname echo -n "Enter DNS domain name: " resp="" # force at least one iteration while [ "X${resp}" = X"" ]; do getresp "" done FQDN=$resp configurenetwork echo -n "Enter IP address of default route: [none] " getresp "none" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi echo -n "Enter IP address of primary nameserver: [none] " getresp "none" if [ "X${resp}" != X"none" ]; then echo "domain $FQDN" > /tmp/resolv.conf echo "nameserver $resp" >> /tmp/resolv.conf echo "search $FQDN" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi echo "" echo "The host table is as follows:" echo "" cat /tmp/hosts echo "" echo "You may want to edit the host table in the event that" echo "you need to mount an NFS server." echo -n "Would you like to edit the host table? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/hosts ;; *) ;; esac cat << \__n#!/bin/sh # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK="" # filled in below trap "unmount_fs -fast /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_ifdevs() - return available network interfaces # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp="" # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp="" # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. We remove all but ufs/ffs. ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" -o \ "X${_fstype}" = X"ffs" ]; then if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab fi done ) < /mnt/etc/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. Note that this fstab is only for installation purposes, and will not be copied into the root filesystem. __fstab_config_1 echo -n "Edit the fstab? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check all of the filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets # Get timezone info get_timezone # Fix up the fstab. echo -n "Converting ufs to ffs in /etc/fstab..." ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab done ) < /mnt/etc/fstab echo "done." echo -n "Would you like to edit the resulting fstab? [y] " getresp "y" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." echo -n "Making devices..." _pid=`twiddle` cd /mnt/dev sh MAKEDEV all kill $_pid echo "done." md_copy_kernel md_installboot ${ROOTDISK} ) unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 N TWp̷Vͧ9pΠsχp~Yv;V?p9 P8/ ߀  ~^>xXf8HO!d1Fc(E g' Y~!΀"B#i$"}%I&_')'()Ԙ*À+z,-\./t>0mi1]Z2V3=<46h56J67,89:Ā;*<= >?~@eA^ЀBEC>D%iEFKGGgHIIJuK+LWM N9OmPpUQW RP7S6T0UVVW݀X֔YϿZv[\]^t_x`_VaXb?8c8ddeFf7gbghDij&klmnogpjqPrIs0t)uv vcwxEyqz'{|D}o~y&rQESTN TWp̷Vͧ9pΠsχpp9 P8/ ߀  ~^>xXf8H矀!dǁFc(E y Y~!΀"B#i$"}%I&_')') )*s+ʀ,ҏ-x.q/t>0S1]Z2r53=<4R5616889:Ā;<=>?@eABECcD%iEC~FKG#`GgIBIIJ$K+LAM N#OmPQW RkS6TKUV+VXǀX֔YZv[ԋ\]m^t_O`_Va}lb?8c]Nde=0f7gghijklmnԀogpqPres0tEzuv.vcxyxEy[z'{=|D}~y&ESTN TWp̷Vͧ9pΠsχpp9 P8/ ߀  ~^>xXf8H !dǁFc(E y Y~!΀"B#i$"}%I%')') )*s+ʀ,ҏ-x.q/X0S1]Z2r53=<4R5616889:Ā;<=>?@eABECcD%iEC~FKG#`GgIBIIJ$K+LAM N#OmPQW RkS6TKUV+VXǀX֔YZv[ԋ\]m^t_O`_Va}lb?8c]Nde=0f7gghijklmnԀogpqPres0tEzuv.vcxyxEy[z'{=|D}~y&ESTN'T^x̷]ͧ@xΠzχ"xp@ #P"?0!   Ȉ   ^>xXm8O !kLjMj/Ly Y!Ո"B#i$"%I%')') )*z+ш,Җ-x.x/X0Z1]a2r<3=C4R5%626889:ˈ;<=>?@eABECcD%pECFRG#gGnIIIPJ+K2LHMN*OmP QWRkS6TKUV+VXΈX֛YZ}[Ԓ\]t^{_V`_]a}sb??c]Ud!e=7f>gg hijklmnۈogpqPĈres0tEuv.vjxxLybz.{D|K}&~y-CSTr f8@x!]xzx?x\x!x>xxyx Ywx!x"B#i$"u%I%')') )*k+x,҈x-xx.jx/Xx0Lx1]Sx2r.x3=5x4Rx5x61x6x88x9:x;<=>?@eAxBECcxD%aECwxFCG#YxG`xI;xIBxJxK$xL9MxNOmxPQWRkS6TKUV+VXxX֌YxZn[Ԅx\x]fx^mx_Hx`_Oxa}db?1xc]Fdxe=(f/g ghijklxmnxogpxqPxrexs0xtEsxuzxv.v\xxqx>xySz x{5|<}~yESTLHST . .. Continental EasterIsland[ $iԟq P@^{бw=@AгXp"4P9@gзP\ Pn`guP@IU2 +>O@ 1@@ Ѱ @ 0 @ 0@h0H0f(v0F&{t]V?8\@>@p @ Z0!o@"90#N@$0%8%0''١0()½*צ+,-.j/bc0@1BE2`i@3"'4@K@5 D06 -@6&08@809+:0; <0=>j0?@SʰAhB3CHDE1@EpG@GRHv@Io0JX@KQ0L:@M|30N@O\0Pz8Q;0RZS0T9UVVװWXĹY@Z[¿@\}]@^m0_@`M|0abe@b-^0cBG@d @0e+ce"0g Eg0h'i j klmun@oUưps@q5rS@st3@t0v@vމ0wr@xk0y܎zM0{p|~/0}R~gK|4SMTCDTCST@l`uz@sU\ U>yp7[p=p p ` p `ph`H`f(`F&yr[Tx`6Z`q<` Z5P!o`":P#O`$P%8%P''ٽP()*+,-./b0`1Ba2``3"C4@g`5 `P6 I`6BP8+`8$P9G:P;)jP?@SAhB3CHDE1`EG`GnH`IPJt`KmPLV`M|OPN8`O\1PPzTQ<PRZ6SPT:UVVWXY`Z[`\]`^mP_``MPab`b-zPcBc`d \Pe+e>Pg ag PhCiLagos?Kigali@Sao_Tome ADakarBFreetown C Mogadishu D Johannesburg[EKhartoum FMbabaneG Dar_es_Salaam[HLomeITunisJKampalaKKinshasa L Lumumbashi MLusakaNhHarare!`POGx,ppHp*` .zL5ppX ϒ4ЊrN$pKp\xC DxZhYvCpfB_|O_1  PMTWET DSTWETMETMET DSTxP 0LMTCAT tLMTWATCAT Ύn~Qp *0SATSASTLMTWAT SATh LMTCAT}lLMTCAT dfqp&` LMTCATCAST,TLMTCATH8LMTWAT (t*0LMTEAT ȓ{ˮ`)ͬϏfЩyф`ҊP6c`-P ``mﰳpy%ZYsp;Up6Ep9۾p%gYpIap+C Հ$Ep x < 1pdt(pU\np7OPHp{<pp4g p!a"z\p#D $b'p%%S&Up?z@pA\Bt C=рDUApEF6tG8HH⽀I-pJK`L$MpNXOpPhQLRJSapT+DUBV wW%8WYlpY0Z[c\p]^Xp_u`aVObmpc7dNef1wf;hphoijkplmpn[opbqyprCs[1t$u=vzwpwyyzQp{|p}~ ǹ*0 EET DSTEET D<LMTWATCAT $T*0AAMTEAT $T*0AAMTEAT慤LMTCAT*'6dL LMTBMTAATWAT0fLzP.-ͭ`ŮPǐrʴLSP̕5 LMTWATDTWAT \/p$LMTWATCAT ē gDdLMTCATWAT š֝/"*0#(&LMTEATBEAT FʸΎn~Qp *0LMTSATSAST _laMMTLSTWAT$ݻ#`xe/?pNB`p+*_`̯`z p` pJp!a~"Rp#D$4%%7`&@'j' \   LMTMET DSTMETEETFð  LMTSAT LMTWATAATT,LMTWAT t LMTWATAATQXpҡ25'%r@pkm aG ?pQ'po LMTWET DSTWETMETF LMTSATFḫ͞op *0 SWATSATSAST 挄p0LMTCATWATQP0LMTCATP0 LMTSAT,T?MTWAT ;LMTAATWAT2l8ӽt´UĖ$6wX!Y;ـD̽ |S̼p4#plqp٠RӀ4p FMTAASTAATWATWAST P֝GT*0#(&EATBEAT Fḫ͞opΎn~Qp *0SATSAST!z4P}[g`~=@` P B S $ P  P ?`sP`gh`J+H`+_P(` o`PKPm~ *0 LMTEET DSTEETFX( LMTSAT Ӭ֝f$*0&LMTEATBEATWATw`PO:X`"T˭iK̰ͩ΢5ϒ4ЉrN` pdtp":#<($,% &%p?vp@fpAUpBEpC5pD%pEpFpFGH޺IΫJKL~MoN~`OnQPg}pQWnpRG_pS7PpT'ApU2pV#pVpWpXpYpZp[\]^_o`_aOb?c/d|emfpfpg{phlpi]pjNpk?pl0pm!pnxpohppa.qQrAs1t uvvwxЧyz{p|p}p~ypiyp1    PMTMET DSTMET š֝GTd*0#(&LMTEATBEATCAT SATF LMTSATFd LMTSATO . ..P RarotongaQFijiRGambierS Marquesas TTahitiUGuamVJohnston WTarawaX Enderbury Y Kiritimati ZSaipan[Majuro\ Kwajalein ] Yap^Truk_Ponape`KosraeaNaurubNoumeacAuckland dChathameNiuefNorfolkgPalauh Port_Moresby[iPitcairn  Pago_PagojApiak GuadalcanallFakaofom Tongatapu nFunafuti oEfatepWakeqWallisHonolulurMidwayEasters Galapagosp<Samoaw(?y Yc y9E 蕘"awCY%;h G!ˠ"1#j $%J %'* ') )*p +,ӌ-y.n/Y0P19f2s23H4S4*626G8 8)9 : ; <= >a? @JAB*͘CdD ED{EꑘG$]GsI?IUJ!KrL> MsTN OS6P Q3Rl STL TV, VXĠXژYZ[Ո\{]j^[_L`Da~i b$c^K dae>- eCg g%h ij k#lmmnѠoLpq,ɘrfs tFwtv/ vժxv xyX zn{: |uP} ~U2 lXzhs` CISTTHDTTHT <DLMTNZSTPH|pLMTGBTPLH}8zhLMTMQTPUss`LMTTHTGSTs`HSTNZST V/0W@ePKJTSSTTGT U/} js`LITTHTKRT7p~PLTGST PNCSTNZSTP,tW@ NCSTKJTNZST7p~PLTGSTGSTNCST PNCSTNZST+˴HBPp|~ LMTNSTJSTNZSTtPVƜP7@  LMTNCDTNCSTQ`1p`o0#`8h`hmḩOh཮࿎nƒNcp.~L``,o`}h  ` ~^>xgXIf8+`!H`e`*`G` `)``g `` F`!`"0 #i$%.`&B' `'$(`)*ͧ`+#`,`-`.k`/j`0mM`1J`2Vi3*`46K5 `6-678Ӌ9:m;`s1?~`@\N`A^`B<0`C>`D`Ex`E`GG`HvI`JXKL:MNOdPp9`QDzRP`S$\T/`U>V`V[`W`X=`Yϣ`Z`[\`]^l`_x`UaXeb5c8Gde)egF`gՇh(`iij `k`l`m~h`n`o^J`piq>,`rIs`t)u*v v wrxyTz{q`|}S`~fr5` NZHDTNZSTNZDTTQ|̲T1^̴oT#̶8Է̸yԸL[Ժ̖L=ԼLTùLTLnTƒ}LNTc_L.mTL{OT,] T T T طT ~TT^T{T>Tx]TzTX?T\T8!Tx!=Z<g F!"/T#iT$T%-&8T' 'T()T*͜+,~-.`/j0mB1J2V_T3*46AT5 6#T6T7T8ӁT9T:cT;s'T?~@\CA^B<%C>DEmEGTGHlTIJNTKTL0TMTNTOdTPp.QDpTRPS$RTT/U4TVVPWX2YϘZ[T\]T^l_xyT`UTaX[Tb5Tc8=TdTeTeTg;g}Thi_Tjk{lm~]no^?piTq>!rITst)Tu Tv TvTwhTxTyJTzT{f|T}H~fTr*TL\ LCHHDTCHSTCHDTC5`t8`^HePNITSST ANMTNRFT~PLTESTxPITb8_^HePLMTSST O3LMTNCSTs`THTpTMTTGTNZST ´LMTNCSTNZSTNZST U+00ePePePNSTBSTSST LPLMTESTCSTt . ..u GMTvGMT-14wGMT-13xGMT-12yGMT-11zGMT-10{GMT-9|GMT-8}GMT-7~GMT-6GMT-5GMT-4GMT-3GMT-2GMT-1GMT+1GMT+2GMT+3GMT+4GMT+5GMT+6GMT+7GMT+8GMT+9GMT+10GMT+11GMT+12u UTCu UCTu UniversaluZuluu GreenwichuGMT-0uGMT+0uGMT0GMTGMT-14GMT-13GMT-12GMT-11GMT-10~GMT-9pGMT-8bpGMT-7T`GMT-6FPGMT-58@GMT-4*0GMT-3 GMT-2GMT-1GMT+1GMT+2GMT+3GMT+4GMT+5GMT+6GMT+7GMT+8pGMT+9s`GMT+10ePGMT+11W@GMT+12# $NetBSD: dot.profile,v 1.1 1995/12/18 22:54:43 pk Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=sun export TERM umask 022 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES # set up some sane defaults echo 'erase ^H, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^H 9600 # run update, so that installed software is written as it goes. update # get the terminal type _forceloop="" while [ "X${_forceloop}" = X"" ]; do eval `tset -s -m ":?$TERM"` if [ "X${TERM}" != X"unknown" ]; then _forceloop="done" fi done # Installing or upgrading? _forceloop="" while [ "X${_forceloop}" = X"" ]; do echo -n '(I)nstall or (U)pgrade? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; *) _forceloop="" ;; esac done fi ?@P  H  H  }H  yHoHH  mH  aH  _H  aH  ]H  YH  UH  QH  MH  IH   ɡH "H H   H H   H H  H H H  H  H  H  H @H  H ! H " H # H $ H % H & H ' H ( H ) H * H + ݡH , ١H - աH . ѡH / ͡H 0 ɡH 1 šH 2 H 3 H 4 H 5 H 6 H 7 H 8 H 9 H : H ; H < H = H > H ? H @ H A H B H C }H D yH E uH F qH G mH H iH I eH J aH K ]H L YH M UH N QH O MH P IH Q EH R AH S =H T 9H U 5H V 1H W -H X )H Y %H Z !H [ H \ H ] H ^ H _ H ` H a H b H c H d H e H f H g H h H i H j H k ݡH l ١H m աH n ѡH o ͡H p ɡH q šH r H s H t H u H v H w H x H y H z H { H | H } H ~ H  H ҡH  H  H  }H  yH  uH  qH  mH H H  aH  ]H  YH  UH  QH  MH  IH  EH  AH  =H  9H  5H  1H  -H  )H  %H  !H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  ݡH  ١H  աH  ѡH  ͡H  ɡH  šH  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  }H  yH  uH  qH  mH  iH  eH  aH  ]H  YH  UH  QH  MH  IH  EH  AH  =H  9H  5H  1H  -H  )H  %H  !H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  ݡH  ١H  աH  ѡH  ͡H  ɡH  šH  H  H  H  H  H  H  H  H  H  H  H  H  H  H P áH  H  }H  yH oH H  mH  aH H  aH  ]H  YH  UH  QH  MH  IH   ɡH  "H  H   H  H   H  H  H  H  H  H  H  H  H  qH  H ! H " H #H $H %H &H 'H (H )H *H +ݡH ,١H -աH .ѡH /͡H 0ɡH 1šH 2H 3H 4H 5H 6H 7H 8H 9H :H ;H <H =H >H ?H @H AH BH C}H DyH EuH FqH GmH HiH IeH JaH K]H LYH MUH NQH OMH PIH QEH RAH S=H T9H U5H V1H W-H X)H Y%H Z!H [H \H ]H ^H _ H ` H aH bH cH dH eH fH gH hH iH jH kݡH l١H mաH nѡH o͡H pɡH qšH rH sH tH uH vH wH xH yH zH {H |H }H ~H HҡH H H }H yH uH qH mHHH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H H H H }H yH uH qH mH iH eH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H P H H }H yHoHH mH aH H aH ]H YH UH QH MH IH H H H H  H H H H H H H H H H H  H !H "H #H $H %H &H 'H (H )H *H +lH ,١H -աH .ѡH /͡H 0ɡH 1šH 2H 3H 4H 5H 6H 7H 8H 9H :H ;H <H =H >H ?H @H AH BH C}H DyH EuH FqH GmH HiH IeH JaH K]H LYH MUH NQH OMH PIH QEH RAH S=H T9H U5H V1H W-H X)H Y%H Z!H [H \H ]H ^H _ H ` H aH bH cH dH eH fH gH hH iH jH kݡH l١H mաH nѡH o͡H pɡH qšH rH sH tH uH vH wH xH yH zH {H |H }H ~H HҡH H H }H yH uH qH mHHH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H H H H }H yH uH qH mH iH eH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H >;;;;; ;(;0;8H )@`  >! !C >>䀡+0;"+4+ >c䀡`΁` 0΁1% !>&;8>>䀡)@09`")@)@ >䀡΁` 0΁1"; > 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/>P-> %)> X %"+/>->+cP>!l`"!l#t@>";x ;"`;" @ʐ@jҊ@@2 @ 0P -@ @ @"P/>P-> %)> X %"+/>->+cP>!l`"!l#t@;x҂@ ;Ԃ@`;"s  ւ@ ؂@ " +> `* -` @t x ``-` @s tx ꁌ P -@ @ @"P/>P-> %)> X %"+/>->+cP>!l`"!l#t@$;xԂ#҂;>쀢;%ւ&؃ ;`#h#l;;;;@럚``htx ;`#h#l;;;;@L``htx )>%!@)>%" P -@ @ @"P/>P-> %)> X %"+/>->+cP ;`@;h#t;x;;;;;`@;`htx; />o->+cPۜP -@ @ @"P/>P-> %)> X %"+/>->+cP ;`@;h#t;x;;;`;;@V;`htx -> -@-P -@ @ @"/>o/>/>o6PP-> %)> X %"/>o/>/>oP;x>!d`"!d@;,/,;@ ;`,)> ;h %)>è T #p "`@ x  +?P`-@-?P- %0P -@ @ @"/>o/>/>o6PP-> %)> X %"/>o/>/>oP;x>!d`"!d@;,/,;@ ;`,)> ;h %)>è T #p "`@ @`xF P -@ @ @"/>o/>/>o6PP-> %)> X %"/>o/>/>oP>!d`"!d> * * ;`@;h09P -@ @ @"/>o/>/>o6PP-> %)> X %"/>o/>/>oP>!d`"!d> * * ;`@҂@ Ԃ@;h ւ@ ؂@@]`h > `* ρ P -@ @ @"/>o/>/>o6PP-> %)> X %"/>o/>/>oP>!d`"!d?p " ?P "  ;`@$Ԃ#҂;h>쀢%ւ&؃@!`h ?p "  @/> @̀-> $)> X %->+cP->x iP @ H ,@`#>c$` (08 @̀K)> />䀥+0;"+<++>c䀥` `  05-) % >&w 8 >/>䀥-@0=`"-@-@+>c䀥` `  05-"T  ->%- +cP ;`@;h #t;x;`;;;;@;`htx ->& 0ʦ! H,@` !`hpx (08@HPX @̀H,@`%> $ (08 @̀@ @̀  H ,@`#>c$` (08@̀26?@ @̀K'>/>䀥/0?"/c䀥` `  05-)$>&' 8>/>䀥-@0=`"-@-@+>c䀥` `  05-" ?  H,@`#>c $` (08@̀ ->x  @kP->"/>4  ! H,@` ! (08@HPX @̀>X `?* `"" * `@">w  * `@&* *  ֊@* "``(  c   c  mt@ >   >  @@   >  @@ #>%>@ '`@`@ !>#=%=@4 ,A '`@`@ !>#=%=@4 ,0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>!ct@>"#>"  *>" !`>" H(  /  >w ==>0H >" >ʐ!x>c@@07"@!>$#H``>"bl  !>" \!>#"$ $ @@=d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P   > *>$ >"@t"copyinstr>@ * > >"@t"copyoutstr#>"c`#  J@*@`  ?"@ 2"#   J*@`4  ?"@ 2"> * > >@ *> ># @" >" >"   >4``6  >oc >  !!`>w @>"x`""x>!X`"!X > >>!` 2$j0>#@t$!>#@t!!>#@t!+switch rqswitch wchanswitch SRUN> >: H>" (o!`j> h>: h >%X"2J "2 J    "2 J  J " >b+  @ #@"   *@ * hH- >"#$ `!"B"j >"̒`""̝j ` *@  ( !>!` (08 2㿠@V>c䀢` Ъ@@"Т@" H"  h`>   >>$ " " " ?" ?> >>$" " > >>$ " " > >>$ " " > ؀ >>$ " "" > >>$" 2" > >>$ " 2" > >>$ " *" >>$` " `2 `2`2" >>$` " `2*`22`2"" @>$`" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x >c䀢`"!0>c䀢`"0 H > *H > +*?p` "@?p`"@@* ?P` <@ "@>%X "2 J "2 J   "2 J  J a>` """"""""""""""""@2?# * 2  `c  @ `>? ># "hh @ 3 >!4 c@  Њb@&""""  >a@@ @: " longjmp botch@" `&"`㿠>&@pː"6 0leam7990_config: weird memory size: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook㿘@  <ܔ & (>*!|& >+ `& >*!& ? "6 X (@)3@.i P @&D !@" @" >& @ @@" >&&!  &!&!   &!&!  &!&!  &!@pV" !>&@."@q9>&! "!@q3 >+!@aA & >&@p?"&!$ ! &!(! *  !&!,* &!0*` * &!4㿘H o*@g@H 0h X! 77 ɢ ȑ* @7 ː ( ʕ*@ 7 ͒ ̗* @7&!&! !&!!(&!@7! 2?* 7!!,@7!2?* 7!$ ؟ !  6! Ж !0, ! 7Е2/Ӕ /Ҕ:77!(  ؟ ! f!  Ȗ !4, ! 7ȕ2//ʔ077!,  ؟ !f㿘   %s: card failed to initialize 㿘    d   i!!$   , 2  4  d   a" € !?2  € !  !B6 V X (`@ {@K6 X >'#0@p1  `@%s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled 㿈 € `Ͱ  @@ * 2 @@ x & x@h p & p>(!P@o 0`  `>(!h@o  p`" p d>(!@o  x`" x  %>!!5> !(-   ܟ  @   >( @o  >( @oz  p  >( @oq  p!0퀢%ۑ- *    >c@O  4 H /* ' 5H 0 $$  $  4  @8   ( @U  $ $  b'  x$ 쀢 & >c@NΔ  4 H /* ' 5H 0 $$  $ 4  @ג ˢ l쀢 :9H /* '쀢   @_ 쀢$ >!x" > 2`  *  ?%  &H 0  "  $ ($ $ $  4   2($  @ $%쀤 2 l p %& p P & l`  @" X! @  @(”  @  @J  (@* /:77 ؟ !  " &!b"g ! [! !,,  ܟ@ ꀊ 2P&! X ;6 Xꀊ @0 @>( @>(!@nQ 0@h>(!@nG @ | & | >(!( @n7  | & | x & x   | " t | & | t & t! " ! ? &! &!@) (! "6 V %s: device timeout 㿘 >*a@m  P`& Pmissing buffer, no_td = %d, last_td = %d 㿐 0 $@ @>!7> ,-` ܟ "   0$6 0 >*@mϐ!P "$  & & $  ?& "$ ( @!ϒ />>#-`4*  `  `  H /* 'T`*`@?2@H 0 ` "%T`H /* '`x"@> 2` ?* *   `"@`% %H 0 T`* @@N)2` ;   <" < 6 . / 077؟   H`@"    Y$  0$6 0$㿘 H /* ' !@# @ ! @" 0<  !1@% !2@" 1  6 0   (@\)0# 0@  2 0t 0 ?6 00 !1@@* (@* (`4А H 0㿘P㿘 0!2<"6`6`6`6@   *;n #  @&  &?    @23 <2@2*  @ * @6@   ܐ 0 = 6 0 0"6 0?6`6`6`6@㿐!'@㿐!'ڐ㿐!'@&i㿘#>c\   @L  >c\*@&R"  "   "  "   "   "   "}  "y  $ "u  ( "q  , "m  0 "i  4 "e  8 "a  < "]  @ "Y  D "U  H "Q  L "M  P "I  \ "E  ` "A  d "=  h "9  l "5  p "1  x "-  ")  "%  2&  &3>`  @K & 0`  @K  & X & & c\ `$c\$  0@L  㿘>  *`@ "   2 $  0@Lx  X@Lu @Lr   * "㿘    0   @@g㿘    0   @@^㿘  0 @ 㿘  0 @9 㿘 ```` 0   @@㿘  0 @h 㿘& & > @"& $@(  & @ & & &㿘 > @" (  P4 : & & audio㿘 4 >А *`@  `2 `   € `` ` ,` ` ,` @(€ @ € @! €#@@€#@@0€  $`$`@!>$"$`@d,@@&`"@"-:`@$`@@& $`>!$`L@@H /* %$`$`|$` $`$,`x,`y @N     @" `` ` ,` 4`l 4`D@0  ,` 4`D 4`l@אH 0 㿘H /* %   .  t    H 0㿘H /* %&  &   . `t  H 0aud dr㿘 ` $  $>.!>!0*`" * >-! & $@^! & $ ` >. 㿘 >А . &  H /* % y   ` $  l 2 Ð 2   `" @ @``  .   . H 0 aud hraud rd㿘 >А . ```( ` 6`, `(> " `@ " $` 2 ` "}%>.H /* %`  7` >-! $`  ! @^ 1$` ` H 0@ߔnH /* %` ?$`H 0`Y0H 0P #H 00HG #H /* % `x  @>."` >-! $`  ! @]– $` H 0 " ׀ X @`@XI :$?$`6㿘H /* %  x?@" & @ `d@ `h@. x. y& @& 8& h& `&  0&  X& ,& (& T& PH 0㿘 `@>@%a@%#谒" `4@@%`,@&`@%:`%> 2`@:` 4 `8€  4 㿘 `P@ .@`㿐  `P@ '`2 .  2 &?&    "0   $$ &`B >㿘!>!0  @H  @Gٔ $!0`P@  @!0*`@`T > 0aud wr㿘 >А . `P  "``  :`&` B>` #`  @>0 ؀$>-! $$ ! @\ m$$@쀎H /* % > "@ ? @@ $|H 0`@W@%/ @@W"@ 4`T H /* %   ?$ @:$ $ y @H 0` 4㿘  >А . a@ N @ 0!@" 0" "}@50!@" !@u!@z 0!@"`  !@I!@"A H !@"q "!@"6 pu !@So  "k&   "g& f 7H /* %   y 2 @ `#` `@0C&A&H /* % | h  , ("> "@ ? @ &H 0&@@ @6̐2``"@`x `&`|€㿘 >А . H /* %` `" 0 "8   `@ H 0   @nxH 0 㿘  >2`` ,@  0. x㿘 ` >2 P \ @    . y \ : X& P㿘 `@" `㿘 `  P "  l  P t & t>2\@  \: X h & P  & h`&  p & p>>2a0$\@ " +  &  " 2 @4 $  $@\& $@m   "@R;    @[& @m   @R( 㿘 , D  (   L 2& L 4 : 0 8 <  & 8>2 `@ " @Ӑ @  & @ H. x & H$`  @[& @m   @Q 㿀  `8 @?"@€  2@@! & ?`2 €  2Ͱ@@!ʒ &  ?`2}  €  2 &  ?`2k  €  2 &  ?"`2Y (€  2{>""& ,@&` @:`& ?"`25(€  2oW>""& ͐,@&` @:`&  ?"`2 0€  2K3>""& ,@&` @r:`& א?"`20€  2'>""& ,@&` @N:`&  ?`2ɐ <€  2?`2D€  2 ?"@@' ' ' /€ 2ް?" 0H@' ' '/€ 2ɰ 0 " 06 l 0 2 0H /*%H 0 0 "`t6 D 0 2`tH /*%ƐH 0`t?1`2`tO`t` > ">  2  : 88€>`  4 & &`t ؐ,@&`@:`& `x" `| d@8&`x "`|`x& `|" ` d@8&`|`|& `" ` d2  : 8&``& `?`2``   .   .  "LL@ `" H /* %  I 0H 0 㿀 `8 j  @&@ @&`8 4@&`<&` ,@&`@&` $@&`  $@&`D H@&`L @@&``L '' ' €  &`H`' ' €  $` l,`0 D,0 p@ ,`1 H@ ,1 2  ,`6  ,6 h t" $`( @ L" $( |$` $ &`t &`x &`| &`  &` 4 >Є(2 @?  㿘 >А . 0a@  @  00!@" !@  !@  x  €0  €  L@WARNING: no memory for concatenated disks 㿘 0. *  @B| !>$#`. *  @Bs #>#``$` 2>>5@b!#` "`@C{ `  @Cu 0"! @`@ccd%d'T >5b >ϑ* `* $  $ $@d;0  * @B0* $@ y 'L;>   $@h"T$ ̖` `@B $` `Lc'x'|''c' * @@x>$`  h`4'X'\'`'d 'h'l`4'p * @@Xp 2 `  (@8  @B @B  O` @$ Y`:$`$`  `@ $ `  &!: @&`   % "`  " ` @B @B N  "3*` * @@:$``* @*` @*$` 2  : ` @B @B 0%` @B @B  @$ @"' ' @$*` ' @  '  $$ $㿘    * @A>& @  2"          @A* $$$?$?"  `  @ d$       @A* $  *` *   @(   "  @:    *  "=$ @ܐ$$   *` *     @* ,``# *` *  *  *  : "    *` * @* $ @$ @p㿘 >!:`@B >ϓ,`@#`*` @ 7  ,`$  * L `@`  "  @4 ,`  " H" D H$ H$ D H D $ L@㿘  >!:`@>) ,`@#`*` @ ",`&    H  H**@$ H D**@$ D H D@ @" L 㿘 ;   : >ϓ*@ #`*` `2 0  $& ((& $0! *# ` @L  0& 4H /*%@ H 00@O㿀@] 8`;`H` ` !"@`*` @``0`<`<-)>!@4`$`0`P`4 "`4'' P!`* @@   $2<  P`4 "`4'' P!`* @@< $@`˦㿘     `   `` : P& @"@s @` `4`@ 2`@`&` `'@  4< @` *` @K`@,  * @@` *` @8`@ @, * @ | @?: $ x`$ @$ $>9!$ L` $ `$ 8$ H$ <@$ P  2"`"* $ 0 04$ 0>#`$ l& *` *  *  *  : $ p $@ *` *  *  *  : $ t'@  " $@ | @> @렔 | $ x`$ 8@$ P %@ *` *  *  *  : $ t'`㿘`$("`0`0&`4`0`4 8@\" @' (mirror)%s: error %d on component %d%s ccdiodone: count㿘 p>c` l,* @H /* % $(  x >9  `$($`$ ( " $`(>9 >9`(0 t@^  0 x@?  `4" $`4>9@]  >ϑ,`* H 0㿘 >!:`>ϑ* c`* @`  >7#(>{ @@C @ 㿘 >!:`>ϑ* c`* @`  >7#(>{  @@% @ 㿀   >!:`@y >ϕ-``*@c  "@"  m@"bE e@"k   h@"d  E g@" E f@"W 0"@R  N K @PF '' ' @=֑*   @=Б**G!  @X 7 -   @ &+ ``@ ''N'   -   @Р & >ϑ-``* @ΐ@> @> @0ߐ >Г-`@*`$ % 8%0@Z$@@p@ʰ Ű @ʐ-`$ L*@  D " H "@ѐ  @6   @}` @>N @ @   @ @>A  @ @@>8 @>5 #>С-` ?$`,  @>) ` @>$ ` 鹒@@Z8Ho o@@D H 0W F雔!O L &-`$*  @A& 1= @B8  @ӭ$2 E g@2 5 *  a >7@ْc( @9"  " 0` 2  `$ $ 㿘>  2&? `>ϒ:`*` * `*` " ?*`  ? >   ? 'Ԑ @''''ܐ @W ZT  >c8'Hc8'L * @@H` @ԈE `>c'0'4P'8'<c'@ * @@0>c8'0c8'4 * @@0` @d0!P c8>c8'0c8'4 * @@0& '0c8'4 * @@0` @D ccdfictitious㿘 : >ϑ- c`* @!@3@0" $ < $ ($$ ,( ,$ 0, 0@/$ 4$ 8 >;c@  4  >;c@ .4 H 4 J$ X$  $ ,  4  !W$$ @XN4 6  * -  @>7@;c( @default label㿘   *  ><@{a@ccdlck㿘  1>< @$ !!@P "    @   $ 㿘  `@&  ?& @QߐMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUT㿘 D @  *@$B D P @ @"= D @>! ` Ő  P ? 2+ D P 2  2$ D @*@ D`* P >! ` , `餐  P ? ` D *2 D4 P D `*&㿘 D A  P @ @"=& @>! ` y  P ? 2+& P 2  2$& @ . D`* P >! ` , `X  P ? ` D *2&4 P&㿘!" ? 6"  ` ""? 6""`  . , &#&  L *@ D* H* P* \  P *@ `@㿘! D * D* H* L *@ \ a"㿘    `@@  @u  @㿘 `" @   & # 2   D   ``*# &#@O `@ncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d 㿘H /* %  >=@Zp"0     >=#@Zg   &  2`  `*`@*  "" @'H 0ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finish㿘 >`` ` 2`d>>@Y  H /* %`  ` >>`` @@Y >  >>@Y h ` *` -  $   "` "`"`  "`$"`4` "`?"`   $  `2$" `@`   >>@X͐ H 0ncr5380_done: sense asked for sense %s: target %d, bad status=%d 㿘 ` @ l@ ,  $,, 20& ` " `!  $ >>   $,`  >>@Yp"x$,$`& & ``*`@*  !"">>`"`@Y]  $,& >=#4``** @%["$@ ?&  `@r" & %s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... 㿘  ` @"* `  " "* ` "``- ,@b 2&"ଠ    `@0& @ `   o>? 0@X 4 - @, ""&  &  `&  &# &#&#&#```"  $,2 $,>? X@XȒ ސ$,(& &  &#&#&#&#   # & `2&#0"" # (&# "  h"    @& € "   p`" @   >@a0@#>=#4@$W@2 "["%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d 㿐 P > @!آ`>?N  P ˀ @2E  @  >?#x    *2 $*  >?#@W 0# @W D D *@ P >  !آ`>?  P  D* P* \  P >! `   P ? >?#@WȒ U  P 2  >@   L * @ />@ @W > ,@* "0>@ &  &  & @&  &#&#&#&# H  H $*@   p`" @   0,#P @W{0$ @ @Wt  D`&  *嗐    &#&#@ L *@ P* \  P *@ ?& 㿘   L* D* H*H /* ' @ *@ H *@ D  @  $ DX  D @?Q  D @ 2  D *@H  D " H D* H*H 0ܐQ * P*H 0 ` *  @*@ D *@   D *@! P @#? $ `  P D *@ P @2 D L *@ D* H* P* \   P *@0 D `*   H H $*@ %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT 㿘  L *@ D# ` #Ԑ<4" ?&  #&# P @ @"  @>! ` 䧐  P ? 2 P 2   2 T " # 2   D   ``*#  &#`&  2= D`$## 2   D   ``*m#  &#`&& ` @&# @` *#̀  (7#̀ 84#̀`#̐ +`$  D#̀ 2 D#͐ @"!# D* P >! ` 5  P ? 2  D*"t P#̀` <>B!t*`@  (    H H   NL#  # D   ``*#<# ") 8 D %  2%  &  -& #΀  >A"P>A"@U # 2  D   ``*# # ` &  D   ``*# &# D* P >! ` 㶐  P ? 2  D* %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP 㿘  L *@ D @  *@#   #Ȑ#@|@"## &#&###  &##*#&#@ # O&#>C *@  h |      t                        `2 >B#P``  `         >B#@T  .# >B#cN&# @ @"R @>! `   P ? 2@  P 2   29 2 ## 2 #Ȥ  D *@# @&# * D* P >! ` Ɛ  P ? 2  D*2 `4 P# N   D *"㿐  L *@  /    + / ////    @` $ , # ` &  D   ``*s# &# %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: can not transfer more data 㿘  `>D) (  4 L +@ 0U  >D `>a*  @@T H 2   @>D h 4 >D @S $ "  L & L t@) `*   `   d   @ $ " $ # ` $  D   ``*#  $#ncr5380_status: none? 㿐   L* F  >D& @S"X ncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... 㿘   u P @ @>D@SA" $,`` @>` !Р?   L>D#5 V d P ? P 2   $>E ̓, @@@ 0/+X'#a>D#@@R # ` &  D   ``*# &#>D"@R `&#`") T   x@ "   &  @ \ `" T#    D   ``*# &# T >D#h@R #    D   ``*# &#`V`  `  & >D@R#``  `>D# @R &  $(`0>! P @? >D  P#@Rg } D* H* L *@ P* \ ` P *@2& & & & &  &#&#&#&#WARNING: no memory for vnode disks 㿘 . "*  @1 >F@R0 0@ ">" >"!㿘  >!:`@>' ,`"@ *` @/ ",`& *@"     $  $   @ @-"  㿘  >!:`@>) ,`"@ *` @ ",`&      **@$  **@$   @ @"  h ;:`>*`" * `  & ( $h" $@ 0 H: & 4 ( <  $& ((& $@0"($ h" $ 4%@"@ @& 40-    $``$ @>c 'c '* @'@@ >d'''''d'* @@Ȧ>c8'c8'* @@耢?" @ %@= @& p @0ޔ "$"0 ,","(`8? 8?`< "8"<<`  "H " >G!"L"P "\ "` T"T X"X d"d h"h~"lH"4H /* % @L D@`$D@H 0@v㿐 ,  @NC& , $@> P`4 "`4'' P`* @@㿘 l ;>:`*`" * @H /* % (    $h$ $@$ ( 4 0 " @1m$ 4 0 4`@N("  4 2`,@`, "`D0?$`DH 0㿘 >!:`>*" `* @  >F"H>{ @2 @ 㿘 >!:`>*" `* @  >F"H>{  @1 @ vnd%dؠ    @6:>!6  "@>- "`* u0"@2   @G @'t'x'TP  'P@'|>> `?8'@'D'H`* @@8>c8`'8c8'<* @@8`c8`'8c8'<* @@8`$`*2 @ 2 $` @Z `  @ʖ@0L`@``*` & @ $>Gc@Qw$`@LȐ`@4  0 @ِ+- $ `*@  `  ` @ @@L`Ho o@Ґ@  H 0 P@5& " T@/0 ' "* @8'Ԑ'ؐ 'ܘ  ?'''> c 'c '* @@ > c''''c'* @@> 8''8*` @@0  T`>℀  "   " 㿘>>*`" *    a@a * "@*` *vndioctl: null vp㿘  ?&>` >I@N А  @ @4 & & &  >8>퀠(  (2 ? vndlck㿘 1>I @$!!@C "   @  $㿘 `@& ?&@Dِ   |  D ("  @8  "8 "" 8   ` '@'`'?#@  8 |'  P >`cX'' @''cX'* @@ఒ>@y 4 @  ?4#>c8'c8' * @@@ -`*  %>c 'c ' * @@@ `  2>  >c8'c8' * @@ >@ @4`>  >c8'c8' * @@>c 'c ' * @@ఒ|#@`!<' `M =`?'` ?'`   ("$ , @$ , '̢ $ , :>@''?'@'* @@ఒ>a@` '̐ "` @ ,`'Ā ܀ " ,@C ,>@: ''?'@'* @@ఒ\ <   , * | ` @ z` 7ږ!s`!< H  2` ``?@^ M .ڀ L!` ڀ`ڐ@P$ 0 rL! o`9 ,@Δ! `  @9 H* $ ,2. ,! ,  @'H* $ 0ږ 0@Q`2  @1 V̪  ,@$ , ,ZĀ`+ , E$ 0 :@>@܀ @>>@''?'@'* @@ఒ <  $ ,`ܚ ' ($ , "`@k`@@@`` ?̀` >a@` "`  ` ,$ (9>c8'c8'* @@ 0@ @ \@ @/܀  >c 'c '* @@0N`> ;>c 'c '* @@ఒ0@08  0  @ 4"#@@@ @ #@܀  `> 2 >c8'c8'* @@#@`@@@  㿐  |  @y`  ?`@S@ "   ``< @# "@㿘>!H>ϒ 9@;>"a㿘6` >! @ >!*` 2  @2 2   & @Ay >  @ >ρcd9660_ihashins: already locked㿘 > >a2  * `"`&& "  ">>L@J" "? 0& 4  &     cd9660_inactive: pushing active㿘 >"   |V  >L"@$ V   ` @ cd9660_reclaim: pushing active㿘 >"   |V  >L#h@ْ@ " |@$  |@, :& | x'    6``  6`l`@   >``.  :@''?'@' * @@􀦠< < 26  @ `` 6``  2 `` 6``  2 `` 6``  2 `` 6`` @2 `` @6`` 2 ``!6``  * @&`d  * @&`h &`d``&`h!m6`` @x'􀦠! `@  ``*  :>@''?'@' * @@􀦠& < 2   =`H@  @ @`X  `H`L&`X&`\ @~`P  `X`\&`P&`T  @`X`X`\`X&`H&`L`\&`P&`T @ 㿘     l' &@&`@ `  ĕ* *" *@" *` , d:@&  * @, ,`* * " < @ݠ&?, * * "@*`@*`" * 0 d,"* * "@&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ / /   (*  (` (  @(2`   (*  @("d   (*  @("h (@2 l` "`RRIP without PX field? 㿘>N@I"@@e ..RRIP with incorrect flags?㿘`$`0  `( h>N#,`  `,@>N` /, >N" @ * <<;<;<<<;<<<<<<<;<<<<<<<<<<<<<<<;  $ `$   h@ >"H> "   >N@IE"`, `,@@՘   `(&`$2&`0   0 &`0`(&``$ " `(&`$2@`  ?&`RRIP with incorrect NM flags? 㿘>N"N ` 7 >O!$*`@=================================  >"H> "   ?>O@HҐ `, `(@2*``,2`@ ``( ?&`@`$""@`(&`$2`$`$&`$ `  ?&`㿘`$>N "*" * *N !    !  `$ `(@ `0`( `( 2@   (*  `(` ( `"`JC  `( x0"`㿘  *  2 " @@ `P  @K P  @ ڒ`H @ P T" H" L  /@̒`X0` 2  " @@ `P  @# P  @ `H @ P T" H" L  @`X`@ P T" X" \` ?&` 㿘@4    (*`  ( (@( @(@2 ( * ` p "㿘 `? @`@&`!a   (*  ("` * +   *  ::`   (*  ("`$IEEE_1282IEEE_P1282RRIP_1991A㿘  2,    2&     >Pb@ 2   2` >Pb@  >Pb@  `" =&`㿐' `!`L! 2`   `*` *  !4*` "!D`!@  ?# ,&`  "`LJ2L J@ ` " € (` @: ` ,`) ``! :`8 B   ?+ @' `<`   @  2 €  2 `''ܐ 'Đ>\`'' 7''ܐ x'6> !` "XIJ` ?'Đ@`''6$7 ''ܐ 'Đ>.ذ SP`&aD ">Qb@    &aD 1@  2?'ܐ"'Đ> ("?  G,R J`;( H ;D ?  Є 7+  (В  / ( ('# `  ` ##  $ ." ; ?# `$  =* `    * 2*. ; 2*;*`@ & 2cd9660cd9660_mountroot: can't setup bdevvp's/root_device >>"P>@ b  >R> !>@! >R@Dِ!!  @%i @! >#h$ $$'!@ @  @@&e 0/>@$`$@ 2`"@">""D$ >R!h Y Z`h@z$ >R!Ȓ” Y`@o$ @͔@ɐ     pa`@[ @   @QO&$ @&(&&@)&,C8 "<@v:  >#@&@l0 @@2  @,  @X h Y{ Z`h@ $ ” Yp`@$  @<CD001x < `'ܮ `   @*@  >!   @   >c'''?'c' * @@ఒ޺ (   @?@ܰ>Sܒa  < @  2   ܢ@@Tc 2  * @~"@@2 !H 9@$> @!H$  Q P " R+  +` S +  $ * @* @ * @$4 *` *  *` $8$ $   $* & $`" $@'&a&`<>R@6!&`@&`` &`$$$  <` "`l 2$l  `?4@@k+@ % < $@l l ?&l $`" $@'l ``$` $< $<#  ܀ `@`  >c,'''?'c,' * @@@$ 9&a 㿀 6`@L #a  <` ?"`> c,'' '?'c,'* @@@ @$ 9$a`*@$`㿘!!Ò!< @`? -㿘!6@ &`&` &` &`&`&` @ &` h`L Z ’` Z `<@@ &`,  㿐!@` 2   ` &`| `  &0'4'@@ & F㿘 @- fhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] p!3 &-  >@: t"& :@" @ t"`|$$I$ 2D'6@ &@&>T# @`! $  @>T#@B F0/ ?@! @ @>U @Bߒ0 < @ @ ">U@w>U 8 @Bɒ а F$ $ ` "2`6@`$D@_ >@'؄  ?''@'`* @@ذ@0 <   *` *  *` $<   *` *  *` $@ < $D# 8< / "' "'*  :>@''?'@' * @@Ԁ " @ "`@`< @>!2` @`;"8>V T*`@Y Y Y XXY Y XxY >ad'" >cX" p@"<>c8'c8'* @@ |$ |>b" |@?" @x'$B<4@@ "@ & | 2@"`D "`  㿘    |`d@h`   |`$ `$ ``4 `l4 `d$ `h$ `H$ $`L$ (`P$ ,`T$ 0`X$ 4`\$ 8`p$ D`@: < `@ 21$ @ < ( 2*$ @$ T@!W '$'' 'Ę  ?'' ''А' ' @1' Д$  :< @"M T$ @ $ <` $ `@: < H 8$ 㿀   *`| 6 @ 0 %@    "   @: @b   f `<a < > > '(  @* ( :`#\  @?!`   @*   '?#\@w#`?@?%` 4$@ 8  <@0M@  2You did ioctl for isofs !! 㿘>W@@ސ!    㿘`@* `  ? 6`#0`@& &#@#D`"`#H `&#@?&#D"@#H?&#H`#0@0  2>#8 㿘"" N" =`?  " !!? 2!@ ""!  # ! 2#.!   # ". "   ? 6""#(!"># "#(b:c ..p'`|#P` T @ ,!, ,",!, $#0 $#@$#D$#H @ <#(>@''?'@'`* @@ذƒ T `@"#(  2 < >@>#(`@''?'`@'`* @@ذ  < 8  #(:  Be<#( Đ  4j  ` ," !&d  ` $" H* $"#( B<#(!< >W"֖ ," 1#(+#4"# ,"L`!   `! ,","!<" " `  `? `,"!< #(" #(=e #,_  !<  ,"ϐ&  "#8@#8>#@ T"@ +㿐  |`!<  T  ` ? 3 + @ )`   < @ @     $ @     @ @ΰ 0@   " & @ "@` "  "`@.c@͒ 㿈 > b''b'* @@@  㿈 > b''b'* @@@   㿘  $@  㿘 &@4p !" x 2 |  ` "  "` "` 㿘  | `" "@4ǐ  cd9660_strategy: spec㿀` P8? |>Y@=" H D2# H>cd'''' H'cd'* @@ఒ"  H$ ( $h" $@l?2 H <@j 0$ 4 H? < $ 8>!* @@ @f tag VT_ISOFS, isofs vnode 㿘>Y@>R#  | `+>Z4(hhhhThhhh`|<`   %   ` $  ` "  `     -㿘` `, @?2@ "!""!0"! @ @ @@~n @`㿘`&`( `(&`,  &`0   &`4 &`D  2`   " ` ` R  "` e @ "@``@*`@``` &`* @*`>_!"   "`("` " ` ` 2`" "``@*`@{````&`*` * " "`0"` " ` ` 2`  ""``@*`@[`` &`* *>_`"x"@  @ "``0  "`"` "`"`@㿘`&`(`(&`,@#@2` *` &`0 ` `&`4 &`D@&``` &`* @*`>_!"  "`("` " ` ` 2` " "``@*`@````&`*` * ""`0"` " ` ` 2`  "> "`0@?@c@`4@ $@```@*`@ѐ`` &`* *>_`bx"  " " " " " @t㿘`&`(`(&`, &`0 ` `&`4 &`D@``` &`* @*`>_!"   "`("` " ` ` 2` " "`0>` @?@@`4@ $@`$``@*`@p`` &`* *>_`bx"  " " " " " > `4@٠ @u, &`4@㿘=&`8>&`< `` 0 &`@@>`` &`* *>_`"x"@ `<`@@ `8" " "``8"`"` "`"```@ `@!```&`*` `* "@`@@"``<`@" "`"` "` "` X@9"/  X * ' ' ' 'Đ '  '> ''Ԑ ' 'ܒ '' ' T''@'ơ @  `@ELF㿘>\ah@  2    "  `  㿘?"`  &  @ " &   @&"@@2   '@`'@  `'@ ' @"  @   & * @*`>_!"  "`"" ` 6`"@">!@ 8 @ @ @  @* @S  & * *>_ bx"  &" " " " @" 'x  #\ #`  #d#h#l@P `   @'t'Ԓ @'ؒ ''@'ܰX xИ 4F6 @ T , @Ɛ0+ 'p  'l 8 tp!l @ p@t &t' tp 't`@ڠ "t@ Tt'@@㻈 ` ' 3`  2̰ ` R   TŰ , * @j` ^ ?&`,&`4/,   2,#` D       >  ` @ ``{ ,@9 >]#?'''@? (* wxxxyx [``  @ &`(&`,&`0&`4, ΢` ? O>!`0@*@ 'O    T@۔ ``D @ T$ *$ ,$ '$&`X&`D@Ԓ T` "@Ȓ T@` #!㿐`H %`` !>^a8@  "` ʰ  @8 @  @ J@ "*@`@ *J@ @    L  J@ "` "` L %  J@  `J@  J@  *@`J@ "` "`J@    `J@ *@ ` ?"` "`H @?&`H  ?@: $@`@M " $ ?@/ $``@B$ ?@' $ $@Ֆ $`&`  4>` c8'c8' * @@@ 2``H  &`H  @B@ &`L`H  +&`H" 4`H   &`H ?&`H`P@O `  @&` 4@ @  @ ?  @ ?@#`㿘 " , & ? * @*   ,  g* @ʒ ?& 㿘   :&   " @&   `&&  @ ?㿐 `` ` #\` #`@%`㿀 ``@/   `` ` `#\#`   #d#h@#l > `a` `8  @ 㿘 ``@ > `a``8   @ swappercannot mount rootcannot find root vnodefork initfork pager㿈@>#>@N" >@8w @@@5C@]@2@tR@6>HH`$"` "H$ >c>,$ "c" >_"ؒӔ , "#`#`$<#``$@>\#` "\# "$( ,-,>Ė$> P" @$ ? "@>#@>2 $>`2 2  " p"  " $;`;@  `!>#  @<   P< p>!>! + ; < X< h@ : < ` $ #>b8$ $  @Ґ>!>8 @  @ $b8>`  $L$ @$$@.@̐@4@@g@O.@G#@B>!4` !4@   2H /*'@i@eH 0@+ @+ > ؟ >>_@6"@ "@ `0 "`0@ #>€a !>>_@6"a $ `> 2`8'8'`* @@@j$ > h>"c h c"`>" ؒ "` >" h` h" " "$@!$ @ >_@6l#@ >a@`Ȑ @ >_@6^# @ >a@bt@u/sbin/init.bak/sbin/oinit/sbin/initinit: couldn't allocate argument spaceexec %s: error %d init: not found no initp >" >> " '@k " >a@6 h>Ԩ``H" ؐ -/ؖ>! > H   s/ٖڤ  *"$@ @ $@  ?¹ ?³?¯'''@ " >a @6 2 ->a@6 >a@5ː pagedaemon㿘>"a$> ( `"& (>a"h`@TH @o K@ $''' @ '@.'ܰ;>c8'c8'* @@`8     @^% #>c܀ >b>"d >b#X@o c܀  >"d @E>""d$c@  >@"c܁(>#܀   Ȕ@ @7@7  'H /* * > h ؖ"@' h ܒ"@`''А"@@'H 0 @g7 ̒@'А"?'`'?/!'>@a0>a4@톐 " 7``` @} 7`,`0 @:7  '  ' (  ?   "? l' / >H'''' H'* @@ #\ #`  Ж (#d#h  @#l㿘  . @a #  6 `   #(.` 6 `.` @.`6 Accounting resumed Accounting suspended 㾘#>bd`#!>`8 2 `  ?@T I$bd  > @^@ d @/ >bc(bd>"&$bd#܀`/`8 2 `  ?@/ $$#  > @9@ϒ d @ > #>bc@$bd$#@4>> !>ba0@$#X@ 㿘>ʒ "!|>@"!x>"`>>!0 ""@>"aȁ㿘>#` ` ?  "`  @`2` > `)> @` >  >!4@.H 2 @!(  >  >!4@.7 >@! >" >@> >!4`>"$ " >>a|  " ">p>!4>#h@""p>h "К"?@  ?/!@"h "hh> "@  ?/!@"ؐ "؀/ >H 0!@4al>#  *`  0 㿘Ho o>#  #> b  $#$bH p@Ho o 2 H 0timeout table full㿘$ Ho o>b` >d@30 p"">###b  4& 2 "  "" #"H 0H> >2  2 "  $  """#"2H 㿘H/` />`h"(b`h`h>" *!4" *" *    * " @@ >!0#c@84c@H 0㿘 ( $ >`& (  "`>" H /*.>!>"!|>"!x>@!H 0㿘 ( " >`& (? "`>"H /*.>ʒ "!|>"!x@ H 0㿘 @#>>  (  @6  >a|? h"a| L Ғ`B < >b` 0"`>b +"ba|? Q"a|>  >o#@ > `B < >b`  "`  > `B < >b` "`b` "`>!x> >!x >"!|;  "  ` \ $ `` $ \$ \ \  @) Ѐ 1 , Ё㿀>">!4>!8''>!0>!'' ' @%v 㿐 @ @.`   @9 @dup2: fdalloc㿐 @ @`,`   `   2* ` (& >!L@ @ 2 & @@ 2@">e@1j#@_@F`@@ @,`@ "3 `` .>f h*`@ Pd$xL`     >!L@ @ܰ@  &`  @  @ ?*@ T  ?&' ~  34 `  ̚@ 4   ` 'ذՐ b}   @`@'ذ2'ư ~   2  0T   ( & `w &T `  "`(  @ 2   &`  `v` T   `% xW W @ B ?W`->``" e " a  3>( $(`'''Ȑ ''`'Ԁ #>( $(`'''Ȑ ''` 'Ԑ'''''В @'`* @@1T +  `Д #W > @ B ?>'''Ȑ ''В @'`* @@`  *`*   (  2  4# " 㿘 .` 2  @ @$,@ @&$  @  .` "$ @Ӓ㿘 @ @: Аfstat8@`*@@ 2R  ``"   >g @ @;* @/"8`= `fpathconf㿈 @`*@@ 2R ! ` `>g`  "&  >`c'''c'* @@@/y"㿘  >!L@  `8`  .  2  `4$``@$$`&4 &@`@- `1*` 2, '@֔ `@*@$``y@$` $$@@@Ւ '$@$`>a$` "a܁ >L   $"4 *` 2  file㿐 y >B8>!L@>h@.!8 `"8 ( &@m @鵒 ( `" >@ $@" "@ $ bb $b" "b$  @* "@ 4  $ @` 2@&@& 㿘`"  "` "@@s >8"8@A &㿘  ' @  Δ  ` 2` ` ` 2`  `6  & p&   `c *`@ 4`@: `c@ ,` '@ && & ,`  ` ``  2` 㿘 ?4*  #`  "$@ &  @Ӓ '@B "@<@Ȓ 'closef: count < 0h-`"$ `( "  T 2 7  ?? 7>  @'''А 'Ԑ''* @@ ?4 * :  3 6 >i@-ސ!(/*  @2 7  ?? 7>  '''А 'Ԑ''* @@ ``€  h @`'`@*@"G R C -   7?? 7?>*@2'''"     & 7   2>'''А 'Ԑ'  0>'''А 'Ԑ'ؒ '`* @@Ȱ "X 㿘 .` @.@` 8  24W` " @,  (` 7`  @4!&   @ (  ( @4&  &&  2  ."&  㿘 ` `  "`` $```(D% $% (@ &` 8 ° >`$c''''c'* @@ఒ2 4  2 2`$(("`$` 32`>cX'' @''cX'* @@ఒ2 4`$  I2 > c''''c'* @@ఒ2t 4`` #\#` #d#h  @x#lM>` ܠ "@>  &` ># `>€  2`H`H > B  ` >`D@8 `, @ `4` 4   `$   $`>c8'c8'* @@ @ 4@ ֒ 0 4@ Ғ @2`> @>  @6't ># "`@8"`@ 't'x'T ?@ 'P'|@!>#@ '''P'''''> ''#'>!@æ   @ @J,J    @@ o ?`@ @ g ? ?'``Y  2`?%'ؐ1 K܀  ذ ?`ئ`` ?%'ؐ .܀ ɖذ ?"# 0!`ز` 0  ,  " ` *  a "  ?؀@' '@ Ā @C} @>% > > @ 2@ % % ̐ 2 % ؐ 2 % %  @  @`€@@    ''>"  $ ݐ!=#  2א` #"@ , ̐@98 '7ؐ* ?# @ 4@` 2`($@`$(D @!$(( >$(􀊨  @ "- @"&@"@`  @̐ $$("`$"("`(!$(@ "` >!@# @ 6 >,' ''','`* @@@(((@ $@  ? @`[ @^V @  ?'G>,' ''','`* @@@N@  >!@M@  ?0. @> "@ ֒ T@ Ӓ >,' ''','`* @@@$>!@&@  ?@} @z? 㿈'`` ` ' 2W , ' *` T  @ *  @'&@s  ? /쀢 7 @'? 'Y  % ? &`N    쀢  ?  '6 @?㿘@@ *` init died (signal %d, exit %d)㿘 0 'H>m#0`@)>` (  H H @  &  ( w`& ( D w@ r& (?& & >! ^#  Ā @A@>< 2  @L>  `# ` "&`` `|2``x  @ @H~` ` " &`@K` "&`@O&`&` @C  ?:` & @< ` "`   >" &  "` "&   4`. - 8"`8 8 4"@ P`" >@ `" #>``H@`((" 7&`(@" `2` H H #6   @,`  @`H D@  @ D (@@" @͐ >"`? " @ l *@wait㿐@ 2 P   &@ P  @" L - 0 " L -   @2 HL - ^ 0&`    `' 2` `"  T  H 2 T "4 @ 2t$ T4   @} H @  @ R `"  "`   "@ H`" L L"`L L H"@  @ E? `? "` @' @  * "@d@  )>`  ?D"` 2  H (@ 2 Hh@ ` " H@  0$ (&`    `*'% 2q@2` 2&! >n@ "[ P @ @9 @   D  H L L L H `P" H`P H L"`P`P" L" D㿘 @㿘 @procppwait㿘>!D > ` >o >o@'א"H? #@    : `p4  !`t@ ?( #! )@2 >`">!/@ d">" $>$@9 !0"$> H + >> 0 $@" 0     0@ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxX$ 4"$  @$ $ 4"$  2 0 >> И >`   "`  , ->!>$ 0HH $ H "` "H$ $ > 0$ >X * @ $ 4 0 * @ 4"`8 0  TX @ *`"  0 p * @$ 8 Ē _ $ $ ( $  (  j  *@ $  L   "` @ 2@ `$ ` 2`d$  ` "$ @1 $ ` "`     ` ( ` ( $ (" < ( $ ( < $ < < <"`@& < <$ @$ D P $ H P H"`L& P P$ L$ P @" $  `$ ` 2` @~Y& H 0. > h"ؐ h "ܒ 4  @b, -H o@ `?&  ( "  03>o bP@   (  0 &&㿘 ,> T@ 4 @Ր `Ӓ `0 $ 㿘>  @ $ T@ $$ 6   .@"`@ $`($@@ܒ@ T@ T*@$㿈> ` @ $`7''$ ( $@@͒ T`*@$`㿘> ` @ $`@౐$$ (@@ T`*@$`㿘> ` @ $`@$$ (@@ T`*@$`㿘>`3  @ c$  T@i '@'` `@4R 2$ $`( $@@R@c T@` T*@$㿈> ` @ -$`.`>`''''$ ( $@/@@ T`*@$`㿐> ` @  $`''$ ( $@@$ T`*@$`H  ` `` $`  *& 'Ԑ @'' @ '@'ܰ2`>c8'c8' * @@ 8  ` @j ! > H`[ `2`@%  &`&`` @` ``2`A 2` <   @ o  "4  `.` @s`<@/`<`@ ;`  @X@"  ` @`*@$`㿘@’ 4 2`` " @  7 &``&`   2` &`?*  &`` &`@&`` @` `` 㿘  P`  H 2 Dktrace write failed, errno %d, tracing stopped H> Z 'ؘ  ? '''Ȑ ,''''@  > '`('@'@ ,'c 'c ' * @@ >`''' '`' * @@>8''8 *` @  >rc@$> H  2 $ $ @.  2  `22 2 2`   lkmopn㿘  0 >`(  !>s` ( (! `& (@k! 2  ( `>`(  "`(㿘> , !>!" > `>"@}!" >" ,㿘> ( > ! " >J  2>> ( " (@ ( x #@O @ #@v #@|>, 0#@">0# @> 0# @" " 4  >ʖ! J` ````,`0!>˕.`*"* $!" &>"@|"> !","` ` "`& >"  !> ,?  b 7>``" @(` Ӱ @   @@   $ ,>!`"`>" 4 " E"  > ,    !>>!` `` @̒"@ !>!  " $F>! * >" ," 4 2 `ؔ  y >ʠ!L  " ` ( @x؀ ``` ,`=!>ˑ.`* "* >ʒa $!J` ?   $  >O  " ,!I* `ؔ    >ʠ!L  " ` ( @?؀ ``` ,``>( .`* "* >ʒa "J 2  &( &$(&( &,2 &0(&4( &8(  ˖ 㿘@㿘@'S 㿘 >ʠ!L  " ` ( ( @` ` `` , 㿘 `4 (`9`7 "` 0 ` >u L> ` `````.` .` > Р`< `8  $` ` ` >`З.`. 㿘 `D (`K`I >B a( > Ф   " (`@@M  (`@ >!(? > Г.`@ >  `.`""`0 , $` >`  Е.`  0 ""  㿘 `| (``D "`   "6`  ` `>#  > >u h  @ ">`@ `>#@ .`f 7>#@6` .`$, > ` `3 `>"H  >#>u h  @ ">²`@ `(>"H@ .`5 >"H@.`- , >#`_ (` (Z$` ` ` ` `.`"*>` F 0 .`*>c = (㿘 `? (`F`D "` = `>   >#` ">`@ `> @ .`# > @.` >#` ` >"# $` ` ` >c.` >"#㿘 (`" >v#(*`@@Thې|۔k    N㿘@ Ntempadosfs bitmapafsIP queue entadosfs anodeadosfs nodeadosfs mountmiscfs nodemiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostNQNFS HostNQNFS LeaseMFS nodeFFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pgdataVM pagerVM pvmapVM pmapVM objhashVM objectVM mapentVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqfhandlemountiovsessionpgrpcredmapmemioctlopsgprofnameisonamesooptsifaddrzombiefragtblhosttblroutetblpcbsocketdevbufmbuffreemalloc - bogus typemalloc: out of space in kmem_mapmalloc: allocation too largemalloc: wrong bucketmalloc: lost data㿘`U.`>!@>w@d#H(   5 3  @0 . "!) ' $$ "      @     ,`>!@H /* '@ ?#> 0  4  .`@ @ *@ $ 2^> .` $ ?@;@ג  >">`)> @ : @y+, 2 V>w@Ր#` >P $ >  &: * >` 2*`@ ?#$2>w@#G$ 2   @ܚ$ "@$""@@""@  "$ >$> >`&: P* R@@>w@#  ?>w@#H 0 2 ?$  *@$  $  $`$$H 0free: multiple frees㿘>> )> .``P&: *  T* >!@*`>!@H /* '> * ! >`"@x* ` `* " &`44```  6@@@?&@ ?3$ ` 4`* 2    $ >y@  @$   $   $ ``" @ &`@ 6@@@?&@ 2 $"$@$ H 0minbucket too small/struct freelist too big㿘 #>`  @I@ۯ@E%>@w?- >"`P!>` "h#>@۟`  @w>"b>!> -@@$ @"$  *` $   #>>!` @y* @*` @  $ T physbufphysio㿘  `>   ` @,`@ @ `@tԔ  ``@&@`?@H /* %`$  # !>y #`$ &`$@`$ `$ &`$H 0&`8&`(&` ` @p )>y@,`` &`$`*2 @ : &`H&`0&`<`0 $`<@t@@H /* %`$"   #@ `$"`$ &`$H 0@Ւ`<@t}ฐ?$`$("`0`( " `0`4#"@ &  &`; @ B ?`` " '`  ``@&@H /* % `$?# @&`$@C0 `$ @ $ * " $@H 0getphys㿘H /* %>#  >#t# !>z#0 $ @& $@   >c "cH 0㿘>##& "# P`?@~A  @  * $ @X 0@4" 0㿘>" H!>!D>" `#>В`:` )>@ !D$aX`#>`:` )>@ `!D$a,`!>`:` )>@ $ xchgproccnt: procs < 0chgproccnt: lost user㿘> >`x @* @ @2   ," 6>{@!`""`  )"    >{ @ܐ!  )m `"" $""" >"   02 D 2 0 >>X @( "   0  4 2 0 >`>, @( "     2  㿘2D    0 Ȑ [    $  $$ $       ( ?& ($`   $` @ "@$`>$`!`>,@*  $@ " !`,@* "@@$`$`@"% @W  @S  <` @"`@ @ <" ` 2& @# & ` & <` <"`@$``& @ 㿘 <` @"`@ @ <" ` 2& @ &  㿘  `"`x""`x`"  "` "@ @? "@   㿘 D 䀢@` ` 2 P` &`? &`@$ P  䀢@" H` 2 HN - " H` "`? "`@  H 2 㿘  L - 2 <  @ܒ @ْ  < 0 2L - 0" D0 " D0 "  " "  "  "  "  "  "㿘@  R  &R    `,  & 㿘  0  "    0  0 &㿘@` 0@" r "5 [ 2 .   ` 2(  (@" !    " `` 0&`@` "   `  @ `i 㿘 @ @ @ " ͒?ʒ @&" & &  ( !$ (㿘 @ @ @ @  @&"  ( !$ (㿘 @ @ @h  @&" & &  ( !$ (㿘 @ @ @ @H  @s&"  ( !$ (㿘 @3 @` @Z& `.` 2 2  ( !$ (R` `(@ :    *  2 ` @2@㿘 P Ŕ @  P 6㿘H /* '?6*   Œ H 0㿘  H Pڐ 6㿘Ǡ; P 6㿘`  &`  w 㿘       @` ?" 㿘@     "`L "'`H   2:N 9 `    .   * N Ҁ& < 2N   >  "`> H  `  2 N Ҁ&  2    & 㿘 @    "`R "-`N   A`@C`;`   1`  -``@-` < "` >  &`> H `  `@2  `@`  2 `` 㿘    `  4 &?N`Ҁ6 .`  .`@ 㿈`q  @@㿘`(  .`@  4  2 @8  4   2  @(  x "@4 @2   @( > ```  `"`@ & .` `4`` >``z>"l 4 >  > >"l >>"l 4 > 2 >"l >"p 4 >  > >"p >>"p 4 > 2  >"p >  @l 4  2  @(  "@ >" >!8  @  @   @t L!L:  4 >  > >!L: >>!L:  4 > 2/ *>%!L>!D:  4 >  > >!D: >>!D:  4 > 2  >!D: >< < 㿘@  *  @`F  㿐H /* .   H 0 D@B2 2  '`'@&` |&@' y'>  @> h h"   "@@ < 0(@(@c3`+  +`@ b 2`* @ *`B2*@*<`@ C@́@M Д @G@&@Д @6@&`@i@5 Д @/@'@Д @@ '`@O@ Д @@'Д @@' 㿘@ `   U   H` H@"`Ж?  ""?/"` "`   "  "?/" `&"  `@"` 㿘  *L  $  $ 㿘 ? & R *㿈@ $` `2`H  6,`'   ''*@ 2' 2 '  '`2   (  '  2   $  *@ $ ` 2`   "@  ( $H*`"` " ? "  (# ( ( " ( " ( " >DŽ2(( ( "(  >*` 2 Ȁ` 8 #  Ȅ #    Ȇ8 #   # ̇H >   " ``"` ȅ*" Ȓ``㿘 ̀ ! $>! l * 8 & ̑*  "  Ȑ &  & *$@ ̀ 2 ̐ $a$a$a$aĘ "H@"`? "` `Đ  "Ą("?"ćH  " pause㿘 $ #>!$!  $!?@" @& Đ!(`@   㿈 $! 2`! $!``!ʔ (@ "    !  ! ?$!#@  ! $!$!$! $!㿘`` F @ /?I2;  "`     "` "`` 2$    `  `` @    @     ` @㿘 ; > Hx0 $-("2)"&@ ``   `   `2  ` 2 ` @20D "   2 <  60 $.<("2*! .` Ȑ& ȑ.`$@$a$@ psignal signal number㿘``>@"P  (.`(>!@*   Ȁ  Ā   ̀   N Ҁ 4. Ҁ    ~   *@&  *@&    & `jN - fHo oN -  "% (D> ( N(J`"/+ >2=  ( ? 6  D* & `(   @͐00h.` %`+ & "  h  . -+ &  h `@ 0  >  "` Ѐ 2 2. @ H 0issignal 㿘>!   ( ,@  *  ? * ,@  Ȁ $  (("  ( ((21 $4  (@@"  D , -@@ 4 ( @]@ ,@f  ((("  " İ?  ė*@ 2  * $  $. @``) 2  0 $ Ā ((2    2 D2  D4 `(  ڒ @@ 2   2  ((2 >@x! { Đ $ 㿘 . - (*  D@& (㿘>?   *@  .  $*$  @` @ a  a  Đ 봘 @b0>H/` /a  ?a $a ė.  Ē` $ a  ̐* $ >! .  Ȑ$ ȑ. $@H o@ `< "`<a  a$$a$   pid %d was killed: %s sorry, pid %d was killed: %s 㿘 >a( 0@>!@ 0@#5 㿘 .` 6 >!@  $@ "a "`Y%s.corep`` @ @2  >` *  `: `@  8 2 `D  >b`@M'Ԑ @'ؐ '''ܐ"@9! 8 ǰ >c''P'''c *` @ 2 WV> H''' '>!'! ?P ?X ?` ?h (?p 0?x 8? @? H? P? X  ??H?h * @@>c''''c' * @@`!`4`d0`@e0' @ʸ '`$! />' `$+>a$'$'(В*',Ԕ+'0ؖa+@@ +@ @'4I> .(  '( ( 0  #\#`#d#h@#l.>(0 ؒa  4 #\#`#d#h#l( >"*@>    #\#`#d#h#l@>c8'c8' * @@ @ "㿘  N㿘 `H D` `&?&8  " 2@@.# 0 2@@є @`@$@"$`&@#&@ B >ureadc: non-positive residureadc: non-positive iovcnt㿘` 4`>@^#``4@>@W#  2`@&` &@     2 6 *  $$ ` `&``B >`hashinit: bad cnt㿘 >@! ؠ 4< , $, < , 﨔   "@`@&"@?&㿘   2&   & >`4`4 &`4" "`4& "     㿘> H  > 4   @  2 X  `  '  `  @D*{Ȓ?`!>"ؓ*`@"##@#(#@##4>Ѐ`   >  > !|>#>#V -`  M` "%`@e >A a ">ˢ a $ @  a `$ >ː `"a`@e````#\Ā``` @e>˔!`"!"@J  ` `ϔ 㿐` \  ? ?`>!*`@%d%|%%%%&&0&D&'0'd'''(t''(('x&(,(@(`  >P  > X  ⊐  >ʖh@h  >!H  >!D  >!L@    !>"@' "@6 0 y  >t""  >И"@! i f>d""H  >#@! Y V>T"!  !> L@'G$ L ۯ B  >@3 9 @sE 4 @x/ @< *                  @ ؒ  -㿘`"K ?`F> *`@(())()@)d)>᠐>ϖ@," >h>+ >!>h> " * >@+ -㿘 @     `&@k  \ 㿘'P` @     `&@PH 㿘 @S  @      &@+ 2 /㿘 @*  @     &@㿘 @ ` `&@ ۔㿘` @   ` &@ɐ㿘@  >!8 ` *` *  (&@`!>"&@"  &&@ "  `' (   (&&@   ` `2i  >c > H `K >"0PN`- "@`? %* .H.P..\..`0` `( ")``  "#` l``  @2`(b@*>! !8! "Xb``2N`- >   $@& mH& 㿘&@  &` @&``&` `&`` &``&``&`  P@` N -  2 &a8&a@&aD&aH @wŐ&a8 А`&a@ Ԓ&aD ؔ <&aH D "&aX 0&aX  &a\  6a` ( ?` `?`l&ad`x " !1&ah`|&al&ad` @ &a   2 l`&a l`ap@Ř 6a|&ax6a6a~㿘> "#$>" >!0 !>@Ô!͒ 㿘>>bP <@*`> H d p -`? $ p t $ t d>@b2  t L$ dH /* .>!0 d   ` `* *  @"* @$ d \@Ȼ@L Ґ $ ` $ \@ڐ Ѐ`1> " L - 2  ( 2` ё2 @" @G ѐ@F, 0 , БH 0  2 p@pN>"x >@!$>>a0!`N 㿘>"P t* *  \& \`& t( t?  & t@_@ǿ2 t 8 & \@}㿘>   @ @`@a  ͔ Ho o> >>! > H 0 H 0 $ h$ l$ t, Б>  #> @ @ "@ ""$>#,`"  (  ` $ (( Ā@``  h  @ , -      , -`@ @A"`@ >*#H 0 ( d$ ( {`$ (  @ @`@E #  N ? #>#,ǒ`*`2  `"   (( Ā@ `  @ @`@  %  $ a* @?   @ @`@     㿘H/` / h N - @M (@` ($& (H 0㿘> Ho o> >>!  > H 0 01$ h$ l$ t, Б>  #> @ @ "@ ""$  , -`@ "`@ `@  @  㰔 @  @2   㥔 >*#H 0H h8> 2 `""`" hH 㿘Ho o>  c> @@ 1'>  h2'$ h"@`"$`L - 2@ t ($ tM$ t  (`, -@E ( 2$$>ː#֒>" @ 2 hH 0㿐> @> l?` l"@ `" А"@@ "?@?/!@$`$``< + 2   %X      X  @4 @ X  @X`B <X>`   aXL`Ҁ 2  ,`@k>aX="aX>@ h >  setrunnable㿘Ho oN -` *`> @<=<<=4=<>@#  ((  ?  *@ &   (`. -@D[H 0 t ( (w ( & t>#0  > c > "#$>"  \J ҇0(28 * >>  $> 㿐@   @6@\  ``>!<R 㿀 y 2r@ ;  2i` 2  `@ "S`H /* * >`h`h#'"`''А"@@'#`h H 0!> "@ І"?@# "?/!@# >hh "h @# "h?/!@# @JH 0@` >"a<a<"` 㿐  2O@Ô  H*"@ *`" *  * >b  >!8*` * !8@J @@ & H /* *>>p"#h"pH 0 ` !@|"@'@""@'`  㿈@R H /* *2  x' |' ' `' 0>h@h & ' h@''> h h " '"''А"@  *@`'`'`'`'H 0 `( 㿈@ 8t `   2j`  &`  ] Y@耢 2T @ M H /* *@ 0 >! N> > h h  'А"?'`'?/!'c& x& |&  &  * @ "`"`"`"`H 0 㿘P  x   | & C& "??/!>hH /* *   x @  |&  &    & @ &  h@ @0h@ >a ҙH 00H 00Ł}x@ ?`  2  " >4&"   6  "@@ " "  "   "  "" "  ` " Є@@ " "  㿘 8 @D@> HH > (( mapply: no match function for '%s' device 㿘   @2  @ 2 ` >@E#  @  " &   "&  & &  ْ 㿀?''쀦` `   @ ''>#X  " V "*`: * "@*`` @ 2  V   㿘` `   @ >#X` '`T "*`: * "@*`` @ 2  @- T  ޢ`㿀''''''>R!0`!0>#XV* "@*`@  @` 2GV 6*  unsupported not configured 㿘a@M"  ƀ >b(* @`  root device %s not configured 㿘  >#@I @$ 㿘?` .?@{  0.@̒ ` 4??`0.%s (root)%s at %s㿘     `  @ V @* "@V    6 6 &`>aL&`aL "`"aL> @` >> `@  >#X    2 V `@2 V  "6 V  2   6   뀢config_make_softcconfig_attach: device name too longconfig_attach: memory allocation for device softc failedconfig_attach: %sing dev arrayexpandcreatconfig_attach: duplicate %s㿈@@ '`>@"0@;V`>?$ (@>@"H  2@>@"p@]&& V` &   & $ / `,`  4$, $, $,    ,``>">">"@K @$@&*`` $ * @ >"@3 㿘&@ג&>a,&a,""a, 2`4"`B" 47"9"`4 46`4 4&,2`H H&%2"`2"`4 4&`4&2`H H&2"`" (   @*`2 %s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)㿘 8 `a  : >@)b`> >!, $@>"h, : >">"  0" H>"` >"> 0" H: @ `( ,` 0`(@!,`@!> "`8@`8@!>`,"@@>  > t>  㿘>"t ># "   @  2  disk_attach: can't allocate storage for disklabel㿘! ⥔ & `" ⠔  ``& d 2 >@!@ߒ! d@ܒ"H /* *> & @  & DH 0 &>c& c>"t"c "tdisk_detach: disk_count < 0㿘 `  d| `"  "`>"# "@>bt? "bt>@"`$"`$H(>"`H"`LHdisk_unbusy: %s: dk_busy < 0㿈 $??& $> @#H /* *> ؐ  ?H 0  H"' L"''А"@' P T@& PА"? & T P T & P?/!@& T& H` & L 8>` B (> 8`B > (H(   : (: 8H( >" @" DH " T" PH >b>À  "b0> a"  "" "  (  > > x klog㿘 > Ho o  @#%>Ѐ H 0D #!x>$xo "  H 001 @‎H 0>`x ?"`x  <`/" `@8@   $ /(`$ ` 4 㿘Ho o`>   @ >БH 0  @ [`|H 0 㿘>" #>Р |@ a? "!>   %  !> !>폒 !> x >R  x ?$ x }@"/ @w@3>4? ~@. v@"%)?H> H&">x xx x> " panic: %: 㿘'H'L'P'T'X> !!">!x@ٔH@?5%s: table is full 㿘> a@f㿘'H'L'P> 'T`(  'X`    @ΖH ("   "   㿘  ? &W 㿘'L'P'T'X  @L      @!ǒ   @L㿘'L'P'T'X @L㿘'L'P'T'XH` @  L@mH 0>"   @^㿘 < @  @̔  @ N ? > @ 㿘'H'L'P'T'XHo o  H@0H 0>"   @!㿘'H'L'P'T'X3>  b<H@&b<>! 2&b<&b<(null)    4@3 %  ?ۀ`S >"*`@flfDfDfDfDfDfDfDfDfDfDcXc`c`c`c`c`c`c`c`c`dfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDcde8fDfDfDfDfDfDfDcfDfDedefDfDdfDetfDfDe 0?N?Ѐ 8 ,* N?А?Ѐ (   L@@L`@L g '|?-@|  < , @L@@`L@ '|L@ 4`L@ `| A r >o12 `2L@>!L@ &`@]L@ `   -@N     0@@ x@< @t||$$L@ - < @&< L@ @L@ ڨ  %@` l@ @ʨ 㿘>! >"# `  `># ```@#˒  ```>c ""c `"   > >  a@@d& &*  /`&` >#  >"8@8'L'P'T'XL @ .* Ѱ @%` @ۀ`S`> d*`@kTk4k4k4k4k4k4k4k4k4k4iiiiiiiiiik4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4jjPk4k4k4k4k4k4k4jk4k4jxjk4k4j(k4jk4k4j 0N@Ѐ 8@`.*  N@?АЀ (`@  x*@ @.`  n?6  -.      0.  x.   @1&$ J@ 2.J@=.J@ 6  %.  l. .* &?0123456789abcdef㿘>ˠ!>#p @( @@,2 >ː!$&㿘` @@`!  H /*.`"` "@"`ɧ"đH 0 Ɛ 㿘, `Ȁ@ '&@   `̖ @Z * 2`@ 2 `Ė ` ʐ@? $`$`> "` (  & (㿐 ( ,*  Ȁ@ %&@    ̖ @' * 2`@ 2  Ė    x   u7 drminit %s㿘 `6& >ΐ"/ && &  @"``@*"`rmalloc %s㿘` >" @  `  @`$ ` "  $` `@ *` 2    ;" "?# "#rmfree %srmfree: map '%s' loses space (%ld) 㿘`4 >j# $  " $ h$f$ @ <   @$Q MJ$ >9#  $ "9"? À ` `" @ $   Ŗ " ?? "?2$ @ > #`""?#     N - h`@` *@@"I  2`C '`''ؐ '`'''쀢 '3 `  @`2'' @`ذ 耢 ?  #2` `$  @`2 & 2 & `@Բ &8`@`  @*@"q  2`k * $e    W  '`''''`I '`   @`'`  `  @`2  Tڔ ؒ@ذ 耢 ?  # 耤$   `@; ɒ T& Ò h`@` *@@"O  2`I '`''ؐ '`'''쀢`'9 `  @`2'' ``ذ耢 ?  #   `$  @`2 & 2 & `@ך &8 @`  @*@"x  2`r * $l  . ^  '`'ܐ '''`O`'`   @`'`     @`2  T ؒ`ذ耢 ?  #  愒 耤$    @Y  T&`  @ *@ "Ӱ   2`Ͱ " ", @  ?*@  @   *@ >` 2      ّ x `{ `@Ò   `$@ "|";@"{"ST e "} "~\@ 't    ?4   b~t[@ 't  @  ?4   b}tGT 't  ?" (` ِ 2 5  't  `vt)   ( !$@ `w@ $@  ``` selectР@) `8@& `@aְ  @8&@`@` 2  *  2(` 2(` 2(` /0 2(I y H /* * >0 h4 h  '0А"?'4'0?/!'4"> 0< 8(>!@$(@@v2I( 2E(H/` /` >`h0  `h`h 2(4@& (H 0%((`@>! H 0$(>ѐ L!>H<H 0 (? ?$(  #" ``" `8 2``" ` X  2` `x 2㿈''`     @62 -4`*   !?@-, @`, ! `> "@   4 `*  -  $` @֑4` ʲ` #  㿘 0@ "&@a " &@ h>ѐ L@2&@` 6`㿘 4   >>ᘐ L "ᘒ 6 ?"&Ho oh>ѐ L@2 (J-  0 0 @ ?"(H 0p@  `2@J @`#,>"*`@440444444444444444444444 00@  (   @2"  0A 0 2&>"?$&  (h  D L - @2&0&@`# > ,*`@TdpT  ( D($ (`0 $ T `` ''О 'Ԑ'؆ '܀ `ؚ8?''@ '@4'`     $  ( 2`@M``" @8+ ?$ @ 2L - D T 0@" $ T0 > $ T (*@$ (L - ` 2 Y `V R ?O$  &`  ( D D($ (0@$ TĒ &`  @2  `ؚ P  ?И'ؘ '?''@ '@'! @"   `ؚ!  ?И'ؘ '?''@ '@'  㿘    @// 㿘    @-N 㿘# F  ":#"? B2 "~" "}"52 #"$.2  ! >3 >    P"3 ` t3 P   P =3   t3 P ?3 t)  0 $# ( (  " 2  " i r   @     @   @9㿘 H /* !`  ```": ,0L" X0I 0 @@8  4V  0 $ ,02 T ` \" " 4  d        $  l t 6 t   @ H 0 y H P 6 PH 0 㿘@i `06`    @ 㿘  @+\$ 㿘.  " `" @ 0`2``@[|  `@`@[t   msginfo.msgssz=%d (0x%x) msginfo.msgssz not a small power of 2msginfo.msgseg=%d msginfo.msgseg > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULL㿘 >!! "* " > h >  #@$>> > !T  > 6>?>422@ᬔ`>2#>>> "p >ې  >> "`""@ᤔ` > >>  ">!>᜔   "` 2` ᜔`Tmsghdr->msg_spot out of rangemsghdr->msg_spot != -1㿘  ")V >>>V >ᬀ>">!T̕* bp2   #bp 6  0̐" 6 6   2V V ?>>o"c&"cmsg_cbytes is screwed upmsg_qnum is screwed up@@``? # @>!6 >Б* *  `* @ "} V@ @2w "5m [i c `" ` " $  $ y@`2`  " >#耢 "$ >  ? ;~ T5 @>` >+ !@8' ?4 b 4  !4 $ > h$ <c! ~] T  "&㿘@ ` +>! @6>>  "` ">`@  T>!@ & N ( "A F"B >! @>>  2` "">`@  T>a@a% &  6 6   6  `6  6 6 & & & & `& & $& (& ,& 4> h& < ?#@ *`@&msgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segments㿘@``` ?# @>aa>Б* *  `* @`  V@` @ h   @??!` 8 `` " @  8 >"p4 ># " `ŀ "4` !>`B `` 4` 2Ѱ ` 2` ˰ `>> h"p$`> `  >> 㨀`2>z 4` ?4 4 *"㨄 >p`Sc>h  >b!>]!(>!&>U!8 p?>!T*  3c2 4 |Д X    ?a ?2 * +>a->>!+ : 4a>!!P@&>!`@X| &>!T.`@+ : ?"?>!x`! @`  4`Z( ` 2`$`  #K ?a 2 0"$``"` `$``$`0$`$> h" ,& msg_first/last screwed up #1msg_first/last screwed up #2msg_first/last screwed up #3next too low #3next out of range #3㿘@``` ?`# z>!ɰ >Б* *  `* @` V@` @ !/` ` > " `"'$` /$`>e"`` )`   @4  "` "$`>G" $`2 $`>@" 2  /!>`͖ a `  ?V@#` @ T  `" `$`$`0$`(> h$`4 8 {  0: #f04 + />5>>!*`: 4>"@&>"@АX{qج>!T.` @4Ԑ' sema is NULLsemu is NULL㿘> L`2>>０"X | >>ﵐ"ht 6 >"`2`t`8>|  >> |"`|`d>" Ё㿘>bl   "l"l "l semconfig: unknown flag parameter value (%d) - ignored 㿘ߐ@  > >> ""l""lh"l&#x@I &semu_alloc - second attempt failed㿘 >>>| @|  |6  & &%# В`@ d>  Ѐ  V  2&  "@@ 2V 2  > 㿘@2R> Ѐ "&@22R H 2&@A R +  `2`R@2` 222R ' ?2* : *   #`  #` `Rۖ  R  *  `22"2 >Ѐ/R &   2"S  2(8 *(  " ?" 2Rޘ 2RX@`` ` @?# e>!6f >,"`L* @`""\ V@` @2V  N > 4. @\4|h@<>`h4@" `>!h"h"@ *` *  *  *  : @ 4`  .`*  `@* @*` " ``"`@ " >at @64` > L"!t` !t`*` * ""!t`@84`yy ys 8?4`ƒb`4`Ȕ !4`> h$` c!ƐyW yW 8Q! & `6 , `* @`=! & `6 , `* @`)! & `6 , `* }@!yy  s`l   `.`y b``@ \ !W &U `6Q , `* @G`  C A `=xΔ 7*`` *$3 Ŕ (x "`   .`` x@``@ ?a   "&㿘@` `l@ 6>!t @6>> L`""`` >`@ `8>!t@ #>.`"`L* m@  s`L l  &[>f "b  >aaY >bh" 4R  @ >!t> L`"">`@ `8>!t@>; .`"`L* " `>"h2, `@2`*`2@#"h "`>22?2 "*2 >+` h*  h"@S" >.`"* `L @?#` @*`@&semwaitsemop - can't undo undosp@   '`?# >! >."`L* @ "V@ @Ô ` `ؒ-`w* 0  5 6   @*`  * T `  # 2 *  2 2 2 @ ` 2   2 2 `@Ϛ`@A 6   * @*`  " 2 (2 #T 2  4  4!>X ' " ?V@# @ "To  2 ?4 ?4J @Yؤ @"=`T  8Ԕw "1` , * `@"?V`  @a "?>p ? ,   * @*`  " 2 0`@  @آ`@ *` *  0$"'@D'@ semexit: undo vector disappearedsemexit - semid not allocatedsemexit - semnum out of range㿘> Ѐ    "> 2 >"l`#@! d` "lᐒ "l "l> Ѐ      2  2 T > >>T  $7 63)>`T`*`"  L* @`"T` >Ӑ `>̐  * `*  @*3  `* @2Ố T Ԣ`$ $>blbl"bl>d 6?>L"    0?? >d@ >*` L( 2   :  㿘> 0 , > ? @@bɔ  & ,"6 >> >>  84"@"8?"㿘?`c >, @L*`  >`  @@b ? &`> h & $?6 *  4   $" >"! 㿘 >!h `Ę?"@@> >!h  㿈    #>ah ʀ* ah @6  ?"h`@ " M@2`` @!!]U>!h   ?">`@  >!h@C  ``> @?8  @  `` ` @ '@ &  '>!  `ܐ@*@ '  @ #\#`@Q$@$ 0 `$`> h`$` 4`&h @@2`U `8R > *`@\ܐ! 2@`t 0 9 7 20`t̔ 0 2)?6 Βb 6 Д !6 > h& ( 2 & V $` 6 >@?# @" shmget㿘>.cL * @ d@6 !$>8ޚ ! # 2``"` @$`  && ? # *`@' shmseg free count inconsistent㿐`>!` !` ?> !  >   > >>  8:@   > a  >!d>#L`"2> `0>!d >茐"(?"a  >,*L,@4 @  $  ?+  4 ?#   *#\>#` 0@P   "4 >"!  ^3 $ ,>`4 5@> >8: @"8 4 4    (4 `>$  " 0>$ 4 $ $ $ $  h@ $ (?Đ*@4 -& 㿘@ ` !y@  #`" 8㿘 %>h , Ȑ  u=` " h ?#>#L`?  * @*` ` 2`!h`㿘 >h @`Ĥ  ?"``h@   m  " ā㿐>` !>!\@$!\!\> @@A >"`0   >">#L2`2` !d`0>"!>"!>" 8@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@㿘H /* &&`l`p    &`p`@ &`t`p =&`pH 0 㿘>c ""c @ & x& | & p 6 ށ 㿘`@a@a >"``D`""` &`D> `$`" &`$>!\``"!\?4`.@@ 22 `p ` ` !@@@2`p !`@O!@L4! @`@"`p@`p @h 2?h2``p@*@!&`pd=` 2  ``  ^@ђ @Β`p@ `p &`p ` ! @ `*@&`@ @ ``( "`@ `&``6 2  ` 2 `@ޒ @ В  `x 2   `@ƒ @ `x  U`p( 2 " `p!2 !`n&`p*@ *`>@ `€ L "5`pG  28`  2'`p2  `2`@2 `(2`a"` 2  " ` " `p@`@ {`p20  ,`V``@2` 2`"`p@`@ b` `p@ C` @ >``"6`@`6``p>*@&`p 2E  A b@`  ?@ 70@ 2`@n?   @`p>cX  @@ @W`?     @@``p 2  " @ `p2` ` `x3 @2u`p@ pq`p``( # V``H 6c`p @y^`p@Ē Z`p@` Sa @ ܐ@ K`p"6` "6` " 6` 2 `ր " `6`֐`@!`(@  `p 6`֑* :  2`p`6``p@*@&`p /@9V`@ y 2`p `"`pV`Ԓ "@8@$ `p @ ?  `p! 2` @  ` * `p&` >&`p@ 㿘` 2 ` @2?@B`H >?`d`" &`d 6  3 `/ `   "@ H /*&>"@@`H>& `d@"&`dH 0`Ԓ?6`Ԓ M  2H? >`  >!`H`d#!@&`d >3 `d "`&`d` @>@ؒ`H ">#X ?`V`> d*`@̜̬̤̬̀̔̔4  6`  ?6`԰?x  @J@  @Z#   @"U>8  ]* r(   }@H#8   e ~  u@<#   @"7>8        @*#  g@$#<   @  @3 #.  Ā)  Э >`<!>@  >  | @ (   x   `   ( "   @"ؐ F n@ @  @ @0u ^@ a@"& k @"t h  o@"@h0Z w@"  s@"^ HN h@" G  b@"g "~@D   ] r@ "}@-00  @H  @"S&  g@"    e@  v@0  @    @0H /* &   p  p ?@A&H /* & p $$ p` ` @ >#  "   p ( (2 հ  ɭ >"# >c ""c Ű @ " 0p , 6 6 6 6  |@  (  x " !1H /* &   =$ H /* & p  ;H /* &#@  @א  @2@   23  Ȁ€ p2    2 $ ߐ"$ p@$ $$ ($ (   |   ϓ @  @"C  ! @;`$ @4 @E ( ' ' ' ' ' ' ' ( ,$  0$  4$  8$  <$  @$ $ $ ($ ,$ 0$ 4$ 8$ < $ @*@$  $ h$  ( 7&      oC$ 0>#  lذ  h ԰ H /* & *>@`€.@€ h*`@€H 00W, hH /* & p!   @G  *@  p" ~@" p0<        >   |@  ( 2 h0z h*`@ `€q H /* & p! ! n$ p*@ *`>@ `€ H 0Q  `L `  | " 䀢 B   $ | $ x  "  ( 5' (Ů `  |  ( `( & ` "!$ x0 @Q @I   4 4 4   x4   @b 㿘2  *@ *`>@ `@H /* &` `"V 0@'   @ p   H  H 0   H 0 㿘 @" @f !  (    "  㿘 H /* & H 2   @ Ā`@ p>!⨘ `& p@ H  H  p ည H 0 㿘ɐ@ 㿘H /* &`  (`" @  ( `"6 @  6 6 ؐ p>* @& p` p n ~& p*@ *`>@ `€ H`@  HM H? H 0㿘>"p m 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @  H 2  p`@@*& p @@ ̀ €   p @& p㿘H o*@f p @ " pH 0㿘 Ā`@ 㿘`T 0G 㿘 p ` @` & pސ3 20  n& p*@ *`>@ `€ !  p ` & p  @2  | "   "ϒ   `@2" p 㿘` p & p ?& p @2  |     ̫   x *@&  p   & p' ' ' ' ' ' '& & & @ ɐ؀ & p00 *@& p㿐 >      H /* & ÐH 0` | @+`(' x#`Ȁ 2B `Ā 2> 2;   5  ٔ >`<!>@L " %H /* &S      &O p0+  *  *  *  *   > x > h  h  m >> h  h  ''>hh"*"@ *`" *  * "@  #`N>!0@Вb? @#b@ ( > ( p    @   p  H 0  H 0 # >">"!@H 0(#"' H 0 @ ͐E 2   x `6>`<!>@ , 2 !ǒ        H /* & p @)   % $" "  @ u H 2  p  & p @@ ̀ €  p ?& pH 0ttckoutq㿘V ڑH /* &` >    HȀ@)@' HԐ`>   >H 0 >a0!` > p@& p3  HH 0 0  V ڢ `H /* & p!   @  H 0  H 0 # !> H 0>  | @2`( "` x{ @w 2v` 2q`Ā 2m` h   >`<!>@t `  @2&` H_`` d8 dM逤`>+ )> >X@S ?@6 * 69 H 5 H1`06 ֐@  H$ Ԣ$@!䀢  d@6 Ԕ%!& d  H`4 ` 4 `4 `?&` H?ڐH /* & H  H 00& H!> p `& p@H 02`0 H 0`&`@? #ttyrub: would panic c = %d, val = %d 㿐` h  *@`z&`V`ր +>  >#X ?f> ,*@H\\\\\@s m`` @"i`֐@j d`V``@@s0]H /* &``p V`Ԕ &`p`  `&`@ 6` @`@  ` *@&``p*@&`pH 0V`Ԡ$ 6`Ԡ ?,"`֐ 0? `>#ߒ`ր`  `p 2  &`p \`@X`֐?6`ց㿘      㿐 " @: H /* & (@ b  @( (@ )  @ S @ @   p*@& pH 0 6 6 ց㿘`p@2`` *@&`` (  ( @   ?  ^   ^  @ ?㿘Q  p   x& T @2``@2@?㿘 @ 2: !4!  6 ܒ@ h `g h (  3@r 4* @*`@*`6 ځload: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk 㿈 > d!>"P!* *  * $2 @[@ dI | 2 x>Aa(6 ր`2`>8aH6 ր  >/ahy6 ֐@x 2 < L-0 >!l >!>! cФ"? '?/!'`') #!>@! '?/!'`'#!>@!ڔd d* * " *  * $2 >@ԢL-` `   @F >@/` 2  ڷ6 ց "Z  -(  `-((  "G "B  J -2 J -`\ \)87 0`0@?J`-`?") "$ `t"`0`t t8  (`( "`0 (2`0  04  㿘H /* &`p ( (  H 0? 2 ܐH 0 㿘 ޒI "V .`: @ ` >  > ">" > c "c>`  "` >   㿘  >  @T  $@  ($@  H$@ 㿘@ː @ɐ (@ǐ H  >?㿘># @[ *`" * >! 2 $ p p  $"    0="$ p #"$  $ %$ "$  !$ $ ߐ Ā  p $ p p >#>"`$ p !bW  p "> h*`@ €@ 㿘 . "@*`>!@> h"*€@֒ 㿘 . "*>a >    "d ` | @24 (`(`"0 (% x"+ (`Ȁ2a `Ā2]  ` U  { >`<!> G` | @2 (`(`2 x (  6 # (!>Ә "0* $ (@ ( &  ( 4` ( 2 (@ ( ( 0  > hⰕ* @R 㿘 . "@*`>!@`Ā   `h*>b   㿘 p o!*"@ *`>! @`  ?"` *`@! 㿘 o`* "@*`>!@   ?"`*  `*`@ 㿘 o`* "@*`>!@  P`  㿘># . ) "* >!  c$C Ġ Ā  > $ Đ> hb* €   7$ $`,`,`㿘 . "@*`>!@> hb* € $  p ?$ p 0 . "@*`>!@@ `p 3     " ,d  @" , ``,8 ,`, V "`H  " `HJ, G `p!"  < : #`P!> "`p0/  ` 2T`ܴ`Hd8 d@ ` 񀢠dT``H  `p  ?$`p0`H"`0 . "@*`>!@@   `p w ` "8``( 2n`p` $' `(" `d8 d#" @  8j`p R @`(` ޠ  `(@dS `>" -`d8 d A`p =  `( # ``!ͽ``p `h? *€ 4```Π   `@?  #`!>0 "w`p`&`㿘 . "@*`>!@p&@` ``"'pU 8 Q H /* & H   H 0 9 H 0 p " ``  ' `       "(  ( #Ӏ`!    *  (>㿘  `@ * "@*`>!@@#` "`p    @, `((" `    @, ` 7$` 6  * @*`>#@>!Ȁ@  p@"=  @"Z`H  _@X w@"'`xm  f@0  i@"8b  @">`H  @7    @0  @"-`HJ   &   Ȱ   ?     ?$    ?$   `H@`H  `  `x;   `@s > `hb+   @6`  !@2  `O, 0 e  `("<`  7  @".  ~@"(  }  @    @"   @  u@`  @  @2 `  @, `"  2  "   @ `     ,       ߖ, @$ 㿘 >[ $ '?@ `:   >G $  Z >? @$ $ $ $ $ $  $ 㿘  " A >  "& ; >& & ?H($    ` `8 ("@82  "  " "" " H  㿘H /* &$  "  @ "  " 4 a}&@ "&@ @&  & 4 & & H 0$@ H(C `2     `: 7  a  0 , 8 ( "8 `       ` H H(@!"$       4 "@ "  "  "  " `4" " H putc: required clalloc 㿘H /* &@` 2` ` 2&` >V#h$  " `H 08?&` &`` *` `` "@!  :*"   * @ +  :*"   * *+ @`  &@``@&` `&` H 0 ` `8("@@**.(@` `8@ + "@:  +` "  (@ ( ((@    * @ * (@ @ (@ (@  &(@ b_to_q: required clalloc 㿘`S H /* &@ ;` 2& >Ӯ!$  /& (&@'  " " 4_  }" &@ &@@& & `4H 0 >> (>(  (  " "" 8("8a">ˀ (  "@ "    8 ("8!"@ ?H(&  2 "   "  ` `8 ("@82" " H  㿘s?u0x(     %>c 'c ' * @@>c'''?'c' * @@>8''8 *` @0 x``(  `   %>c 'c ' * @@>''''?' * @@>8''8 *` @0 x``(  `   %>c 'c ' * @@>''''?' * @@>8''8 *` @0 x (     &  a@   q@ >     ( ?' (`4'''''?'`4'* @@ذ㿀(    >``''' '?'``'* @@ 㿘>\>b "`> " >!`""!"!"!` "```:` "`` 4* ``2`>ሀ >ǐ ">ǐ! ሔ >> #`> d" #`>ǐ!$  >" "2 : R" 4  4*R   >"* "2  : R  R 2  4R2  42 4" 4 *R  㿘`.  ( >!"# *" 2 * : *0 0P؀244*Pذ *㿘>!```:` "` ` 4* ``2`㿘>!`>``:` ( "`` 4* (``2`>!0>Ǔ2 !$ :㿘>!`>``:` $ "`` 4* $``2`>!0 !>@X! mbinit㿘H /* '>` @C * @   >ǑH 00ϯ"Pmb_map full 㿈> `?>#@), 6>H /* *> h h ''H 0 >00#@'#`''А"@@'耢 ;"0  >b@x>!쀠 @  @P &':  @6>>>!`쀢@&" ( " >a` "`㿘@P>c.`  Ҕ6 H /* '>a.`  2 H 0 &&  & 6 㿘@(>c.`  6 H /* '>a.`  2 H 0 &&  &  6 㿘H /* '>!` ``:` , "`` 4* ,``2`H 0>a` "`㿘>c.`  T6 H /* '>a.`  2 H 0 &&  & 6 [㿘>c.`  )6 H /* '>a.`  2 H 0 &&  &  6 W㿘>c.`  6 H /* '>a.`  2 H 0 &&  & 6 "  @# l㿘H /* '>S !*`@ ?2@ H 0   &>H /* ' >!x"@> 2` ?* *   > "@ " #H 0 >S #*`@ 㿘 H>!%>>#H /* 'V *`@?2@H 0   "&V H /* ' >!x"@> 2` ?* *    "@ $ $H 0 V * a㿘>V *`@  :"V  3 H /* '>V *`@  2@ H 0 ##  # 3 ?2  "# #  #   #3  #   ?6 #`c  d"  ?@& & m_copym㿐@ `>U `  2 `>ʀ 2 F @ $@ `􀦠w'沨">! >m>/ V *`@  "V  4 H /* 'V *`@ 2@H 0 $$  $ 4 ÐH$ $  $   #4  $  "$ $   "$    $  >!x"@> 2`  *  $  $  $ $ $ 4  Z  &  >b>b  "bm_copydata㿘``>̫">ʀ 2 ̣"@ &@ `#>ʀ 2 ̔b"8& YА 㿘 2`  2&  ` @  @*` &Y  ` @ "& 2 P `&`$ 4 " "@" " `5"  1"     "    "  , 2 " 6 " "2 2" 㿘` `d``  `d@` `d` &@@ u>T`*`@  ~ "T``6 H /* '>T`*`@  2@ H 0 &&  & 6  J& ` " `& `& ` #6  & ` ?4`   ?&> 쀦@ 8`  8  `X  &@& ` $" $` `$`K``>` &>>b|  "b|㿘@    $  ` K"@>T`*`@  "T``6 H /* '>T`*`@  2@ H 0 &&  &  6 "x `& `"& $`  Kd d&  b&ې^ 2 d>VT *`@  "T  6 H /* '>T *`@  2@ H 0 &&  & 6 ΐ l"  ?@&   "   6  &  &  $& $ >!x"@> 2`  *  $ $&  X & $ &$㿐' >c@  6H /* '>a` 2`H 0 &&& 6 n 2&  & d`& >!+> ' >c  6H /* ' 4H 0 &&&6  ΐ l& $@   (@ H /* 'a쀢    a쀢&>!x" > 2`  *  ?$ %aH 0 " &(&$&  6 8( &  6  2 & >! 4&  & W6%&@`munix㿘> 7 ": +  2V4 + / ) S @ 4`  2$  4 $    @  `@`2 0`>ǐ#@2 &@2&@  4 &@ 㿘H o*@a    @ H p@㿘H /* !      @ "  H 0 `  6 & `8 6 H 0 sofree dq㿘      @ 2 & @ڒ  2& >+ h@  T@3ђ soclose: NOFDREF㿘H /* !    @V    @N     5  # 2 @2   "   !!"   " #> "!V z`2    "        @ "  " >!6 {H 0㿘     @ soaccept: !NOFDREF㿘H /* !   >Ȗ" ?6     @ H p@㿘  ( -H /* !     2 8@0   8    @ H 0㿘H o*@a    @ H p@㿘H /* !    9   %     @ H 0㿐' 'P  >   P `     2`  ``4  "`4  t  ` >@ې T >@ > 5 t>!H /* !   $ 퀊2 X   2 X 9`2 X0􀠠 ' X T ` \"" 4 `  (@   (H 0G t'%2   d ! # t ? 5 t ?5 t t@e TH 0 )P tH 0P$P`ܦ P ) >c  6H /* ' 5H 0 &&& 6 "  d&%&>c˔  6H /* ' 5H 0 &&&6 Ԓ  lTS@H /* '>쀢   ] >쀢&>!x" > 2`  *  ?%  H 0 " &(&$&  6 (P (> $@ @8  &(@8 @@8 $P  6  d" ?@&& %@P` D"` ` `` 2`*P`  5 H /* ! `   P @H 0`   ?5  'P  P󀦠~ t ? 5 t ?5 tT tP  R Mx''' `'&@ 2'` @ ?+ f   @   @   X֐` 2 2& $" P     @  P   @ߐ 0  6 P H /* ! D  d 0@ :`  @@ @"Z  48V   Q O  $  2G쀌6 $   < P "6 D  "0 D 2T   2   "} 9 "{ P !v #t P ? 6 P ?6 P P@h 0H 0" Pm m '􀠠     ^ 0 "  8& 0& 8   $"@& 8􀠠 & DF$H /* '>T !*`@ ?2@ H 0   "&H /* ' >!x"@> 2` ?* *   > "@ ?" #?H 0 >& DT c*   D T    >!    'g 0 "@ 8& 0?& 8    $"@& 8 `" '   2'@'& DD$H /* 'T *`@?2@H 0   "&H /* ' >!x"@> 2` ?* *   > "@ " $H 0 >& DT c*  9 D  ' T    "$ T '     >!T  䀠     , ?6 `"@@8 "@42H 0 }H /* ! "& "@@i  2" 0s  "  8& 0& 8   $"@& 8&& DE&H /* 'T *`@?2@H 0   "&H /* ' >!x"@> 2` ?* *   > "@ " %H 0 >& DT c*  y D 2$  , _ &  $ "@$  0"& 0 , 2 @"  & ,  @B6 @@ <@0" 0   , @x 0" D P ? 6 P ?6 P PH 0u 2 @     " $   "T     2@ 02 "& D "     @ ܀``  ` P ? 6 P ?6 P. PH 02 P`" P@'@ P ? 6 P ?6 P PH 0㿘`` @`      @ p P 0  @ 6 P@ߐ0 6 PH /* '@  ? 4 ?4 ِ ' ' ' ' ' ' ' ' '@} $H 0`  ` `@@!Ё㿘'P?#@  " * `  @P *"3"8 21 *, @( *$} *    *m * 4i *B"v  2r  6 "l  (h   O6 *L6 "[  ' " "=` &:` 0 T@ 0`> 7*& d'& @"6  80 >a0@ >a4@z # !  "6 R`6 v`   ` @P 㿘?#  " * ` @  K&` 4 "FV @"AV "!0@yے`"@@z>@ya4`"`  *& 㿘 (   0   l ( H 2 㿘   ;  6 @Ȓ @ @( 0 |   "0  "@ 0 |  @ T㿘  " `86 @ T@ 0 |  㿘  " `06 @ T@ 0 |  㿘T T @ T *` 2  : F   O ,@{ 6  ?6  6   6  &  "6 " (& ( X 4@א@'     @  @:;  `@ 0 |   " 6 "` 2 "`  0 2 "`  "  `" ``2 "2  "2    㿘 `2 @B T㿘  0 @96  |  㿘 !  @6  >R "㿘   4 @! > "       4 㿘`` ? 6` ?6`  " (   0    㿘 T@# " 7 0@  @ 2 d & @ d 2 d(& d d X 8& d @ 7㿘> (@|, @(&   .`@8   & &  㿘@ʐ& & 㿘@  2 "@ 0 @A㿘@, "  2   &`&  $@& "& " "  ?2 2@ 㿘@0  `"R`  @2     &`&  "$@& ""` "  ?2` 2`@ݐsbappendaddr㿘 @ >!x "   `    " " 4 4Y @ l( >ch  4`H /* '>a`" 2`"H 0 $@$``$`4` o 2@- `$` @K "$$@` @ & &   " $@&  2  " &    2 $  sbappendcontrol㿘2>x#   `@ @"  @   " " 4 @ $##  @ & &  "$@& 2  " &    2 #  semi-panic: sbcompress 㿘 `U `` ` 1@ 2R  R V`@#$   ` @ @VV`@`K@  `  & ` @ &ò"& &` @ & & ` `$@&  ?6& >6 sbflushsbflush 2㿘 " >"h@  2 >  >"psbdrop㿘    `d >!>#2  `>"R`" " &&   &@  $"@& H /* 'S *`@?2@H 0   "&S H /* ' >!x"@> 2` ?* *   > "@ " $H 0 S *  ` ^  `Z >!>#"  &&    $"@& H /* 'S *`@?2@H 0   "&S H /* ' >!x"@> 2` ?* *   > "@ " &H 0 S *  "&  `" " & &  #  # # "&㿘  W>! >#&  "@ &?&    $"@& H /* 'S *`@?2@H 0   "&S H /* ' >!x"@> 2` ?* *   > "@ " $H 0 S * % 2㿈 | 2` 2` >"P"`@``찒*`" 0" &㿐 @@``@  A㿐 @@ ` accept㿈`  `G @@H /* !     H 0o  !T  2' $H 0` # 54 $  $ %>   "!z ET   $ "  $ 84 $ٔ찒1&  k 2 >   2  2>P""  `  4'`G2`G, ퟐH 0㿐 @@^R   !!2`J %`@* C27   !!t5 $H /* !    $  3> "!`      $  "  $4 $H 0  B4 ?" x@```Q찒O@``I谒E.<ܔ  '3 3 >P# # $22 "" '`  찒 F G* "@A* "@p`'`'ܐ' '''`'`'@` @48`FJ '䀢  #" (*  G 䀢F4* ''@`@ D h @a԰Ė '   '' ''?'  @`d'  ` @ "0' "Q'  @ @  @2=` 2̀  `?"   ?"    "  "  쀔 '̀` ` ` "`̀ 2 N 7 "@?#"` "`J   @`В Tܔ , GFԔ  ݚ耢 ?  #    `$'    | TЀ p` EK  "`0'`'ؐ' '`'`''` '@`@?8`E+ 2䀢  #- (*  ( ` * ''E*@ؔ @ '`E  h''̢ @5԰ז '   ''''?'  @`'    @`  Tܔ , ̐Fz 'Ԁ` И̖  Ȁ@ ?  #` `   Ț %# T pȒ"@' "1 'Ѐ2' @" `2@ 4'DqȰJȀ&ȒDf  @;а  5̀ @?#@2(& " "&?" ` " '̀`2` 'Ȁ &'  &D* &Ѐ "̀ 㿐 @@V `s 㿐  @@G"` l `  頒 2`  7 C`"`0 $ `` 㿈 '@@7`  `Cʔ "`0+'`` T찒`   4' ` C`C 쀢 㿀   * ?  # 6- & 3 3 >P# # 22 "" @& 0* "@** "@㿐 @@.`CC &`  A  7    @ ` 4'``C+`C% 阐㿐 @@]3  $2`+ 9C $   7    @ ` 4'`BB ]㿘l 2 p l  ~2$  7 Bǔ0$@ *  @*`2P   &" uipc 1uipc 2uipc 3uipc 4piusrreq㿘  >`  X -`     B - ``2< `6.`>!@8H`x` D  8@+@W @~     @@e "   2  & >`C  r@耧 V  2>>! ۀ   8``"@  &`` 8 $  0`X" @ " X 0 T$ ŀ ~! @ْ V < 2t>  8@  2  9 ``> `0P \`|     7 @ }   " v  >,!( `0 2  `0 `8  `"@ " & ` `8"`  `0  X"@ " & X `0`0"`|  B !0@ 5<  X&@V  ? "?`0@&@?&   >#"#$  *&  "&  &   "&   "&  &   C   >!8 绐unp_attach㿘 X "V 4  $V  " >>> >  > Ȑ "" $   " 7@pb $$&  㿘  " " <@ &  "  @> @y 6  2 " h >!Ԁ  f @ Ȕ ` H't'x'T`'P'|  2 ` `l`J k } * @P 2w` >'@td'H'D`* @@@d@;0@)@6Z 0>!А! ? ? ? ? (? 0? 8? @? H? P? X?? '!7>dH?('0'4 '8H`* @@(>'(`'0t'4d'8',`* @@( 2` $ <& m & >c8'(c8', * @@( 8` D''ؐ '`''`` ` @N`  (0H* @jC 8 = &>cX'' ''cX' * @@* <`"& =T@V@@! )`  `  2` =   沔  &`@ @nunp_connect2㿘V@V@  )`" V  >""  "  9 unp_disconnect㿘 (& R``  2 $ >〤 2  @"  $ & ` ?2`(%$ 㿘R    㿘4 $   $ ꤐ  unp_externalize㿐 > ` @2`  6* (@E $ ! (6 '> F ">" Ԁ*" $Ԑ?3 $     ` ?26   / 0@  `@(` @ & @  >`@(@ "  2 !2 #!Ԑ 㿘>`  "`>">Ѐ  " p?#  4  2 ?##>%>" 5`pT "- @`p @4 ? $`p@2 T "@4 T 2 " > \@2  "D>@Pc< 2T `p 2> &> !8 * >b T `T @2    2  $@`  4  2T @ `?<@ @ƒ ?` &>" 㿘>@ct㿘 .?# &R 2 (`2` 2@ ?2 ` @ @`&@ 2R    >p p  2 㿘 >Ԕ2 "i bremfree: lost tail㿘   >"` @: > ` ">`@ *`>"@2 >W#  ""`  "@㿘>"   ""*"  !>> >>`"H @j@kXG1>!P#!'>☢ ! l@l?$ 8$ \$ `$ >!, $ <>  > @o$ , ,$ $`>">" $  "` ""$ ☀ $" $$ > â`l㿐 @  $"2#' $ & $ > \?2 6& \>'' P`* @@>  `, "`,'@m㿐\ `@Ҙ `$"2#$@?`$ &`$ >`\?2 4&`\>''`P`* @@>  `, "`,$@`>#> @@ 20`@ @ $""?$  "$ a\?a 4"\a''Pa`* @@>  `, "`,@ڐ `/`@ɴ@㿐'P'T\PT #\#`㿐 $2   ? P "?  " ?  @?@d[  $! $ @& $H /* %  "> P@ P  `0 "`0 P`4 "`4H 0@ $> & $'' P`* @@ "" @H /* %  P@ѐ0>  `0 "`0H 0@R㿘 㿘 $ 2 : $>` & $``0 "`0H /*% P@H 0 :*`" * >`   @0  $ ?& $ $b" $@㿐 $> & $'' P`* @@㿘>b$ b$k"b$ $ @ $ * & $`H /* % $   $ 7& $ $"@" , $ & $ , $ P $@  P @ $ , ?& $`>>"" &  "` ""&  $@> " $ >">"& & " " $?ߒc & $H 02>̄ >H( "  D 2  P 2 $ 2 D getblk㿘>4>`̐ H* @@ G D2? P2;H /* % $   $  " $>(GH p@ ذ 0E $@ $`0& $$H 0 H 0 2 D $@В"@@ &@" $@& & D& HH /* % @$H 0@,㿘 @   $ & $>bb &b" "b& @allocbuf: buffer larger than MAXBSIZE requested㿘> @g@m( ,>" "l& 0:5 ,'>☐ @j  `$ $`$☀ $@" $$` ,`,$ `<  <"@#w@  ,& ,`,"`0 $`,$`0 , Ӑ  ,(4& 0H /* %>"`  H 0 & 0_`$ $`$H 0`< < ,@#>" ,"@" ,& , $" 0@ " $H& 0getnewbuf㿘H /* %>" "? >)0 ""$"$>`.H 0A  $ & $ $ "  PH 00̀ @VH 0 & $?& 8& D& H& L& (& 4& 0& X& T& h \?& d4& \ `?"-& ``"  "` "@biowait㿘H /* % $"  1>  hЖ  $"H 0 $$ $  ;$ $0  $(  ( " biodone already㿘 $"> !0 $"& $ $@@ $ @  $ L " $€4 $ 0 $ * " $>  㿘> Ȁ 2   >b`  "`*@&> >bܐ t* @  2  @2L 2 @h !   2  2 >b`  s"`@2 >b` C"` 2  @`:&>b` "` `W  "`   "@$ >b$ b" I"b @>b`  "` b "b `"  "`   "@$ >b$ b" "b ?(&@ `"  "` >""  "@` "` "$ >bؔb؀ $ bؐ "`  ">""ؐ"$  㿘> Ȁ Z#>b0>aH  > @  @g @b0 $b0"؀ E" ` "` "  "@ ` ` 2"  "@$ `$ ` $ $  $  !, *:):$ >b$ b" "b> >"ܒ@ @t*`  $ " " $ 㿘>""ؐ"" >!H> >"`t> " >>t(@ *>"  2  :> " >؀`4`",`""`&``"``  ` # ` ` ` @2 `@ "`؀"`؄` `# ""` 2`cluster_read: DONE bph  \s $`$ 5 T @@   `$>`&`$``,  "`,   ` `& T& X`@j: Ȗ € `>d'''''d' * @@ت`?$ X@4  T T:  :& T    ` *` 8 & T & T T 4']@d``@i&`H: pk` f`>d'''''d' * @@تS`?N$ X@4  T T:  :& T    ` *` 8 & T & T T 4' #\#`@c#d   $$ $$ H   >  `, "`,` `$">>E (''`P`* @@ت ` $" > $?c $ $ '' P`* @@؀ "  ` ,@c D@& X`Ɛ㿐\`d@h`: 2    $& H& $0v#\@q $".0hbR@  +^ $$ $  $ < @  @@$ @& @+> 7  ژ ,@<<@ @(&H` &@ @@<@` &H@ &H,``@$` &$ @  $  "@`2   + $& @ & $& L@hY:㿘@    $"\& H\@hA"> & L $& H @& $cluster_callback: too little memory㿘 $(  ( @ <& @ @ <@$ 0 ,`$ , $$ (($ $ ,"& ,  ??$  ," & 06>  h <"@@& 0& L + $ 0 $ * " $h D` P$ D$ H$ P$ L P "  D@2   0 L H;`  "I H  $@bX? P` ' H  D 0# @h  0`@g: "!>d''''Ԑ H'ؒd' * @@Ȁ  H? $$ P H$ L$ H$ D $ P`$ H$ D$ H @   @*$ P$ H͐$ D H$ LClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocks㿘e    ?` ̐0 n žⴒ g $ 20?ŐԐ,@?ː/   + 0$, $$ $@$$@> $$L<`@$$g?! _`Z`   `$ 2 H   $ ,H`H: @>Dǐ#`D>`H#>Ր#`<@N0,$0@$,`$`, $`$"@`$$`, $`$H /*%`P@ `P`4 "`4H 0@-  "    +$$@ $$I$L?"6㿘 +D H "* &  & H`,   ?`0  , "  &  -operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operation㿘`2'  !>! ޑ* !@c%*`" `2>"P@" >#>>0   * $@ 2vfs_opv_init: operation vector without default routine.㿘>"P*` 2>>  !   @ bP* "@ `㿘>a, a,  >a,  a,  >, , 2>>!耠 !a  "a㿘@>@!>>(`Б*   "( ,( * *㿘 \  7`O W` J  "@E @ B&> ` 2 `` 2`?? ( DB? ( ( < < $ $ ` 4 $ $ $4    0@@*@x (0 ( lf_setlock: lost lock㿐V  $   ('>@"n'  @ʒ ( # $T$ $". @"* `h$ `l2!>!>!  @ @"` @2`h (Ұ "`l >?*  @2 &  6 @ 6 & @Ip    $ 2 $   > g ( >" @+ `*`0|Ĕ̀`z"v& V   R` @D   (32d V R@2( (Y  @  @ " & `B :@@V   R` 2 $@ ` $$@& $`  "  '&  "@ ( ' & "   B@: `"&  B: @ 㿐  2'0KG >! @?@? 9* ŔŰ< "@ (0) @   @Ր @j "`  "@  (ː B? : ' `B : 㿘@)#  6`6` >@ ?2   ?2   >` @ b `B >` @?  0&`&`6` 㿐 '  @ "  V  R` 2` lf_findoverlap: default㿘 ' `` `@> "  `@6    ?   @ $   2  2    4   8  & '  2  2    2   "   4$   2 "  4  2|  (x  ?2   ?2 n  4"  @2 "^  @  ? @ 4  @ 2Q   8 K  4  2  @(  4  29  @(5  ?2  ?2 +   > 2 > @ 4 @    > ?>  >#`  `  $2$" $$2$ $㿘 `@2   ` @2 ``B > '&` `@ ( `@  (` B?> &`  ( 1 (``B < $ $` B?> $ &` & 㿘 $  & $ $" $C" X`,`( `$`,$`0d $  $`4` @$`4/`$`4/e` " $` ’ $` 0 >  @`2 } $` >!$`  $`А 2`$J /2$`@  $`?$`J@ /"`` ` 2`$`@@@`@dz s $p "` ` 2` >`c8'c8'* @@` ``$` `  $? '''А 'Ԙ  ?''''`> b\'''b\'* @@ ` ('0 "`% #  ?#  ?( `0 $*``@@s$`o`  @{`@j`$`lookup: SAVESTARTx($$ `   `@ @`>$` *@$` $' ' *` @$` ` $``/" ``@$`J  `"`$`v ?$" $`@$`J 2 ``2`*@$`` 2``J` .2 `J@ .2`` *@$`J 2``   *@$``J 2(` 8 ; @ 7 "$$  4 $` 2 `>c8'c8' * @@`@ > 0@*1> >!2$$  4  "$`!2$' @`   4 # '# ' * @@ $>b|'''b|' * @@ఒ4 ? ?   ' @`  > 4 c 'c ' * @@$?    `@ $ 2` `$'` $``  $` "@$$` @ @"   8 < €ܰ2q`@5$ 8 2  8 <" 8`!" 8 2``@@J /2@@$`f J@ /2@$`J@ / ` $`?$`J /"`@ $` ?  /    *" `   "`!``@$` 2`2`@` & >c8'c8' * @@ ` J  >c8'c8'* @@@@$relookup: lookup on dot-dot㿀 `@>* & ' ' *` @ J 2$ 8    "0 2 &@>c8'c8' * @@&@@q >] 0@>>V#b|'''b|' * @@ఒ?TR    M@L   H4 ? @+    &" `  0@` 4`2@4 # >c8'c8' * @@    @@ >c8'c8'`* @@@@&@> pp >@ @ vfslock㿘  " %#> &  ao    &  vfs_unlock: not locked㿘 @*@>"h@& *@& vfsbusy㿘  " % #> &   b9   @@2 @&  vfs_unbusy: not busy㿘 @*@>~#X @& *@& y >@@" @ < 2 @` 2 < 㿐>& @#>8 * `& <`28 8*  '>"@"@@' ͐ a8 '`6a8& <J  * *`8J "??: : H?" <" @" 8" 4" 0" ," (" $" D" " " " " ?2 2 " Xvnodefree vnodefree vnode isn't㿘>"p "p>!H>`,* @  > ,>!H@   w @Z >`, 0"`, 2T >!p&4  "  >!x@1>Ȑ!` "` "  "@z"$  8 $ @@$$ $ T$ X$ D$ L$ H$ P$ <$ 8$ x$ @ & 4 $ |   ` $" ( ( ( ( $ ` " `" $` $ ("``" (vwakeup: neg numoutput㿘 $@*@ P& $``4? "`4>j#@  "@d`4vinvalbuf: dirty bufsvinvalbufvinvalbuf: flush failed㿀`>`''' '`'`* @@ఒ`0 %>>3 %>`,` ` ``D ```2`D```0` ` ``D ```2`D`Q `D &:H /* %$   $ @ " $> (H 0 "`,06u$ &$H 0$ `Đ $@ " $c``,''P`* @@`,`  `0 >`, > 8vflushbuf: not dirtyvflushbufvflushbuf: dirty㿘H /* % 0 &  $   $ >" $ $ $H 0 P`0I0ՠ@`2  4H 00  4!>  &" 4  4H 0 0 >"@0bgetvp: not free㿘`P " >< h & &`P 8? 8? < &`8 , &` ,`"` & , ,&` brelvp: NULL㿘 P 2 > !P#!@  `"  "`   "@&  P& P`?"`reassignbuf: NULL㿘`2 >!x0!P#!@  `"  "`   "@&  $ "`,`0@ & @ "` &@& 㿘@  㿘@ 㿐?  >ʖ &@ $ 8@  '@Ð&@ 㿐 8? >`b @ @ ?* >` @ '  < @2 < 8 8@2    ~ $ <"  <" <@"` < " $@($h@k" c8'c8' * @@@  &  x& x$ 8vget㿐 V  z "ۀ@2 V &> ǖ !  2  `"  "` >""t  "@ `  6 >c 'c ' * @@ vref used where vget required㿘V  >!p`6 㿐>c8'c8' * @@@㿐 ?6 *  >& bt& bt" "bt>b'b' * @@ " holdrele: holdcnt㿘  4?>"x& vflush: not busy㿘 @ >"  8 - $ 2'" T T  "  8 2T   "` 8? @א @ >b "  2 `  vclean: deadlockvclean: cannot reclaimxV   6 >c 'c ' * @@!"!>E#貎` & ?   >c8'c8' * @@ `>c,''ܐ '?'c,' * @@>b'b' * @@>b'b' * @@؀  > >>"& x&  ~b& |&vgoneall㿘(4! >"& | 0+!(#& <"< < ` 2<8 8@2 < "<@  2<(2 < >&@vgonemissing bdevmissing alias㿘! "& >9 0~>   8? 8MV  <@2 `"  "``" <2<2>w"("+ < <@ ` < 2 <8 8@2< < 2<>S"2 7" 7& <| & bpbp  ""`"   ">bpbp & bp "`  ">""p"p&  & 8: ?>ฅ(" < 2 <8@2<" 2< 㿘(2 <"V P @ ` < @  8 8@2  R  2< VBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %d, writecount %d, refcount %ld,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBWAIT|VALIASED flags (%s) P"`8>"x`8>V`b V`*  `>t"/@ >@UOb@ >@UHb@ >@UAb@!>@U:b@">@U3b@$>@U,b@(>@U%bO >#;`| >>4#0 1#>c'c'`* @@kinfo: vp changed 㿐 > , ` *` * E&@$&@A >"@"@@ 7 o 2-$  >"0 >  @ܐ%  2 % " $ 'h2$&@  <" " `" `< 2 `<`8 82`<2 `<`2`< 㿘\  "u `4 P&$`0 4`4  "g$ .  €@C.  1d  z-@TuX`\%M `\ 4,`d" \X% < d 4, .  >!`. @2`` 2`$``2@.   7  @`4   P&$`0 4`4 z 1㿘  z 1 㿘 %> " ` (zҒ & `` 㿘@"  <& ! P " !&  㿘 !  *  ` `€ 2  "2㿘` /   @!2 `@p  @2 2 2   2 2 2 * `  unmount of %s failed with error %d WARNING: some file systems would not unmount 㿘>"D"D? +>)> @^cȔ""e h >[#syncing disks... %d giving up done 㿘H o@>A#>!  >@c >#Ȓ @ >#Ȓ @~  )>  > *`" * " !* @  >!$  "   ">># '3' @ۢ@ >#> ufsffs  'd D'h'D`@'@'lW@`@>P@ 2`K @  2`@ -`@  @  $   D@ ~ ,   ">`!7 &`>c8'8c8'<`* @@8` >c' '$'(',c'0`* @@  @ ~_     `!  &`   8 `8 "@װ  " >@!(6> Г,@`0@@Qٔ >aX@Q  >>a`@Q˔ >a( > Ф   " (@QД  (  >!(*`<F  ! ?  w @R! > Х,@$ w`0 "`0$`<$   $ D` "   `@$   $ `  ~@$ `@ ` @ @@ @ $   @*@B$ @$ , 2, >@$`$ @ 2`"@">""D@2>c8' c8'$`* @@     ," <> @0"0xT mount: lost mount㿐V  : < `€ ">># H`!>` 2  ` 2`$  2 `` 2`$ ``2`!>! `$! 2`pP'Ԑ D''@''ܰ& `D@  }"`Q0`@  E`@= unmount: dangling vnode㿘 v T  @@ 6& 2L  @"& }  @    @* m&  ",# "` >@@"@"@`" $`< `0"`0  ">͐ wx 㿘>"@"@@ &  `@ 2`` ?$`  @  "@` @$`@@2` P'Ԑ @''@'X'܀    `` ` @P'Ԑ @''@'>'܀      4 ` !㿐 @@ Ҕ    `   4 ` ֔!㿘 @>"@"@` *2  !6 @2`      2  ! 4  ܀$&&& h @@ uW `> 6`c 'c '`* @@`8 .  >cX''Ԑ @''cX'`* @@>@ @" S   `€̰ >̐̀ "`<>c8'c8'`* @@Ѐ `$` ÐP` D'''@'@-'܀   $ P  {G 2'Ԑ D''@'@'܀   " $ 㿀/'  8  `>cX'' @''cX' * @@>c8'c8' * @@ ^eF`` @'''+ @ ''Ė8 @ $X"$Xew  ?X fb?"B A`0 `ϒ 4 4 >"8$ G$ 7  ?` ? 77`  0>c8'c8'`* @@>`'p't'x '|'`'`* @@p>T  @ e$* "@c 'pc 't`* @@p  4 >c8'pc8't`* @@p &آ` za` 't 'x'T@P'P['|``>@ !А! ? ? ? ? (? 0? 8? @? H? P? X??` ` /* 7 ' < @ @8@   @ @ 2  '' '  H>`>dH'8'<'@'D H'H* @@8!>t'8t'@ d'Dt'<`* @@8 >'8d'@'<`* @@8(d0/>'8`'@t'Dd'H'<`* @@8'8td'@'<`* @@8d``Ȑ 't 'x'T@P'P'| 2d` >'@td'H'D`* @@@`@ 0А `G >!А! ? ? ? ? (? 0? 8? @? H? P? X?? ' `` /* 7 >dH'(','0'4 H'8* @@(>'(`'0t'4d'8',`* @@(('Ԑ @''@'1'ܰ[ 'Ԑ ''`'$'ܰL >'''`* @@@c P \ 0.!>!H ''''!H'`* @@''''!H'`* @@>D'''D'`* @@,Ƞ$ r @$I r 't 'x'T`P'P'|e` >'@td'H'D`* @@@`@ ` ` F>!А! ? ? ? ? (? 0? 8? @? H? P? X??  8 !7 >dH'(','0'4 H'8* @@(>'(`'0t'4'8d'<',`* @@(s8 ( ' ''@'C'ܰS >@2 >'''`* @@@| i  0 r>ĐH?''H'`* @@>t'''t'`* @@ >'''`* @@7ā( 'Ԑ ''@''܀ M@ >'''`* @@Ā 0 0 @ 6 !>!H''''!H'`* @@ ''''!H'`* @@>'Đ'''* @@   @@*@ 2T 2 "`-  "    "!`# > ` c''''c'* @@  `@ B < <   >8   $  $ 'Ԑ D''@'<'ܰ2&$ ``*`` !``2`@`>@ >cX''''cX'`* @@^$ $ 't D'x'T@P'P'|`@ E` ` `'t 'x'T@P'P'|`@ '` ` `@'Ԑ D''@''ܰ>`?''`* @@' ''@'', 8 " `'`  ''А '?'''`'`>b\'x'|'b\' * @@x̐`" &آ't @'x'T@P'Ps'|P>``H'8'<'@'D H'H * @@8>c '8c '< * @@8   / >!А! ? ? ? ? (? 0? 8? @? H? P? X??`'`>c'8'<'@c'D'H * @@8j`@@˔Y `>H'x'|'' H' * @@x>c 'xc '| * @@x   / >!А! ? ? ? ? (? 0? 8? @? H? P? X??`'`>c'x'|'c'' * @@x>c8'xc8'| * @@xآ't @'x'T@P'P'|Q>``H'8'<'@'D H'H * @@8>c '8c '< * @@8   0 >!А! ? ? ? ? (? 0? 8? @? H? P? X??` /7`>c'8'<'@c'D'H * @@8`@@ Z `>H'x'|'' H' * @@x>c 'xc '| * @@x   0 >!А! ? ? ? ? (? 0? 8? @? H? P? X??` /7`>c'x'|'c'' * @@x>c8'xc8'| * @@xآ't @'x'T@P'P'|R>``H'8'<'@'D H'H * @@8>c '8c '< * @@8   1 >!А! ? ? ? ? (? 0? 8? @? H? P? X??`'`'`>c'8'<'@'Dc'H * @@8`@@G[ `>H'x'|'' H' * @@x>c 'xc '| * @@x   1 >!А! ? ? ? ? (? 0? 8? @? H? P? X??`'`'`>c'x'|''c' * @@x>c8'xc8'| * @@x>!А! ? ? ? ? (? 0? 8? @? H? P? X??`  ڔ " 'd0X@'' ''d @'h'D@@'@'lE> PH'(','0'4 H'8`* @@(>c '(c ',`* @@(`  $ '*`" *  * ''*`" *  * ' >c'(','0'4c'8`* @@(>!А! ? ? ? ? (? 0? 8? @? H? P? X??`  [ "  0\@1'' ' @@8N  >H'h'l'p't H'x`* @@h>c 'hc 'l`* @@h`  $ '*`" *  * ''*`" *  * ' >c'h'l'p'tc'x`* @@h>c8'hc8'l`* @@hآ't @'x'T@P'P+'|e>``H'8'<'@'D H'H * @@8>c '8c '< * @@8 8 E @@>`cX'8'< '@'DcX'H * @@8.>!А! ? ? ? ? (? 0? 8? @? H? P? X??`?`>c'8'<'@c'D'H * @@8 `@@nb` 2`\ ` >H'x'|'' H' * @@x>c 'xc '| * @@x 8 4 @}0>>!А! ? ? ? ? (? 0? 8? @? H? P? X??`? >c'x'|'c'' * @@x>c8'xc8'| * @@xp`@@( >c 'c ' * @@ >'''ؐ '' * @@а>c8'c8' * @@Ё ' ''@''ܢ ְ' ,''l`h'h '>'X'`'\`* @@XQOx`|8  `8 "8    `8  " `Ā` `@F "?`J>#> aH '@'D'H'LaH'P * @@@Ā@` '@'D'H'LaH'P`* @@@`> '@'D'H'LaH'P`* @@@>!|'@'L'X|x'D'H'P!|'T* @@@-'@|'H'D`* @@@Ő``>>'@'H'D`* @@@pl5  "l, 8` @Ȣ 't 'x'T@P'P4'|e` >'@td'H'D`* @@@ds0anI >!А! ? ? ? ? (? 0? 8? @? H? P? X ??'``` !* 7`>dH?('0'4H'8`* @@(>'(`'0t'4d'8',`* @@(`8 'Ԑ ''@''ܰY`8   2@  2  1>!>!H ''''!H'`* @@''''!H'`* @@>'Đ'''* @@'''`* @@Ā0쮐Ф@@̰` 2`   8  `'`'Ԑ'ؐ ''''`>'c 'c ' * @@`?`>0''''''0' *` @'4:`>c8'c8' * @@ z`@V> `X 2O`@.F> c''8''c' * @@x `8 `0 >c'' ''c'`* @@>c8'c8'`* @@ $02 ̄  " :@Җ'l 8`耢@4 4 ` `    ̒`4 " :R 84` j `"@ & "@ 0ؠ't @'x'T@P'P'|2``8? +  >c'8'<'@'Dc'H`* @@8 @ o[  V` @(좐몐 @*`" P    8 "  `,br $`$ h$`( L$`() ` B>>aВa`?`?`?` ?`(?`0?`8?`@?`H?`P?`X??'7>H` ''?H' *` @>`b''`'`$'b'* @@˲{*```$'''* @@``@& $` $`h`  }$`$ D$`(㾐``8 b -1d`>cX''!''cX'`* @@dd`8 } @x>cX'' ''cX'`* @@hdP>c8'c8'`* @@>aH''? 'aH`*` @>c 'c '`* @@>''''>!'! ? ? ? ? (? 0? 8? @? H? P? X  ???`* @@>c''''c'`* @@` ` 4`c㿘   " 8`> *`@@@@@@@@@@   " @o   㿀` ?4 >c,''''c,' * @@3P\`dh  l>c 'c '`* @@Ȑ'ؐ '?'?''  '>c'''' c>`''''`'`* @@ %耢  "   >c8'c8'`* @@㿀 >`H'''' H'`* @@>c 'c '`* @@ >`>` '''*` `''`* @@` $ < @ C > >8''8`*` @㿀  8    2   2`>`H'''' H' * @@>c 'c ' * @@ `>`>`''''`' * @@` ``$:  @ B > >c8'c8' * @@ >c''''c' * @@ "Q&@&` 8?`$>!X*`@EtEEEEEE  ( 0% 6`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`H "@<>`8 `  8?`0>"*`@FFGDGDG<G<GD"@2>c''''c' * @@5` "@ 0&!@ + ) >T``4'`'d'h'l'p't`4'x * @@` a@   " "   4 㿀V  > ``'''''``'* @@㿘 V  %defaultvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_selectvop_mmapvop_fsyncvop_seekvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_islockedvop_pathconfvop_advlockvop_blkatoffvop_vallocvop_reallocblksvop_vfreevop_truncatevop_updatevop_leasevop_whiteoutvop_strategyvop_bwrite    dead_read: lock㿘@  " >#( @? dead_write: lock㿘@  >x#x 㿘@{   >  4`* @@  㿐  P " @b  > `$("`$@    ?`P`* @@㿘@G   > # `* @@ 㿀@5  >     cd''?'cd'* @@ tag VT_NON, dead vnode 㿘>!@  dead_badop called㿘>!x㿘!   "&zy !"fdesc㿐 @@ 5 - @Ֆ 2.  dh #>a "8`"#&! @ & g h Y Zh@>"@  @> Z   㿘 !@  >"   T    2 櫐!e5 &! 㿐! > 4 c 'c ' * @@&@  -㿘  8     * *@ "`@ &@  6@#@"&`&` &` &`&``&` @&` <`   h`L Z ’` Z `<@@=    - - -㿘>"H 6>>#>Ř!  @ ">ϔ `(>ϑ*"a > s>"c㿘 > >c@* @@ > 2 `2  寒 2@ =& 2 >a@  a@ "a@ ye @ "a@ >ז>ː  Tc^ "`|$ $ ?$ $ $ @ $@" $@$ >@@ `"@ "@y fdttystdinfd/0stdoutfd/1stderrfd/2..㿈      L .2 %@> 4c 'c ' |   ` ɐ 2 >b@=  2   `쀢 2%@>%@ d"`8  2# >b@=f  2  ( "        :쀢 2%@>%@=    $ >b@=<   >" >c@=1  >#  >c@=&   >#  B 쀢 2V%@`|>" %@ "`8 ' '`* @@D  2 >c @<  2 _3  @*`*: @Ѐ@  А ,`L @   ,`@   `쀢 2 %@`| " %@%@㿘 | `># *`@WXWXW WXW8|    "`X>!    fdesc attr `6_ @. @ 2R W ``" N> >c''''c'* @@?@ ;?`# @66`ɒ11 &@6`6`&`&` &`&`>`&` &`$&`(&`,&`0&`4&`8&`<&`@&`DЖ @8R >`H##hfdesc_getattr㿘 `|  `a >!P*`@YdYdZYdYd@; ``| $ `| ``!!m!m4  $$ D 4 `|@;  < 4 $ 4 >!  <  $ D4  $$ D 4  "< $ $ ` <$ "$ >#  $ $$ ($ <$ @ $< H ($ , ,$ 0 0$ 4 $ 8`|   4>!$`8fdesc setattr㿀   | ` ` * `*@@ 2R  ``" >  > c''''c' * @@s"%d㾐    |   2  `    @;/  7  | S , * >a >!Ā6 2`( "/` `   2'`  :"` *@ "` ' `/ `` U @pG/O ? %@``   C >?=   6 4  '/>#  ' `*? /, @ " '>cd// p  ?%@``ʠ < <㿘 `8 "`| ` 2  -`@:G oߐ㿘  |  ->!   㿘  |  ->!   㿘  |   ->!     㿘  |  ->! 7    8 㿘  |`""`"@ |` T& | `%>(`aaaa``aa `   ` "  `    `    tag VT_NON, fdesc vnode 㿘>!   㿈 > b''b'* @@   㿈 > b''b'* @@  㿘  $`   -fdesc: bad op㿘>~ѐ"(   p`< 23  _T $`<  ܖ    $ R$ " $ `L $`<$  2` 2` "    $    2  $u  "    $   2   $uq  * 2) 2%)>%>#8'#8'`* @@ !>(s  ' '`* @@耦 29 #8 .   : )  5 )>%>#8'#8'`* @@ !>(s  ' '`* @@耦 2   #8  >c,''?c,'`* @@Ё㿐   <`6  "`!4`> c8'c8'* @@    >  '' *` @2 ` ?4` ` >4`㿐   <`  !4 > c8'c8'* @@     >  ' '*` @   >4 p  "~@"#      <'   Ѐ 2  "   < '   Ѐ  p    <'  cЀ 2 "   < '  TЀ     ``    㿘    `< ? $    " T` ? $ T`   ^  $`<tag VT_NON 㿘>}!@ >}ߐ! , fifo with %ld readers and %ld writers㿘 <> }̐!"        "     -fifo_badop called㿘>|"kernfs_get_rrootdev: no raw root device 㿘>4 $ >܀?"4>bH >'>  `ܑ,  ` @:$0`܀  H &, >?"#0>}f"Ёkernfs㿐 @@ 7 ->p 2/  @\ #>c "8`"#&! @ "&  h Y Zh@7#"@  @7 Z    㿘 !@  >"   T   r 2 9r!]Ò @&! 㿐! > 4 c 'c ' * @@&@  -㿘6@"&`&` &` &`&`&` @&` <`  2  h`L . Z ’` * Z `<@@6S    - - -versiontimerrootdevrootdevphysmempagesizemsgbufloadavghzhostnamecopyrightboottime...%ld %ld %d %d %d %d %ld 㿐 "'  5  " [ B 5 Y /+>R oN @>~b09@>~b032&:> o8p /" "8` +&"H>"#  *@* >bP(# bP( > }ߒb@5&& 㿘 /2 J? "!>Р"q.>""H 㿐   %@? Z   >L .>%@   L5 #p>`P 6 `?2 @6    P ` / -  ` G `?$  ` Ŕ %@ݚ  2  >Ֆ    T[\ "`|" `  "`8%@ 㿘 @ 2!m`|    Ӕ 㾈  ` @5چ$ $ ` <  $ < "@$ $ $   4*`" *  * $ ($ 4$ <$ @$ D 8< H $$ 8 ($ ,$ 0@   $!m4  4 $  "< `| `  $`4  4 >#p$@:  $ '! > <   㾐 `8   -`|' !j}  㾘 `8  ' -`| ` "   8 j\ "  2  *?@4Ԓ㾈    8  P  4J    @4В  7,`>#p`6> P@0 G` ?"!  ޺쀢 " `' /   j/ ?`%@`  Т`<`<  8 㿘  | [P T& | `%>8(w\wwwwwtwww `   ` "  `    `    tag VT_KERNFS, kernfs vnode 㿘>zQ#  㿈 > b''b'* @@b  㿈 > b''b'* @@P  㿘  $Z   -kernfs: bad op㿘>y' Ё㿘 > i>"bnull_node_find: vget failed. 㿘>">6` * @` #>`2@`  2 @۹  yݐa `2` 㿐 > "  T`8 Ym# 8`8`   Yc "`<`<` " "|$ $ $  &Zh T`8?  `<Z_  >b" 8" \ @`8? >`< :` ?* >` @  << ` 2 <8 8@2  ">6` *   $ " " $  㿈8  'Y [|`  "`>c 'c '* @@ &lofs㿀@@f - _ T&$&(&&&,T'&  X   $@>c8'c8'* @@耦  Y 0.@ "@$``|    "$ $$>פ xh Y Z`h@2$ ” Y `@2$   㿘 !@   >"   T    2 ڹ!YC &! 㿐!  > 4 c 'c ' * @@&@ 㿘!  @㾘@2M!!  "(6@6`&`&`&` &` &`&` @&` <`   h`L Z ’` Z `<@@1   㿘!   - -nullnull_bypass: %s >!耢 > x  >   ?#  " "" a؀@""" | `"@` 2`<`  ܘ x *` @ ,  ?" @`" `"`|  ?"    ߣ<`!" >b|    _@ 㿘 2    < "` 㿘  |`""`"@ |X4 T& |٢ tag VT_NULLFS, vp=%p, lowervp=%p %s%s (LOCKED) (LLOCK) nullfs lowervp㿘 >  |# wI  > #> #> #  "> > #Д#w5  | > ۬# 㿐  P`| >$ P'' P`* @@$ P㿐  P`| >$ P'' P`* @@$ Pnulllock1nulllock2㿐 ! 1>!"$ ! k !" |   T  > c 'c '* @@  &      & >!0k~  &  㿐  |  ` & > c8'c8'* @@  `&  & lÐ  |2  㿐  "  ` ?"`^  @X | `" +   |` ` ?"`>c8'c8' * @@`#>c 'c '`* @@   @*'!c `>c 'c '* @@  |` ` ?"`   @ >c8'c8' * @@portal㿀 @@` -Ô  2Z 쀢 2S     I ,><%耢 2A  TU   "|U  "8|`""|"@|"`## >" x `2  &!@ & ԛ h Y7 Z`h@/ǒ$  ” Y,`@/$   㿘 !@  >"   T    2ܐ!   ! F !V] &! 㿐! > 4 c 'c ' * @@&@  -㿘6@"&`&` &` &`&` &` @&` <` ˔  h`Lǔ Z ’`Ô Z `<@@.    - - -portal_closefd: error = %d 㿈'D>"uE#؁㿐   '%? H    L . %`  :2``><@-  T  T# 8 "`|L`J    T # T$ $`$@`\>b "b$`% %㿘`"! =VV@@"` ) ( 2` =    沔 &`portalconportal_open: %d extra fds  't'l   `X  | t  ltbP l t` lH /* !t  $  R  >#t>0 "+ i) t` `$ " H 0t$ 2RP2vt`@2P @2t 'x  '|  ' x 7  @ 'Ȑ P'̒ ؖ   '  t''؄ '܄ '''?P,'谒hl ' 'p @'ht ؖplhWp "l% 'p`- l  " 6l 耢 "'pl`8l`@?2 `. =` >#" s 6 `@ ``,@ R`     =H 0l%`X l "tt Ȓ t㿐  ` @-Ҧ$ $   < "$ < "@ $ $ $   4*`" *  * $ ($ 4$ <$ @$ D 8< H $$ 8 ($ ,$ 0  $!4   4  $!4  4  | $        㿘  |  " T' T$   |T" T " | `%>$(XXll0DlX `   ` "  `    `    tag VT_PORTAL, portal vnode 㿘>%s# x  㿈 > b''b'* @@4  㿈 > b''b'* @@"  㿘  $S   -portal: bad op㿘>%q!waitrunstepdetachattachusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfsprocfs_control㿘`(2 `0 0@ &`(`D@6``0I&`T^’  N`-  `D`((0+6`" `(q>%q"4`(k>%(q `D 7`T&`(`0" &`TU "&`TI[&`T`(* hN&`(SN`-`  &``( @2@ ` ?>&`0C(+ N`-  5>%`D! f  N`-  `((2`D &N`- 2" `D2 `(( !>%N`- ! "f "N`-0 p"N`-  h 㿀 6 - '@E䰒,> -#@j`1> @]N`- 2``D2 ``((`h2  `] 㾐!$ @  `  &``(  @Ȓ  @T `ϔ2` 2 `N`-  @K`  ?&`> (2   h'>`/> `?` >@ >!*@"@`"@8 `    @c `?   @3 e'`  #\#`#d@谒@|  `0 @ې " "  @G   >'@ @پ @@  ؒؔ`5@@   @Ԕ@ ` 4y` 㿘`  e H  @  '@(  -H P$ @  `  &``(  @Ǟ  @> _۔2` 2 `N`-  @0`  ?&`> (2    %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld -1,-1 %ld,%ld %ld,%ld %snochan %d,%d 㾈  -`D `0 0`   ` `0`Ӓ /@)>'cqΚ`(`  ` `n `o>'c>'c??q>' ` #>'qc>'#`  2 J>'qc>'#J ,>'qcȰ`(  ```>'qc>'qcX= >'q|c`h>(` `l>( qn!>(` @ `qd`q_T` @ %>( qT`T` @ >(qK` & "   @4@  ^ߔprocfs_allocvp㿘>!H> 2 2 E >&@w 2 >aL  aL "aL d >ː "aL >lR>@  TN $ |"" """*  -">) p.@!m2 $ 8 $!$2 $ 8!m2 $ 8! !$2 $ 8>(n#>!H`!H 2">LL `"L "Le  㿘>!H!H`  | 2"   |O T& | 㿘   | `R->#Ȁ2 = ?`8>)"@*`@x\\ &   Ė S  Ȗ -㿘  2(  ""   (]ɔ   > .@@("J? 2&?.@& 㿘 @(    procfs: invalid directory entry sizeprocfs㿐 @@2! -@& &!#>*`0 h Z Zh@("@  @( Zx  㿘@  >"    q  㿘 |  㿘6@>a&`a&` &` &`&`>!D>` &`" &` @  <` =  h`L9 Z ’`5 Z `<@@'^   -  -  notepgnotestatusctlfpregsregsmemfile...㿘  |  2$  ">Q #Ȁ 2  `h (2 h       ($  |` >*D(p `"`     ``  㿘  | ">P #Ȁ д  㿘Q `%>+h(̐ `   ` "  `    `    tag VT_PROCFS, type %d, pid %d, mode %x, flags %lx 㿘  |   >+ l  㿈 > b''b'* @@   㿈 > b''b'* @@  㿘  $M   %ldprocfs_getattr㿀  |    ">P#Ȁ`> ><< < <  < (< (0< 08< 8@< @H< HP< PX< X  8$4 $ $ @>!  $ < @< H$ 4*`" *  *  4$ 8 8$ , ,$ 0 0$ $$ (` ' >+#*`@    `(!? "I @4  4 ` $ ` $ ` M*`>, D@p8Hhhhh 4 $ $  4 $ $ >`>+0mϒb : < H+<  4 ` $ ` $  "< H<  -` Ԕ > *  :  P<  !< < H>+k "(   > c''''c'* @@   curproc㿐   %@?   2  |M .2 |%@   5   "0 @  2>,!@%˔  2  i @N!1e >N#Ȁ`[ S @"  |S ">N#Ȁ`C>!`>b 6=  ?2 ?@% 2  `"@   b  2  > 4 c 'c ' * @@%@      㿘j@ 㾐     ` |    @%  7 N 2  ">N^#Ȁ,`>a`  >"@ `" @ ""  ``  *  ' /  1 Z#/f `%   Z`>>` H  O`  K`%``   '/>*"` *? "/' />,!  /  & 0`*``'>+ 0l,b / /  Y˔ %`  <`= 㿈  |  2 > `0>+lb  Y 0 Є  * (Ѕ*8 !12    㿈`<` ` `  `8`>. *`@888 8888>"H  ?1,  ,>"  , * >c  $ t >" , @? ߔ  R`  \@ W , * ># $ >@ $@c8'c8'`* @@>c 'c '`* @@0.>#* >"  ?  , "* >`    , "*>   spec_read typep      8 ' >.>c8'c8'* @@<  *@ *`>㰒@ ` >c 'c '* @@0  ( '<># `")` *" * >`  `  `h@   `  ` " ``"@&' ( 2@  @ 0= ( @ؕ>   &@8  '?#\#`K  ?ܰ$ 4"@ 8  <Xn܀     `0gА#H` spec_write type㿀  8 )` 2>/>c8'c8'* @@<  *@ *`>㰒@ `  >c 'c '* @@` 2` 6< >c( " ) *" * >`  `  `h@   `  ` " ``"@%O ( 2@ޒ`@i> < @(  `$@8   g '?V4$@8  <We e䀥 2`  g"` spec_ioctl㿘  <`  8  ` .>0+` *  > c     +` @ +`" * >`   @ " *  > `    @f͐!h㿘 `8 2 `< *@ *`> @ `  spec_fsync: not dirty㿘 `8 =H /* %`0   $   $ >0f"  $ $ $H 00ޠ@  `4`4d$@] `4 2@H 0 㿘  :*"@ *`>@ `@    ``    spec_close: not special㿘  < 8`- `I>1;      H   " & 4`!4` * @*`>#@`#    ƿ 2  4`!4` * "@*`> @`e `  tag VT_NON, dev %d, %d 㿘  < >1 fǐ! `%>1L(pưưƈƜư `   ` "  `    `     - spec_badop called㿘>1e"㿘 > Vs4>"b| 6?     ?(  6?    ?(@㿘>"4>6` |* @@` `2@`  2 @ 2@0`2` 㿐 >8G "  T`8 E# 8`8`   E "`<`<` " "|$ $  &Fƒ T`8?  `<F  >b" 8'" \ ^@`8? >`< :` ?* >` @  << ` 2 <8 8@2  "4>|6` *   $ " " $  㿐=  'Z ǹ &㿘+!` ?2&`#&``?2&`?#&`` ?#`ߔ?"&`&``` lofsh@@~ - w T&$&(&&&,lg&`8 "Q`  Dє `$$ $  ５*N"ﵕ*G{ܰ>c8'c8'* @@Ѐ 1E 0.@ "@$ `|    "$ $$>2̐#àh Y<̠ Z`h@̒$ ” Y1̐`@’$   㿘 !@   >"   T    2 !Ek &! 㿐!  > 4 c 'c ' * @@&@ 㿘!  @㾘@u!!  "(6@6`&`&`&` &` &`&` @&` <`   h`L Z ’` Z `<@@ڔ   㿘!   - -umapumap_bypass: %s umap_bypass: user was %d, group %d umap_bypass: user now %d, group %d umap_bypass: component credit user was %d, group %d umap_bypass: component credit user now %d, group %d umap_bypass: returning-user was %d umap_bypass: returning-user now %d umap_bypass: returning-component-user was %d umap_bypass: returning-component-user now %d       >!( >4cƐ P >   $ `"x`"   b8@""" | "@` 2`<``ۘ ?"&I&>!(   `>4 c h>!( "  `">4 cs ?)x I"` >a(`  ``>4`cY ؒ>!( " x``"x>4`cI x *` @ ,` ?"?`" <?"?`<`` "!22 "2   ?">!(    `>4c!("H&>!(  " `>4b!P?%>!(  ` ``>4bސ!xHǐ>a(` "    >4`bȐ!umap_getattr: mapped uid = %d, mapped gid = %d umap_getattr: original uid = %d umap_getattr: original gid = %d 㿘͐ " G   <"` )>!(` ` >5" b  !  !( ` " >5"Pbv #"` > a(` " >5"xb_  ?#"`   㿘  |`""`"@ |C T& |u 㿐  P`| >$ P ?`P`* @@$ P㿐  P`| >$ P ?`P`* @@$ P tag VT_UMAPFS, vp=%p, lowervp=%p 㿘 `|>6b ؁ umap_rename: rename component credit user was %d, group %d umap_rename: rename component credit user now %d, group %d 㿘 `  G>$` a(`  `>6 aӐ! R>!(   `>6 aÐ!`G$` 㿘>ː!P |"@<"@>ː!@ 㿘>˒!б.  2  &  &  W=  㿘>˔!б.  `& & W 㿘    2  @2  ` ː Ɛ @ @2 (@ (  ?`& ( "` "@@"   "& |  " B T&   "& o& & ??> 8  "& b& ??> 0@>˔!P, @ &@ " "@ @  (&  & (}㿘 㿘 ~㿘 8 1?? |`0 2:`0`4 :`0  2`8?`8?`< ?:`8??@Ւ union: unidentifiable allocation㿘  \ `a``>7_ɐ" `" `8`8@" @ `@ ``  ``` 4``  N @2 >ˬ!P "`  `0 `0 "9  "5 7`"1 4` Đ ,    2  2 `2  +  ` 2      Q@"  (   h  ( U$ (`$ ( @ `" R "  (  ?$ ( @ ` T $   ? $  ]   *@ 6$ `" '  $`  @2  < T` >X`  ``_0[ @ T?s "`|@`"@`8`8"`8 |$ $ ??< 0$ < 8$  6$ ,$ $  `$ ( $ ( ` T $   ?B $     *@ 6$ $ $ $ ` >˔!P,@ $@ " "@ @  ($  $ (`` Ӑ㿘 | (  ?`$ ( "` "@  "  "   " |  " v  " |? T |? T& | P' '  ?%>8'8'*` @#>aH''''aH'* @@!># '# '* @@'8'`* @ @'''' aH'`* @/@'# '`* @;>@ T> Ш''''''>c''''c'* @@#'''?'%'Ԁ '> ''''`'`* @@耢` > "'ؐ?m Tp@ (`  :& (>c 'c ' * @@>c''Ԥ ''c' * @@Т2  (D>c8'c8' * @@>c,''''c,' * @@ (> ?& (c8'c8'* @@В @>c 'c '* @@ (` (& ( $@#  '>%>,'''',' * @@А'''''`* @@ $`@,& $㿘 \ ' = '  f  *@ '' ' '   2  '  ' '  ' `l6`p#\ƒ "Y >>>!А! ? ? ? ? (? 0? 8? @? H? P? X?? ' >7aH'H|'L'TaH'P'X`* @@H>'H'L'P'T'X`* @@Hb'`'db'h`* @@`>c8'`c8'd`* @@`& 0>c8'c8'`* @@@&#\ВĖQ >c 'c '`* @@0AĀ >b''b'`* @@{y. `>H'''' H'`* @@>t''' t'`* @@ >b''b'`* @@K`%@8 `@¤ a' < '`\ 'p' 't'x'|'` l''`p 2`gu.`l >`b'X'\b'`* @@X`l@0lV >!А! ? ? ? ? (? 0? 8? @? H? P? X??'7>H` '@'D'H'LH'P* @@@>`b'@'D'H'Lb'P* @@@>'@'H'Ll'P'D`* @@@l`  2`%@l㿀`> ?6 c,''''c,' * @@㿐@ߐ (  ?`& ( "` "@ (  ?& (> c8'c8'* @@   >  c''''c'* @@  ؐ @ union: dircache table too small㿘 >`X `"  6 @`&@"@? &><[ А & |   ڔx>c 'c ' * @'@ | ,``'  T  ';s* ' |" ,"@`' |'@`   @ `'@ !>c 'c '* @@ `  2`  #\#` > |" ,`|" ,>c8'c8' * @@㿘 ,    ,<, T& ,union:::x   @@  -   ` 4`&$ P&(&&&, d&8    :Д  ``$ ```"$   0 $$ $B $$  2 >at'''at'* @@ఒi  $ @ 2@   `8 !$   "  @    " $ ><`# $@ $h Y"ܒ Zh@"@   "><  >< ><><><###Ȳ#@^ ² Z"?ܐ@ @$  ;O  @u`` 㿐 @ !>"  7 @6  /Ȕ "    $ `@ R` $`p   xv@@.`c!: &! 㿈! `2   2>c'c'* @@  > ' '*` @  `` 2`    #\ #`?` >c8'c8'* @@"   @ |`( ?"`( -㾘!@̒!` "    2H" &` " &`@   "6@46`&`&`` @@A&` `  &` &` `&` &` @&` <`   h`L Z ’` Z `<@@    - - -㿐> c 'c '* @@ ( & (x@@>#> > ' &@x  4 c 'c ' * @@2>b|''ܐ'b|' * @@ذ0:V07", @2'>c 'c ' * @@쀢@ @" N  `€찒)쀤"& 8 " <& union_lookup returning . (%p) not same as startdir (%p)``   ''h! |$ ` `'`e'l`( 2 W 1>`( $`(c8'c8'* @@R @` @>`( $`(c 'c '* @@  `"@  ?$ %l @2 l >  ?p'x'|'`* @@p  l؀   lI 2H >c 'c '* @@$ l $ h`$ hl  $>c8'c8'* @@ 4` @g 'T '`h"@  ?$  @ `  | 'h>`2 ' '*` @ 2`  ?$ `" 2h 8 /h`(> ?$`(c8'c8'* @@>c 'c '* @@`(  $`(h SO'hh >c8'c8'* @@`h#\ #`  "hh +֞`>  @2  >c8'c8'* @@   J . `@>?!XVp | `3 ( 2`` 4` ( $ (  >b''ܐ''b'`* @@ذ    #\#`f0c 㿈  | 2 ( - 2   > at'''at' * @@p | `5 ( 2`` 4` ( $ (*  >b''ܐ''b'`* @@ذ`    #\#`'0 㿀    | `A  `8 2 $4 ` ` C> c''?c'5 $> $ $c 'c '`* @@>c''?c'`* @@>c8'c8'`* @@0 ( >>c''?c'`* @@㿘  |` 2& `$`?"`$& >#,* @@㿀  | ` `( 2    > cX''?cX' * @@A` <>c 'c ' * @@ 1>#X''?#X' * @@࢒> !` 2>`''?#X' * @@>c8'c8' * @@   | $ (  2  > c''''c' * @@ 2A`??  2 8   >  c''''c' * @@ "`??    @ "  @ 2 ` 2    < "`㿀` |   8 2 `   "`  ` `/ "+  ( 2   `` >`c''?c'`* @@ఒ``?2``? `??[`x  |` "```?`"`(>c 'c ' * @@  2 Ɛ   > c''?c' * @@؀` >c8'c8' * @@؀`+  |   04@  ?? 84   <@  ??  union: missing upper layer in write㿀  |` 2`(>CS!h 2 d  > `''?`' * @@ࠒ  `0 `4  ?? 㿘  | `" & >!H`* @@㿘  | `" & > 4`* @@㿘  | `" & > ``* @@㿘  | `" & > `* @@x  |`  ` 6``?"`(>c 'c ' * @@  2 א   > `''?`' * @@؀ >c8'c8' * @@؁㿘  | `" & > `* @@union remove: null upper vnode㿈  |   |>DS! ` 9 (   4 ( $ ( `( 2 }  5 `( $`(    $>a'''a'* @@谒y0 2 T   ` K!union: null upperdvp?x``   |e'| 2`'>c 'c '* @@  @2` >`c8'c8'* @@` ` `    . '>DR"@`` 찒`>`c8'c8'* @@D  >`c8'c8'* @ @0>`c8'c8'* @@ ' "  "(d`0 2   4 ( $(V`>` aD'''aD' * @@ذx   >`X   | "^  4? `>`X 2`| "M    @ "  ` 4`& >`X  |` 22  4`( "`(  > `X 2  |`   4 `( "`(  > a|''''''a|'* @@ Ԑ ϐh` | A ( 2 #  6  (> $ (`c8'c8'* @@` >`a''Ԑ''a' * @@а"``0``  #\#` ` 0 union rmdir: null upper vnode㿈  |   |>EQ_#` 9 (  ɐ 4 ( $ (] `( 2   5 `( $`(O    $>a'''a'* @@谒0 2    ` !$"x  | `& ( 2`w` 4` ( $ (    > b''ܐ'''b'`* @@ "@ 㿘  |` 2`( 2& G & >"0 * @@㿐  |` "```?`"`(>c 'c ' * @@&  2&  & >"\ * @@` >c8'c8' * @@㿐  |` "```(`?  >c 'c ' * @@& 2&  & >" * @@` >c8'c8' * @@㿘  |Ɛ (   㿘  㿐 $Fʒ !2" |  (  T  >c 'c '* @@ ( & ( ( "  & (ܐ& ( 㿐  | ( ?  & (> c8'c8'* @@ ( `& ( & (F 㿐  |` "```?`"`(>c 'c ' * @@&  2& N & >#d * @@` >c8'c8' * @@ tag VT_UNION, vp=%p, uppervp=%p, lowervp=%p uppervplowervpdircache:㿘  |` >G`"P | `>G" | `>G" | ,   !>G"  2  |(2  㿐  |` "```?`"`(>c 'c ' * @@&  2& Ӑ & ># * @@` >c8'c8' * @@㿘  | `" & > `* @@㿐  P |` "`& P>'' P`* @@& P㿘` %>H!8.`@!!p!!!!!!|!d!!  ..  . . .    >c/  6`H /* '>a` 2`H 0 &@&``&` 6`  2&`] 7$d=&`H /* '#>a쀢    a쀢&`>!x" > 2`  * >a` ?"` `$aH 0` " `&`(&`$`&`  6`` 2&`  7&` &` `#&` >&` `$> y" `"`"` bpf: ifpromisc failedbpf_detachd: descriptor not in list㿘 0  . 0 @<  " >HNI#   >I`@N= 2"  2&   "& 㿘 .  * "* >a    @ L $ 8>" $ 㿘 . * "* >a H /* '   H 0@ bpf㿘 . * "* >a`    0^H 0W H /* '  / 2 "   2  !>ICW # 0?. #      $ $  $ $ $ " 2H 0  =ӔH /* '  $ $ $ H 0㿐 . * "* >a  `2`*  `% ` >˲PF`8@ (H /*!  x H 0 "" " " " " " (" ,㿘 "o@  . * "* >a @ 7"q@" "i@" "h@ "f@p"j@"  "@O"s@" 8  w@"n@>آ  "~@" "p@""k@" Ţ  "r@ "}@"  "m@"}   v@ "g@7  "l@g0"f@"  H /* '    @H 0&  2    8z&  &v& @vrH /* ' @0"d H /* ' 0   @\  . 0H 00J "H E "C  @0>@:>@ =a0>a4@ϐ .& a0 @ & @>@ )a4!& (& ,&. 266 ?& & & 4 & < < (& 8 &㿘`  $@ 2< H /* '  & $@-, , `׆ @S "H /* ' & $H 0-  -  㿘 .`N@  ` А ( `> 0` @  8*@`@ $ @>"`"= ` "5@ @_ 2/@ 0 2 - 2  @% #H /* ' @  +;H 0 `2` 㿘 ز 㿘`2/  *` * " * >a H /* '   2   H 0  TDH 0 㿘  !>$ ( $ @& ("@E" bpf_mcopy㿘#>L 2 Ka 8@ N㿘 `` @`  #>L (  $ @j& ("@a, 㿘    4    ?@ $- 2 2  , O& , & &  & & A&  4  8` < 7s.  7 8S D& D " A 4  8` < 7T.Ԑ  7 8S| D& D @$ 4 &$ @& 㿘  + &   * & & &   ,   7㿘  " $,   " +  " $+  $ "&+ &bpfattach㿘  *˔ 2">MJ1 "">b" ""b" ?"">!!@$t"@@6"@x`" $ 0 2 $ 2  & $ 0! 6 0? & $ 0 > 6 0   07  a D"@ @6   @ " @  * ((,  ,   % "  " @  @ * ((   * ((   * ((  "  "@ @6   "   2" "   * H  ذ?? `>M#ē*`@<<==4>\=L:>>>>>> >>>>>>>>h=:>>>>>>=>>:>>>>t=T>>:>>>>=>>; >>>>=l>>>>>>>(=>>;p>>>>=>>;>>>>D=>>< >>>>>>>>>>>><>>><=>>>>>>>>>>>L>>>>>>>>>>>>>>>>T>>>;`;h>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>><   `?2 Ŕ`4  `H2 & @ Y2 ` @   "@  @ 6    ` 2ڰ @ @ *  **`    ` 2 @ @ `* @ @ 2 ` @   "@  @ 6 J @  @ 2 ` @   "@  @ 6  @ *    * ? * ? *  "? *  "?-  () '  *# !  2   "  (  *    2  "  * fdb"  0 X VT*R2 O L"  @ G  @  A =  : 7* 422 0 .  4*`2  6*  6% 928 4   Ҕ*``?㿘> ` >"` ""```2`@ 㿘> 2& >"  " &  & & >`& `%>" "` " 6 ,>#  ># + "#+ ' `  h4  (˒ $  @ 5@(   , $ ' @,`$ ,`%`,G,`) ,4`& 4,`(>">c *  "?$` >Q"$` `$ $` `"``& &  $`$@$`,?* 㿘> ) ""  ` @2  @@Ӓ  0 "    "   @Œ    2  2  㿘> " 0 "  "   `@2   `"   @@    2  2 0 㿘      >" >># .  :?> `5` "-` `2$  "   ` @  `* "  @ { "   2``2` 㿘X 2  2  > "     22  㿘  < ` "8 `2/ `  @ "(``"   @ 2  ` @  @ `*   2㿘 ,`@ ( `$`   `@R` ?@'X &`@2`&`@    4 >Q"㿘 0 ?  6 0uM   2@ @-㿘 0`@-2 0㿘ws && & 㿘H /* '>  T . " ?4 .*  2   `" @  2T .H 0>Q>a0# 㿘> "   @     㿘0!@0!$@@ݐ  !1@"v  !@  !@"cy 0!@"`0 !2@"_l 0!@"`<e 4$+`0  H /*'AH 0 "`0`0 2`0H /*'>H 0`0?"R` ! @ 4`0} +Yws$`<+Pn` e ` - !"+  !"%  !  !" )0!"00! 00!0!0   ,!!!"0!#!%   @0!" 00! " 0 !0! 4 x@ `>Y 0! S T  G@ ϓ 2C@<` :8  ` ~7# ` ( ؒq ` " ؒf 2  _`  @ Ȁ @"&@%s: can't handle af%d 㿈  0 A A 2> h& p h  8& t 4  @$  6?4 6 4 " 4 t "  0 4  @% 0@$ $ t2 4 A " X`> h : A @$>S@1F 2` ! ( 0( 沔u (7Ќ 7"D) z /@` 2  `?" 8 `?"  `` ?&``&`  ul ` ` `` &`G 7` M I ࠒE H /* '  @    & H 0$ 7 \` & \&` 2" &  &  0 d&  |@H 0`""  d & d`tǐ㿘 0 ]> h& p h  X& t  & X@  >#@  !"6#"`  ` & `` h"!> h>02 5@,0-> *l>#` "㬐  >з > \ *al>@>#䀢 " Ғ >Т >"\@2y0&tb0#H /* ' @ `tP"0 & 2" "" "H 0>ˆ` > : `0 `(   (((>ˁ"`㿘 . 4. 5 . 6%& 8 >S"`& x @"`  2 `* 5 *`  5C & `2@& 㿈H /* '   "  0( &    >#( >#0 // ^/  `/ /  / H 0^ / 耊 2 `H 0P  @  2   @          $ H 0.  7"  H 0  7λ  η $  $ ` $ ` "`&``$ ` &`H 0 4㿈H /* '   "  0( Ή    >#( >#0z `// ^/  `/ /  i/ `H 0C / @%  2   @      2  H 0$ ?  $ H 0  `"  "`   7""`?&`H 0 4lo%d㿘 ? >W!P> @ >Vb8C^$ $ 84 0$ >V#$ x , 4, 6, 5f ( y `` looutput: no header mbuf%s: can't handle af%d ` 2>>V@" h& p ( h ` & tx 'x't' ('t&`4 @" Lr42` ] 3[ A L \ & L`@& \ >V"AL rgI />Ж \H /* ' @ `rR"H 0. 7&` 2" # \"> *l "> * @>#䀢 " Δ  Dd  D X & D`@& XH 0 ` "`P 1@ @  @" 0  2@ 00 >W8 "" /  /sl%d㿘 >"? >[#>X"o$1 `>WBgb$@!($040 ,0$0$0 2$1 $1o  /osl%d: can't allocate buffer 㿘` @`H /* '!>!쀢   o !쀢>!x" > 2`  * >a` ?"` $!H 0>"$@/c;!>W@_"@Z:``0 ? 4`0$```?$`@)>$` 㿘> `&`K`h >E C 7" `H ?Ԁ 27/ &`&?` ^&?\H /* &`L"Q &`` @ j& #xjZ  H 00& &H 0 Ơ/ 㿘^H /* ' . h`1 o$`& БH /* '>!x`("@> 2` ?* *   `>"x>`a` " "` H 0 $`$`$``䀢   Hj-``iH 0X@ ?ࠐ "%s: af%d not supported 㿐 >X"?pl / &l`2`pp| 2  ` @20pp A0@ ` 2 pc 4  2H /* '܀"  H 2 > hp h"  't"@`''А"@@' $ `@6&  @ `pE& H 0P 7  &P&`  2" & &  & > h&p h &t`H &@ H 0 ` Ь  H>! H   ğ@ H 4  L H" "QH /* 'ऀ "  $$% ଐ?$଀ "d $d    $$% ?$H 0   " Ь ` `@`  20@  @'   @*   /  e>`h$p`h`$t H   \ Hj$\|  4  ` `?*  $j H \$\ i    ݐ iؒ "\k 0 $\H /* 'U *`@?2@H 0   &H /* ' >!x"@> 2` ?* *   > "@ " %H 0 >R c*  2  i " \jϐ iT $TL $\`$L㿘 >c  6 H /* '>a` 2`H 0 &&  &  6  m `cO (G`đH /* '!>!쀢   m !쀢& >!x" > 2`  * >a` ?"`  $!H 0  "  & (& $ &  6   2 nK `Đ($`& `Đ 8&  Ŕ& & & 㿈>a\`А ` "a\?2 ``p 2 `X` @2`X`Ȑ $`Ȕ `0 `'$`X2!$``Ԁ >``h @6$``>h @>`Ԑ  $`h$``Ԁ >/0> h$`Ѐ ܀"`` 2``̀ 2 ``̀ 2 `$`̀  ?$```İ" $`o  M ` @ @*p 2`0 O*@`0!@ `Ē@'e`찒$`Ho@yp2x`H 't`Ē p@'S`찒$n`H`04`0o  `Ĕ ,???o Ւ"W`H`D $`D> h$`p h $`tH /* '> d d@  "`H `h$`H`m$`h0#  2" ">Д\"> *l >">#` "㬐  0Ð H 0```@`$`*@ $``Ȑ $``H $`H`$`̐8$`$`H( @ @  @"   1@ 2@ 2 /0 20" /  /Hppp%d㿘 >!? >^#>_"a $?`>\=`$@%$?4? ,? ,?$?`$?X 2$?x$?$?$? Ŗ !a㿘 >! ``! >! ```!`$& $ "& %6 & !@ . e  &!P@$?&!,&!4 "!$? 6"!$&!!&!> h&!<&!8㿘+&  0& ?6 0 "  & & " Ȑ?& Ȁ" l  "  & & " ܐ?& ܀" l  Ԁ"! & & " ?& " !l   l{&!!2 lq& @&!,!D &!4  &!D&!@!L "!P &!L&!H!P  &!P%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x x  Q@@% S@"   N@"@"A ? Z@">  V@"6 ? J@F?0  G@"X  Y@"'   R@"G ?  F@"E?  M@"j   K0 L@"t?q&o&m&  h H /* ! @ @@9Ho o <?# @@$  p B> $@(;4 : 7&  _ 1!P "- H /* ! @#h0  H  0$  ?   ـ >#8`o#8@ 2e`` . H /* !!, !( @ @$!(@`؟€  $!, @@ 7>] X:'  7Ho o ,H /* !!4 !0 @ @$!0@`؟€  $!4 @@>] p9  7Ho o *@$ H 00@  @@i>]ؐ ْ 9ښ  ! 0 L@2 !$w& r!$"m H /* !$!$  @ @0H /* !> h!8"@&!< "@&H 0C "*   9 *G 0-   = #    G@!H!@ H /* ' && H 0    㿘> H /* '  !2@I @ !@"5 ! @"-  !@  !1@2v 0!~@"( 8 !@"i 0!z@P0!{@"^  0 @Z ?X6 0  ڒNK$ 8I&"F /  B@ /@ 8!&! &!&!&!& !&$!P . &(!P &,!P &0!P &4!P &8!P &<!P &@!P $&D@ 8!, "!4!(`€!4 !0`4€,H 0%s: af%d not supported %s output: 㿘 " 2 0 @. 2` 2 2`?Ȓ*@6`>_ `   ! !$@6` *  "8s  / 2" ` 2  `?"  `?" 4 ` i 2&`  7?&`4 `*@`*@`*@*`` ` &`  @ @>_"80 @ 2!! ` *@!D   2!Lg !L  "`> h$!8`*! H /* ! !"&``.$!`@   @&&` "&` "H 0 P 7!`$ P "$! 2" "" " @> h& p h  L& t` \& L& \H 0 hѐ㿘!?!  *`@`! !$"-,#$"@   @& " " P! & P`&! 2" "" "$h 2&!㿘Ho o &   & H 0  >*@&  "> >#䀢 *l Ē 0ĕ H 0 㿘>! `?@ 4  ?Ā  @'Ho o?` ` $?$?"`?$H 0 `"@0!̢a㿐 耤    & & $  ?&      & & $  ?& ! &!  ` ` @*  ! `  -/0 +0!P' ` 0  ` 0 2@͖  p "  ,` / -,@,`,`,`@o 0 !+  "( !, # @ '     !( !, 8`@ " g  ` 2 2  0 !"     $ $  4&  2 ` @,`,`   $ $ &  @if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) 㿐` 4`@`` `` `  ` `*  @  @ @>b H6  0 @?`>b!4*`@p``pp```````` zHo o?#i  @ki ` d2!4!, ^` !(@  SHo o B F`!0 @ #\$ 9Ho o @&0 `*2!4!,$@!!( @ 0@!0 (@ Ho o *@& H 0 㿘!,"!4!( @ &!,!4!0 @ &!4㿘Ho o` 6`&` Ā 2" & &  > &  "> >#䀢 *l ¹ 0Š H 0%s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full 㿀'!   &! @ `  >c 4@`` @ `% ` `*  ?А*6`Ho o (& H 0  @!4>8  8 !0,2 eҐ o` ` `* 6 @@>c 4H/` / (& @ @& H 0    @ !0`0€   L  `   ( -!P  @ Ho o 7& H 0  - / !P ` ` #\@   @@>c >cݔ  4 H /* '>a` 2`H 0 $$  $  4  d  $   dS$H /* '#>a쀢   cj a쀢$ >!x" > 2`  * >a` ?"`  $aH 0  "  $ ($ $ $  4  쀊 `  $  @  "@@     ?$ : dא0n  !,@,`,`,` ` $ ``@` &`?"&`    !  $  @  "@ $ `Z$   ?$4R$`  `   `  $ H /* '>V`!*`@ ?2@ H 0 ` "&@H /* '`>!x"@> 2` ?* *   >`"@`?" #?H 0 @>$V`c*  ""!d !P ` p` #\@ڒ 6  ! @@>c 30ΐ !,`d86&`` 1 >c  4 H /* '>a` 2`H 0 $$  $  4  b    eId&` &` &`` *!D f "!L \ "`> h&!<`*!  !В !* 0 !$ "`cʐ0i`` ?&``&`>&` c> "c >#䀢 *l  > > \ Ԡ Ho o @&&` "H 0  @@>c!2qh #$h 2" "" "H 0 DX $D@$X> h$p h  $t @0 cg H! & H`&!%s  *p>#X  @  2  *@ `  *@` @  |*@ *@ ޒ`  >*@`*@>f 02 p㿘>  ؒ NH /* &`h   `Ѐ  4  02  H 0. `"6!@6!&!|!T@ʒ ?&!T&!`&!t& >h"& >h#& >f"& &!x@ 0`@6 0  & @PQ" БH 0 㿘H /* & P<  Ѐ  . h&  @ H 0 㿘H /* &!x  b&!x!| " b&!| $>j L ;& H 0㿘 Ѐ` r H /* & ` h " `ԑH 0Z - p2  p  @2 p  p  H 0= # !>V "`H 0,[ (`Ԁ    $`$`& `ܐ?$`ܑH 0 `    P2`b㿀 p     @2 h  h  " ਀ 8` @` ` (a 7a>!)> >ce  4 H /* ' 4H 0 $$  $ 4  `n $@$ `#$5 H /* '!쀢   _ !쀢$ >!x" > 2`  *  ?$  %!H 0  "  $ ($ $ $  4       $ @  "@  ?$`4 $ ` /  ``  "`"`  㿘 Ѐ``p? P@[ @  U@0 X@"!aTS  W@"   T@" F  O@" ?Ғ EB$aT@&ǒ :7$atat4& .H /*&aT4 $aXa\*@$a\a` $a`H 00aT  0   R@@>p(0 @0( `(2 㿘 H o*@f@ H 0㿘H /*&  [`(S8H 0㿐 p    @"  Ā" ਀"  H Ā`&@0"!    H>!x`2` "  H 2 ` ~ HZ$`?` #4>`h$p`h`$t` ` 7 2 *`@ aT.@*  [S H$%@$  }Z  Z $? $ ΀`?S@ Oጐ8 :*`@ aT.@  }/ /[Ð倠/ጐ8:  :*`@ aT.@ },@` ,@,@` ~,@` ZS H "    [ H?0* $@$%`M%` H /* 'U`*`@?2@H 0 ` &H /* '`>!x"@> 2` ?* *   >`"@`" &H 0 >R c* # ` `` "4ጀ`$x H!$x Ā` @  ऀ$ >j L ऐ$$ँ 㿘 H o*@f {& H 0㿘H /* &   `o!|>!'> 2\  >c   4 H /* ' 4H 0 $$  $  4  ] B&H /* '쀢   ]J 쀢$ >!x" > 2`  *  ?$  $H 0  "  $ ($ $ $  4     $$@"`H 0%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! 㿘`Ѐ  @H /* &>@\ !`"\  $! @@>j"`") `2` "``p!!`n&`p*@ *`>@ `€ 0  `p`Đ >`&`p@0   @ $ > >ap*   * @   $  @@z ~2j !! 4!@o? 0   <! @@ $ @@>j"!,Ԓ  H! $ H`C$!0*@?$ 4! 9@ @>j"ؒ , H! $ H`$!  &$ ` ?  "` !|!@ 2@$!!` ?"` !!|@!$!|" 8  * k" 0@ 4   !t*@  @2*@ }2!Ɛ $  ! 2@!!| 2!|G!| 2 !| @@>j"&` !| `` "  &`$!` $!?4! `@@>j#!`$!?*@!`$! *@! 4!`  &` ! 2!  @ @>j#0 ,$ ! 2! "!!`$!*@!! 4!`  "` ! 2! 2! @@f>j!J#P *+^   4!* 2 ` @ @P>j)#h!`  ```$` @  "@`$ @+` `  ?&@ 4$` @ 2@@ 2 @ @@(>j#+Ò $ $!` &` ` ``&`$!`  &` !`$!*@>!cp*2 *  2 4!   H! $ H`$!  $ @H 0 %s input: 㿘`! &!*!! `  >l#(+l !@!&!%s p >>! @ **@`2  *@`   *@`*@`*@>l#+@ptun%d㿘 >n p>#    4@ >m`@,ٔ$%$ 8$ >n!T$ x 4 0$ T$ H$ P$ D$ L`>b$   ༀݠ %s: open 㿘ْ   4 . * "* >#      >a`2 >m!*  %s: closed 㿘 . @*`"@*`> @ @ ?# 2@ H /* '     $ $ &  ?$ H 0 [̐  0 "*$H /* ' ) 0 @   2   2@   2H 0$2>! >m!*v  %s: tuninit 㿘>! >m#h*f  4  A 6 4 ` 2@"   " 6 "   " 62 %s: address set %s: destination address set 㿘 H /* ' ! @   !@  >! >n  8>! >n P*  H 0%s: tun_output %s: not ready 0%o #>a >n!0)   a >n!@) Zg @  x 'x't' 't 2H /* '  @  `Z$ H 0 T 7 :$ T&` 2" $  $  $ H 0 L $ LZ" /`@?# @6  ` 0 ߐ  ˒ 1   }@ * ( (> ; @Y@"'>@; 0Rw@"L L  Z@" ~@"?  v@"68 >4 1""  *2 ? "  2 ?2 H( """H # " %s: read tunreadDropping mbuf 㿘)>!  . * "* >#  >o!(  ! >n!@(  @H 0 #?# 6H /* ' `    $`$`& `?$`  !ڐ @4 >o a "`H 0``\[ >!># @8`P  H /* 'V *`@?2@H 0   "&V H /* ' >!x"@> 2` ?* *   > "@ ?" $?H 0 V *`@  ``"  >! >o(>!(YY`H $`H%s: tunwrite %s: len=%d! !>!  >c$ . * "*  >p h( ` ! >p x (  ۰  >c   4 H /* '>a` 2`H 0 $$  $  4  Wݒ  d 7A 7'>>!` 7@$  "$` ' >cl  4 H /* '` 5`H 0 $$  $ 4  Wu Ģ l"`  " HX H b% H. * "* >c  ""`   'l'p '|l'x`ېpH /* '> d d@  "H 0  T`X{% T, 7" `2"`">`\`"` "`H 0  D>`% D "> >#䀢 *l   %s: tunselect %s: tunselect q=%d %s: tunselect waiting 㿘 . * "* >c   H /* '#>a  >q x' ``0  >H 0a >q &   .ݒ 0 H 0 H 0>! >q &ђ  R` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘@  ` @= 2  @; `    2 `  ``>  @8@    @  ` 㿘@ V`  ` ` `  "``V` 6` ` 2 `   KJ@2@  ` `` 2Z  :  4#,`8 `` V`4 `A ;``2` `@ .@  "` T4" ' 8        2  Y    2 @2` 2 ` 8*""(:`"$?2" " *#* 㿘@ `    LJ  *L 6&& $ *`:` ` ``V`8`   @  $ $ &` &   2& & &  rn_addmask: mask impossibly already in tree㿐 >"@ " @& >">bx {`!>"x$@u@"x@ %>L? "?%>x$@4 !>>a6"a>"|u ,! 6$!@"@$!x>*b|x%@` x @ 2 Y`W %>  0M  0@ƒ`0>"x)>b|5`  >s$Z`0~ 0/       * "$L` :  >L!L@2 $ $* 86   .  @ 2  :  @ `  * @ Mask for route not entered 㿘>a  "a     >s#cp @E  6 .  " & & & $Non-unique normal route, mask not entered㿐   `   2 ڰ  8 =  ,:  @뀦``"V [  x   2 2`&  ` . `&  2$ $  & $`& ?6  . ` &  6   @.  <``8 `T  6  .*`:   " T &  2  H $  2 ` *`: V 6$@2V$@$`G-T`:  $ 0@  & <& T`@2*,: V&!4# "  `  >t#`00֐  ђ 22V$rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Mask㿘Q  @4 @ "@8@ 2 ` Ҕ"  "  2  `"P K     >u"`ڰ   >u"x`4 "@>a"""a ? (" V V`8 4" `V`2  " 2   >u"I`0 2  2  < 2 &`2&`&``  ` 2``  "`>u"`` # q  & & & $&  (& ,& `2"`"`" Y" ````2"`"`&@"0 V >2@"@ & ? " ""@ >u`>u!Ƙ @"  &@ &` &` $&`  (&` ,`&`"``"  `2"`"`  # `. . #㿘V  6  ` `2  "   V  6     @   2  "  㿘  t9  v "3 @ۼ t&>"| , \" "   * * 82$ \$ `$ d $ h $ l>b$ p$ h>t`\$ >u`$ >r`t$ >qcL$ >va$ ($rn_init: radix functions require max_keylen be set rn_initrn_init 2㿘>!` !>>`(4"``2`(!>"`*` >v!b0)   #>ˀ $b|>v s#"*@N@ b|" >"">˒ ""x?* **>"|q >v V# 㿘  > 7!>!`| "$   >4 4 bؔb؀ $b" "b$  㿘 V" `"  "` "͒ 㿘   > ؝㿀'H'L'P'T'X>"؀ H  @@2@ `" `@28  "  @ 2.  ` @ 2$` 沔R `0`Ֆ Q֐  _ݒ`|    2 ``0`  _Ē`|  0Q raw_usrreq㿘 `  ~ -    o -]`h.`>w#p@߸DD ( DD  N J "G 98D "? 9B0!_&9  "0 8$ "+ 9 € " $ #U^X   2   2   9o& >w##Q%㿘>!  "  $* €  2 㿘m>!㿘`  `<  `4  @ &h> !'̓*`@H /* !  0 € "*> ` 2&> `' 4!    @@̢" 6'̐ 4 6  4"  ` 6 4 6>a` 2`` А@ $'Ԑ @H 0́rtfreertfree 2rtfree: %p not freed (neg refs) 㿘 2 6>x{#H?6 6*  ( 4 $ ">>xj#P#V 6"#>x#`J0 @R` ?@  2`   ifafree㿘 2V >yD X ? 06 p  ׼2U 3D @  0@7 2   @ G 2 A`. "  " 4 (  4  2 "  @x >!>! 4  @S4 4  A  ``'@]`>a 2a 4А@ث $'''' @ -㿘    ސ  -2  `6`@? 2`6  `@ ׍"rtrequest delete㿘H /* !>a` *   2   T0?`02`   >yR#p 4 t ?`4 4 T 6 ?Ő4 6$ t @` >`  >c耧` "c'@T 6  4 60" @ 2 @}  0 4 D >*  :   S xk 3 x  b 7@ߒ x 4 4@b  S 7 @ -  2` t " W   } 0. 4`$ @` $ <@`L$ L`P$ P`T$ T`X$ X`\$ \``$ ``d$ d`h$ h`l$ l`p$ p`` @`'@ 6 4 6H 0㿘@ ?    ?    0 "  ?  8  (     2$ )  @$ 0   t " 4T 6 ?Ґ4 6$ t 4 ] $ t 㿘@ .@ ` .@  `  .@ `@ *@ @"rtinit: wrong ifa (%p) was (%p) 㿐 ' `)    M=    6 @?@ 4 6M` 3^ A  _ M````   @T 6 ` 4 6D`28`25 "1 6 @?%4 6>{! @    @R` ?X $ @2`$ @ $ <   6   @㿘`     & @[ `    >aX?"aX >aX`?"`>aX`?"`>aX` ?"` H /* !  `/ ,`  0%  >aX "aX >aX`  "`>>aX` "`>!$ >X `Y"   @6 H 0route_output`'H'L'P'T'X  'İ     N 2  7  2 >|!@K(' 'P  u 'G 7 N% >'< +` L0&@'Ԁ   t  @ 2! 7 '?`>|"*`@p000؀ܐ İĀ$ @;L 62 6" Dؐ İ뀦 6 &7 6> a*   ڰ / ܸ2 6Ұ  7 6 "   ]ƀ" € ' 0' ' D' 0 <`"'` ' @'`0 "' @ '`,6'Д @    Ji̒ Д@ W 4& L&$ P&( T&, X&0 \&4 `&8 d&< h&@ l&D p&Hl&   b a E "w  ` " "W 4 2  W 4 ش#$ $ @ "  @  ؟ @R` ?s ' @2`' @ 6' <$ @] L @ "   ؟ 2' D  L* ' L $ ' L - "& @& "`` @ >!d 4 `' K0!  @^ 26Ԁ`> `!2 >a>>MȀ 6  `" `" @`" `" ` "  `" `"` " 㿘@   : " "  ? @ 㿘H ` @ T`J  3 l@ 8 " $@@` @4&@$&` "8 &`/@ @ T`J    l@8" $@@` `&$`rt_msg1㿘 J$ ?`  ` ` T L  L`d(& >~"p& &   @Ӄ" @*@&@ ?   }@  5- - J 㿘 &@    T L  L2 "` @*@&@ ?    ``*&`%  $      "ݒ    $ $    $  ,,4㿘>!d `M@"`"`@ "` >! 2`2` >a>>ȁp>!d А@̒ $ ' 4` , D4 V 0 #$ $ >a2`>>ǖȁp >!d c`  +>a@Ҥ $  ` " `    @' '` '`'"<` ,2` ` "``"`"`  ` `"%`' '0'ؠ"` ,2`V4` "`"`"` "5  5 a>>`Ȣ``Ёp@   V 4`@X @8 $ ' 0' ' D' < "  ' @' < 0   @ ' Д ``1`".V 4" 8" L"$ P"( T", X"0 \"4 `"8 d"< h"@ l"D p"H < ,2"""А " `"`&`&`p@ߒ $> "h `` ,@2\   @p''``G` "D` ,44 T0 D$ А" `e 2>.` @ 2*` @'` '`B'````"``  ,2` `"`` "`"```9 "`&```Ѐ '''2` x  c `^  @c '' ' ' 'ܑH /* !% 0>!  / @  2 `>c (ؠ ``h$@0MH 0  @ '"&䀢   0 *` * " @α &route㿘 ( .@'@'h'@@`.`"* * ?*` "@.`"* * $, & . .  6 㿈@ `?@  ',@ `  "S @ &` `@2``@2  `@ *  @/@ &` `@@ ``@ @ `@ *  @ @ 2& &` 2 ,2@&"$@", ` @@2 ` ,``@``@<  @ 2  ``?@Ў* ` 2  `@Ђ* א ` "``* 2  `2 ,, , 2 ,   @`" * 2  2 , , , ,  `@?#,2  4, , , ,  `@?#*2  2, , , ,   1>!d- @            ,    ,V`T` _@"`\2`T` "2 ` T` "2` `` "@*2   2 ,, , 2,   ` 2 `` 耦$ `@ " `@. @.@ ` ," @.@ 4  "& @& , ,     & `۔ `.` ` p.㿈` @#\@    &  ? ?$  $@㿘p\"-   ` 8 / ? # @7  +` *" *  * 'h @ `,`@ `  2`@ ,`6   ' '@$ '  @ @ `  "  $? ' $ ` ? # @7  ``/   *`" *  * 'h *  * `@ 2   *   " V  V "@ "S @"@ N"  *  2 2  * @2   *  `2   * @ 2  @2  `2   *  @"   "  `2   *  @"   " " `2     * @ 6   @ 6 & @ 6 `"6 @`?# 3  3  8 6'@ $ ? `7  ' 㿘H /* !>> "P!>a0@4 ( > `#>` X@`h8@ `2`H 0arp_rtrequest: bad gateway valuearp_rtrequest: malloc failed 㿘`0>x `H >h "xh "hh>>a0 (߾ `4` "  `0"+ `02 `4` ?a6`4`4a>` G`<`0 4,``< ,4`> hy&`X@" `` `< `` @o@ `   @  >C`0``< 4,``< , Y4`  D &`H >/a0L> `>!#`@|#!$ `4>$6`4`` $`" "`$ ` `@ `D- &`X`< ,` ` `ƒ@ >"t > @&`<>`?"` " "@`4&`H ;6`4 "Dg  㿈 C 0 $ $  H@*$># (7 4 H(4 J , L , M4 N P~  Vz  `v / / x arpresolve: can't allocate llinfo㿘!>#= " //  ^/  / /  d/ `"`H @ٔ 2  `2 `X >saCL ``0> h@(  2     05 "$ C$ `X "+ `4 ?6`4  >`X`h " > h&`X >"p $ `@@ R`  `4`X>"X`6`4&`X$  arpintr㿘>b\ L b\H /* 'b\  $b\$ " ?$ H 0 > 2 >p#     *   h@@5 >CW >b\ arp: ether address is broadcast for IP address %x! duplicate IP address %08x sent from ethernet address %s arp info overwritten for %08x by %s 㿀   ````\ > Ȁ  2 8  D@ 82 m" DD`@  b>c@   >k`h0T !>Ω  ^D' @ @`?=` 9`05`  `@ђ  !>΃  8 ,`  ` X > h>bT $X4 ?44 `%  x% `B0;  ``͔ ࠒ @` ``  0   ``   5`(5`` (7/ / x arptfree㿘 2R6>F H  0`  `   *`& 4 ?24    arplookup: unable to enter address for %x 㿘>˒ *"" * " @ 2 +26 ?264  `0   ` >` H -㿘`D  >!8`&`a6`㿘      *   h@@0AА㿘   /  >0) '0%"  > "@#>b| >ː `@ʸ   >˒b  >˒b  $b|>"A㿈 @ / $ $  H@_$>#”   57 4 H(4 J , L , M 4 N  P  Z / / x revarp㿘>"| >- ""> "b >ˢ" >>0(2 ؗ: #>??>b|` "">ː"r n   3㿐Ȕ> >ˁ 㿘>"  2  $    2  8    >"b"" "b$ 㿘>"    2  8q  & >b&& "b㿈'H'L'P >c('T  "c(V'X c(`@&0  `  B &  & " @Ih&  >(`@"0  "& @&      >0&>0#(`  &` 0  2Q " " 8 @"'K``'> Ȳ  ' p 8`' `[ `2` 2@8 ? " &`@ 2 &`>""``'  ` p 8`' `2`0-< 8 " '``@&&`0#`'> Ȳ 2  ' p 8`' ` 8 >!ܺ `2+@8 @"% 2`? * %&&&$&`(&`@ʎ &`>"" &```'  ` p 8`' `2`0>#( "0 < 8  2e2a ?@> Ȁ`` ``8`2` `>`,& > Ȁ` ` ``8`2` `2`p `> @ ```2@`{>&`c(` "`` "` p n l&`  "g e #( "0 ^< 8  2" `?R"0O?@> Ȁ`` ``8`2` `>`,& > Ȁ` ` ``8`2` `2`p `$> @ ```2@`>&`#( `" `?`>!x*`@))))) &`@!N㿘H /* ! & 8 ?    0 2& ϐ@ & @Ɋ 2 & >""& H 0㿘    8 ?   0     @ 㿐> TH /* !"'> Ƞ  '   p 8 ' ' 3#>  ? $   2     @H $  $b  '   p 8 '  2 H 0H(>   2   " "  2 H@ >cĔ  4`H /* '>a`  2` H 0 $@$``$`4` < 9> `$` a$` $`` *`2`2` *` "` "``` `$``$` ,,  $ @F4 4    " "   ' //@ >c(`  "` >>Ȁ`" `(`$ " `8`2`( >Ȁ`"  `0`, " `8`2`0 <  8  ?      *H" * :Hin_control㿈 > Ȁ    "  8 2  !@"0 ` !@"F  !  !@{ !@"9  0!"@"w  !@0!!0!#@i0!%@f i  `   ! 2 8 D`@  8 2  !@2  "} 1  A > #xB  t 릔 i 7@ t$ 8>`$ <`" 8"`$ $ " & @$ P$  `$  , `0  , P , Q$ $ p0  >c  "c   8   3 1 !@" !@"P0 ! @ !@y !@"` 0!"@"$0  !@0!!@" @0!#@0!%@" `퀦$ D$ H$ L$0    P$ T$ X$ \$$ d$ h$ l$ װ  P' T' X' \'$ P$ T$ X$ \ $ P$ T$ X$ \  $  :  P$  4  0 2 $ P$ T$ X$ \@ $ d$ 0   A  ` 2 ` @$` D$` H$` L $` D@" `0 @q`0$ ``4$ d`8$ h`<  d$ l$ 00 " ` `! 2 `@[` $ P`$$ T`($ X`, $ \ ` 20"0`@[ 0 = `! 9` $ P`$$ T`($ X`,0$ \@0 ` "`&  "@ 8`" < <"`<>"  < 8"T  ?m  4   - 㿘`  0     ~`?# @6`㿀H /* '`@'`D'`H'`L'&`@&`D&`H  &`L   a H 0&`@&`D&`H^&`LH 0&@`@&@ 0?  ??&`(`0``(&`0&`d &`(`(```0 &`$ &`, <&`  0  `0`,`(2`$&`T2 &`4 @` &``Q  ` 2T 0` 6`T 0 @8 '@/?! "% `0"! ` `" @2``T" `4" `,"  `$2` `2@ xH /* !> Ȁ      8 2 2 p  $    2  $  R&  61 B&&  & > Ȁ  82 2& ( 6p & p "`"pp&  / /'`  a1؀  `"  "`   6"H 0  XH 0xH /* !  ? & m `"  "`  "@ /'   a2ϒ 6H 0㿘&&   & 6 㿘 \ 蝔 N 7@ \$ $ H /* &@$ $ ` &`@" &@    `  `* @  $    `  `* @"     `  `* "@    `  `* @$ H 0 &  㿐  > Ȥ   > . b  2{   2w b `  `` `E`` `c <`8   `6`  Q 1 2" "# - >  >!'`@' " ` R 2`) 0`& `2!6 #  #4 *`2 $4   >!' @' 2 6 @ 㿐`  `  ` "` / }> Ȁ`" ` ? `D2  `  0 " `T$`  2j` (  ( 0`@2R6   "  R6 ?m $26$   2 "  < 2  ,  , `$ ```< 0 "`@`2``4`4`> Ȁ`"H 1`< 8 2`@ X "`@`> Ȁ` ` ``8`2` ``@( 1`@`'  " ' ` @ "  0 2 `  2 ˒  & `& `@22  㿘& 6 @*   @㿘 ="  T " (8 ( @n XH /* &  " "  @ "`"`   @ "@"`H 0 ؒ 㿘 &` ` @ ,  , 4  $ 㿘 &` ` @ ,  , 4  $ 㿘` +\``'#.2 / 2  2  "  2  2    ` @2 㿘` `` 2    p (`& (@ $ ,'`0 '` 'T`4틒`4   ` + `0; ` 0㿘 (  & (㿘 @ @9/ 0.0`2.``  ` 2%``2!```"` `2``" `6``@2``H(@ `" `@ ``` ( "@``` ( ``` ( ``` ("`H *2+ @3 #d   ( + d2#  2  2  2@    @"@ "@"  2 #interneticmp_erroricmp len㿘  ` * >a "a?؀@ 2& `" @*   `      >a` c"` #_ 5ߒ Z T 8 `$` ` d"@`  $`>e">!ĕ.```"+ $ ` $ ,   `2 , 2,  ",  84 ,    4 `?`@:$`>8"`  ``$` $` t$`` 4  , * @@ $@9, 6%㿐'H'L'T 'PW 'X>a`\ !"`\$ $ @ 6  72 >a`\ "`\  "& & @> >a`` "``  & "@&  >"$*`" `>"X*`@QQQNO@Q,QQP QQOO,P(QQQPHQ̀ X>"ē*@NNNNONOOOOOOO   <> 7> 2> # > *` `8>a`d "`d<8  > D#`>!8 @*` *  * >b   w  0r>a`X m"`X2.O @:.& *&> @ ^ \ `2> >" X >> TL .`d&  >`  0 2`T " `T' > 7 h "h * `@2" 0.># a *` `!>>a`d "`d D> d  # >`T"` $ 他  2@@04㿐   `*`3'   ?  " 4ڐ % > Ȁ`>`D>`  0 "`8`T>`8`2`D> T`"  2`D> `D` % a- @1   4  $ "@9`#  2   8  D 2 $@ ’  $ $@` ` ` ?@ `4   `*@ ` $  "5 *@@ %  "`&  "& `    @ 2 3㿘   , & " & 4`R@<"@4`   "" "  @ 㿐@T@Ba#*& .  . @ 㿘`    *>  @ip_init㿘  1O >>!# *"@ *`" *  *  * " * ":>!8 *@@6*@> ( ( &>!8>">  ,S@#*"@ *`" *  *  * " * ":*, 4 `4>"!(>" Ȑ " > h>2 > >" h㿘H /* '>\` \` "\"$`?"H 0 `c> Ȁ \> ؒ`" ` `  ؐ5a 2`  $ `<  >``X >"`X2 <``` 5"`` @ 5>2`>`` "`@;4 *  >`` "`T@6`>`` "` >`` "` >` $` T$`4"@ >`" @X u> Ȁ(> D` "  `@28  0 "8T"Q4"M,"I$"E82D<8  &> Ȁ` `` ``8`2` `2`p ` @ ```2@`2 >>  >(`2"(0@x 0 ?Ѐ@"k`  4 2`>``  "` >!( "  2  @2  @2 @" 2  "2 4*` `" >``` C"``* 4*    >`  E% ܔ  2*  d *% d" @,  @  % @ >@ >"4>``4 "`4> !8 @*@ *`@ *`>@ ` €020㿘 ` ? *@  $" /$  1< >`>a(a( &@a(" "a(&` <.`  .`   6` &`   &`   Z&`2 `2` 3 ?P``   R  R  ` 2 `: ` R`R`R " `0 R@> 3Z `2` `"2` R R R@@ `R"@ @"1 `"  "`  E=" 2 `2 @` &` " &` `  &  &@" %@&  `    R`XR`  ` P `  ?$2ܒ E   E 2Β 6 `& `& @`"``"``@0" * @$   `*`" $  @ $``1""Œ E 㿘 " 1 ?`"  "` "୒ E@2 `"  "` ?0"㿘H /* !>!( > ?* 2`  $`  2 H 0㿘>a(  > ؠ `!(`$`!( 2`㿐   * ?쀥7>> ` Ȁ 2     Dѐ De D "B % 2% `%` 2 % ?@ @'%`  2`: @'  Dਔ $  ,< @8q@ `?@8k% n?   Dਐ@' n Dz   S, $g  ?2    *  X$>% `  ?```&0JG C%` "#% DA   29 ? "%  ,' `  ( ` ,`%8 > @       $   + " 4  >``P  "`P㿘> t?` >` R`6 4? >2`6>" p ,  ,$ >ޔ p> p   @㿘 `+ @!>ˠ"Ĕ>2 "`$?㿘#>`  . ># "` *``& @@" +" ,   `  @  @"@@`>""@㿘  @` *@"   "`&  "& @* @@$@㿐    !  `s' 2 `>(`/"(0퀢     ?,`> t  `@"  T 6 ?v>4 6>" p , ,!>` p$ p    T`@4 @ /y  <  # 40 >   > `> @ 0` , 2 >"` 0   >   > p ! @  >``( "`(> `$ "`$m.0i`, "`,dAJ >#*@llllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll   > p   <>``L "`L  q㿘`4 ?`.>!<*`@mTmhm|mmm> > > >"  > >  -㿘 d>!@?1 ?`,>"4*`@nTnhnxnnnnn@ΐ@@@l@ @@g - -j㿘>!@  ,ג  j& k -0@A@U -J㿘0!30!4 0@U0@H( >㘄 22  2 2 >>ᄅ(    2  2 L" 2  >φ H   ? 4" 8"  <""" " @>,* (> "`$"`("` , "` ip_mrouter_init: so_type = %d, pr_protocol = %dip_mrouter_init㿘!>!  V >RyaPV 2; - R  `4 -"2 ` (. ` >' a ""a! 0! 8>몔>"a>"@!>!0>""># ~:!  >=a ip_mrouter_done㿘H /* !>!,  >", 2 * @*`@`  @  >* a,2  , >"@e/>2!,>"">#t  #>a. @ " @  a>! 8>"!0>"!H 0>!  >ݒb  #  "  "  8  > @  >  "  Source routed tunnels not supported.mdecap%dadd_vif #%d, lcladdr %x, %s %x, thresh %x, rate %drmtaddrmaskp "  (  `*`  * >b   > 0 !4%"  2 w 1`` >p`m -  8x @ `>t` 0@ > "a0 T`0 @ R -/ /' a1`؀ CH /* !$ $ $  , ,  $  $ $  $ $ $ $$ ($ ,H 0 >, `2,>! "    > >!(>!0   #\ #` x     8>b܀"b> ""/ /'  a2 ؐ@< Ddel_vif %d, numvifs %d㿘 "U  %> ,@ *`I  * >b > 1H /* !   x* "*>"@,>*2 ?* @*`@ ` *  *>2!,H 0>!  >` *2  >!,2`*0@ * (!,2  *"`@"`L㿘 L`" @*`څ 82@`"  "`  8v"add_mfc update o %x g %x p %xadd_mfc %s o %x g %x p %x dbx %pmultiple kernel entriesadd_mfc o %x g %x p %x dbg %padd_mfc no upcall o %x g %x p %x㿐   +8  H /* !>c "c  3 3   2 2  >` >a* @   2   @2L " 2>ϒc` "`>!   > Ӓbp@ >b ?- H0 22   2 2  >` >!- @J >"2@  2;L"7*    >b> #\>!     >Lb@ "L ?-L`"@``@ϔ)@ٛ 82@2, 3>!   > \b P 8f 2 H 0! 7$ $ $4$8$<$H$D>ᄓ-  $ " "  $H 0 del_mfc origin %x mcastgrp %x㿘 "i  +>c !   > bH /* !>c "c  3`3`   2 2  >` >a* @   2   @2L " 2 >ϒc` "` 2 H 0 1`"  "`   8"H 0 㿘  08(  74 |   )?ip_mforward: src %x, dst %x, ifp %pip_mforward: received source-routed packet from %xip_mforward: no rte s %x g %xip_mforward: ip_mrouter socket queue full㿘>!    > a@a  $   2 >D# @"D C   >Jah<  88 ? 2 H /* !>c "c  3 3   2 2  >` >a* @   2  @2L " 2 >ϒc` "` >ϑH 0@M >a `"   >a  8  沔( 2 s22   2 2  >` >!-`@   2  @2 L   2    P 8   ִ*ǒ 8'ؐ0; ( `  `  )`> 8 4"` ** >Ϣ#`>!$` 6  >oa`0 8$`0׏'׊ 8H 0O 7>$ b$ $ 4$ 8$ < $ @ @ > -@ , @ ? * ,`@ ?4 >ᄓ-` $ " "  $ $ L>ϖ 8P"'a0 L   L ` "$$$H 0 expire_upcalls: expiring (%x %x)㿘H /* !  >Ϩ#>" @ "'>!,@ "  @ ? $ @ @?,@ >!` %   > ђcxh2 @֢`H 0>!0># :wrong if: ifp %p vifi %d vififp %p㿐 >!, T`, * >b "` >!  >`З, *>" >ϔ>b "<` &<  " `0 , * >b 2 @ `@|G*`HD""  q **А"@"@"@ *`" *  *  q"p '[     (Z 7&D>&H4 * *  * >!g"H @2  $, "$@",( " @"(>"4 8 &4@>!, *&8 ,,2  `"`D ` (`D@ &@&@ @;`D@`D>* a,2  ۠ D 㿘 沔  &+ `  `  (,` ` 2`@s0V @㿘  V >c԰ 4 H /* '>a` 2`H 0 $$  $  4  $ޒ S $ $  沔 1>!  &$  $%0?! d" @4'֐5> !&! &  &  &  >& 6 6  `2 & `?& . 6   $   `@.~*`6  ?$ `  @0V @ip_mforward: no tunnel with %x㿐'H'L'P'T>!0'X  @0w < 8  >ϔ`%"0h >b؀ 2>>!,*` *   "D @ D * >>ϔ`%`">! = > ֒b07"" >"">" > & "@ & "&  \& H /* ' @ `%1"0 &  2" # \" "H 0㿘@  !  "& @Q0+ # >ϔ,`%",0@>! 0@  >ϔ(`$"(0@@1>"("** :H( > "؇((* ( "`P " " H 㿈>b& *`" *  *  : H /* !   *" * >"ؠ@@' ' ' @ " & @ @ɐ  2@H 0tbf_dequeue: vif# %d qlen %d㿘 `>b& ?*`" *  *  : >"ؓ+ "@ *`@* *  """ ? >ؖ*@ *`+ " * @@ " "@ "  >a?`& >>"&* "**  c:㿘>! @h  >!̔ 㿘H /* !@   1>"&* "@*`@>Ϩ#, * , : * "@*`@ >"ز@`@@(?#`oH 0 $   % $ߢH 0 phyint_send on vif %d err %d@H /* !     0 @ 0$     ' `/ @y/>a` >b>␖& *" * * :  H 0㿐H /* !@xע #*$ ,  @,    @L$&  2 @&   #@8& H 0port %x prio %d㿘` " 2@ * @`0  @  <@ @ F 2 7 2>! > `X`H'H'L'P'T'X  @'@``<@>*@ $@4`` @4`@* =` * @$@>``82 "`8 @ * 2@Ò 4 "R6`@" R6 ?Q &26&   - -`%`" 8  ,` 2Ѷ`2`8>``T+ A`@ "`84 `<0`< 8 2e` ` " 7` ,` 2U 0 ,`U 0 @2 ` >``T 3 ]"`T$` > Ȁ`` "`D`8`2` > Ȁ` ` ``8`2` `2`p ` `@ ```2@`   @q `  0 "(`"? D$` 5' "` 0  1` 2`  8@8 (`! >7`` 8 4`4` `@*4`4`  xΰ`@>``L ( "`L" ?  'ϰ (>``< 7 "`<`'`@   >cn  7`H /* '>a`  3` H 0 '@'``'` 7`   >&`!'`@'` $ `$ ` `$ `` $ @ * < * @''` $:``?Ȑ*@4 ` @ 4 ` "@'  4  "4  '@'` "  4 @*04 4 >``H "`H`  `@ "$ %4`4` ` @*4`4`  '` x!G2` >``D "`D``R`6 ?Х 02`6!'㿘`  ?? #@ @a`@ 2$     " @> >cϓ  3 H /* '>a`  2` H 0 ##  # 3  ’ - @#    & `& # ` >& @ |& `&     & |k& ` { `& 4 㿘  * ?쀤``  2  ,   4 "$@{ٔ$@`?" ,   㿘  `  a` d 2` V>#*`@$,88888,`T@`"> ` "`7 `3> *`@&.`A$.`H `< &`< ?&`< `< &`< ?&`< `<  &`< ? &`<`X@ *`ZҐV` P>!p*`@||||| 0 '`T "6$`  `$` `T{2 /  ' `$` >"(*`@<DLXd `A `H`< `<2 `<2  ` "`X@ *㿘 `s`&`  `L gH C``   = &` ` {F`@s $+` ` % 2  `%@# `  2$`` &` ,`z {$ڦ` ,&   㿀@  X 5 2&@$ 7$ ,,4?`> *`@<h8"  2 >$ Ȁ` `D ``8`2`D` ` ` T`0@" 1$"۰  2װ  ,"а  2̰  8ǰ ,"°  2 < 8 2 >' / /' " 1Y <` Ȁ` `D ``8`2`D` ` `v T`0@r  `2 @@"   p 0l ;Ԓ, @ "`c 7 _4"\  2X < 8 "N >  Ȁ` `D ``8`2`D` ` `"6 1 ` 2  @"  ,  1  6 , ` "``?4 -  @@@@ڒ 5&@㿘 _   & 6 # ( 1 - "` ``@`> Ȁ`"!"` ``8`2` `""`D"" "` ` ` `"` ``` *@  -㿘    `㖠  `͂ 5㿘 沔o ` 4  4  4  `@&*`4  㿘>!㛒 㿘 >!!   >A"!L I`" @25`" @2-` @2%  沔' >0aH,| }  +|   2 I0>aH,^ _0+g|  0 R>  0 4`" 0" 4㿈'H'L'P'T`'X` `<`8   2   ?" 8  ?"    ?& `&  j  "    "   &  *2`I*  2`" " *`T   > 2 2 >``\ "`\ `(`XȖ㿘 ` B  >耢" 4k2d0 0&- ". `"* `  $  ` `<  ?#`<o "` `<` "@    - ] rip_attachrip_detachrip_usrreq㿘 `  ```2 `.`>#@,$`" >Y#0 > !X>!\*x><aq n,`I  "i 9)Y`>7#@ѐ_ > "U 1? 8O 1 "K$`L "F 1C$` = > 2 `6 1? (`/ /($`+)Ȑ'    8`2 9    -㺒 ƒ>א#Pِ㿘>`" d*` *  * >Ѥ @"$@4 4 $  8v  8@  $ $ $  $ $ $ $ $$ ( $ ,$$ 0@s (4 4㿘 `   E 2 >px`"x  `  "  2 1>R  ` " `$(>V` @>p "V` @ Z" E  "" 2   6$ ` `"6` @&`>bp` "`V` `  !"` V` ` " $$ R ؒ  (`"  "`  E"@2 $  $ $" & $ $" $$V  $=  "9    D@23  R  D & D  !`  $` "  "  )O 0 E@    D@" (ؒ 0 |  X'H'L'P'T'X    '7'Į >"p d' $ d` ^  '  (2  | )$ |V@p 6 @#R 6$*  >bp`p "`p 2 * $>bp`t "`t/6   :c2 >bp`| "`|   ( $!J4 2!(@B @2!! 2 ! ','0 '! '>"'82 $>"p Ȑ $  ' '❒2 $ ̐ p$ ̀n`V `2""x*@ ` C >"bb"`"` "` "`"`"`"` "` $7"`$` &' d`'' 7 j' T $ z 6?#`4* .z (`46`>!`6 V  #\@NV 2  `7 2 䀢|@, D2 " <2 (T@2 "V " 4 V V @<V >!&&|V Y$"@ $ T"@ 4 X<@ >Va` 6 >"p ` " >!ܐ"@  `Vb `Td"  @j`T>$pల# "ఒ@")F&$$T@2V6 2`t6`t '?`T`Tn $@2C  2? `4`0`<`8" " 4 43 >pĐ "V D`0 &Dhl "hV  "l` ` "`"'t"` ' `|  !  }6 z6 @ & ?"& `4`0`<`8" " 4 & PD"@ * V &@ x`䀌`<```6 #2< 8 *  % $   * *  "@|2 `' l ' NJ@s &@ E 7'Ā` #\@ >&8#T&88>T&L&,&T&(&$ 6 > 6 6Lbp &D&P>"`"T Q"` `8" `T" ``@ =``" 6( &$&(6`&L`&D&P $6$8" >p`$"  ` `6{z.x.y { Vb`" @ 6V  &@@"@ >@p6  `""?&0&&H  `2D|` <D>!" Ҁ 4&|>p "V  "` "D" 8` ` &`&6& ߠ?V > 6V p @"  ">"p  `" " : &"@&6 "6& 6&` "V V $V V " V @\>p`"D@@  "@ 9>"p` "`V '`` "`V 2@D" }@@3 @ `D@`>bp 6` "``"`ے  "6 䀢 `" `V ` > `@ `>!&&|`#`?* : `>!p*`@ɐɘɘɘppɘp = 67`$6>p `/" `@ 6@`eV "$% $`%" /`T"@ *`>p`#"  ` `6{z.x.y 1 ?&0$" 4OVV 26<26>"p `" V "6$@26>a` 6* :  &<X ( 2 @ڒ ( @s&\66b&(@&X@gV\@($@ &X&(X@ @x&X怦>a` &6X\ 8&X6T# >bp` "`>$p#  "@  ">!ܐ"@  `Vb" d"  @LT@2V6 'Ԁ 2X6X\@  @i x?#* 8&X`T@  `T<"@ &<`T&c  `t&_< "&<`t $ `T( &$&(V "    ,` % x&`$``  "> 6  6 6@9 x6 " `  `@= 6 `0@,V @4@, V @$` < ` V 2&<4@2 &<<>bp` "`&<<p&0 &4&p 'Ԁ` ":D&"6DV 42D`0>` (6&- H@ " $&D&H`0"  ? '`,` @7`" t ?.t& @8V `!2V @GV H"@ 4&HV 2V`BV >D@1 -2+!   6V >Dp &Dh`0!l`"hV ` #"l#)`|`` `{`6  `"2`V -  "ːD 6`&DV     `  x`6  6 6@@ x6 !`6 `   Δ>∘ (:`Ԁ P@Ɛ0L`2`@2 0A`' ##< 8 ` ` `  6 R`  ` @Ā      Δ>∘ (:`{Ā㿐U\@ Q 2`  J "    =&" 9&27&! "3&`o @*&2(&! "$&  @6 ` 8 . {2& '`op `ol ! " & !6 @>!& |& &@tcp_pulloutofband㿘`&? > 4  # 6 >!@ $ @ *u t@  *t `" o5 ?& >p  h*(8 2 h( 2 h(&  j(8"@2 j(4 2 b (2 h(2 j2 b h2 R j(882 *8 2 2 v㿐 `(`(`   ,`- ,`,` š$`0`(2<>!x!x@8 `@8 ` *  `"/$X``" X@ @q@ >`@ 8 !u T4\`" 4@($X@[@>`@ 8 !_ 0$Xd`.  * $\tcp_outputp T $  `?  T `T @& < $ X < ( X  $ "@  T >L ah 24 T@*  4 T% "6     $4 $ (  4  0<8" " 4  Z2T  "L T P L  L  p2 H ( T@ C ? y#*  P D"  "*` 6/ 4*  6*  2& 2#  , $" 4 "  ( " T  T  T  4 @  " ( 8 `$ ( /ؐ /ِ 7֐֒m~      @"    z@#@'  ` 2 2   a" ؒ@B ">!В`"@ |` "` "  "m L   2  (>bp`T "`T ( T@ >"p H L`" H " L"p @ D`" @" D >cr  6 H /* '>a`  2` H 0 &&  & 6   k> !& @  d" " &  h  & hF  & T@ "PO&  >bp`P "`Pbp`` "`` , $" >bp`X "`Xbp`\ "`\ >c   6 H /* '>a`  2` H 0 &&  & 6  8 2 Ȱ 7>a&  & &    >D!l (     ( T@$ (2  (2 (T  " T ($` D`$`ؒ`(lg` <* `2 * @$` ,`!42 6 y & y?#* 4 P D"@ & = 4`" , ("@`$ $ `!4`& ,`!$ , @4` @4`$L  T  25 ( ($ ( (  $ (`4  ( T"@ $ (T b  $ T 4 b$ d>bp` "`T  2 ( $@" T ` 4 4 4  T@"@ 4$ T  T Ҙ & 4` H,` A ,` `(`To > 7 A @V #  2T  4 vbp`<   "`< D P@"@ 4$ P D` $ ?# @4  tcp_output REXMT㿘V  h *`V j:`@:`>M >V a*  @1 6 * :   x  x6 V   6 tcp_init㿘> "cT>>a">`쀢 ' ("`>! ( d> 㿘     H  (" &  @  ,  4 `$ ` & *@<* `6 `@6 & & & . !6 "6 $6 &㿘     4 0 < 8" " 4   (# 5 X>! &@" `"``"`` "` `"``"``"``"`` "` `$ "`$ && (& ``  `&``&` 6`6` 6`  (& &&@y &`&` ` * <*@ &` .`! y<@6`"6`"6`&6`$@H6`$6`>`   .`Y㿘   , @H && 6 h >!x6 l>6 !>a|` 6 *` h6 jV j* :  :  6 6   6 & X& \> $ $, H㿘 V `  6 B>bp`  "` >bp` "``<24 $V v 24 $@㿘  8 X T* @@ <n( "j   "e L @ V h*"@ *`" *   h`* @ 2 $ h$ h L  V j*"@ *`" *   l`* @ 2 $ l$ l L 2  ` \" ` d 2  `2 :( *`2`2`@(  @`( d`@ 2 $ d$ d`"  "` "@ V E 2  "_ ?I $$3>bp` "` 㿘 $R`   `A!`3`@ 4 2`vR` $2`vR`v "2`v6 $v " 0 |  x T㿈> .#T> .  @> Ȑ? >#D `0 > ' * `" 4#\0" _  $ X㿘H /* !>" " ?#>"p  $"  "    2`  `$`  2 $H 0㿘H /* !>>>! * "`F "7> $ - T` "?4`*  2    @ 2 `2 2` ` T b4 ``  4 b2$>T>"@`"T"T>!В`"!БH 0 060㿘`q>``" 0u`V   >V `` >!6 X 6 * :  > 6 bp`$ "`$V v  <bp`(> "`(V  h*`@ * V j:  @:: 6 *  l:   6  6  V ` 6 Ո  h j* : @6 j6 h < $6 b X@ & (  2`@v ( & X @ 6 & \+0Cbp`,"`, .  8. >"p0 "0V `&    `>!> V `@ 4  "4   D $?>!6 >! 6 >p8 <"8tcp_usrreq㿘 `  KG   ǐ ;  7 H /* !`   ` H 0!   $T `.`>#0@LTd(pL(  8@v耤 ` " `T` 2 `>!0*`" * 4`` $T  ZGΠҫɰ   Ң   4   Җ   * $ Ȑ 7 z ?#`4* , z (`4>p>`"p 4  4 >Tb$ 8  8"T$ ,$ T$ ($ $z -@2vӐ@Op0  k `Tub 5]`X&@H 0e `, 2`` @"K `!2G  t  A  = #& u7*@ t 3, t`X`T```\" " 4 `T # 7/ $`T@ $ , , , Ӏ ӌ .@>ٖ"(  `   ｘH 0㿘 H /* !`  H 0 a 6 ] %dߘK 3 $ E$ *"!  (  "`` 6`?# @6`"  `$ `@4 6`  0  ^ ' " "   *` "@`"@H 0㿘`X >`4 2 >!>!/ >b `y "`2    ?4`~ ` 74`㿘 V `    T    ː 0@ 㿘V `>"Г*`@6   6  V     V  > 6 㿘`    *>ˎ!㿘>>a^!h'H'L'P'T'X'>`P``P "`P   `    R2   2$ @ W`@ >ђ`P`  "`  & @'`'`'` '`'  @  @7` 4 *  >єP`"`<8   >' !Ԁ w>!2 ` "   &  & >!! K >Ѣ P   @2@  `" `@28  ` ` @20  @2+ " 沔  >0aԔז  ؐ`  $`ݒ|   " 2 0>ђ`P` "`>aԔ |>ѐ|p ж` '>`!' Ҕ3>>Ѵ P &` '` '  > & # H&'@ `'` @'` '`  '`ҩ7`0<!2 ` "  <   `@1 'Ȳ` > aȐ"& " & &  ? 0 > J 0  |  0 `P` "` 0Ȁ  *㿘 U   ` d[ & $$ $  㿘 2 $  0  |     T㿈> )!\> . @? >#D `0 > ' * `! #\0!  㿀'H'L'P'T'X  ` ` 8H /* ! σ" H 00q 2 m 9 2   ?" 8  ?"    ?' `'  Ӕ        ' 2 B 7 @M . `6 `& `&`>!6`  66 6@`6*  `?6`6`H>.`A`P.`  "` ` `T`X`( 0ǐ&`H 006udp_usrrequdp control data unexpectedly retained 㿘 ` `ʔɰ ``2 `.`>!|@p4   H /* ! >ӒaH 0  >!>!w `>`r* HH /* !  H 0^   Y 8H /* ! | H 0 E pA   : 9H /* ! $ H 0` ?%4`D" (@& A  M    - ->X ؀ >< WR㿘H o*@aH 0㿘`    *>6!а㿐a"@  o.6Q !' "` `  """"  o2  @9  `     '  7  6 bind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d h ` + /  'А Ԕ      '̐ " #?c ##  ` ے '̐ " "@Ԓc 急    '  " $ , ,$Ԣ 4 0, 2 "8}̀ >[!€      % a Ē  <$ <$ @6 $ $ $ $  $  $ $ 4$ 8'>a "a $ @ '$$  沔ז g'Ԓ    ``'`> "@Ѐ "'̀ #@'''ԒД̘ؖ  ĚȰ # &?P$@`! `  `  >a   > "(` >"@ `   ǒ   ' 7>!԰ `  @` ? \̀`''@'Ѐ Ѐ  ԁ㿘` ? hL  ɒ `l?H /* '!>!쀢   ג !쀢& >!x" > 2`  * >a` ?"`  $!H 0  "  & (& $ &  6   2&   &  "@``㿘 4  7 2     ?   {ϒ.@&㿘 [  "   "" " "  "㿘   2   @ " ` &@.@ ` .` `.` `.` nfs: bioread, not dir NQNFSNONCACHE: type %x unexpected nfsbioread nfsbioread: type %x unexpected   |  ` a '|` |ܰ @" @b`|@|@!\`8`X! &``>ң!@|- @ %>c''''c'* @@0+>c''''c'* @@@|8 @{ @ 0y!0vu %|@!R> h@$<8!  @658 @.!" W @28$@28 2 8 + 8 2&8 @{ @: 3 =   @{ @&  2 8 "8  8 "8 " 8 "  8@ߔ@>Ȑ!8    >8 "8`\` #``@ٕ=  @:` >` 't`K|` F@D  @:  88 3@:` ! !|@x"  $" $` $ $@  | $@ " $!|``!o `$@  @@ @F"n `$" 't`$ $`$@'`%8` " & t`8 $7$ `d`h $/$  @"9 `$ `X$`$``$ >>"''`P`* @@   $ `h "&۠ ڀ  $>`\`0 @#`0" `$"2`4`$ $`$@x`4$`" 8   `!l>`\`8 #`8` $@Ѹ c $@"ΰ `$"E>`$ $`$@9> 4 #0 @z& @  $@|" `$"2 `$ $`$@^"    "Հ > B|` $?$`   * : @  @ /$ +$ '$  Q  $$@0$ $" $` $ $@  $@ " $$`4"`" 8  >"  `"`<@Q8 "  8 2 8  `$ $`$>"  `  |    `|8`!Ű   ?4" @b`@`"&`  $ @֘ `>$c''''c'* @@>`` 6`  ` ``; ` B 4  2` m 0i $h" $ 9>@I!6> h@$ !  @ @2' @D!" @ @ $@   @^ * < >` `\ '||@xx`@x0`\`$ "`$`@/= %`    @:` @"  `?2 5$ `4`=  B 8 2 X(  X= `@ C <@HҒ  X @4$  T@ 6$ !'' P!`* @@  !;> h@$ !  @ @* @ !" & @ $@ & @ x < <Ð X $$ T T@$ T X@ * $ X@$ X h "  T T & T d X@  T X $ d 8  h X@ $ d $ h $ ?$ $ 2$ `"$ !'' P!`* @@(  @P "`0! $  $ " $@`f`   㿘 ! @!2 2#> @c۔  a0 !+  "    nfsvinval㿘 ! @ | >!0!*   4   >ɔg "  "   @c 28     4  @c  ? 4 ?4 Ģ   .H 䀧  ? 4 ?4 Č  㿘> I>>ϒ!8  ". $@ \?2& "& @ 6@& \ $@  `& $2 & "& @ 6@& `&  &   "@ " R" `L$ $D @2  $ P& $/?*  Process killed due to text file modification nfs_doio: type %x unexpected h  P' !|'''' $@- 0'' <' H ; 2`* @ *` ? $@ '> \ @# ɢ''>\,Ț`@ , $@" X 0'' <''8 > " 8 "k8 H :3`+  +` > \ ?@# #& d耠" 0 H ; 2`* @ *`  0" "@ ` @8  <@{& h& hl` h`!> h@$!  @6  @>$@ >!J`T@E`>̎   :&  ?> \ 4@# 4-\<"< D ; 2`* @ *` ?@@@ #@@*@%@@ `@> 耤`"q` $& ((& $k` T" '' H82`* *`  T: @ C ? < T '>`\`(' "`(  $  @` ''̘̐ $@@& $@̀  $  $ ?& $` $@*@& $` $ ` $ & $ $ -Ғ``"` $$& $`" & X $(& $$& (ྐ 4& X& T`Ȁ`& 4@uAnfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=0x%x nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=0x%x nfs_boot: hostname=%s X>#̀ ">   0    2 0 2 >;"ТؒX~ >ː" Ĕ Q ">(#0a" >#8aĘ 7蒒>#X">>#x#@ߒ  / / a '쒒>#ĠȐ@Ȓ //ɐ?'>!"bH@w">ؐ#>˿#>̐ >˺bX  nfs_boot: bootparam get %s: %dnfs_boot: mountd %s, error=%dnfs_boot: portmap NFS/v2, error=%d㻘@>̐"hʠ@j>̐"ʖab p>̐"ʋ @, :. O  i: . @.`J@  .nfs_boot: bootparam_whoami: bad reply 㿐  ' " ab$ $ 4$ 'ab"  $  o6 } >`  7  %' ܒ > "H> b6  H&  '>">cܔ '  '># H " nfs_boot: bootparam_getfile: bad reply 㿈>"H>]"  '@U "@4 ab   ) Y' '’쒒'#' 耢  '@  . .&>ʤ!p 㿐#ab  0@K  '& b  Κ `  H` #    $ '  Vǔ 0 H㿘>!H> L>"b     㿐>`>ϐ * @@    2T 2 @Y 2  ,  2@2& 2  >)8 %&!  @!& |$ @ $@" $@@$  T $  $  VT4 & nfs_inactive: pushing active㿘>  >" `|R` >.V!p  8  ` $`   @ΐ+  ` 4` nfs_reclaim: pushing active㿘 >b``|` !T` >ΐ"@."` "` "!"`8 ` @ & "`   @ & "``8 2T  " T ? T T @ 5 Tѐ`|0 $`| nfslck㿘 !" x!>ΐ"& #  !" x@?   㿘  $  Nqnfs server, too many leases nqsrvnumlnfs_nqlease.c: Phoney lpp\ 8 `  d`E @>"@8&@>c'`'d'h'lc'p * @@`.<@H /* !  @>`\aD "aD9  `<'x`@'|  `(€ H 00>#> @*`  x @2| $@2  (@ "' 8 x0$ @ |  _   @_  T"B   2> J@O  D       @; /  2@    2@ !   T 0 $@@a T@ @0 `@ 7 @O@ܐ@ 2 @@   %@%@ $7 H 0f H 0] %>#>b@>+ @9>1>ϐ <  `֖ b@ < < /Ŕ @  <  $7  @K' 8x' |' $ (Ta2> p '" $' $ @H /* ! @@TH 0 %@> \< @@"<"@ x'  ?  #\#` #d 㿘>!$6"@ > A6`& `6 !Ā@2  沔_ & `6& (6`D &`D>h> @ >p " "  >bp"bp" ">tt  $> 2 >p 2 p""  p"  > p""   2 " 㿐? !)@ >">!Ā2  @   `0 2` `  2'' @o_build > MLENmbuf siz=%d Bad nfs svc replyX'''Ԧ``   >! } "f4#2d @3> c  4`H /* '" 6"H 0 $@$``$`4`  ` * $`  *">"2  >!  `0 "$ ``  U@ 4    @c'` ``$`` @  "@`(  3 ``  ?&@ 8+  >c. "  2H /* ' 6H 0 """27 $ $ '   $  '@M``<$`@$ ` `(€ @   !@( #\>ѐ ; >N #`#d#h#l#pԒ#   @cʚ / 2  ?" 4  ?"    ?"`"  s "   " ? "   0   @@   @ % @Q "@[$ @"EH /* '>T`*`@?2@H 0 ` &>H /* '`>!x"@> 2` ?* *   >`"@` "  H 0 >T`c*  T2 "   2nqexp㿘> h @$      # `  >Ҕ0 ` 6  >@ 2 "   `2㿘>"p"p@  >!`>`h ``  `?#ߐ @4`S``2 b 2`d {> 4 2 ` {4`>"@` & "` ` @`&p"`@```"`  ` @ "@>`8#"`@` a F(H /* ' R *`@?2@H 0  ` "( H /* '`>!x"@> 2` ?* *   >  "@  " %H 0  R *`}@("@s 2 n 0 "   `2_ /Z 0>`\a<?"a<@2G`㾠 , 0 @  LX 8'T 5'P``  "    'PTP @fLf L  H& T#\<#`8#d  H,@U@` t  T L 䀤 H" T  P@"@    'PTP @fcL1 L P  L T  P@"@  TP@fÔ T 'PT  P@"@   'PTP @f4L %<L 4 & \0#\ L`@k#`<& T#\#`8#d ,@U"@`   0 L o H" 0 #" \4% & T#\<#`8#d  ,@T@` ڐ   \ L J H"  \,4@#\#`#d>'''4' '`* @@%4  & T L   d , d,@<#\#`8@T#d`   < L  H2   $ @  "@`  58  ?" .8 >c  2H /* '>a` 2`H 0 """2  <"'<" '88<  '8, " # \ #@ #D<#   $ @  "@`S  58  ?" S.8 >c  2H /* '>a` 2`H 0 """2  <"'<" '88<T'8 T@j=# ( ,  0  @  L 8' 6'``  "  ` ' @dԘ N@   H& T#\#`#d  H@SԚ`   L H   @"@  ` ' @d  N͔  L   @"@ @d   yX  "F6'n ># @>!*`  @2 $@2  (@|a  "2,     Ք Ơ 2  `"  `@ 2`    ?#ߐ @6 h  $>``\` @^y#``| 'R`  ?   $  @  "@  f`|   ?$4^`|  $ @  "@   9  ?"1 >ce  2H /* '>a` 2`H 0 """2 l  l> "'" '` "` `|R '#?"?`|`R`M `R`@d'  $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2  "'" '  '` #ଚ##\>h@O#`"? .  @"@`| ' @c(% > h''ؘ#\@'ԐԒ@d  !0   > `\` @]L#` |`'R`  ? ``$`` @  "@  d |``  ?$@4\ |  $ @  "@   9  ?"1 >c8  2H /* '>a` 2`H 0 """2 ?  l>~ "'" ' "  |@R '"@` ? "? |LR`R`@b"a0\       #\#`#d#h#l#p@]̘ T`/  2   ?" 4  ?"    ?$ `$  t  "      $    ? "''\ @U  P`@KƖ\ @U5㼐'L'P'L'P'` @V    P`d'L 'P l 7``  "  ` 'PLP @aޘP @   H&T#\ #`#d  H@Pݚ`   LL  HLh L  P@"@  ` 'PLP @a  KՔ L L  P@"@  PL@b  09'P|  .` (``"` 2`   `` $ " `  `$ "  ""  2 $ " $ !_ cld kerbnqnfstimr@@;  @27@>( !   Ā4 Ѐ@4I Ȁ 2 I 2 &  & &  @& @ &  Q & @2  +>)>a> 2  P "{  0  ''''@LYo `hA    2` &  @W@ & "`  @& "`ྀ E& 8`A  ɘ ྒ 602 '''' ' * @@ྐ ?#6`h 6.ྐ ` @2  0  E  2 &  @  b  > &  " @" @2  H& [ & @2 @">!0@uɒ  Ȓ!>ܔ2 ' @Ea 䀢` "`  "@`"`&   3"2 #" #X` X ` " `  `"  ``@2``߄ 2`"`:`    ` $ 2 2 "`"`  2 "  " "`"`  2 " nfs㿘>a "aH /* !>"p"p " 2H 0 >"@"@  X>ڒb@w  2!!"@" `"``@ 2` Xnqlc㿘  " !>ڐ 6  #     ?#` @6 㿘 ?# @`6 Mbuild > MLEN㾨 , 0  @  L 8'T 5'P``  "    'PTP @_8Lf L  H& T#\<#`8#d  H@N7@` ` T L `H"; T  P@"@    'PTP @_L1 LI1  L T  P@"@  TP@_c T 'PT  P@"@   'PTP @^ԘL ŐL0#\ 4 L`@d#`". L  & T#\<#`8#d #\<#`8#d @M@`헐` L  `H  <@c@8  !40@FC 2 4`8      0@F2 2,4`8      @0@F! 2,>'X' '$4'('`* @@P4` & T L  #\<#`8#d #\<#`8#d \@MM@`*` L `HX<@bӘ8<  $ @  "@`  58  ?" .8 >c  2H /* '>a` 2`H 0 """2 딒 <"'<" '88<  '8 " $㾠 , 0 @  LX 8'T 5'P``  "  ` 'PTP @]LO L@  H& T#\<#`8#d  H,@L@` 욐  T L  H" T  P@"@  ` 'PTP @]L L G  L 0T  P@"@  TP@]  bҰ'P0#\ 4 L`@c#`<& T#\#`8#d ,@La@` >  L 4 \ , 8@#\#`#d>'''4' '`* @@#4  & T L   ,  L  D T ,@<#\#`8@L#d`    L  H " L]  D T<  $ @  "@   48  ?", >cY  2H /* '>a` 2`H 0 """2 ` <"'<" '88< L  `T`D"  L 8 T D'8@a8 `, `0 `@``L`8'쨊 5'``  "  ` ' @\y䖒 @  H$`T#\#`#d  H@Kx؀ U  `L  H"W   @"@  ` ' @\D䖒°  Fr `L >  @"@  @\ > '>!А! ? ? ? ? (? 0? 8? @? H? P? X ?v?  @"@  ` ' @[䖒v @>b8   @"@  ` ' @[ޘ䖒\ @ /7  @"@  ` ' @[Ƙ䖒D @>b8   @"@  ` ' @[䖒* @'  @"@  ` ' @[䖒 @>b8   @"@  ` ' @[{䖒 @'  @"@  ` ' @[d䖒 @>b8   @"@  ` ' @[J䖒Ȱ @`?  @"@  ` ' @[2䖒 @  &  @"@  ` ' @[䖒 @' `> h h '*`" *  * '  @"@  ` ' @Z䖒r @  &  @"@  ` ' @Zژ䖒X @' `> h h 'đ*`" *  * '  @"@  ` ' @Z䖒4 @ a  @"@  ` ' @Z䖒 @'`H'  @"@   ' @Z䖒 u0?# @ 7> 8@ 2' 2'  :? "'' "'*`" *  * ''Ȑ#\ ̖`L`@`#`(`L  $`T#\#`#d #\#`#d @I>؀  ΐ`L Ҁ H ƐД `\ `8#\#`#d I>'8''''`* @@  l@ p@ # )`L $`T ` xĚ؄#\#`@H#d Ð v`L z Hư n??2`8Ȁ 8    >00`8  +  @A^#>'''''`* @@>'''''`* @@ |̀ $`T`L    D xĚ؄#\#`@Hz#d W  `L  H  #\8@]MN   $ @  "@`C  5  ?" C.А >c  2H /* '>a` 2`H 0 """2 溒 "'" 'АԖD' D@^I# , 0 @Lp8' 5'``  "  ` ' @X2g @  H$T#\#`#d  Hl@Gߚ` 缐  L 3 H",   @"@  ` ' @X22  Bٔ L   @"@  @Y   '  @"@  `' @X| l0@ 4 ? $ H $T#\#`#d l@Gs` P " 'L ǀ H" '' 'ؐ#\#`#dL`@[c#h >c'p't'x'|c'* @@p2 *L  $T#\#`#d  #\#`#d` Xl@G`  rL s Hl j \ l8#\#`#d @o @ `<$`@$  `(€>c'p't'x'|c' * @@pÐ  $TL   l    " D X2 Xl#\#`@F#d` 擐  L  H  @\: O  $ @  "@`  4  ?" , >c  2H /* '>a` 2`H 0 """2  "'" ' ` ' ` #  L#@  $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2 䪒 "'" '` '   # A%  @[@[0M  $ @  "@`C  5  ?" C. >cE  2H /* '>a` 2`H 0 """2 L "'" 'D' D@[# ''d 't,'\0@L'l8''' A'|``  "   ' @Vjܖ[  * HL  $T̒ Hd #\̒ Hd#\#`#d@E]  :  L  H"ɰ   @"@   ' @V)ܖ ܐ l@W L    @"@  @V  0'  >!5> >c  4 H /* '  6 H 0 $$  $ 4  ㋒ H /* '쀢    쀢$ >!x" > 2`  *  ?&  &H 0  "  $ ($ $ $  4   2(  l d$ 't& $$$"$ $ `% %  %%  =%% %%#\l \L`@[7#`8htL $T̒d#\#`#d ̒d#\#`#d @Dg D L  H  @YͰ 8 |`"   L \  8#\#`\#d>\'''\'`* @@>\'ĐH''''`* @@Ā " $Tt $TL 2| |   \d#\#`@C#d Ր "|L  H|  H@Y{Ȁ 2Z   $$t "@ @X|"  $ @  "@`  5  ?" .Ȑ >c'  2H /* '>a` 2`H 0 """2 . "'" '̒ 'Ȑ " "t"nfsrv_read iov8'  ,' 0 @' L 8'4'0 5'``  "  ` '040 @TI, ,@  H% T#\#`#d  H@CH  %  4 L D H"j 4  0@"@  ` '040 @T,g ,>B  L 4  0@"@  40@Ts M '0Ā4  0@"@  ` '040 @S,4 ,@`''  0@"@  ` '040 @SȘ, ,@ ?4  0@"@  `'040 @S, ⠐0,@ L  ' < @  H H% T#\#`#d  H@B  t  L  H#\   L܄`@Y)#`*  L  % T#\#`#d #\#`#d @Bc  @  L ` H^ X  8  Ā     "> L   \  8#\ #`ܖ#d @:Ӓ! @:˒ @>'ܐ8 ''''`* @@耦 '̀ P  L % T  @8  T@P:` B 8P TP"@   ? % T L   Đ ? d P #\#`@A#d"@ᢐ @ ' L  H" ĀQ  $ @  "@`c  5  ?" c. >c  2H /* '>a` 2`H 0 """2   "'" '`d' >"8`d" $@`'L`T  $ @  "@`G  5  ?" G. >c  2H /* '>a` 2`H 0 """2 ߽ "'" '`H''` `D H"`   >!7>      $ @  "@  ?$@8@$  [ >c_  4 H /* '` 5`H 0 $$  $ 4  h H /* '쀢    쀢$ >!x" > 2`  * ` ?%`  &H 0  " $ $ ($ $ $  4 $ &@4 .  T  * 2 >b      $ @  "@  ?$@8@ $    ##    $      8>c'  'c'''* @@ T? >'ܐ8 ''''`* @@耢 ='̀ "   % T L      Ą` X#\#`@@ #d   L  H̔8@U(   @V$8% ? Ē& @T"Ā$@`>"8> $@`$@   ,  0'| @  L 8''Ѐ '& 5't``  "   'АԒД @P̖   H$ T#\#`#d  H@? n   L ˀ H"|   В@"@   'АԒД @P]̖P ̐ t:  L   В@"@  Ԓ@P 6 'Ѐ  В@"@   'АԒД @P+̖ ? '|  В@"@  'АԒД @P̖ 0̖ ?  0 ,Ѐ  #@ " " ` "" " `$ #"@"   4 ۀ @  L  $ T#\#`#d #\#`#d  r#\ t L`@Ue#` L  $ T#\#`#d #\#`#d ܖ>'8''''`* @@ 8        L  \  8#\#`#d @71`Q L $ T ` x#\#`#d@>R /  L  H#\8@S'4 < T-  %@%` $"@ "``2 |  %` %`%`%`=`>`''''`'* @@>\H T"H>'''''`* @@ " $ T L  `  ``L2 #\#`@=#d ݦ  L  Hg#\8@R 2   $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2  "'" '| ' " "" ">#"# N"  $ @  "@`C  5  ?" C. >c  2H /* '>a` 2`H 0 """2 ۮ "'" 'D' D@S=# nfsrv_write: nd_mrep not free('ĸ'' &Į  '%& (& 4 & H , 0 @ L>h'' ` ; 0(@ (@b2`* @ *` b2*@*@D4`, @',`'>"xh: ?: EB L B>``  "  ' @M   , H L  & T H #\ H#\#`#d@< `c ' L 〤H  @"@    ' @MP N   h7  L   @"@  @M  05'  @"@    ' @M   &  &  & H   @"@    ' @M  0<  >     & P8@ B `$>     " " # `  # "  # @ @#@"@#   ‣  @.۷  & T#\#`#d  #\#`#d  @; #\8@P& ,  >& 4H /* !  H  @8@  @8"  H &   "`$$   &  H "`$' H H& $ , l  t *    h h@dW     h0  h@dK     @4 h@  @ h"4@ &  "`$&  / @*h @#h h@d  L L `` `@   @d  P 2߰@ڰ & @ "`%@& H 0+>`h;3`+ +`@ b 2`* *` b2*@* @ 0(@`h`(: DH /* ! H  '>'  2 4    4 2" $ $$$ $ "@ `"  "`  "@H 0 '  h   L , ` 8& ,#\ L`@QH#`2!''А8''''`* @@к 8      2 H L  \  8#\#`#d @3  H    &&& >  " ?&@   4` 2 &+` T &` $ "@ "`` 2 2>'''''`* @@>\H`"H T`?А'''`* @@' >!*& T ̄#\#` #d x̄#\#`#d@9#\8@N& T`   ` L2 ̄#\#`@9#d^#\8@N "$  @ "   3  ?" , >c  2H /* '` 5`H 0 """2   "'" '`  "`   P'# H #># ## M#  "$  @ " C  3  ?" C, >c  2H /* '` 5`H 0 """2 ׶ "'" 'D' D@OE#  ,`& 4>"H /* !   > H &  H "`$' H H& $ (   `" $ $"`$ $ "@H 0 ․H /* !  < H $  H "`$' H H$ $ 2H 0H /* ! H   4 "  ` $"`$ $ " 4%% 2 4H 0 nfsrv_coalesce: bad off㿘``"``"```"@` `"`$`$"`$`$` "@` @4  @` @ ` `>A#$ ,`, ,@ 2@`,"@`> 8`,`H` &`,`2 ( H 2 (& H ( &`  (` "`$& ( (&`$㽈  '  , 0'$8@PL'D''@L 5 `  "  ` '@D@ @I<2 <@ , H$T#\#`(#d  H@80   DL  H"  D  @@"@  ` '@D@ @HϘ<2z < 2 L D  @@"@  D@@I/ Da '@D  @@"@  ` '@D@ @H<2K <@ 4 ? $ H ,$T#\#`(#d @70 w " 'L  H" ' ' '@#\$#`#dLD`@K#h$>c'' 8''c'* @@'W '$ 8>L  $T#\,#`(#d  #\,#`(#d` x@7A0  (L 4 H2(#\8@L,$ S 0O!А! ? ? ? ? (? 0? 8? @? H? P? X??D  @@"@  ` '@D@ @G<2 <@ "    Dm MDi  Dc   @@"@  ` '@D@ @G<2g <@>b8 D  @@"@  ` '@D@ @G<2M <@ /7D  @@"@  ` '@D@ @G<25 <@>b8 D  @@"@  ` '@D@ @Gp<2 <@'D  @@"@  ` '@D@ @GY<2 <@>b8 D  @@"@  ` '@D@ @G?<2 <@'D  @@"@  ` '@D@ @G(<2Ӱ <@>b8 D  @@"@  ` '@D@ @G<2 <@`?D  @@"@  ` '@D@ @F<2 <@  &D  @@"@  ` '@D@ @Fܘ<2 <@' `> h h '*`" *  * 'D  @@"@  ` '@D@ @F<2c <@  F D  @@"@  ` '@D@ @F<2H <@'`+'> h h 'đ*`" *  * '  @@"@  ` '@D@ @Fx<2# < H0   7 >'D  @@"@  '@D@ @FX<< He$>a2 < ' ' /` 7``"  `"    :?  ^``Z.L \ 8#\0#`#d>''''' `* @@ ,>Ж??? ?(?0?8?@?HH?P?X ?0?>'?'' `* @ @ ``? 'j "3'O >''' `* @@$T 0,#\#`(@4#d Ԉ L  Hǰ L \ 80#\#`)#d>''''' `* @@"!'o$T ,#\#`(@4i#d F " 'L [ H '''?c ' Ӓ $T 0,#\#`(@4>#d   L 0 H"[  @@ >''' `* @ @$T  0,#\#`(@4#d  L  H # z >''' `* @@̰ oc ͐>>''' `* @@??K  @,Z <L \ 8#\0#`?#d>'' ''>!'! ? ? ? ? (? 0? 8? @? H? P? X??? * @@ ] $@\' @ `<%`@%  `(€>c'' ''c' * @@9   >H@\2  2 >'''$'' `* @@($ $TL     " D T2 x0,#\#`(@3#d  L  Hg [(,  $ @  "@`#  4  ?" #, >cS  2H /* '>a` 2`H 0 """2 Z ,"'," '(( ,`$'( >b8$# #@` #@-ϒ` ,@H@((#\8@G,Ȱ ,  $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2  ,"'," '(( ,` '(   -q# ,  $ @  "@`C  5(  ?" C.( >c  2H /* '>a` 2`H 0 """2 Щ ,"'," '((,D'( D@H8# - " >{ >''' `* @@@ِ Ɛ  㽘   `,',`0``8P`@'L'`L 5'H``  "  ` 'HLH @BD2 D@ 4 H$`T#\#`0#d  H @18 {  L`L  H"  L  H@"@  ` 'HLH @BjD2S D , `L L  H@"@  LH@Bʔ L: 'HL  H@"@  ` 'HLH @B;D2$ D@ 4 ? $ H 4$`T#\#`0#d  @158  " '`L w H" ' ' 'H#\,#`#dL`L`@E##h,>c''8''c' * @@ 5L`L  $`T#\4#`0#d #\4#`0#d x @08  0`L & H$0#\8@E4, E   H@"@  ` 'H @AD D>@` *  ?  ? ( >)  Ұ#>!А! ? ? ? ? (? 0? 8? @? H? P? X?L? H "  ` 'HLH @A_DH D@>b8 L  H@"@  ` 'HLH @AED. D@ /7L  H@"@  ` 'HLH @A-D D@>b8 L  H@"@  ` 'HLH @AD D@'L  H@"@  ` 'HLH @@D D@>b8 L  H@"@  ` 'HLH @@D˰ D@'L  H@"@  ` 'HLH @@˘D D@>b8 L  H@"@  ` 'HLH @@D D@`?L  H@"@  ` 'HLH @@D D@  &L  H@"@  ` 'HLH @@Dh D@' `> h h '*`" *  * 'L  H@"@  ` 'HLH @@[DD D@  '?L  H@"@  ` 'HLH @@@D) D@' `> h h 'đ*`" *  * 'Ȑ? L  H@"@  `'HLH @@D  w,D@`*  '  ~ >'''`* @@  ,'`L `\ `8 #\8#`ԏ#d>'''' '`* @@2~c m q "`L~V >'''`* @@Q `\ `8 #\8#`L#d>'''' '`* @@"'+ '?# @''~ 2<@@ wf>'''`* @ @ #@W# @ `<%@`@%`  `(€`>c''''c'  * @@5>''',' '`* @@2, $`T`L     84#\#`0@.$#d   `L g He [04  $ @  "@`#  4  ?" #, >c|h  2H /* '>a` 2`H 0 """2 o 4"'4" '00 4`$'0 >b8$# #@` #@(` 4@CU00#\8@B4- " >}+ >'''`* @@@ v  p `, `0 `@``L`8' 4'``  "  ' @>R2e   H$`T#\#`#d  Hl@-Q  .  `L ? H">   @"@  ' @>21  (L `L   @"@  @>~  '  @"@ ' @= 0 4 ? $ H $`T#\#`#d l@,  Đ " '`L Հ H"԰ ' 'Ԑ 'ؐ#\#`#d`L`@@#h>c'p'tP'x'|c'* @@p ` 8 2 < =>    @ 0>`L `\ l`8#\#`#d`L " `8#\#`#d>'pĐ'|'t'x* @@p'p'x't`* @@pĀJ086>c'p't'x'|c'* @@p/ $`T`L  ` xl#\#`@,#d   `L  H  #\P@@ x    '''D'$, 08@hL''d'''`L 5 `  "   '`d` @<Ř\2q \ L H$T#\#`H#d  H @+ĚP` ˡ  dL ̀ H" d  `@"@  '`d` @<\2= \ & L d  `@"@  d`@< d$ '`d  `@"@  '`d` @c'(','0'4c'8* @@( 'D ?L  $T#\L#`H#d  #\L#`H#d`  @+P`  HL  H"< #\L@?ؚ#\H@?КD ' ؞茀 6d  `@"@  '`d` @;\d \  H$T#\L#`H#d  H @*P` ʔ  dL  H" d  `@"@  '`d` @;\0 \ % L d  `@"@  d`@; d '`d  `@"@ '`d` @;V\ G{D\$%>q H' ' ,'`#\$#`#dhLd`@>Y#h$>c'(',H'0'4c'8* @@('' '$ >'('0',`* @@(Dx  |`8   8   `8   8 2`8 25 4 2`8 < `8 2``< ` @ B @@ B @ Ā  @R "? F>L \  8P#\#`V#dL " 8#\#`I#d >L " 8#\#`9#d>!|'' '|x'''!|'* @@0'(|'0',`* @@(m Z >U>'('0',`* @@(US?" Npxڒ D>c'(','0'4c'8* @@(7D$>c'(','0'4c'8* @@('#$!x $TL  `  PL#\#`H@)#d`  L  HH#\L@=#\H@=ؚ1 D "$$ " px^ Ԁ xU >'('0',`* @@(H    ,'0@PL8' ' L'4 ``  "  '  @92ʰ   H$T#\#`#d  H@( ^   L  H"    @"@  '  @9N2  #| L    @"@   @9 "L} 'L 5   @"@  '  @92e   H$T#\#`#d  H@(    L  H"    @"@  '  @821  # L    @"@   @9I   '   @"@ '  @8 ǫ0W 4 ? $ H $T#\#`#d @' Ǐ  L 4 H3 #\ L`@>C#`/L  $T#\#`#d `  X`x#\#`#d @'w T L  H  8 2 '{ ' 'Ԑ 'ؐ#\#`#dL `@;\#h䀢>c''̐P''c'* @@* '䀦 \    @2  0>L \ 8#\#`̫#dL " 8#\#`̞#d>D'Đ'D''* @@'Ȑ''`* @@@א Đ  >'Ȑ''''`* @@Ȯ䀢>c''̐''c'* @@Ⱥ쀦 $TL  `  X xĚ#\#`@&#d o L  H@<#\P@;^ `   'ܺ ,'0'8@(L'$'' L 5 `  "  ` ' $  @762j @   H$T#\#`#d  H@&5`   $L  H" $   @"@  ` ' $  @725  !/ L $   @"@  $ @7a $ ' $   @"@  ` ' $  @6Ҙ2 @ 4 ? $ H  $T#\#`#d @%̚` ũ " 'L  H"I ' ' ' #\#`#dL$`@9#h>c''8''c'* @@' ' < >!А! ? ? ? ? (? 0? 8? @? H? P? X?D?$   @"@  ` ' $  @6K @>b8 $   @"@  ` ' $  @61e @ /7$   @"@  ` ' $  @6M @>b8 $   @"@  ` ' $  @53 @'$   @"@  ` ' $  @5 @>b8 $   @"@  ` ' $  @5Θ @'$   @"@  ` ' $  @5 @>b8 $   @"@  ` ' $  @5Ѱ @`?$   @"@  ` ' $  @5 @  &$   @"@  ` ' $  @5k @' `> h h '*`" *  * '$   @"@  ` ' $  @5G{ @  &$   @"@  ` ' $  @5-a @' `> h h 'đ*`" *  * '$   @"@  ` ' $  @5 = @$ l H Tr} 'h'l'  ?xh'p 't''  '$p@3X  2-$   @"@  ` ' $  @4Θ ÿ7@7- "#LsV >'''`* @@@   b \ 8#\#`A#d>''''''`* @@谒; 3'''?c  ')Đ@L3 @ `<%@`@%` `(€`>'''''`* @@DOrے r֒ T>c''''c'* @@'3 $TL     2 X2 x #\#`@##d`  L i Hge [   $ @  "@`#  4  ?" #, >cq^  2H /* '>a` 2`H 0 """2 e  "' " '  `$' >b8$# #@` #@ڒ`  @8K#\8ܘ@7 3  r&  >>'''`* @@@~ k   t q T㽘  `, `0',`@``LP`8'L `L'H5 ``  "  ` 'HLH @3>D2e D@ 4 H$`T#\#`0#d  H @"=8   L`L  H" L  H@"@  ` 'HLH @3 D20 D 7 `L L  H@"@  LH@3i L 'HL  H@"@  ` 'HLH @2ژD2 D@ 4 ? $ H 4$`T#\#`0#d  @!Ԛ8  " '`L  H" ' ' 'H#\,#`#d`LL`@5#h, >c''8''c' * @@ ', 7>`L  $`T#\4#`0#d  #\4#`0#d` x @!|8 Y 0`L 0 H.0#\8@6Q4, F Y!А! ? ? ? ? (? 0? 8? @? H? P? X ?G?L  H@"@  ` 'HLH @2 DG D@>b8 L  H@"@  ` 'HLH @2D- D@ /7L  H@"@  ` 'HLH @1D D@>b8 L  H@"@  ` 'HLH @1ԘD D@'L  H@"@  ` 'HLH @1D D@>b8 L  H@"@  ` 'HLH @1Dʰ D@'L  H@"@  ` 'HLH @1D D@>b8 L  H@"@  ` 'HLH @1rD D@`?L  H@"@  ` 'HLH @1ZD D@  &L  H@"@  ` 'HLH @1@Dg D@' `> h h '*`" *  * 'L  H@"@  ` 'HLH @1DC D@  EL  H@"@  ` 'HLH @1D( D@'`*'> h h 'đ*`" *  * 'L  H@"@  `'HLH @0ۘD ̐,D@ /7  '>'''`* @@Ő0F `L `\ `8 #\8#`S#d>'''' '`* @@$,@HX @ `<%@`@%`  `(€`>c''''c'  * @@k,>c''''c' * @@f, $`T`L       2 X 2 x 84#\#`0@O#d ,  `L  H g [04  $ @  "@`#  4  ?" #, >cm  2H /* '>a` 2`H 0 """2  4"'4" '00 4`$'0 >b8$# #@` #@ ` 4@4~00#\8@3ǚ4 4  $ @  "@`  50  ?" .0 >cm-  2H /* '>a` 2`H 0 """2 4 4"'4" '004` '0   # 4  $ @  "@`C  50  ?" C.0 >cl  2H /* '>a` 2`H 0 """2  4"'4" '004D'0 D@4w# $ >4>'''`* @@@!      ,  0' @  L 8'  L'4 ``  "  ' @.2e   H$ T#\#`#d  Hl@  Ð   L l H"k   @"@  ' @.21    L   @"@  @/  '  @"@ ' @. u0%`4 ?`$ H $ T#\#`#d l@|  Y " ' L  H" ' 'Ԑ 'ؐ#\#`#d L`@1l#h>c'p't'x'|c'* @@p: ' 7 L  $ T#\#`#d  #\#`#d` xl@$    L  H#\8@1  h`8   2@  2  0> L  \ l 8#\#`„#d L "  8#\#`w#d>'pĐ'|'t'x* @@p'p'x't`* @@p@ 0힐 휐>c'p't8'x'|c'* @@p $ T L  ` xl#\#`@#d  d  L  H  #\8@1Z ' ,  0  @' LX 8', 5'(``  "   '(,( @-9$ $  H& T#\#`#d  H@8` ` , L `H" ,  (@"@   '(,( @-$Q $ 2  L `,  (@"@  ,(@-c `7 '(`,  (@"@   '(,( @,Ҙ$ $??  (@"@  '(,( @,$ +$: ? L'|` > < # ##4#\  L`@2J#`'t L  & T#\#`#d #\#`#d Ӛ L  \  8#\#`#d`>'''''`* @@ت`@ @>< L & T ` Xc8'c8'* @@ؐ Ti '@A /  Ti 'l0'8 'tc 'c '0'4'H'* @'ԟ@>0'8'l''0'''`* @@l`@`" `>'''''`* @@؀`>c8'c8'* @@؀`7HjT TlljN T L & T ` X#\#`#d@`` L  `H@07 l& T` ` X  #\#`@#d`]`` L ؀`Hր`V@0  $ @  "@`  5  ?" . >ch  2H /* '>a` 2`H 0 """2 Œ "'" ' ' " ""K  $ @  "@`  5  ?" . >cho  2H /* '>a` 2`H 0 """2 v "'" ' ' " > ">b8 TiR"liO T. l'd '   d?'d     ts?'`& T L   ` ` X  @#\#`@}#d`Z`` L Հ`HӀ`T@/  $ @  "@`  5  ?" . >cg  2H /* '>a` 2`H 0 """2 ’ "'" ' ' " ""  $ @  "@  i'  ?&_>!1>뀧 Z "Md  H` ` `'"@''|@؀ m  &@&  >cgC  6H /* ' 4H 0 &&&6 L H /* '!쀢   ܒ !쀢&>!x>В" `2`  *  ?$ &!H 0 " &(&$&  6 2(  l d& % >"8`&r m  &@&  >fϔ  6H /* ' 4H 0 &&&6 ؒ H /* '!쀢   h !쀢&>!x>В" 2`  *  ?$ &!H 0 " &(&$&  6 2(  l d& % & m  &@&  >cf_  6H /* ' 4H 0 &&&6 h H /* '!쀢    !쀢&>!x>В" `2`  *  ?$ &!H 0 " &(&$&  6 2(  l d& % & m  &@&  >e  6H /* ' 4H 0 &&&6  H /* '!쀢    !쀢&>!x>В" 2`  *  ?$ &!H 0 " &(&$&  6 2(  l d& % &`~ m  &@&  >ce{  6H /* ' 4H 0 &&&6  H /* '!쀢    !쀢&>!x>В" `2`  *  ?$ &!H 0 " &(&$&  6 2(  l d& % $ǔ$@`  .  m  &@&  >d  6H /* ' 4H 0 &&&6  H /* '!쀢    !쀢&>!x>В" 2`  *  ?$ &!H 0 " &(&$&  6 2(  l d& % `s& m  &@&  >cd  6H /* ' 4H 0 &&&6  H /* '!쀢    !쀢&>!x>В" `2`  *  ?$ &!H 0 " &(&$&  6 2(  l d& % d"d?`'d  r  &@&  >cd  6H /* '>a` 2`H 0 &&&6  H /* '!>!쀢    !쀢&>!x" > 2`  * >a` ?"` $!H 0 " &(&$&  6 2(  l d& % > & q  &@&  >cc  6H /* '>a` 2`H 0 &&&6  H /* '!>!쀢     !쀢&>!x" > 2`  * >a` ?"` $!H 0 " &(&$&  6 2(  l d& % Ԁ >"8> &  &&  &@& d% Tld" T'Ħ  ' ,' 0 @' L0 8'D 5'@``  "   '@D@ @%a<f <  H& T#\,#`(#d  H@`0`=  D L _H" D  @@"@   '@D@ @%,<1 < Z  L D  @@"@  D@@% D '@D  @@"@  '@D@ @$< <?  ? L! >`' < % %%4#\  L`@*#`'| L  & T#\,#`(#d #\,#`(#d 0>'H''''`* @@ L  \  8#\0#`A#d@ D @> Lc8'c8'* @@ Ta '@9 /` Ta 'l' '?'$'(',>|c 'c '' ' '* @'@>0'А'l''0'''`* @@Ь>'H''''`* @@>c8'c8'* @@l`" "5 l"lb Tb T L& T  X 0,#\#`(#d@ ` L  HH,@(( {yl& T h 0,#\#`(@#d`H,@(m(,  $ @  "@`  5(  ?" .( >ca'  2H /* '>a` 2`H 0 """2 . ,"'," '((, '( " "l">`">b8 Tb"b T l'd '  `d `'d  ` h|? ' h't & T L   00,#\#`(@3#d` L 3H1H,@'(,  $ @  "@`  5(  ?" .( >c`s  2H /* '>a` 2`H 0 """2 z ,"'," '((, '( " ",("  $ @  "@   ?&E>!/>뀧`@`3d  / ̖   " ' "d@:W  < @  `(€ >'''''`* @@ cd_t`  '`t't@4't|@'@'| '>"8'pd''x@ n't, ( $@&  >_  6H /* '  5 H 0 &&&6  H /* '쀢   H 쀢&>!x>В" `2`  *  ?% %H 0 " &(&$&  6 2(  l d& %@ >"8$  m, ( $@&  >_=  6H /* '  5 H 0 &&&6 F H /* '쀢   ֒ 쀢&>!x>В" `2`  *  ?% %H 0 " &(&$&  6 2(  l d& %@ $  m, ( $@&  >^͔  6H /* '  5 H 0 &&&6 ֒ H /* '쀢   f 쀢&>!x>В" `2`  *  ?% %H 0 " &(&$&  6 2(  l d& %@ $  m, ( $@&  >^\  6H /* '  5 H 0 &&&6 e H /* '쀢    쀢&>!x>В" `2`  *  ?% %H 0 " &(&$&  6 2(  l d& %@ $  ~ m, ( $@&  >]  6H /* '  5 H 0 &&&6  H /* '쀢    쀢&>!x>В" `2`  *  ?% %H 0 " &(&$&  6 2(  l d& %@ $@ 5$   ,   p m, ( $@&  >]_  6H /* '  5 H 0 &&&6 h H /* '쀢    쀢&>!x>В" `2`  *  ?% %H 0 " &(&$&  6 2(  l d& %@ $@ $d 'd n r, ( $@&  >c\Ԕ  6H /* '>a` 2`H 0 &&&6 ے H /* '!>!쀢   j !쀢&>!x" > 2`  * >a` ?"` $!H 0 " &(&$&  6 2(  l d& %@ > $  q, ( $@&  >c\]  6H /* '>a` 2`H 0 &&&6 d H /* '!>!쀢    !쀢&>!x" > 2`  * >a` ?"` $!H 0 " &(&$&  6 2(  l d& %@  >"8> $,   l$& ( $@& l\ T\ T@ , 0@ L8' 5'``  "` ' @7얒f @  H$T#\#`#d  H@ 6   L > H"=   @"@` ' @얒1  0 L   @"@  @b  '  @"@ ` ' @Ә얒 Đ0 ̖@`''Ԛ#\L`@#|#`"1!>L  $T#\#`#d #\#`#d @   L  H#\8@! #''''#'`* @@>'' '''`* @@'8'''#'`* @@Ỳ  $TL  #\#`#d #\#`#d @ V 3 L _ H]#\8@!+܀ 2S   $ @  "@`  5  ?" .ܐ >cZ  2H /* '>a` 2`H 0 """2  "'" '` ` "` >#'#@# #` 㽠 ,  0  @  LX 8'T 5'P``  "  ` 'PTP @LO L@  H& T#\<#`8#d  H@ @   T L o H"[ T  P@"@  ` 'PTP @L L   L 0T  P@"@  TP@  ]+'P0#\ 4 L`@"#`.4 L  & T#\<#`8#d #\<#`8#d @ Q@ .  L  H<@ ט8  X >'' '$4'('`* @@ 4  & T L  #\<#`8#d ` X 4`#\<#`8#d @ @ ܐ  L  H<@ 8 2   4<  $ @  "@ 4  5<  ?".< >cY6 "  2H /* '>a` 2`H 0 """2= <"'<" '8<8`  4 "` 8 48 5'8` `': ' :`@/?&@&`` ; `? @/~; ?&`&` ` ; `? @/q; ?&`&`&``&`&` `&`$&`(`&`, &`0&@`&`` &``&` `&`㾨 ,  0  @  LX 8'T 5'P``  "  ` 'PTP @LO L@  H& T#\<#`8#d  H@ @`   T L o H" T  P@"@  ` 'PTP @L L   L 0T  P@"@  TP@G  ɰ'P0#\ 4 L`@ {#`.> L  & T#\<#`8#d #\<#`8#d @ @`   L  H<@;8 '' '$4'('`* @@y4& T#\<#`8#d  @ @`_<@8<  $ @  "@`/  5<  ?" /.< >cWʔ  2H /* '>a` 2`H 0 """2 ђ <"'<" '8<`  8 0"` `0R '8 """"" """?"" "$ "( ",㾀 ,  0  @  LX 8'T 5'P``  "  ` 'PTP @LO L@  H$ T#\<#`8#d  H@@`   T L n H"D T  P@"@  ` 'PTP @L L ۔  L 0T  P@"@  TP@   0'P0#\ 4 L`@A#`".%> L  $ T#\<#`8#d #\<#`8#d @{@` X  L  H<@8ذ ' ' ,4'$'`* @@ '' 4'$'`* @@ ' ' 4'$'`* @@>' '  4'$'`* @@>'''4''`* @@4  $ T L  #\<#`8#d #\<#`8#d p@@` ڐ  L  H<@8 2Y <  $ @  "@`  58  ?" .8 >cV:  2H /* '>a` 2`H 0 """2 A <"'<" '88<` '8, " "@ "`"`"` > >"8"`"`x!& T ,#\#`#d  @~`[ x T L  ,& T#\#`#d  @c`@ `2 8   "  8    25   >@Y >* >c''''c' * @@> cX''''cX' * @@  ` nfsconnfscon sotype㿘 T X `% P   PR P R % \  2H @B >cU]  4 H /* '>a`" 2`"H 0 $$  $ 4  d  $ #  , ,$4  0* 2 "84  " ` \ < 90H /* !  >">0j * $ 2 `" `<@ < $ "$ 4$H 0 A>!0*` 4R4v4R4v T     @ ! a    !@ *  at* " >"t ! 1 >cT  4 H /* '>a`$ 2`$H 0 $$  $ 4   ?c  #@ C"  R  22  >cTw  4 H /* '>a`$ 2`$H 0 $$  $ 4  ~    # "   !* a*` %>P"t@4P@>4t% % % % % !0@, % * % |% x% t% p% l% |%   ?4H 0@/㿘%> #>"@'  ?<  ai  > ` `2@`$ @"`$@`2` 㿘 P & PJ 7nfs send error %d for server %s nfsd send error %d 㿘$`"= C  P  `@&$3 9 &$`\ R    "R   @?  `  >$`Ps$  @ &$>$`xs ? # 2 short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s `> &"@  T"  P@1  $`" @ %  P``@%> \ 沔 B ``&` ``X" $  ?" @ 0 @ @ o}x'В 'Ԑ''''  ?'' @'Ȑ ؖ  %Ȱ #   # $  #"'Ȁ 耢  >$aȔ "     rИ € s  *@ ! '̐ >$a>$  # ' @'Ȑ ؖ Ȱ #"'Ȁ "'Ȁ?"'Ȁ K耢G >$̒a   " r = !''''Ȑ ؖÚĀ` #   # $ I #"'Ȁ   Ā 2'Ȁ  >$r̐"8  " " '̀ D B?A   &  >$b@rI @7" ' `2`*   А"@''''Ȑؖ ^Ȱ # $ 쀦 #"'" '̀ "&@ nfsreply nil㿀> \+>>#p@ǐ @  @  ? #\ P2 $ "Y  ' @"@ ' ' @Q䀢 >c$ ! 4 "$!( %!(!(`%!(> `>"` 2@` 2@$` $`># T$`cl* @*`"@`4*`"@`4*  @d  *  h` x:`@` :` h` x:`@`"" "`4* *  h"`4* *  x"`<"`@" >`h"$`h`"(`$ "`8"@"cl`  ?"@%cl4`$< @ @)1 $$`$ ?$`$?$`$ ""$`4`* `8* h:`"@ "h `4* `* x:`"@ "x$`2e` ` @!$`%!$| $2 $   >%pj#p$  is alive againnqnfstry(''     @ P $`$`$`<  $`4  ''$(  'Ԧ @+ ` Ԑܖ@"E #\#`ܘ@!QÒ 00W @ *`*  'Ԑ#\#`#d#h#l@#p܀` Q TT 0  2   ?" 4  ?"    ?$ `$  #  "      $    ? "$`$`   eh$`($`,$`8>"(`@  $`$$`$$` >`\a "aH /* !$@>`$``""`P> h`>T  (@1H 0 \ @w  沔 P`*\`@  `$ @ !$`$  $`$H 0 ?$`8  ĐH /* !@ `"`>" `@"@H 0 `$  ?$`$?$ 2 ``$ >'`<@``` ` '('``  "    'ĐȒĔ @2 >bd  > @2 -$>!P@2 `2 PА"@` '  $`#\@!Fİ0`` Đ "  ?   @>Ėo '  Ē@"@    'ĐȒĔ @Z    Ē@"@    'ĐȒĔ @B  @"' #$ F}>h h@>+>)>' `<  d h&`<>"-@@,G F2" '@\ @ `] @I0Y!F  Ē@"@    'ĐȒĔ @? .   @"@ |   'ĐȒĔ @%Ͱ  > h  ''#\'@\ @` @`O    +`O build > MLEN㿈>#\` dNh  4H /* '>a` 2`H 0 $$$ 4    8H /* '#>a쀢    a쀢$ >!x" > 2`  * >a` ?"`  $aH 0  " $ ($ $ $  4  >` $  $ I`X &>#$ & >>"d&  >!P&.&  ?E$ > &  #&`L @} `@) *  L"u&`@2`<    @U 2"Z&l?'p>!|'&  &&       $ @  "@`   3   ?$ 4,  >cM  2H /* '>a` 2`H 0 """2  $ $    $ ` & && &J JKHa a LY [ & &      $ @  "@`  3   ?$ 4,  >cM*  2H /* '>a` 2`H 0 """2 1 $ $    $ `L ` &Z&  & U& S&Q&N&      $ @  "@`  3  ?$ , >cLӔ  2H /* '>a` 2`H 0 """2 ڒ $ $  `  $ @Ȓ&&`L 2$ S      $ @  "@`  3   ?$ 4,  >cL  2H /* '>a` 2`H 0 """2  $ $    $ `L & &`\ &@ &``F&      $ @  "@`  3  ?$ , >cL.  2H /* '>a` 2`H 0 """2 5 $ $   ` $ &$% %@>`\a "a not responding㿘H /* !> ܮ > \   $ 2 <@ 2T $ 8 7 $ 8(2d> 4b*   d *  h` x:`@` :` h` x:`@``>"*`@@(  8 $ 4 $ $ $  ,@ >, <@` $ $ $ , (@& T!  %!  $ r$ $ ` dl$ , di$ ,P"f?$ 8XT`\" " 4   &V(2   $ 2 @6I  沔] "@       `@  ",?") #"&\ "!4$  $  ? ,$ $  d$ , d$ ,:  $!$  %  $ $!$$ 8 2+ > )> h@ h h"  h>h= 3`+ +`@ b 2`* *` b2*@* @ 0(@(: D``H`"@@8 @`8@@`@`2`HH 0>,>b 6 `"`$" @  ` Ȅ*@(` nfsndlck㿘 `  ``<*  !$  ˔  >-x $_!2>!0 * @@2` @ $nfs sndunlock㿘@@*@>-i"P@&*@&`nfsrcvlk㿘 *  a    <  `>- $_5a>!0 * @2   $nfs rcvunlock㿘@*@>-iz#p@&*@&`u㿘 x `2   "m     ?  6  $ " ?@&  &  &     $ "&? @4;: $2`  ? 4   $   $   $  "  ?$ @8[$@$` %`     Ȁ  $  2$ 0 2 Bad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad P 0  @ ,''``  " '  ( ' (@ ј2C $ X > Ԁ@ 0 ``  "    ' @ 2& $ T$ L>bt   I>!@> 8@א J   ͐ K` K$ T `2 $ L$ D`  ` L2 L`4$ T L 2 L` L L 2 > D ܓ*`@$ D   L>` ? $ L ``  "  ?   @  '  @"@    ' @ .  @" P 4 $  $  g``  " *     '@ }  @`4 " `@ 4 4 T `$ @  3&``  "  ?  '@ NG >!|   y&`  ? ' &`5 H  ?'ؐ ''`'А! 'Ԑ@    @"@    ' @ 2 >a|   ">.hV!H . ..I Cape_VerdeJ St_Helena KFaeroeL Reykjavik M Jan_Mayen NAzoresOMadeiraPCanaryQBermudaRStanleyS8 South_Georgia[Q̕ t| @ LMTCVTCVSTAATBh?MTGMTsmX#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yLMTWETWET DST@`шrQMf&C& %ˬB ͌$μ lМ K҅+ʠe9 Eq %S p w ܹY 4 ޢu߮ W b9m BM !6ؠ   ~ ` Bj _ S_A 3?# d F (E ` RMTIDTISTGMTEGT tK㠜 ɟ_pAn#)O @k"p>rP 2h䐸ՐƐ{ xhzXk?!8M:XȐK<˵òh͕ܿQgrېu3ϬRХUьf2҅YI9@)@@ @@@ܹu@ݲޢߒsrdbURFB72("E@ 6@'@@ @@@@@@z@j@cSC3#qbӮß    | l !\q "Lb #O?*@f1AG BFCd) D%ED FנG# G I I J K L͠M NOn| PQWRlsS7zTLUU\V,7V>XT X Y6 Z[ \ ] ^ _ `_ a}b? c]ڠd e=fàgg襠hiȇjbkil mKna oh-pC qQJ rf% s1, tF u v/#v xx yz {ɠ|Р}~y                                                          HMTACT DSTACTACT DDST . .. catchmod cp dd df edexprhostname ln lskillmkdir mt mv pwd rm shsttysleepsynctest[\ . ..fsck_ffsfsckreboothaltifconfiginitmknodmount mount_cd9660x/ mount_ffs mount_nfsnewfs mount_mfspingrouteshutdownslattachumount disklabeldmesg . ..miscǀzoneinfokeymaps . .. 0 1 2 3 4 5 6 7 8 9΄ 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28! 29" 30# 31$ 32% 33& 34' 35( 36) 37* 38+39, 40- 41. 42/ 430 441 452 463 474 485 496 507 518 529 53: 54; 55< 56= 57> 58? 59@ 60A 61B 62C63D . ..E BajaNorteFBajaSurGGeneral|g;ؑѠ޳ݩ޾߉wip~YIR^;)4GX Q': 3   qޠo_O?/(f fe HG *)  x q(a'Q A 0C ΐ ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]L LMTPSTMSTPDT]pnfV`C` 6`'`ؑp1g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O< LMTMSTCSTPSTMDTbpnfV`C` 6`'`ް`Ɨ4PUPϷVPڙv1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A  LMTMSTCSTCDT (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( @2SC <  @@p\X<@`bT U2S(pA2SD 2SJ,2SJ,2SFA2SD'c2SN2SN2SPA2SE S+2SEe2SE!2S\Am2SU*T2SUp2SU*Q2S!2SRw2SRw2SU,2S!2SR !2SR !2SU,2S!2SR 2SR 2SU,2S!2SR߀2SR߀2SU,2S!2SRf2SRf2SU,2S!2SRW2SRW2SU-L2S!2SR2SR2SU-L2S!2SR2SR2SU-L2S!2SR(2SR(2SU-L2S!2SR"2SR"2SU-L 2S!2SR$s2SR$s2SU, 2S!2SR'c2SR'c2SU, 2S!2SR+2SR+2SU, 2S!2SR.}2SR.}2SU, 2S!2SR052SR052SU,2S!2SR3%2SR3%2SU,2S!2SR7n2SR7n2SU,2S!2SR:i2SR:i2SU,2S!2SSÀ2SSÀ2SU,2S!2SS]J2SS]J2SU,2S!2SSX;2SSX;2SU,2S !2SS S+2SS S+2SU,2S !2SS沀2SS沀2SU,2S!2SS2SS2SU,2S!2SSܓ2SSܓ2SU,2S!2SSp2SSp2SU,2S!2SSk 2SSk 2SU,2S!2SSe2SSe2SU,2S!2SS!2SS!2SU,2S!2SS$s2SS$s2SU,2S!2SS'c2SS'c2SU,2S!2SS+2SS+2SU,2S !2SS.}2SS.}2SU, 2S"!2SS1xˀ2SS1xˀ2SU,!2S$!2SS5 R2SS5 R2SU,"2S&!2SS8C2SS8C2SU,#2S(!2SS;32SS;32SU,$2S*!2ST2ST2SU,%2S,!2ST2ST2SU,&2S.!2STр2STр2SU,'2S0!2ST 2ST 2SU,(2S2!2STI2STI2SU,)2S4!2STz92STz92SU,*2S6!2ST 2ST 2SU-L+2S8!2ST2ST2SU-L,2S:!2ST2ST2SU-L-2S<!2ST(2ST(2SU-L.2S>!2ST"2ST"2SU-L/2S@!2ST% 2ST% 2SU-L02SB!2ST) 2ST) 2SU-L12SD!2ST,2ST,2SU-L22SF!2ST/q2ST/q2SU-L32SH!2ST22ST22SU-L42SJ!2ST52ST52SU-L52SL!2ST8ـ2ST8ـ2SU-L62SN!2SU2SU2SU-L72SP!2SU2SU2SU-L82SR!2SUw2SUw2SU-L92ST!2SU !2SU !2SU-L:2SV!2SU 2SU 2SU-L;2SX!2SU߀2SU߀2SU-L<2SZ!2SUf2SUf2SU-L=2S\!2SU 2SU 2SU-L>2S^!2SUp2SUp2SU-L?2S`Am2Szv2Oh2Sk 2S$2Szv2OZ2S,2S $92Szv2OY2S22S $N2Szv2OY2S0G2SA2Sz|2Jr2SW2S$q2Sz|2OD2S2S$I2Sz|2OG2S h2S$2Sz|2OR2S 2S$2Sz|2OS2S,2S$82Sz|2OT2S>2S$2Sz|2OT2St2S$2Sz|2OT2S(2S$2Sz|2OV2S#F2S$2Sz|2OZ2S&6 @2S$2Sz|2O]2S*Q A2S$82Sz|2O^2S-L B2SA2Sz2Oc2S C2S$%2Sz2OP2S( D2S$92Sz2OP2S, F2S$2Sz2OP2S&6 H2S$2Sz2OQ2S  J2S$s2Sz2OQ2Sv K2S$ 2Sz2OQ2Sܓ L2S$-2Sz2OQ2S M2S$/2Sz2OQ2S" N2S$2Sz2OQ2S&% P2S$2Sz2OR2S*Q Q2S$2Sz2OR2S-D R2S$2Sz2OR2S S2S$2Sz2OR2S5 T2S$&2Sz2OR2S98p U2S$2Sz2OR2S1- V2S$L2Sz2OR2SĴ X2S$L2Sz2OR2SX; W2S$M2Sz2OR2S X Z2S$E2Sz2OS2S߀ \2S$`2Sz2OS2SC ]2S$2Sz2OS2Sр ^2S$>2Sz2OS2S8 _2S$2Sz2OS2S / `2S$)2Sz2OS2S$[܀ a2S$N2Sz2OS2S'c b2S$2Sz2OS2S0G d2S$2Sz2OS2S3% e2S$2Sz2OS2S8ـ f2S$I2Sz2OS2S1- h2S$2Sz2OT2S h j2S$)2Sz2OT2S  g2S$2Sz2OT2S l2S$2Sz2OT2S4΀ m2S$2Sz2OT2SG o2S$22Sz2OT2S/q p2S$2Sz2OT2S!` q2S$2Sz2OV2S$s r2S$2Sz2OV2S)' s2S$2Sz2OV2S, t2S$2Sz2OV2S4s u2S$-2Sz2OV2S;3 v2S$ 2Sz2OV2S w2S$2Sz2OV2Sw x2SA2Sz2Oj2S沀 y2S@#HD! H , #@Ac ` * ` ` * * Ґ#P2/DC! C!8  CA!hfcp@ז(CaP 2D "aPA!hfc@Ɩ(C "aPDD"!"a DD"!"a ''''\ @7 D*`@  " 2'@$  ,  ?   , * ,` ? ,`8$  *,  ?@   .`,`?@,`  ?@ "? ' "@`   ,  :`":*`@ "z`@ * '? 'h @  '|-`?@L  '%@.|"-`@`@"  *.@T*    @h c #c'@"-  "p"/ /'&4@l, "@ @ "`@ 4 %@/+`   c/    /" * @ /" * @7%@4@ ., "  " .@@4 @@.? @- @z  ?&+? @- @ z 2?a`@Z-``  @ 㿘?@? ? x''###D"/`@'/ @'-1##7 #@`%, @@: * , *   % cm? `$4,#@`%, @@ * D", @ * ` ߢ `4  $ `- ʀ@="#Ĩ :`,#@`%, @@ * `D", @ @$4,#@`%, @@ΐ * ܐ *   ' c2 `p $?4,#@`%, @@ * D", @ * ` ݢ `$4,#@`%, @@ * `%D", @ $@4$# @@&& % %@@W@@ @-`? `@"# `ߢ @!"#"#"# 㿘### & 4#)#`,#@`$`, @@1 *  ?# ? 4 '+#,c@`$, @@ *  ?#*@4 3 (?'+#c@`$, @@ *  ,#, 24 @'"# 4 ?"#"#"#   .    ";  ! .    ";! ! .   !";!   .   !"; 'pp#\x! !DD"*t*  .    "; 'hh#\x  DhD"l tt0 lph  t l  incomplete literal tree incomplete distance tree 㺐##` !)# ,#@`$ , @@J *`` `4!)# ,#@`$ , @@0 *`` `4!)# ,#@`$ , @@ *`` 496 $)-#@`% , @@ *`` ,D!, @*`@ "{4    D!,  *    "; '#\    ) 0D"*`@  )3#c@`% , @@ *`@  , *  ' 4$@  . ";t  ) `  ,c@`% , @@ *``  4??T. ";?? K5``8  ,c@`% , @@Y *``  4{?"; ??. # c@`% , @@8 *`` ,  4Y?"; ??.   y"#"#D#'#\!DD"*h 4!hk@b 0D#'.#\ DhD"N !hk@b@}{0   pn  㿘##  `%)#,#@`$, @@ * @ `&? 4`%)#,#@`$, @@ *  @ `4`?"#`"#2``@ 㿐"#"#"#İ !$# "#8 "$##  ",?`",c@"c 㿘 $"## !##A#@c# $cȐ@ $##?  $#܀ @{Ac" 0 D?`D (0  D 8  , A ȁ 0㿘"# $"#)!#% ###@N$ ` #@$## 2〦 ?@.0c "0 "`, #㿘!#  @%cA# "$#㿘#c`!#C!@ A Ԓ#@ cA㜐 ""㜁㿘@?&@@JJ@؄ @*@`J@㿘@/ / 2 㿘@/ . @"` _J@ ."*@@ out of memoryargc<=0㿘@ @^ @D@ @o>N n"`@ՠN @N .N 2@@5 $@ @ 2@n@1"h@&@n@)"x@$` 3n@ib`$ N $` 2@$ %s: %s: %s 㿘A!ho`((@%s: %s: warning: %s%s 㿘C!8  A!ho`x@֖(CaP  "aP %s: %s: unexpected end of file 㿘A!ho`@ $#܀ @Gc (0!ho`@(T㿘A!ho`@@GL#E%2ld.%1ld%%㿘@1  @4 . "* * @#@ ?`&@ - & -*@3A ?`&@  & *@3/@ @ oa@N㿘@nJ"houtput in compress .Z format not supported 㿘E#  E "#!ho@*c C"!P  %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.x''C!D,#@`",# @Ԑ $EC!D ```" C!8  CA!hoc@і(CaP 2C "aPCaD "aD , 'A!hoc(@ C"!PA # !!'?   ,* E# !!A# @'! #,?<,<"  6   *   `? @@ @ `0@"`0`@$,  @!!- ?@$? !!'*  "À`5A@- ?@k$? C!D܄ (? (?'<  * @ * @ :@ @ p,!E# AA!ƀC@ 2 C ?Ȑ&C! pp ,@  A# ,@,  8 AƠ +,@3&@4 @C@ 2  Ȑ&Ȥ @AƠ  ݐ&@ @t܀@6 A-`2 -@`D@`<C!@ 2  cĔAcȐ"cȰ 㿘a*2a!$%'!! %+##a$&! *@ 4,c@`$, @; %! ?"$!  $a$ a$""a$ 2@ 2㿘a "@> 㿘2!"! "!$ Bad table  * 2?ؖ  @ *`@ ؐ  27  * ؐ#@ *@ 2 q#  " * ?:@2?& + 2?.  *@ #@ +2.?:  * * 6 "  ?*@#A#@`2+`??@ @ &+`* 6+`+`?3* @ +222* * + 2+`2?*@㿘E @  #, &, #,   2 0>,'#* 2 ` 2 @`2  `` ,    ? ,  #, &,c 㿘    #,@`a$,@ #ȑ,``o2 0T@Ba'##2 *   A# ,  2`#y  4        ? @#,@?`@#?,@`@a !#,@`a$,@!c ȁ㿘1# v  &#-!  '   !?c?"c!2`#ȓ*`@! !#A# .   !2`# 㿘!2`#*`@  !#A# .   2`# ?! *@㿘#"#㿘"!("!,㿘 a(? "a(#@.@   9"a(? "a(s!  +"a,#.@ $0?$a(!&??* $#a(? $a(#c@.@c   "ca(? $a(0ρ㿘"#" !, ##C!a@  !, !!,  invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘"!0 -!0%)#0* ,#@`$, @ @  %@!4,#@`",# @| $!4 t  !4@ "'/#+,@,``$, @\ %,``a4@,!tg! !4b*  "  @ ' "8"!8+-,`" #`,@`%`, @' ? ,`!4@,`!4b*  " 4` 8: *`  `p4 4  p( @*`#p (*2`p@*`*invalid compressed data--length error㿘"#" #"#x"#t #p*@!4"*`@?5)#t'-cxp@cx#!#t* ,@`$, @ %cx`$cx#p@#tcxp" #t2@ @# @`",3@p`,  cxcx##t* ,@`$, @a %cx $cxcx"@#t2 #.`@@*۲`@!4@㜐 ""8.`@!8@ @+  @cxtcx"$cxnA!0cȀu;   J   (8  J  (E,( " *c* E,㌄ "c( " *(E, ㌅( " *POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿐'E"#(E, $ ","c""#N - + "cv"# @} "# "c# "J # 0!E#c  E#,@EE#c, "#E ",,  * @J@ -,J` ,Ec,"#!E#, (* @v@ta "E#, $#,#c @  #@E#,""#E"#,E,  E#c2",?#,* @J@ -J` # E?E, ",* @"( R #E#,*  @ J  -`? @  " E#,* @J@ -!J` -`"##     `="L    +c @$ 2c$G 2    E#0  E#,*!hva@@X@ !%## $# wE#,`"#,L 3  EW"c(E#0 E#,* ?J  - E!hva(@@,!#,* ?!hvaX@J@!## $#   *!E,􀢀  EE",*@"c(#0  E#,*!hva@@!## $#N :@? :!## $#' `  "@ `#,* @J  - #J@ /!E#0 E#,* @J  - E!hva@@#,* @!hva@J@#v!"cEc, "c,j !#`$# @nJ@#J Ec, "c, :2JE#0  . !hva@@{:E. : "c4B :2>. J : #J@  E0"#(#J@ E"#(Ec, %"c,E#, EE#0  . !hvb@@J:E. :`"#4N :@? :E, ",* @"("#. > 㿘   㿘 㿘@usage: chroot newroot [command] .%sSHELL/bin/sh-i㿘@c !hx@c@ @%G` 2 x@%!#  y`@ `` " y@F` y`@`@ y y@  y`@㿘@HLPRinvalid flags: %sinvalid flag: %s%s: %s%sfts_read㿈@    )yy!А@_!(?+? $* LLLLLLLLL LLL,LLL8LD ޢ  ۠  ؠ ֦ @Ӑ#0*`& @@   2 `"@? @' @?А !! $$#ܐ @Z  $ "$# $#܀  ya0@aJ "' ya0@L @耢  yaH@>8' `@   @= y#3y@L $ 4? ,*  @dd縀@  @U a`@.   @U a`@.Π   <D "D <D "D < `D@$ y!h@-  #܀  y@ap@fusage: chflags [-R [-H | -L | -P]] flags file ... 㿘!hz@a @O uappnd,uchgnodumpopaquesappndarchschg㿘* ؀   z@U'az!  `@U  z@Uaz!  `@U  z@U az!  `@U  z@Taz! `@T  z@Taz!@ `@T  z@Tߒaz! `@TՐ  z@TВaz!`〦` ؁ ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐` &@2&')@'%z@&icp"$ &L "z n2 L  o2    ?* : `{ *`@h0hza@}Ҕ  z``cx@}Ɣ 2 `"z&`"z@&@`?zc@}  2ǰ `"z &`"z@ &@za@}  2 `"z }&`"{z@ v&@za@}|  2``zc@}p  2`"^zY&`"Wz@R&@za@}Y  ``zc@}M  zc@}F 2a `"4z/&`"-z@(&@za@}.  2``zc@}"  2`"z  &`" z@ &@za@}   ``zc@|  zc@| 2 `"z &`"z@ &@ 㿘@ B@8 0(     werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscardxrprntflushbrk㿘@nf@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %s㿀')| Д  %|@̗2  Д  @̎2f `&` 2 N|"@+*@ N u2 N|@nbЀ "  N <2  |@mb؀  @= ? &@W7   |" @+@ j |# @*@ aJ |#8@*@ W @* (N ^ @N  ? - `  *(@* ( &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 }@ah}@agfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘}!  @[ |  Ѐ #}  b@[   2 @D@?}"@[:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@` : 'H H  'H%}'|}H@#bL @_ =2,@,@`}b@RL c i}@mbȀ 2Lp&  i2 L}@m bЀ 2Lc& i2L}@mb؀ 2 L@RR& $ l2 L}@lb耢 2LE& o2 L}@lb 2L8&  o }@lՒb  @Rc'& (@LJ@2` @l 2` `? @RJ`* @ 2@@ HH j}ttyspeedsizesanerowsrawospeedoldnlnewispeedextproceverythingdeccookedcolumnscolscbreakall㿘@lt@illegal option -- %soption requires an argument -- %s㿈L@ -2&` &``'Fad  ~@ʿ"T2 # 2  ` ~"p@)[@  "  &  &`~"@)J@ @ 㿘  D @_ 㿘  " @0"@&   &  $$ >& $ & 㿘@Q 6 F &  * + * - * 0 $߄C" $ "  " 㿘  D @( 㿐   '`` '``@& & 㿘 @QZ @đ &   "  "  "  " 㿘 @Q> @q & 㿘  @0 @k  ?` #&  & 㿘@Q  6 D &  `"  ""  $ g" $ "  " %d %d 㿘"H D@Y F%d 㿘@F @Y"pTIOCSETD㿐'  `@  @rbH@80(   #3#3233#@@@@xh`X-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5  @x@ph`XPH@80(   -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk xph`X@H@@@0@(    Ѐ@@  C$CC$xChXH8-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho-oxtabsoxtabs-tabstabs-onlcronlcr-litoutlitout-opostopost㿘""  @h 2   ` *@&`   L&`  !L!L  @h 2   `*@&`  3&` ##耢  @h 2   `$*@&`$  &`$  ( ( "  @hu 2   `*@&`  &`&`    tablet disc; slip disc; ppp disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-oxtabscflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ ```"" @V" @@U" @@U"@@U"@@|@w "@U#@U@# @@U`@`" @UՐ#8 @P#@! 4  `#H@Y@  4  `#P@N@$ 4 `#X@C@  4  `#`@8@  4  `#h@-@  4  `#p@"@  #x@@  4  `#@ @ @ 4  `#@@  4  `#@@" 4 `#@@ 4 #@@4  `#@֐@4   `#@ʐ@4  `#@@4  `#@@(" 4 `#@@@#  4  ` @@! 4  ` @@ @ 4  ` @@  4  ` @w@" 4 ` @l@$ 4 ` (@a@( 4 ` 0@V@4  4 ` 8@I@   H@?@  4  ` P@4@  4  ` X@)@  4  ` `@@ "  4  ` h@@ @ p   x@@  4  ` @@ 2  4  ` @@ @א (2 #4 ` @@ #!"" " 4  #"  4     @4 ` @@4  ` @@4  4  ` @@4   ` @@$ 4 ` @@4 @ ` @@4  ` @w@! @]!|  Ѐ %@`@  d@sҖ@]` @ 2@@B 0>@? |  Ѐ . !(! ,```@"` @S@`@_ @S`` 2 `  @S@S` @ ݀`!! @S! @S(㿘!!` @S{#8$!`"!d%s: %s %s %s㿘!!`  #ad@Sd$!`@!` H @SY##@SU  !#@SN!` $!`%d㿘2 1, `?  1!X @s:h!!X《 X M*X` -*@`  ^*@` ? *@4*@ ^*@`@*@`*@1!X-aefgaef:g%sTIOCGETDtcgetattrTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@'H'"#,#0a %"t# $0* H@Ԓa@0* H@d@MH@6H?F? (C* lllllllllllllllllllllllllllllllllllll (T  c@z  ' aP@Sc #00#0*`H 'H`@v  @;aX@S  @2ah`h@b쀢 `@!4!x`` `8'H 2'8'q''H IH  8H 2H ,HJ"ؒ@ `  H@IW @@'a@z    HHk`'!@ @@5H 'H     @  @a   `g@쀢 @ !@) usage: stty: [-a|-e|-g] [-f file] [options] 㿘!h@rb@ 㿘@|%.6gsourcehelpusageversionassignfilefield-separatorcopyrightcopyleftnostalgiaposixlintcompat+F:f:v:W:m:@(#)%s: %s: can't allocate memory (%s)mainsrcfiles-m[fr] option irrelevant-m option usage: -m[fn]=nnnempty argument to --source ignored%s: option requires an argument -- %c POSIXLY_CORRECTenvironment variable `POSIXLY_CORRECT' set: turning on --posixno program㿘@O #  !@" @ " @"!@@$"$&@!I!c0@y:   ! $!4@ #8 @9 "bD""  >"  |@=2 @%!F@.   $#x $@G#ܖ#@ch@#pF#x @1. ]""]"" /F !]%F+F'])]F@͘ ㄀ ]""`f*"`s`F! `V`Ch㄀`"%"} [`WU0vb`s`u`m7FnU`v-0h@"~%"J"ؒ@ `  ؔJ  2| $|cx*  " J  | ⬐`$⬓*`@ Z"cx;* @}"T%"# @"#"J r f"J  =A@"q#>%"@":%"@6%"@2%"@^ .%""J |@"W#$%" $|cx* "@@""` ""`"$@T "$ !hc@$%"JF# !F@# 2F@o    $#F# @" F# F "c@{R! F "cF#|?]?" F@ Fc| "c|Fcx*  "]⬓* @ " "]"$@@?@K9 F#d @) @-F# F#h F"  FF#l 2F@! `F#hF "c@ F"#F#p F" F#l F@$F#lF "c@ F@("# Fct 2F "ctF@#t -f progfile [--] [--] 'program' [POSIX or GNU style options]Usage: %s%s%s file ... %s%s%s file ... POSIX options: GNU long options: -f progfile --file=progfile -F fs --field-separator=fs -v var=val --assign=var=val -m[fr]=val -W compat --compat -W copyleft --copyleft -W copyright --copyright -W help --help -W lint --lint -W posix --posix -W source=program-text --source=program-text -W usage --usage -W version --version 㿐#Xh#\#`!!hc$#@@ #@ !h#@!h @!h @!h @@!h P@!h h@!h @!h @!h @!h @!h @ݒ!h! @ْ!h!8@Ւ!h@ 㿘G !@˒!hG!@ǒ!hG"@Ò!h@)!h-Ft does not set FS to tab in POSIX awk㿘"<` < @V "<@7N tN  F# @ ~"F# F#  .@ @7; @0$ARGVARGC㿐"D <@F" @G##!$"  @7 c@4)"@@7 $@ `2  %'?@6 c@4. @ː@6 $@ `2  '?@6Δ a <@E @F#"b,ERRNOARGINDSUBSEPRSTARTRLENGTHOFMTORSOFSFILENAMEIGNORECASE RS FSFNRNRFIELDWIDTHSNFCONVFMT㿘G#p ``@6 a `` @p@6 `@E @F@"@` ` ` 2` ENVIRON㿘"D <@Ez @F{"h"b $# 1 -H+H!ԑ,@@R =",@`b@0@6ː@3i@'@6X $ `@2  =, $ԓ, ԁillegal name `%s' in variable assignment㿐'@Q֒ =K. L"ؐ@   `_"L  L   "J@  `_2 J 2J#@_@Ԑ@6 ` 4`@G> ` < @  @6$ ? =.%s: '%s' argument to -v not in 'var=value' form 㿘  !ha$@ floating point exceptionfatal error: internal errorinternal error line %d, file: %s/usr/src1/gnu/usr.bin/gawk/main.c㿘 ?@!x0 8@!@Z!"@source=empty argument to -Wsource ignored'%c' -- unknown option, ignored 㿘  ##F %F* :  m* 6666666666666666666666666666666666666666666666666666666666466665666565l65666X66$4666666666666466665666565l65666X66$4b@C>  @  b@C2 _ u b@C'  T j c@C  ] _$cb@C R@e UNc@C  F $cG$c@B  : F;"#b@B  .  b@B  $  % b`@B֔   N F@"h c| "c|Fcx* "@@ "`!hb@~RN N awk: bailing out near line 1 㿘!h@~<c@~%s, patchlevel %d 㿘I!hcH@~* @~ʐ 㿘@ / 2 internal error line %d, file: %s/usr/src1/gnu/usr.bin/gawk/eval.cuse of `break' outside of loop is not portableuse of `break' outside of loop is not alloweduse of `continue' outside of loop is not portableuse of `continue' outside of loop is not allowedstatement has no effectH'D'̐ 'H"#H"#D _HDR "cHD "cD ?ހ`1!l*`@:8:4;LEEE;;>p?BtBCCCD= E CEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEC'D'̀   H'DHDR "cHD "c@矐!h    0 D D@  D} 0# @ ް  '̀ İ 0D'̀ а b '̀  0D@ D P D J  !!'`'`'` '`'`'`'`'` '`$'Ha "aD'@| l@+!     0a"a""" """"" X"$# @30!!'`'`'` '`'`'`'`'` '`$'Ha "aD'@ސ! ,    0a"a""" """""  "$# @@ !!'`'`'` '`'`'`'`'` '`$'Ha "aD  D'  @  @~!   % !f  a 0a"a""" """"" "$# @0'!!'`'`'` '`'`'`'`'` '`$'Ha "aD    <D  D  @'D   '  'R b* @'D'@/ڒ0@@2@1n"@ "@! +  00a"a""" """"" #"$#!@@/ ""`"`"` "`"`"`"`"` "`$Ha? "aH! F#  1H" 2F@  &"F# 2@ 8!h@厒 !@勒 H! F#  1H"Ā 2F@ h &"F# @ !h@l !@i D@ 0D@ 0D   DD@.` D@-c !h@L @@ 0F "cpD 8D"bp '@ 0"p `> `<2 @"p0"p"D'F#t""p` @B@/"p@&  @1!h@ D"bp '@ 0"p `> `<2 @"p0"p"D'@0N"b  @1X!@ג F#  D  <2@ِ D`""p` '@u 0"p `> `<2 @i"p0"p"D'   @1! attempt to use array `%s' in a scalar contextfunction `%s' called with space between name and (, %sor used in other expression context%s: %s: can't allocate memory (%s)tree_evaltreeliststrliststrdivision by zero attempteddivision by zero attempted in modillegal type (%d) in tree_eval㿀  '?T b* @ 2 "D?`K `*`@JMPPPPPJJLPPPPPPIIPPPPPPLLJ PPPPPPPPPPPPPPPPPPPJHPPPPPPMJPJ4PJXLJxKLPPJJJJJJJJJJJ @* "'@% @ '? @ 2 @  "' '@     0 @@#_@,_ '? @  <̐@u Ƞ"@ `""p` '  "p `> `<2 "p:"p"D""p  ?@-"p?  @/@ " "bp '  "p `> `<2"p"p"D  "bp ' z"p `> `<2t"pmm"pj"D@Zc"@@G' `""p` '  "p `> `<2 "p"p"D` <2 @Ò" @.Q$@/b  @/\ "     2  ` @ב,`  $@ `< 6bp&bp"D&bp`  ` "(@bp@-{bp$bp$ ̠ $@l2 $@<#ܖ#8c`@* ,@ @ ` @` " @.   2@.    6 @@0l@Gi`""p` '  "p `> `<2 "p"p"D `""p` '  "p > <2 "p"p"D  Y  W@  "`@.V` " @.P ?瀢`="*`@RR<R\R|RR   0򀤠   0ꀤ   0․   0ڀ   0Ҁ   0#"w@""p  @+"p?  @-""p` @?@+"p?` " @- ?`<#*`@U@UXUUUV V V TV V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V VD'F & H"????? F??9@?2? F+?H" B#?@#?H" B@ #@s ??D??@, c "@ #@  㿘 2 V  @     H &   2& ?  ""p  ' "p `> `<2 "p?"p"D   ""p   @@*  @ H؁ B#    @   @,ސ㿘@"f `  ""p` 2`@*`  ""p` 2`@*` @` @"@@ B#@@ @H8 6?""p` " `"(@@+,"p""p` " `" ` "(@"` @+"p` `  &`@b` "&division by zero attempted in /=division by zero attempted in %=㿈'@  <@@""p` @@*:"p?` 6  30@,:` 2HH""?B?@,*` 2HH""?B?@+Z a& "@+O c``""p` '  "p `> `<2 "p/"p"D""p  ?@)"p?  "@@+ݐ@  <@@,@+`?`i#*`@\\]]H]\\苠D'聨F   0J2?F$%?&?'? B7?@1??艡 F+?H"聩 B#?@=!X?H"聩 B@.!@ ??D?荡?@* a&##@ "function `%s' not definedfunc_calllocal_stackfunction `%s' called with more arguments than declared '''@:` '  B!@`R `@,`'   $@8Q#ܖ#8a@Ô`S-I)値T耢 %@* <&   ' =T b* @  = > >  >  >  $> %"p  '"p  `> `<2"p  "p"D@)&& ` "$@*$"@G`@!I <%!耢 $!@*~& D&& $@H '!!'`'`'` '`'`'`'`'` '`$'"b'"baa' ' ' ' ' ' ' ' ' $'H`"'bD@"  """""`"`"` "`"`"`"`"` "`$Ha?"a"bR `/+)I+  'T b* @ ?Ā ``=2 ``$ $ @$`$ `4 ` =!@*@!&@%!` !I` =@%@)@!&@$!萔@ @ H"a""`"`"` "`"`"`"`"` "`$   6 attempt to access field %d`%s' is a function, assignment is not allowed㿐  ' V b* @ ?`KQ *`@iiiiiiiihdiiiiiiiiiiiiiiiiiiiiiiihLiiiiiiiiiiiiiiiiiiiifeiiiiiiiiiigffhfHf(fg|h,h gg"@ 倦`"L"&@逦`""&@倦`"<#P&@!"@))"?@(b a""@`ؠ #&@!"@)"l?@(N a""@`Ġ #&@"d?2!#@ s!"@("d?@(1 a""@` #x&@!"@("0?@( a""@` #&@倦`"4#&@逦`"#&@逦`{"!w&@倦`s"\ lo&@V b* i@`""p` '  "p `> `<2 "p"p"D""p  B'@&w"p@'  @(|  @) "Ȁ  倦`&"h#"&@@ے  'T b* @@" @$  @@@#$@㿐 ` @ `E @ 7"p`""p` 'f $"p `> `<2 Y"p$"p"D$"p`  ` "p"(@@&"p"p @*   @*E 8`?@  "'@''?@'+ cIGNORECASE not supported in compatibility mode㿘F# HF#  c 2 "c@[#x"0""bp H B@%"pH B#  @"$㿘""\"bp "  "(@@&*"p "p $"\ "|"* 㿘"""bp "  "(@@&"p "p $" "P"*  fmt_indexfmt_listbad FMT specification㿘!H#  H#@ӑ*   $# $@4u#ܖ#8a@""p` " `"(@@%"pH#6`%H!H. @> 3# `` *@ 2H@!HH# *`"@!H  $# $@4/#ܖ#8a@@%ؐHHc. "  "㿘"4"b8Hc* @ "㿘""b(FHc* @ "`%s to "%s" failed (%s)standard outputreason unknown㿘\ $"#ܐ@` +!`F# ` @ @ @`` 0 $#܀ "@3 @ @.exp argument %g is out of range㿐 ""p  ' "p `> `<2 "p"p"D""p  @$;"p?  "! $@&@! $$#ܐ@?#܀ "!8@Ô@%m c㿐`""p` '  "p `> `<2 "pL"p"D "bp '  "p `> `<2 "p-"p"D""p " "(@@$q"p""p  "  "(@@$a"p   "0  8H!@85LLJJ@2 ?`#@3Z ??   "@8LL@2?` ` @d= 2?? " ?  " @%  "'@%'?@$ c㿐?$%H ?@0@ 㿐 ""p  ' "p `> `<2 "p"p"D""p  @#."p?’?  @%/@$k c㿐 ""p  ' "p `> `<2 "pJ"p"D""p  "   "(@@#"p "p   "'@$' H(B?@$# clog called with negative argument %g㿐 ""p  ' "p `> `<2 "p"p"D""p  "@""p?H0? #@ 1@?  @$@#є c%s: %s: can't allocate memory (%s)format_treeobuf%`l' is meaningless in awk formats; ignored'l' is not permitted in POSIX awk formats*.*%s %s %*s%snot enough arguments to satisfy format string^ ran out for this onetoo many arguments supplied for format string'''''/w@Ɛ x $@1h#ܖ a@ ڔ x w̰Ć z'9N %m$&&&%@'-2 $@1>ܖ@ -@@&@%''к '''H#8'H#H'Ą'N``y #Г*`@}0000000000000000000000000000000000d0}0000 0H0~H~t~t~t~t~t~t~t~t~t0000000000000000000000000000|0000000000000t00000000ԀuĀ%@h-2 $@0ܖ@ -@ ! - {SĐԀH#@'nЀ $ĀА Ć'* @*`*: @$Ѐ &6 5ЀH„ `'"p` '"p   `> `<2"p $"p"D'"p` @B@ "p@$` @"ҐЀ" w( qn/wЀ ЀH?'А#8'^'ԀϺ`S'F#  !H#t 2 F@ ,!(#t $#tF# @ B!X'K `'"p` '"p   `> `<2"p "p"D` @@Hx 7@D' HxąB' /ؐ '؀`@ ` 8='` `'"p` '"p   `> `<2"p i"p"D'"p`  ` "(@"p@ "p"p`` @(T`` 'P`̄ `'"p` '"p   `> `<2"p ."p"D'"p` @?x@"p?xHx Ʋ gH)`F'       @t  0,@) 2 - ,w( `,`H#8'Ԁ@4' 'Ԁ H8"L -w( π2 %@-2 $@.ܖ@ *-@ - А?'Ԑ?'H#`'''' '`'"p` '"p   `> `<2"p |"p"D'"p` @?x@%"p?xHx- gHH  gxxHF' xx…B' `H#8'@s,@k2:1, 0,H8,8 %@-2 $@.ܖ@ -@ - -  Ԑ?'Ԁ2' 0,' '("%@Γ-2 $@-ܖ@ W-@- Ԓ'Ѐ@߀Ѐ #%@-2 $@-ܖ@ 0-Ѐ@@Ш%!%@-2 $@-ܖ@ -@- Ԓ'Ѐ@߀` @ E2 '`'"p` '"p   `> `<2"p c"p"D'"p` @?x@ "p?x` `@ `Ԑ 'А  %@-@ $@-6ܖ@@- %/ِ -/٤w( , #,H8" 0,! !, `, `, `,,,@6Cx@s%̖&!a̖!@]aĆ 'F# @,!#&&53'% $&%@-2 @,ܖa@4-@@&@%@є  `2 㿘"p`""p` ' $"p `> `<2 "p$"p"D$"p` " ` "(@@"p"p     @,printf㿈    @ t` 0! #\   "xX  @sqrt called with negative argument %g㿐 ""p  ' "p `> `<2 "p"p"D""p  @"p?  H@ƐH? 9 D#@K?D @@?@ csubstr: length %d at position %d exceeds length of first argument㿐`""p` '  "p `> `<2 "p"p"D "bp '  "p `> `<2 "p"p"D   Q  `@`""p` '  "p `> `<2 "pt"p"D""p  H㠁 D'H@"pH㠁 7H@' 㠅…B' @  @""p B'@"p@' ?@""p  "   "(@@t"p"p &  `   @͐%"D @ `2 "#":  "F# ` x@D  @v  @("p`""p` 'ѐ $"p `> `<2 "p$"p"D$"p` " ` "(@@"p"p  @ Ȑ01"bp '  "p `> `<2 "p"p"D""p  B@3"p@'  @8@% d@`@㿐@ ?@b c㿐@   ""p  ' "p `> `<2 "p?"p"D""p` " ` "(@@"p "p  "`N " `` .@:  ` .` "'@Ԑ'?@  cprint     @ `! k'+`$p` 'p   `> `<2p p"D  @'"8b(2$p   ? "#\@p#\b@2  @s@p@6#\   c  " @_  ""| #\  c 2""P  #\  #㿘 ""p  ' "p `> `<2 "p["p"D""p  "   "(@@"p"p @    : Jbؐ@  #*`@ `* *J  @㿘 ""p  ' "p `> `<2 "p"p"D""p  "   "(@@I"p"p @v   : J"ؐ@  ࠓ*`@ `*   *J  @㿐`""p` '  "p `> `<2 "p"p"D "bp '  "p `> `<2 "p"p"D""p  @6"p?""p  @*"p?  " @/  @)@y?@` c㿐 ""p  ' "p `> `<2 "p?"p"D""p  @"p?@}x?  @@& c㿐 ""p  ' "p `> `<2 "p"p"D""p  @"p?@}?  @@ c㿐1H#   a@s"@$ &#@A'H㰅 ?@є c㿐H#H#  a@V" @ΐ!  !H@א @$#9H ""p  ' "p `> `<2 "p"p"DH#""p  B@="p@&'@ʐ   H@>H"#'?@u c㿐"p`""p` '_ $"p `> `<2 R"p$"p"D$"p`  ` "p"(@@"p"p @   @=   ( $@" '? )/   "!@ݐ!"@'?@ a""@!"@@@ a"@"@@ cdo_subbufX'D''''@B'D 'D 'D"p ""p  'ؐ$@"p `> `<2 "p$@"p"D$@"p` " ` "(@@"p"p  @ ?" `$ @(   @`  0V >2  'Ā <朗'' 5  `"?c 5@+5 ' "p`""p` 'f$"p `> `<2 Y"p$"p"D$"p`  ` "p"(@@"p"p`'` @& @|`2- $@&0#ܖ `(@0-@* '䀢J & \ܚ` '2 J & \2*JԚ`'`$@`(@$@@zq$& @3 $ -`@|Β @@%cܖ``(@X`0@ :  .  䀢"J & \@ @.`@  2 J & \2  . *J쀣` @2 : . %쀣`  ' @ ?Ԥ&%@" @|h` $@%#ܖ `(@0 .  .&@|:%% ` @&Ԁ`Ā``@@#@ "?# @5ԅ?@F c㿘H 㿘B %s: %s:cmd. line:%d: FILENAME=%s FNR=%ld) 㿘@x!!!hc@@a$H#Ѐ H#Ԁ!h@acHH!h@a cPH!hc`@a" *!"T !h?`"@ ( " (*@ " !hch@`ݔ!hcx@`!!h@`Ғ!h@a!h@`ʒc@x!h㿐'D'H'L'P'T'X!Hwarning: 㿐'D'H'L'P'T'X!PHerror: 㿐'D'H'L'P'T'X!qHfatal: 㿐'D'H'L'P'T'X!ؒaH@a& can't stat fd %d (%s)8@y5 "'C$@z7?2  $@$a#ܔ" ֒  @}˖ ?Ȁ"&؀  ؀  ̀ ؀ Ȑ  2؀@ 8 ؀ ؀ ̀ ̀ $%s: %s: can't allocate memory (%s)iop_allociop㿘?& @zh 2&  $@$ #ܖ#hc|& @xŐ   & & ?&  $"#&& & & get_a_recordiop->buferror reading input: %s㿈''` `?  ` ``@ ,@ $##@&`&`-: ` 2R` *O`  ``& ( 2`!&``*`&```` @y   &`!#% $@#cܖ#h`P``` ` * `` @$@yb%&$ $@yY``@&`&`  `&@z<`  *` ?` @ @|$@ &`F#  $쀣` $@#McܒÐ p` ` ?` ` &` * 2,N"H  ` ` N  8`   *N`  `   N" N -: N  `   `?` A&?&``?2 &`` 􀥀2&`#@(??N-: @2 .`` @ -: `  J@ `&` ?N-: @2 .#@&㿘@ #@ rcannot open file `%s' for reading (%s)-㿐  H#䀢 "H@H"# #䀦  H ?|!H@#$#H",B'܀ XH%H#H'"܉?@ c@ J@ "7 *@F#  "@܅:@ `2`N  2#c $c @Òa H  "c!  $@"N#ܔ!(ĒT@@T"@""ܐ $ܒ`$",B'@Hc 2H "c!P @K bT"@ R H"cH#B B l㿐 "`J$   bl "blb "b @ l close of fd %d failed (%s)㿘  $Q "#    & @h   & & & A  R@  Rf@ R@@{+2   $@!#ܔ P   28 #bh@  @   @Ĕ bh@abh@ Z"@xh @xf8`?㿘@ϐ##%Fݐ 0߾b t p to>>>|<invalid tree type %d in redirect()expression in `%s' redirection only has numeric valueexpression for `%s' redirection has null string value01filename `%s' for `%s' redirection may be result of logical expression%s: %s: can't allocate memory (%s)redirectrpstrwacan't open pipe ("%s") for output (%s)fromcan't open pipe ("%s") for input (%s)internal error line %d, file: %s/usr/src1/gnu/usr.bin/gawk/io.ccan't redirect %s `%s' (%s)㿘  "8`?ɀ`#  *`@  ` 7` "@"H   "P "X"`0`@`""p` '  "p `> `<2 "p"p"DF#   """p "  "(@@"p"pL F"F# "(H "LJ"@ @QȒ  #LJ#@H@Q H#H#؀ '@g+  2 "  JL@2  @Q 2   _  `     2: @vk 2  $@ #ܖ#Pcx @vZ 2 $@#ܖ#Pcxn@u  ,& && & & & H#؀ 2" & Hc& "c  2 2) $!7 !!h %#`?ɀ : * ,8| @41#@t㘀  & !@#ܔ#  &#А@ `!@#ܔ##@a  &  !(`+@_?$& V2V`& 2U&  & @=l & @xϐ   @t# "  &  2&  2" #ܐ?逢 #@; '@`?ɀ 8 @>#ܖ H    @ 2 "_ @close of "%s" failed (%s).too many pipes or input files open㿘H#؀` ``2@!% $'` "`@  @$@$@=` "$``@ܔB$```2``X#㿐"p ""p  'ϐ$"p `> `<2 "p$"p"D$"p` " ` "(@@"p"pH#؀ " @e  2 "   JK@2   @O "      @G  @rU!@( '?  @u cpipefileno explicit close of %s "%s" providedfailure status (%d) on %s close of "%s" (%s)㿘    !@ X@ $f "# 2 @k  " @=0  @ C &  "P"X`"`n `! $@#ܲF# " ]F# 2 !"X@@d@ "X"@ `"  "` `"H "` "c@t @terror writing standard output (%s).error writing standard error (%s).%s flush of "%s" failed (%s).㿘 ! $$#@q! " @#ܒ   @q!h   $@#ܒ  H#؀`% +)' $@ "`` "`@qi "`@ bP"X`@ܖؔ ``2@㿘 $"#H#؀   #F c 2 2 @q=! "  $@]#ܒ  @q/!h   $@P#ܒ  㿘N r"  w a "   &  "}(/dev/stdinstdoutstderrfd/file `%s' is a directory0?ՐF# s?!PLJ!P@@8 "#8LJ#8@`? @Nn  Y?@NK?S?#@L J#@@  @7 BR #HN@J#H@@7 2`0R!#PN@J#P@@7ג 2`R!v#XN@J#X@? @N&  ?`@g(@'?????@M!?@ri  <  #`spec_setupcp㿘@rא`2&  $@y#ܖ#Pa & @c^   *` * & & & &  @& ?& & 㿘5?"?:"?@&`& `& ` & `& `& `& ` & @s   %d 㻘N` g i@ @X@@%ic(@c   @* %d %d %d %dcould not find groups: %s%dX@Ʀ@@@c@%>@b @ʒ?   $@#ܒ]#Ȣ @6  ),,`#@%@bÐ`@ ,,@b@  @) /dev/user/dev/pgrpid/dev/ppid/dev/pid/dev/stderr/dev/stdout/dev/stdin/dev/fd/could not open %s, mode `%s'8? IF# d!PL@J!P@@6  SR Ɛ  0i#8L@J#8@I @Lڔ  B@L?< 8H#H#, * "*  "& L@J@2  @L 2   Ǒ, * "*   '!! ґ, @L|!@p  <  #`㿐' @W8  @W4  @W0 -H?@_ @")  ؀  @2 $ $   " @$   $ 2  $#܀ Ӑ @V @V @Vcannot open pipe "%s" (%s)close of stdout in child failed (%s)dup of pipe failed (%s)close of pipe failed (%s)close of stdin in child failed (%s)/bin/shsh-ccannot fork for "%s" (%s)㿐@G   $@#ܔ!@Q??@s ? $@p#ܒ! @  $@e#ܒې!H@s? $@s? $@U#ܒː!`@s ?2  $@I#ܒ!!a@  @a 2 &` $@5#ܔ!&`@s? $@(#ܒ!` &` 㿘9 &  ?"  & ?&  㿈 ')F'  2 '[ 2*'  0 2` `# @ 'X@ @`@  X"@/ 0o` 2'  0h"`J# 쀢 @'X@ @`@  X"@/ 0G`@@  ː$` @ $@  062 bl "blb "b 2'@ ` <2 ⨒@ N@`v@  $ `2 耢 "m  @ w c㿘@.:/usr/local/lib/awk:/usr/lib/awkAWKPATH㻘!PNJ!P@ F@4^ FT # LIal  "al@Bo"IL I"!hI!h@& / 4/   :" * L   J / /* @'a 6L : L  2 L 2/ܒa %s: %s: can't allocate memory (%s)init_fieldsfields_arrnodes㿘!@o8   $"h $@#ܖ `HLX!@o'   $  $@#ܖ `H;hIa耢 "a@ V"D:::: : h ""@h "` "<@ N"` "bȁset_field㿘! "h@on*`  $"h $@#ܖ aX!  @o[*`  $  $@r#ܖ ahI!x $I#I)'%a耢 $a@ "D:::: : h, "  " I"!x㿘I!x .  "`"`  2`"h" rebuild_recordops㿘"\"bp    "(@@ k"p"p"d* bh  !/+$"p`  ` (@"p@ L"p"p` bh8"d?@l[, @n5 2-@ $@#ܖ cXIh-@"h`"d*  11/` 2` ` ,  @m`` d* "h  , @md* "h (@  !"h@ S"h" "bȁ㿘?"bd I!t4I%#Ih, @ <  athI$"!t"h@ /`  !"`@ ' "<@ $ @" @" @ *` 2`"h"@"h` 2` "bȁ㿘"h"bp " "(@@"p"h``  㿘"d""bp B@"p@$I"daxIw I!t "d@4%)'h,`@ h"D"@`d@h""ȁ㿘\@I!t# ]"`J 2"H L   *L4 $@@ ʘ ?,+ ( $@2    $@ $ "@ (ִ  @΀  $@@&@㿘\@I!t# ; 2 @ @@@-&@ ',@    *L  ` "  L    $ @ ,@&@㿘\@I!t# 7"`J 2 2     @#,@ @,@* >L> L 2  $@" ,@ ܀&L,@&@㿘\@I!t#@ 'I|.   $4 @2&@&@㿐 .`"Ȁ "`!"d?"h` " I#\#` "  apc$"dI"aty`#&@i"h""I!t]"d?5I!t "h "` #bh! `"` I#\ "  apcI"!tbh``   @""d#I!tI!t6#倦`I!xII!t @ "h"D*``@"""dI"!t1"D. "h@㿐@L   4 '?@" c@H"second argument of split is not a variable㿈 `""p` '  "p `> `<2 "p"p"D@  " @  ""p " "(@@&"p ' ?T b* @?Ā 5#@ `  "<"bp   "p"(@@"p"pIJ!p"p``""p` '֎ $"p `> `<2 ց"p$"p"D$"p` " ` "(@@"p"p   J 2"#, T@ '#\# cT'?@G c@` @[ ]+[%c ][\\][%c]㿈"h #a /""H!I!p @ P$!p"<"bp "  "(@@`"p"p  TX"`"`J !#,"` `KO J 2  ""H#0#0'`7 `:/J 61c8""` J 2   `2 %""HJ "O O"0 2 #,"`J \2  #@#@' `/cHJ@O耢 @Z0@ I"ap T"`  T@ I  0@ I"ap"!p "`㿘""bp " "(@@"p" 5"b`use of FIELDWIDTHS is a gawk extensionset_FIELDWIDTHSFIELDWIDTHS㿐F#  Ia 2F "a"F# l"h #n  D"`"L"bp "  "(@@t"p "p '!I!| 2II!@ia*   $!| $@#ܖ buI!|" )I'I-+!@ *`%!|@iΓ*`  $|! $@#ܖ bY"Ȑ@]T|,`@"@`I!|,`?" 㿘  D@%s: %s: can't allocate memory (%s)concat_expstr㿘 &7"p""p 'ԟ$"p `> `<2 Ԓ"p$"p"D$"p` " ` "(@@"pѰ"pͰ"p`""p` 'i $"p `> `<2 \"p$"p"D$"p` " ` "(@@"p"p "t   @ @h2  $@-#ܖ!a0ퟔ@  @h @  "@ߐe'"p` , @g``$p` 'p % `> `< p%p"D%p`  ` "(@p@6pp @$@h2@ $@#ܖ!a0=@@  @g   "@|`$@Ӕ   6 㿘  * 'I ,@`" @@[`@Y`$@$袔2@ ," & @hU & & & ?" @6 㿘`O ```J2"`*`@D( . J .  ". J .  ". J .  ". J .  ". J .  ". J .  ". J .  ". J .  "Ȕ @V㿘 . "     2  㿘  '2 V b* @   K`` }Ӓ  `   @  @ subscript of array `%s' is null string㿘""p`  ` "(@"`@"p` 2` =$`$`$@`?" @4`@`` 7@` 2@ F` \@a0XF# " `` 2` ` ` $``!2I @i#@  I@`` @Ia耢 "a@  G& ` @ & ?c 6`@& 6`` " @ ?# @2 ` 2`"D& `, &`"  㿘  '2 V b* @  H   ,@`  ` " @`2`  `@ڐ`&`" @$@,@" @`@`Ia&@"a ? &   @L*&&  ?" @6 @f & 㿘&@&`&`&`   @ null symbol in assoc_next㿘 2 G   "(&  @( !& "  &  & & @&   &  *@`2` `& @  & & grow_tablenew㿘   I!,   &, !<6 @eّ- 2 $@{#ܖ!a @L-    &  ,@ "@``` * $@$2@ ,@f & &㿐I!>  6  n Jbؐ  2I "J  *J Jbؐ  " I!0H` @?# @6  $  $J"ؐ@  3'> +6 "# , @Ym>J"ؒ@ ` ",ؒ `'J`   , $#܀  $:  $"#9876543210%ld%s: %s: can't allocate memory (%s)force_strings->stptrx B#FI!  I! = @Fc`@@U|& J"+'  & I!*@ @a@Ue& ?&  @dƐ   &  $@h#ܖ! aHڔX  @d@ .   6 dupnoder->stptr㿘 `?# @ I4     I   , =a耢 "a@> >  >  >  >  ?# @`6   >   .  @dj   &  $@ #ܖ! b~  @c   *@㿘I耢 @"@ >"`:@2` backslash at end of stringmake_str_node㿐Ia耢 "a@o >&  6 & @d`  &  $@ #ܖ! 2 @c 8* @@'#F!J `\'@6 .@c  \ ` \.@ ` &@@dp`  &  $@ #ܖ! ’` *  6 &  . ?& 㿘  `2 newnodenextfree㿘!I@c/  $! $@ Y#ܖ! ’b`˔hI!/x a/x6  (& *6 &Ia"a㿘  ``?# @  6   `` ?. @c Ia&"aPosix does not allow "\x" escapesno hex digits in \x escape sequence㿘`$J@ xÐ . @@8TTTTTTTT (0h f d b ` ^ \ Z??$U??Ж `$J@ /H 74G*ЖB F#  ` 2F "` 磐#F# / xJ bؐ  D 璐#! x`$J@ؐ  D *ؐ  ?$ @(#)Gnu Awk (gawk) 2.15%s: %s: can't allocate memory (%s)make_regexpdestinternal error line %d, file: %s/usr/src1/gnu/usr.bin/gawk/re.crprp->pat.bufferrp->pat.fastmap%s: /%s/㿐'@b4` $@ #ܖÐ#ÒcHzĤ!J@ \k`'J`?Ѐ H[* @@@@@@@@ttttttttttttttttttttttttttttttttttttttttt@@ttt@ttttttt@ttt@t@t@t@i6.@Đ  Lߔ(.@ \.@`.@` ' ' .@`@*J@.@@a 2 $@ H#ܖÐ#Òc溔H @Gє @a   & $@ 4#ܖÐ#Òc榔P & @a!  &  $@ "#ܖÐ#Òc攔`H!& & &@@/Đ p悔 @*@ & 2 &  ,@@̖  & & @aǐ㿐 '@@ ,  @@.@`  2  @$ ?㿘@a@a  $ " (@a ( " @a @@֐ ,@a㿘'㿘  b0 2W 2 "p `""p` '̔ $"p `> `<2 ̇"p$"p"D$"p` " ` "(@"p"p R    "s #o  &  "   "V V `6 V 46  2A"p `""p` '/ $"p `> `<2 ""p$"p"D$"p`  ` "p"(@d"p"p&  "Đ0`` 0V &   .   .  㿘! @'@0 whiletouppertolowersystimesystemsubstrsubstrftimesrandsqrtsprintfsplitsinreturnrandprintfprintnextmatchloglengthintindexinifgsubgetlinefunctionfuncforexpexitelsedodeletecoscontinueclosebreakatan2ENDBEGINunexpected newline%.*s'D'H'L'P'T'XFcd "cd 8 @  D`;I"8  J ư! @ J`@ "  J "I""8 D <@!IJ@   "bh]!"a!  8"bh]!"a! "bh8` @@"8] >"a > "bh" ,]! "a! ]a  "a]"!"a`8?"`8]! "a~!  !/-+)H#I' 8`<@ `  8`$ 8J@ "N  \ 8`@@$ 8`8 \&  8`<@ `  8`$ 8J@ b@#А %#А`$b@ \*@b@L@   b@ 8`@@$ 8`8b@`$b@*@b@L@ 8 8II"@b< " <@ "bh `2 ]!"a!8`  <@`"8 J@4  8" 8J = - "bh]! "a! ]!""aڰ!"8` @@"8] -"a̰ -8`  <@`"8J@  8" 8J 8` @@"8"ؐ   .] ."a%I)#'@`$@*@@ L@ # 9 E 0A . ;  e 5 23 12. `8`<@ ` `8`$`8J@ - +`8@`$@*@@ L@  ` @@$`8 `8`<@ ` `8`$`8J@  8` @@"8F#  !]! I܂"ؐ $!Ib@"b@*b@ L@II@z"݀ . %"h*  %"h@U. *  %a@@""h 8J (  "`,]!"a!]!"a!㿘Ia耢 "a&  6  D " HJ H#?#6 H#& 㿘ܐ"" %s() cannot have %d argument%cstring literal as last arg of substitute㿘     .``2 .* \"<@  : 2 .  s ѐ  .* \b<   &`"x@2`   a   & k`"P@2 ` ` E"`&@@   Z"@#$@# @2,`` E @ & F  h a z  &w @Ȑ8&@# "4&@    >2-&@١ (&@#܀@2#&@ 2  "< &U @  ` E @  `"@ 2 &@   ` *`&@㿘Ia耢 "a @& && make_for_loopr㿘@TY I $@#ܖǐ @ђcmIa耢 "a& $$ $ & 㿘@Dϐc#Ia耢 "am F""t, """" " "  㿘@D?#bt*  "  2`" JN@2  @/  2 2  ]؀ ]]   2 ]"  ܐ dup_parmsnamesfunction `%s': parameter #%d, `%s', duplicates parameter #%d㿘V ` C @S-`2 $@V#ܖǐ @ҒbȔ   ,`$ ` @ -Ұ 6`,`. @B 2  (`ؕ  . `@ @S4  function name `%s' previously defined㿘@L @ M Ґ#{0 B㿘@Cy#* bt % )I @2`" JL@2 @.E 2 $!$` %!@S0 2 㿘  Ē 㿘Ia耢 "aL '"""`H"`H2  ENVIRON㿘1]! Ӕ!LJ!@ @ & &!ɐ `"D < @SF㿘  EIa耢 "a E& & && .  6 㿘"    Ȑ#4.?.  #4"bԠ"< @S . %$, "b#b@S. $bБ, "b"". Ԑ ?"  ?syntax errorBEGIN blocks must have an action partEND blocks must have an action part%s() is a built-in function, it cannot be redefinedplain `print' in BEGIN or END rule should probably be `print ""'file`next file' is a gawk extension`next file' used in BEGIN or END actionnext used in BEGIN or END actionreturn used outside function context`delete array' is a gawk extensionRegular expression on left of assignment.non-redirected getline undefined inside BEGIN or END actionRegular expression on left of MATCH operator.regexp looks like a C comment, but is notRegular expression on left of comparison.call of `length' without parentheses is not portablecall of `length' without parentheses is deprecated by POSIXyacc stack overflow㿘""""x?"bp"Ԁ  L""b""b 2J ȓ,`R@ I!"p  J_ $"p$"pJ#,`R@ 7"p 3 _0KT!z. R@ )K"b   b"bL . R@2b"b"h:?"bpbx ?"bxK!,`R@ "p  _T!z. R@ L VR@"x  H#b̐ "bbx 4? "bx!J# _T!zL %"R@* R !!  . R !" @ `B "`$". R2`$"hW:""Ԁ@$"?$bp ?F"bpI#. R@ "b* @:?`Ր"x*`@XYY8iiiZYZZ[[@[L[l[[ii[jj\\$\t\i\\\]ii]iijjiigi]^ ^$^l^^^^^_````a giiaajjjjiaiaabiib$b<iiiiiiibXbliiiiiibbiiiijbcc<cdcccd8dddeLede|iejeeefif`fxfffifjgg,gDg\gtgggggghh8hjhhiii i|iiiij`jjjjjjj"?g"b"`]""["""  " !"?` "  " """ " ?2"b!F#h`` "  " $#h!F"  # " #h "  #F"ch""I  "b4I""4!F#l`` "  "m $#l!F"  #e "b #l"  #XF"clӐ#ԎFcd "cd#" #C"  #;"   a 0  &-  .* ?& #"@OIӐ#b<F" H!"=?"`"b "4 Fcd "cd"?  3 "b" 4" m`0 q"`0Ia耢 "a[ E$!"@??"?Ք $"? ɖ $$ , 4 J"""?D"b"? !  $ "? $ """ $" )" 2!"ؒ "?Ӓ f  +"??\? *"?В R? *  ,  -"!"耢 .& "  > a P  &M ""F# I"4  ]a䀢 2 "au (""? -S p?@(IF# \ xF# FF# F#d`"#d] xI"4 2 SF#d`"#dQ   SI"4  0b  0x "?s 1 4 |R w"?d 3!"?' " 4\F# !F# FF# F#d`"#d!"? = 4" % ?4 ("? %?* ("$ ;" 7" 8" 9""?" &" &{ ?" &" &m ?F#  "  E2ҙ!8"!" " A"? :G ƒ 5F# I"4  " 2o!h" 5" " "?  E2S!"??""bF# !I" ""p  #<b"p<"?   礔 ab 7@""":"b" *!"  " " "b"Ia""a?Ғ " "  } "b""x" ,""x,b" #bR,"" #"I"D. ` R@L#b 2#"":!"p  m $"p$"p"p < JL `,R@   _ JT!z. R@2JL J#2,R@"b   b"b2b"b":v" 㿘]! ' P@! a P *@``z$*@ A P *@``Z$*@ 0 P *@``9$*@ P * _] "a] Unmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit㾸'ĺ'ĸ@   '@J"  %' ''& *@* *@&&-& 2 @J &@Jc &   &䀢 /@'$䀢  '  ?`r &ܐ \*`@s8ptTtHy4tHz r(Đ`䀢@ `2 @ *   $@  -  W * &&@J6  M& $@ %` %@ $@ %@$@   ؀  䀢 `2 @ w*   ^ $@  -   * &&@I  & $@ %` %@ $@ %@$@   ؀ ΐ Q?d $ 2/`  ڀ`  /  `. :  +` *:  ?` 䀢1  '  *".   +".  ?ޑ.  \䀢"    '`` + ?Ĥ?'䀤 y* l$@  -   * &&@Ig  ~& $@ %` %@ $@ %@$@   ؀ ?NJ?`.N.@. $$"$.  䀢"J N` N @`@$ $`@ $ @ 7 /$ @ /`$@  -   * &&@H  & $@ %` %@ $@ %@$@   ؀`  $@@  .   ʢ`$@  -  ݠ * &&@H  & $@ %` %@ $@ %@$@   ؀  @ – `$@  -   * &&@H  & $@ %` %@ $@ %@$@   ؀[ /䀢 v $@ " -  h * &&@HG  ^& $@ %` %@ $@ %@$@  " ؀$@  -  4 * &&@H  *& $@ %` %@ $@ %@$@   ؀`J ^  *@J@ ^`''$@  -  * &&@G & $@ %` %@ $@ %@$@   ؀ ,@`@  ؀a1 ` ,`1䀢"   ' ` \ ]䀢"   '`ސ` ]`䀢 ` -J ]2 -Ā J [Ā J [J ^J ]J@ -`J` ]@W '@ "Q` [2/J@ :2/@< '䀢2 䀢2`'䀦 @  : ]䀢 ` ` $@*?`$@*? :NJ ]I@ b`?/@ bȀ`?/@ bЀ`?/@ b؀`?/@ b`?/@ b耠`?/w@ b`?/o@ b`?/g@ c`?/_@ ߒc`?/W%@ ؒ`?/O3@ ђc`?/G@ ʒbȀ B@ Œ =@ b 7@ b 1@ b +@ c &@ c  @ b @ c @ b耢 @ b؀ @ bЀ 2x 䀢m '䀢d '<'4','wog_WOG<` "ؐ  q 4` "ؐ  f ,` _ ^  "ؐ  T ` "ؐ  I ` "ؐ  ?  "ؐ  5  "ؐJ  +  "ؐ  !  "ؐ   ` "ؐ   "ؐ  D"  2  *@ @  ,@ ~< /?'  `  ,` ` ,`// 2   *@ @  ,@    ? ,@ ?  @@2׀ @`р hd̀  @dƀ "@@=? 䀢 v ' ?ـ`U"4*`@||||||||| @N &`'쀢@*`*`@@D*` '* '* @*`%" *` * `%@ ""*` * $@" * * @`E"`*` * $@ "$@  +  * &&@D & $@` %@ $@ %@$@   ڀ ,@`,@`,@` '  k @ `@~ ?$@  - n * &&@DM d& $@ %` %@ $@ %@$@   ؀ ,@``$@  @B @s 6 ?'* @*`    *` *    @* $@  -  * &&@C & $@ %` %@ $@ %@$@   ؀ ,@`,@` @!@ d $@  - Ġ * &&@C & $@ %` %@ $@ %@$@   ؀$@ @ ``$@ @$@  +  * &&@C` w& $@` %@ $@ %@$@   ڀ` 9b"@@Ā?@?䀢?@2.'? +`' @  !"ؐ@   & . *   ?䀢 `' @  `@ ,25䀢+`' @   "ؐ@   & , *   ?䀢 `' @  `@  # c@@@ \䀢`'䀦 @  }@2'  ` ` < $@  -  * &&@B~ & $@ %` %@ $@ %@$@   ؀ $@@`  $@ - b * &&@BA X&@ $@ %` %@ $@ %@$@  ؀ `"" @O`  @H `$? @&` $@@7`'䀢 `'䀦 @ @A Ā< J? \46 ]!@0 $@  -  * &&@A & $@ %` %@ $@ %@$@   ؀ ]!@ $@  -  * &&@A & $@ %` %@ $@ %@$@   ؀c ]!@ $@  - o * &&@AN e& $@ %` %@ $@ %@$@   ؀( ]!@} $@  - 4 * &&@A *& $@ %` %@ $@ %@$@   ؀ ]!@B $@  -  * &&@@ & $@ %` %@ $@ %@$@   ؀ ]!@ $@  -  * &&@@ & $@ %` %@ $@ %@$@   ؀w ]!@̀ $@  -  * &&@@b y& $@ %` %@ $@ %@$@   ؀< ]!@ $@  - H * &&@@' >& $@ %` %@ $@ %@$@   ؀ ,@`@V А`'''А@`*  D $@  -  * &&@? & $@ %` %@ $@ %@$@   ؀ ,@`,@``怤  "3   2-`)J@ *% ^#` \ bJ`J + ?bN@J {"FJ@ \2AJ` {2=$@  -  * &&@?e |& $@ %` %@ $@ %@$@   ؀ ,@`,@`$@  - M * &&@?, C& $@ %` %@ $@ %@$@   ؀,@`  -䀢'䀥` $@@  @>$@&          *@*`:*`*@*`:*`*`:*`㿘  *㿘  ?? +ې J\`?H(  2 2  H| 2 2 J\`?    J H)"  J|"  0 H|"   , ((  (  24  "2  )  8%   8   8    (@  *@ 㿈     ` '6? ''@! @ *@& 2  2@ *` * &  ?'* @ `#*`@th@@@@@@   - * ? Ӥ ``:  `` ?$@:@ 2-` * `4  -``$- ,`?  ``:  `` ?$@:@ "-`   P L@ "-``$L@    P L@ 2-``$L@ |   -``$- @2 n- l { L* @`c  ^ L* @S*@MJ' L* @#쀤2] @:b<8E?, h#`@?ٕ, '* '`'*`"    &   L* @` î @! 耤 䀤 2@ *` * &    (" "@"` "` (" "@"`"`㿈#\#`#d  @㿐\`d`` 4??84$` `@  `  4y? ` `@ ) m?) j?) `BA `= * &$&@ " @ O@  `?? " @O@ `"&@& @J   2 #\`"#\`"?#\#`@ ?  $ ? ??㿐#\#`  @'''''` ' '  '!!' '|'t 'l'd'\'T'L'D` ' ''  J(```c ?#`'`c ?#``c ?#`'|`c ?#`'t`c ?#`'d`c ?#`'\`c ?#``c ?#`'L`c # `'D`N`L| It`F`Dd A\`>L ;D`8 L̐@@G? !P07#;#=#. t @ |! '@  @ @  &@   . Ā` Ԁ '''̈'Ĉ'Ԇ@''̴&̀  @Ԧ̦$2& Z <̀   T@̐@T@ `?@l` `T`]Z  'l'TQ . d @@\!  . Cl "\TԀ (  d @\'@  . \ `@2@2%`  \ @ \!\@@:@* \! @:;* \ `` \`Z * @"!   \ \@ \ @`@:*`\!  @:*`\ `` 5`K?\  " $$̐"@ !P?̖@\@@8 ;.  "\@  \\`. `" )"  ̀` .  Ԁ@ ". "̐" \ ̀` . @ Ԁ ". @"̐"  \:?\`. `" "  @ \$̐&հ"@Ұ"@`Y#<*`@xllD@T ,àà\üP<lTɈ\ǴȤ  0 H@L@"?@LL@?@*@   &@ { @ `"L H@  `" L H@ @ @є*@   &@ E  `? " "  * @ 2`  `: 2  @*@   &@ ' * @0 2 @ ** @ 0* @&@ * @ 0@ @ !P@ * | @ * ! *@  &@ *`@ *&@ a  * @ 0@ @ !P@ * @t @ * '@ *`@ *@&@ ?* @@ * @ "  !! * @@ 2 '         J *  `' ' ' 2c ` 2_ ` @2Z*`@ @*@&@ *|@ ! t@ @6'@    * ' J *  '"%`*`  &-]?*`  %`*`  @5<쀢* h#`@;* '* '"@@ @`'*`+ @ " `'*`@ " `'*`@  " `'*`" `'*`" `'*`" `'*`O" +  !P@ F@ B ̀`  Ԁ@` ̀`  + @Ԁ  `? + @+ @  @@@ %%$4`@q @g @Ѧ̀ Ā 2L` 2  @T2LN   @@@̀`5Ā`/ L* "%`*`  '9]*`  %`*`  @4"<쀢* h#`@: * '* '"@@ @`'*`+  " `'*`@ " `'*`@  " `'*`" `'*`" `'*`" L* ' `': ` @ @   ` `a "%`*`  &9]?*`  %`*`  @4c"<쀢f* h#`@9* \'* '"@@ @`'*`+ @ " `'*`@ " `'*`@  " `'*`" `'*`" `'*`" `'*`<" L*  ? 8 * 9   @`@1 20  ' ` 2 `      `? *  @ 2`  `:  `?2 ,  -,''* '*`  * *?'* @D! ?'* @L @ ?'* @  @ L* "%`*`  &1]?*`  %`*`  @3r"<쀢u* h#`@8* k'* '"@@ @`'*`+ @ " `'*`@ " `'*`@  " `'*`" `'*`" `'*`" `'*`" "%`*`  )1]?*`  %`*`  @3 "<쀢* h#`@80* '* '?"@@ @`'*`+ @ " `'*`@ " `'*`@  " `'*`" `'*`" `'*`" `'*`" L*   ?,> ,֤, , L* ?,> ,Ť L* ' L* *> *`̀ Ā " P2N@2LHJ `? PN2LH@J `?z̀ Ā  P2N@2LHJ `? PN2LH@J `?? PN2LH@J 2̀ $Ā ! PN@2LI?J  ̀`ԀĀ`~ PN@2LHJ l PN2LH@J TR PN2LI?@J 2;@3*@   &@ * PN2LI?@J @ *@   &@ @ m?'* @ 2'* '* '*`  *?'* @&@ ?'* @'@ ?'* @ @ :+      Ԁ Ԕ ' L*  ' '  *(l`TT?㿐 ]' @ H K`' `J`*`  H'@G*  @'  `' `J`*  ' ?  ?   ?J?*  @@!*   '' & @0*  "   㿐'  @*   `' `J`* `@ '  㿐`' @`g *`@H0000$0HHHH|0000000Ѩ0800HHHH K, 0 **0* &*-  J *`  '-  ' J *  '?' ?J?*  '' * 0@    '&  @JJ`  2  㿘* *@@ "]]a*  No previous regular expression㿘  !!T 2, 1)#!T 2!@1~ Ȁ  $!T!!T $ @1u! $ 1!!!T @ $ @"]Ӗ]a*  㿘@!!T   82 㿘"@"&& & !& @1<! & :    bؐ  #*   * & @ ?!   @*@& 6 `*` * & @!u " h@! @ @ ' ' ' ' ' ' '  * *@ 7  `*`* * @`''.@0̐'@0ɐ'쀢 `& Ȁ`  `  ** &    "`@1@16 Success㿘  ]@!!. @ #@!  @١*?@㿘 "&@0&& &   "& @0&  *@&   "& @0& Memory exhausted㿘@ĒB 㿘@0C8 㿘@0Ò- 2 (  (@2 *  (@ "@ 2 *  (@ ("@  *"@ (" *`8``" *@ * 㿘  !Е.  ( a a!  @!``* "`!! *`!"@!` "`. @     ܆  ؄@  ؄  ؄@   ؄@   ؄D@   ؄@   ؄@   ؄@   ؄H@   ؄@   ؄ @ :cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]㿘@!耢 @ a䀠`? Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [x  %')7!59!3" ]"@耢 `$ @??`rl$"ē*`@`TTTTTTTTTTTTTTTTTTTTTTTTT TTT@TTXTTTTDTlTTTTTTTTTTTTTTTTTTTTTTTTT4TTTTTTTTTTTTTTTTTTTTTTTTTTT,耢  $! !Ԁ  !쀢?!! 2"!& !!Ԁ:!耢`5` J耢  J@ \2!J` )#!! @耢  J  J@ \!J` |!!Ԁ(耢 J !&ʰ!!@"!&!!Ԁ倢!&!!Ԁy倢v!&!!Ԁo倢l!&!!Ԁe倢b!&!!Ԁ$[倊 U!Ԁ ! 2M"!&!E!Ԁ !  2="! &o! !Ԁ$4倊 .!Ԁ !  2&"! &X! !Ԁb@'!&耢 䀧`AF`$ @? )$ؐ  "?&耢 䀧`',`$ @? $ؐ  *` * ?Ѐ ," ,"耢 䀧``$ @? $ؐ   !*` * ?'!'!!@ } \"耢 䀧`ِ`$ @?$耦 }͐""! &İ! !Ԁd @  !Ԁ$|倢2z"(v "! &! !@ha "a "!&!!@V! !@2M"!"!"!&y!?qw!Ԁ @  V!Ԁ  OR"&!Ԁ$Vؠ  ؐ  /ؠ    WI倢:耢 2䀥37b  $ ? ^$耢 2䀥"&b `$ @?$  [? \!Ԁ ; \ 6 ,`! * ,` @ ؠ  $ ,`@ $@"@`$耥b `$ @?$`,` ϑ,` \!Ԁ 耢 䀥ΐb `$ @?$耢 2䀥ʾb  $ ?`-=$耢 䀥ʭb $  ]$$)$耤 \!Ԁ 耢 䀥ʒb `$ @?$耢 䀥~ʂb `$ @?$4-5Q܀  ؐ  #.  R  ؐ    .  R / ڐ ]/ [ E!Ԁ!ڐ ֒"!܀ 3 1ؐ  +&ؐ  #.  R  .  R -ذ! &``Z@?"a?㿘!  @!``* "`!!  *`!"` ! `"  *`" ?`!ܓ*`@<(((((((LLL(b ?!` "`b "ba"@4"Unbalanced (㿘"`a!~  ~ ~ a "!"$"!$"@ "!ɇ"x"b!㿘! ,  ?! !  !4 !  ?  ? $ 㿘  #aВ *`P  aЁ㿘I"! ?!!! ! "! 2! !  +! !6'Ȓ!  !'!!  D"b"=$""~ ~ 㿘"!! !"  ! "!!  㿘"! ! $" ! !"! No syntax specifiedUnbalanced )㿘"!"!"a"!?"a "a"!!؀ ȟ"@!$""b "?" Ȑ"X 8!   !  &    *"@@ "`&#  `@*:` *`6@* 2   #h #l`"`@*#`#d@h l `#hd#l`&@#   "`@\  @W+ @+` (@ "* @ "@@ "`/ + +`  "*  "@@ "`* @+  "@@ "` "(+` " ``& 0 "* @+  "@@ "` `&  "* +` "@@ "`` @&  *" *"* "@ &㿘 @ @  `@ @,`` `@   (@6> ( $ (,`*  21` ``* J` 2'`J` 2#` 6`@ $,`* @`(@   `2 `@  @2`(``@ʑ,` ( ,@ (*& ,@ ,* @ $*`& $ $,`, "`ܑ*  $@"` $ ` $*  $*  $*  $*  $"  `6 (,`* ,`@,`* @(  * @ 6X@  @ 24 $@ 2% $ 2 $ $ 2 $  $" $ $@ ` *` $+`  2@(@ * @"(@ * @!2  $  *  $  * `&@ ( & (㿀`;*  $@ `,   m d,  ` *@ ^!\!4[ '  ''@ '@ `'* @ F?*  $@` * @>  * |      '  `0*` , @''' `0* *?  &@'h& 4 * ' * ' * ' * ̴ *  *  * @ *  % &, * '  & 0  6E'  , ? * "p % $%@`''3 @*` 0@ k@* @.`@ *` * % @ * @6@ .`@ 0* *  A*`@ 0*`" .`@*` 0@ `@͡.` , ! 2%?''* 3 @*` 0@ &@* @.`@ *` * % @ * @6@ .`@ 0* *  *`@ 0*`" .`@*` 0@ `@͡.`? " %* ?  * ?, .`$@@ "`* $?  ?@  % $?  ? "%? %?? ,  !`?"@$%@`%& %&%   0,"  &   67' ,@ !!$, 0'' 0 쀢 6,d*` 0"@, 0  & '   ' `', 쀤 ,  `2  `0 2  &, & ,& ( ,*` * & $Ж @%@%@%@%А@%ΐ@%̐@%?ca   "a #!䀥` bؐ@  !x``` a?#ؒ@ `$ . * @`@6Y`?#?#؉. ?ct@ @?ct@@?ct@ @?cl@ @*  -`@ $@ `'`` * @ 8ɒ?* @!* ?a @ ͒?c  `$. @*` J   ?  ?#`$?ct@@(` J @ ? !- @@   " ?#`$. @*` J ? !x-  *@  "?c`$. @*` J 2 !x- @@   "    ?#ب  -   "   n ??#` * @ -   "[   - ?, @`" ,D   -  ??#,@@* "@ ,* `" (, ?#- -  `Ǒ* -" -  -  `" *`"  ``" &2 `?- ?#lϒ ?cl@@`* -"@ @  "@ "@`"```$. *  @&Ɛ`* ?c$ `x* ?c$ `4 a  `$ @ `-`   `2  `0 2 `$ -`   ` 2  ` 2 ``$`@&``$?c        ?c    "؀` ` &(@  -`&-`&```    ?-```& @6 ?#?#?#? ?#d!'  -` @`65`4     - @`0*`   * ,@ &@ `&`0*    -`  &Ѧ `4 "  `$ 6 `- @ &@ `&{ `$`&` -` ?#d  ?# ?#-   `2  `0 2   -   -`?!x-  @   -  ? #?#@-    ` 2  ` 2  @ &@        -` ? - -  : ` `&(@  *`&`4*`&(   ( `@&'  @6 ?-`@"`@&-`?#@"?#@"㿘`<#  ,` "`H@" `@ "`@"`H"``8@&`@&`<`< &`<`L. "@`$* @J`  ``$.  `$. @*` J `2`L `$`"`$`L.   " `$. @*` J `@`$. ``$. @*` J `2`L `$`"`$`L.   " `$. @*` J `@2`$0``$. @*` J `2`L0 ``L.   " ]$Q ,``8 *  *&`8 @`8``DN*`&`D &`@`8`HG*`&`H`8`LB*`&`L`8`P=*`&`P, " `H"  `8&`@``Б,``P. ("@ ?$(`$* @ ` "`@`H" . "@㿘 & 8& < 8  & D & @ 8 & H 8* & L 8* & P 㿘a  "a ! "ؚ  ` ` "(@  *`" *`" ``` 8    @ .!, ` * @,``  * @, `   '%, H ! L* @ @`7$*` J   .'@,'@H,  * @    ?  '  z@?  ,`P@㿘 & X && & S & & & & & & 4& 8& Tout of memory㿘!܀ ?@ 2t#0 "! 2, * : "ؐ@  *`@ ` , * @ А@& &&&& "aܐ @:㿘@ @    , @*` @    (& $@  $  , @  @  & 0@  0 , @  H, @ " @   8& @ D " H@ w H " P@ q P " L@ k L " T@ e T   @ ^ @ \2 㿘` @o   @e @@Ɛ @ L` `@P㿘 ْ㿘@G @  N  㿘@ 㿘    ,`@ &`,` ,`㿘 "F ǐ2.@=   . .. .  ,  ,   @ . && ,  2, @Г*` .&" @0 㿘  `"8 @0 2$@1  , *`:`   N J @N 2N 8 N@=2N  " N 㿘 `2@  ,`@@g`,`@ ,`㿘 `0 @Ր 2&) :%  ! @  ,,`@ ’# `,`@ ,`, 2@㿘   **@* 㿘]"   @*   @:!,`$  "`"` "` ` @,`% @w ,`$@s $ @o $ @l $  6 2  .`,`*@**" @ܬ  -@! x!  !!!?t`0 !! 6` ! ` ߀?݀?0ޤ  @ " *J    JJ@2`J  *@@    @ 6  $@ " JJ?@2 `@ $  $ * * F@S$ *@  ,`@\@@Y`@@,`@ ,`@g` " 0} { q$J@ "` J "`  b]@$$@ P` J "  ` E$` J `*` 9$`` J " `  J@ "`  "$` #*' %! *@** * *`*  $  & @ ɐ @+ $@ @% $ @Թ T$ & T |y w u ` @$,`@  (8  J  㿘]-@+!'@ @6!'@!@. (&`@&!! @6@@. @(&`@&Ԃ@5]3b&&&bPOSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿐]""]⬀ # ""b"""N - + "b  ""  @" ""  "b " "J " /!]"b  ]"@']]"b ""] " * @J@ -J` ]b""!]"'* @ @੒b !]" $""b @  "@]""""]""]⬀ ]"b2"?"* @J@ -J` " ]?] "* @" 'Q "]"*  @ J  -`? @  " ]"* @J@ -!J` -`"""    `="L    +b @$ 2b$@  2 '   ]"  ]"*!h b@@@ !@ "" $" u]"`""L 2  ]U"b]" ]"* ?J  - ]!h b@@!"* ?!h b@J@!@ "" $" ? )!]⬀ ]]"⬑*@"b"  ]"*!h c(@@!@ {"" $"N : ? :!@ o"" $"' `  "@ `]"* @J  - "J@ /!]" ]"* @J  - ]!h cP@@T"* @!h cp@J@F" #"b]b "bi ?!"`$" @|J@"J ]b "b :2J]"  . !h c@@:]. : "bA ? :2=. J : "J@  ]/"""J@ ]""]b $"b]"]]"  . !h c@@:]. :`""N :  ?  :] "* @""". > 㿘   㿘 㿘 㿘@node must be type 'b' or 'c'.%s㿘@7 "`@7`J c! !`J b2 @ @ax,`4`@` @`, `@    a@`@ usage: mknod name [b | c] major minor 㿘!h @`bh@ 㿘@[@(#)cl_bsd.c 8.25 (Berkeley) 4/30/96㿘  c@ 㿘#   @ z@!0smkxrmkx㿘` #h #p@? @ ^@! 㿘@flash㿘"@ >&# "@# @#p?" @&&# "@# @ڐ#h?" @&&# "@# @Ɛ#?" @&&77x7p7h7`7X7P7H37@78707(7 777766666666666666666x6p6h6`6X6P6H6@68606(6 3p666653h555sosmsokstismcupsermsoketermcuplilineskRkrikPkppkNknpkHkllkFkindkAkil1kIkich1khkhomekEkelkSkedkLkdl1kDkdch1kukcuu1krkcuf1kdkcud1klkcub1vbceelupcuu1cmcupcocols0123456789;123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz㿘@@㿈 a   @;z#Ѐ 2 N kN  f@ˆ `?4뀢`  F k/ # @//"'@5쀢 ?"㿘 a   @;G#Ѐ 2 @ ??@(#)cl_funcs.c 10.40 (Berkeley) 5/16/96㿘 $!$ $ !  @ 4@ H "   $ 4  $  @2   " $  $@!$ $!$@      $@!$ 㿘`$$   $a  "aa @ @;!  $@!$ @!$ @>㿘  $@52! "&"X K"""X 2"X n "X !,""X "X  "X$$ "X!&@ 㿘$  cx@d  !̀ " ! !đ*` * 8  0 Ͱ 0° 㿘 $@q!$`? $$"@$"@ H "@ 㿘$ H `@ $  @ $!$   @ 4@ H  4  ) $!$@!$``$* `*  @   !$ @$@ !$@F ?!$@A ` 8@*!$ $!$@q $@!$`?㿘 ` $`u!   ! o $ ! @ D @ ɔ! !?`"@  " *@E ! @ 0I !  ?`&  @ `&*@@,``$  !  ?`&  @ `&*@@``$ !?`"@  " *@ @!0@ 㿘 $@e!$`? `$` ``" *`?*`?*`?*`?" Error: move: l(%u) c(%u) o(%u)㿘 $ H!$@ @    p@e H 㿘`" $ $#`0 @"`0 $@!$`? rmcupsmcup` $ &@$ ! $T  @Ȑ  @a @ T g  @c !$   $`Ԓ@] @!$ @ƒ!$a a a0@Naa  @ @I!  @aa @ƒ T   @Wa a8@.aa  @ @)!! $!$+ !$@    @ Ā    "   $a "a %susage: ex [-eFRrsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrv] [-c command] [-t tag] [-w size] [file ...] 㿘!hcH@P@(#)cl_main.c 10.27 (Berkeley) 4/28/96TERMunknown㿐@2^`  "`@!@_@$ 8`$@ 2@ (@@@$`\ $``@@  @ @q $`H$`D$`<$`8!  @t @  "@^ @@u@܀  @!`? @͒ @@@A/dev/tty%s: tcgetattr: %s 㿘@ / 2  @M( @H! `2& $@N& $!0&(X"&(\"&(`#|&(d&(h &(l ,&(p `&(t#&(x!&(|#&(#&(#&( &(&(!,&( &(!(&(!&(!@&(#&(@ (T &(T(T   @ja?" $&! @x ?"&@Za?  $@#ܖ!ha@@ @t&%s: No terminal database found %s: %s: unknown terminal type 㿐 ?  0!hc@@ !h`@@ 8$   8$ 8$   8$  %s: %s signal-reset㿘`D $" < <`" !@` + $ <`" !@S̀  $`<@ "@ !@E耢  $`<@ "@ !@7 1 $@s#ܖ!ha(@v'   @$   @̀   @耢    @   @0 㿈'''@㿘 $  @!  @!  @!Đ  @}!Ё㿘 $@!#ܖ!ha(@$@Đ @(#)cl_read.c 10.13 (Berkeley) 5/3/96㿀  $!䀊  4  ?"$!L  H !䀊 D !䀊  ?$! @Ø䀢 ?  @,  @v#'@#* "@*`@*`'0!@$`!*`@M(M@MHKMP&`&`  &`   @ input` $(T   @`2'ð  p @ '`'p 'p   @՘? `0 `0- @Ȁ 2)(T`  ''''''''''' ' '    \@:(T @ p @є p 'p      d"` 2 * (x "x`  4 2d p  @o ?% p@   @M ǐp8 @S`2d  1$ . '  $#܀    @}p  @ ? "' *@`'$   @”ȁlines=%lucolumns=%lup''''''$@@'@  $@@'@ @ @(#)cl_screen.c 10.44 (Berkeley) 5/16/96㿘 (T @  $@l 2g (T ?$(T``$ 2] `$ 2W $  ?&$$   ?&$  ! $ H 4!$ @/ @!$! $ H 4@!$@% @y!$`)@ 2.  $aa $a$ "% a "! " " "  " *` * 8?a@  @s  @e  $aa $a 㿘 $!䀊  ) @ 2 (T  !䀊 "(T@) 2 (T   !䀊  @Ő 2   @!! ?$!016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattrsmcup㿘 `$a䀊  hT @y   @H`ϰ  =@Ք "#ǰ  " # #ԑ*` * 8!@Đ  @ @㼐 " " "  " *` * 8 @ @㩐 !` " !X !X*` * 8 @ ! $$#ܐaX `#܀   @v  @ @  2 @  @! $@a@!$@D !$  $a @^  @ka\  (a"$a\"$a\a$"aha\$$a\ah $ah ,aw,au,av,a{,az,a~@)    @a\   @@  a 2  $aa `@aa  @-@ ! 㿘 $! $!$ ! !$ @ @!$ $ !$@ @!$@@D&! cupsmsormsoelcuu1rmcup㿘 `$!䀊 S hT ra@v!a@q!a @l!a(@g!a0@b!!  ! 2!! "!@S$!! "!@L$!!$!0!$!4! $!8!$!<!$!@!$!D!$!H! $!L!$$!P!($!T!,$!X!<%$!<!0!$!0!4 $!4  @K!0  @ ! 2 $!! a8@!!  @@ ! 㿘@# $ 㿘&?" @" @v` & @  @` 㿘! "!@&!! "!@&!! "!@&!! "!@&!! @&!%lup@ А (@A`@  @(#)cl_term.c 10.20 (Berkeley) 5/3/96____________p_h_`_P_H_@_0_(_ ___^^^^^^^^^^^^x^p^h^`^P^H^@^(^ ^^^]]cursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1_`p_^`h^^``]^ `X^lakahaja㿈 ` '  @?"``@@`@#\#`#d@ؚ 2 `` #` 2']  @%?#h ` h `  2"``@@#\#` #d@ 2` ``  ` "C   s@6?4@}`x "0`` 2``@W@T#\#`#d @H@E`@A#\#`#d@` ` ``  !D " $     @>  2 $ 㿘!D`  `$ @@ 2 `$ 㿘$   $ " @ kf%d233|This terminal has no %s keyfunction key %dH@ @@L " @  @l @@40@#\#` #d@ۚ  @ 㿘`"  ``" 0 `= (T`@"(T$ ? &$ `$ @`? stderr%s046|messages not turned on: %s045|messages not turned off: %s8@^ 2  = @8 @Ò 6 a܀ / )     &a܀@` 6  ?c@ 6   @ږ TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS㿐  '   `h@x?`6 ` 2v'0tn"  " *` * 8" !`^" @Z!`  !X*` * 8@ۀ J!X@Հ D`( @ # ! `# 6  @f(`` #8 6  @V@ " `" P@ސ#P  @ @Ր#X  @ 2&2& 㿘!?` "@ . :  `"*@@^ @(#)cut.c 10.9 (Berkeley) 3/30/96㿘  `@  @  2 @ ` @ߐ `bؐ   `"  `c*   `"ؐ  #*   !@  `    2 0 2  1  2 1@"  1@Ք ` !$  @ 2,  @   $ $  !@ $ !@"  "!@ !@$  @A $ ,  "  , @8?   @ \`@0 @2 "@@ F   @ <`@ @  @{ )  "! " 2  1# e !@  `  |  2 v   p!$ @ϐ $ ,  㿘 !@`2 "X 2 3 4 5 6 7 8 9 `?π * n|nnnnnnnn*`*` *` *` *`*`*`*` @`2 ` `"  "` "@@ @ 㿐 @x 2(   @F   ""  @&  & &  @2 ' "'    '  㿘!@  "@G `"  "` "@@ ǐ!@  !,!, @1 㿘 @ﱒ < @x  & @ + &  @h   `@    @`& 㿘2& "`2&"@@ 2㿘  @ j@ h@(#)delete.c 10.10 (Berkeley) 3/6/96002|Line length overflow㿈0 '@@ Т @xj 2ް  d & d@ d 2 (T   @u&   (T  '@@ݐ @y 2 @*|@  @w쀢 2 쀢@`? j#'@x% 2  d & d@ d 2 (T   @t   (T  '@@ݐ@ @w쀢 2p    "'T!"`'`  @̔耢 !x t@x "M &ttx'T!&T@ x`@@x` & 8 @@2S` @wD쀢 2,    "'T!'쀢  @耢 ݠ`x t@|x "  &ttx'T!&T`@ 2` @ (" ?`"@@x# Ѣ Ϣ `7@ @v 2ذ     T!aa' @5耢 x t@)x " &ttx'T!&T@  @v쀢 2 쀢 Z? V"@  @| `   " T!"x -'%   "TtT >&Tx t@ؔx "e &ttx'T! &T@ǔ耢  @ " ?" @@@wܖ * "@v #  d & d@Q d 2 (T   @s   (T   '@@ݐ    ` `thT >"hT@i@(#)ex.c 10.46 (Berkeley) 5/15/96script 170|Interrupted㿘`@bt "l۰    `"  "` "@@7 @5l 2T *  $!$?# pd@@ @2d`L@d d $d@< a< "a4`a4*` * 8 2 @ bԀ " bԠ @ bԀ "b`b̑*` * 8 ` `hT ?"hT`x :@\ 2t `(T   @r˖  `(T  @<a@<:X @톔`x` 2`!$ $`$ $@Ґ "`T "@ `(T 2`  @r  2T`(T " T`(T "(T @ZT @2 &d @"d& $d @i\ 2 @d&@ L$ !#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedx  `|` "`` &a`&a`@ @vr L  B & P`*@$`` @" `a &a`  $` ` *@$`` `Q @t 3`$`@ 2 ` $``  `J  a &a`  $`  2 ` ` $``? $`` :2`  ``$`J`:`? $`` ""2!` ?` $`J  "``? $``J 2`|`  $`` $``?u$`` "``J  2 `` $``? $`` 2` $ `("`@    `|` " 'I` @`  2``J ` *@$`@ 쀢   쀢 2 !``  `J  :2 `` $``? $``  `J`|` ~@ِ!   ` $``?$$`` `"`J  " ``?$`` $`` 2``2  @~` ?* : `f! *`@<! 'LJ@ 'JJ@"J l p + - ^ ##`" $``@$`<! ! $`$`$`(`$`,` $`0`$`4`$`8!U$`0 Lc*  ,@ M X$` L k s?B`L  >`L  :`?`" $``?$`<"(<$`   J c g r`?`" $``?$`=  $`$`$`(`$`,` $`0`$`4`$`8i"h$`(`$$` L`*  ,@  `` =!Ѐ@`$ `$` ``` `! `<#@ H@` ``  !р``  ""` #L "#D #D*` * 8 `  ; ` @@_ `;#耢@2` L <"L` < @2 ` L >2`  LJ2 ``?$`` $`` 2``@s" 2`` ;#@2` "<"@@2` $<#@2`%0`@*@<#$` `0 $``` 2`$@2 ` $`` L $`d P$`h`@ $`" "" "*` * 8 2` ` " ``@ $``|"4`|@*@$`$ `  $2` `" ` `  @|8` `@`$` >$``$`` <!P@   @h@@u;`  `J@ !2``$``?$``|!4`|`$`J  2 ``?$`` $`` 2`` "``J@ +2``$``?$`` ;`J`@"`! `   'S "` 'R@@m  ` ?$```$`J`  "`,`?$`` $`` ɠ `"$`#@ @@@2` `#`<#@"p@2` `J  2 ``?$`` $`` 2```l!2k`` $`e$`= @a` J  2 ``?$`` $`` `J"ؐ@  2=`|2`=  $`$`$`(`$`,` $`0`$`4`$`8i"h$`(`$/$` "-``J $``?$` " " ``J@ \2 `` `$``?$``J "`?$`` $`` 〤`  `J @  W`J`@"`6 `   'S "`+ 'R@&@l " `  `J  '쀢 |2&,쀢 2 `a &a`  $` `?$`` $`쀤 |2, 2``  $``?$`, `?$`` $`` 2`` `$`$``$```" " $`` = 8@2` ` L \", `  "l``  `` : 3`` "`    `  ` $``` $`@q耢 2f`耢 2 L$`d` $` L$`d Pj$`h$```l$`d`pd$`h "b` +```` ( ` $` $``  $`l@qÒ`l 28``   `l  $`d` $`$`d$`p$`h` 6$` * 42` 2/`  $```@$` L 2$`l` @q耢 2 `耢 2  L$`l$`d` $` L$`l$`d P$`p $`h $```d$`l`h$`p2` ` ;#p@2,$`\ $`` L $`d#(   L # *` * 8# $`l P$`p$`h@qX耢 2`耢`" $`\ L@($`\`l 8$`l$`\`  y?#+`! ` "l `J@ !2g `$``?$``|!]4`|J  2 ``?$`` $`` 2`` "O` ?ϑ* : `F-%!*`@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@8@@@@@@@@@@@@@h@@@@@@@@@@@$@@@` " `J ^"`\ l +"`\ - #"` " `\ݠ  p"`|נ  $`\?$`\ $``|"4`|0 "`|$4`|0$ 4`|0 %0`?$`` $`` 2` ` " `J ."`| = + -" `|  ^" `|    @`| ( L 32 `| 4`|`?$`` $`` 2`~ `J + - ^ #2 `@ 1 2m `J "ؒ@ ` 2c ,`Q` $``?$``| W4`|`J"ؐ@    L +2K `+`-2F `J -2``| J +`| 4`|`@ m䀢 L 0S`" `" $`$`L a `l$`d`p$`h`d ?$`l$`X`|  4`|`@ `ۀ @쀢 쀢 ?܀ *`@o *$`T` ;` #` @ `? ```'=J`"`" `   'S "` 'R@@i  `  ?$```$` `,  2 ,` $``? $` `?$`` $`` 2` @ $ 2``J  2 ``?$`` $`` 2`` "` `'2J`"`", `   'S "`, 'R@@i 2,`  ?$```$` `,,`?$`` $` ` 2` $ @ O 2{`_```@ ` p L NR?'L  o2,, "J``,쀢@2<` C`` ` ` *` * !X  @hL H@w L  ` "```$`J@  2``? $`` 2 ` @bx " ```  @w``` - 2I$`l 2``2$`d$ @@2`d`   @nX`l 2`d`|    @n{耢 2`$`l`d 2``$ @@2$`  ז @n0`d 2$  ͖  `@9@@322```  2'``l  L@ ``"``l`d  L@ ``" ``d " & L& P L@ P`$``$``@ L' P'`*@$` '@vx  2`$ "  , & ,  $@2`@nƐ` @" `   "`$ "`hT @@2 h|` ;#p@2`h|€ ` *@$``  € 2hT (T 2hT  @i  2$ (T " $hT 2/`$$*&$ " @xs  ".$`\`"*$  L  @vÔ`8`\     L`\@m] 2  L @v` L`\ & L$ L   H  L D `|`:! @4`|`@@?`|! @4`|`|b  "$@! "! !*` * 8 2`  ` @2"  L''@0 "D``$` *` $``@J? "`#` ?`8    'S "`` ? R@*@gt:` 2 ``$` *` $``"$``$``@ ` $``$``$`$"@d   |`0 )"+) `P "* Ѐ 2@  @ub@2 @  @u#@@+@`2 `P pn $"@2y'$`| @uƔ` `@w( `     @I` 2A`` "=```$`J@`@"` `   'S "` 'R@@fҒ  ` ?$``  $` |2 ``   $``? $`` ``|  @ucX@@iԒ   @uW '&a$*@&$094|The second address is smaller than the first㿈&&``` ݠ *!'  ` ?* :  2*                                               `2`   @k’`l  `l@ &`d&`p&`hE&```2`   "``` " L  " L`" `l`&`d P&`h &``&`d`p&`h L&`l P&`p&```J ; `` "`d  `" `l  @& L`h& L`p& P ` &``?5&`@ 2  {쀢 ) X`` "   "`l &`d&`h&``&`l&`p &``&`d`p&`h&`l&`p ` 2-``@2M ;`` "2 L  " L2 "%`l-``&`d P&`h&   @Ԗ .   @Ζ (   @ǖ ! !   @  &`d`p&`h L&`l P&`p &```` 2 `l`d@ *@t@ & $0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0㿐'&`* &`  2``+"H@J@     @h '` ?ܑ* : `8+#l*`@Px &` &`&@jW 2| ` &` &``@D  @ e'&&`" `" &`&` &` &`` 2 ` +@sK`I'J`@r,  2s ` &``f?`  `J  / ? +@s,\ ` &``?&``J /!! L& P&` p > `" `" &`&` &` *&` & P& L 2&@i̒ "   &`  `Jbؐ   +*` &``?&``  `J  2 `` &``? &``  `J"ؐ@  2 `+`-`^2 2 ` & L& P&` &`%#` "~`J  2 `` &``? &`` "k`Jؐ@  2 ``+`-`^2\`Jؐ  2`J  2 `+2? `?&`` &`J - ^  ` &``?&` `@# 2  ` " $   ` $   \ `$`" `" &`&`  "   @ +@r? 8  4 & 㿘$*@&$ |@2 `@q @$l$ 2j `P "F@`<`<"`<  @`<2 $`@ "` 2 $`<"@@`<2 `<2+`H `P `D`@h\ " `D@h L " L)   & L@`H@`"``"``@"@@͐|$``L @``L$`  $ & L$`D `P $ &$ 㿘 `|`"7`|` P "# < < <2& @"`2& <"@@  <2@ H`"  "` "@@~`|2 P`|"  098|The %s command is unknown㿐     (T!' @c 1,@ x  t@W x %$ t t x'(T!$(T,@@ .@rEx   ` `t@hT >"hT@'㿘 @" < `@%@ 㿘@ J? !   @ =!@`?㿘;#p#p " JL@4 JL@2   @"   2J 099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0㿐"     @p[ 0B .@pU0< .@pP07 @@Rb 0/./!p.@ /@p60@g   /8 /@p#h0 @o /@@p@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end㿈`x  "`t0 @ 2u  /@o@n @ `@ ?"ؐ@  2 `t`_ /W``t /   E ` `t `" @   `_2   @   `_@  @ ?`t `#\#` #d   @@ 2  hT "hT / @oS 109|"%s" is not an abbreviation㿘`t (T  @`@Z "   @0@pw0 @(#)ex_append.c 10.27 (Berkeley) 4/27/96㿘@ 㿘@ 㿘@  273|Entering ex input mode.㿐  2`d` @}  & L`22``d `d`l ט  2ܰ Ö  2԰ ` E`     ? 2$ $@&   .2 ` "?`  @d[& /  ? `0 0@dK 2  Ę 2&`&`$@~`$ "+`| (€   ` @ @Pu $2` ` &$0@)b80b@@s& @)0@)b8@* `|!5! "! !*` * 8 2!< "!<!< "!4 !4*` * 8 2@ @ @+ '' @J_ 2! ``  @c  2 ` & L@d   & L @(#)ex_args.c 10.14 (Berkeley) 4/27/96111|No more files to edit㿘`x 2` ( "  2` 1J!"`|`x  (@. @  2 @z@zv a@[  2o `x G$@ $ "@  @ $$*@&$& (`x @Ԓ   & $  @mE `t@   $@3 $`@  $ $& (@S@ `| (@S`$@  2`|!  $ @TJ 2   "$ ( & ($(&$ 㿐 @g + @ `t@S@  `|2 @T   @ @ @ "`$"`(& $ &$ 112|No previous files to edit㿘 ( $@2 ` 2@m 5 !"`| (@V?@? 2' @<" a@Z  2  (@SG" `|!  $@Sǔ 2   (?& ($(&$ 113|No previous files to rewind㿘 $ 2 `| 2@l(   a@Z  2  $& (@S@" `|!  $@S 2 $(&$ 114|No file list to display %s%s%s[]㿘 $   2@l0Q  $ H 3 ()3@ ( `@  8?@   3`3 ` @' (3 0 8 (3 @ 8@' (T   @^l  2  (T   3@'` 㿘` `x @Y  @l  ``2`t@m@ $  @  "$@ $`@  $@(#)ex_argv.c 10.19 (Berkeley) 3/30/96㿘 $ ,@2  $&`t ,&`x 㿘 @' , $* @@ڔ , $* @* , $* @"  , $ , $&`t ,&`x x    "'(T!" x'' @" "c '쀢!  t x@" "W $ t t' x'(T!$(T'#\#`#d@     t@T >"T@-  @@  J@  @ `@ *J@@ |    t@T >"T@ echo x ` "'(T!" x'' @r"  '쀢!  t x@f" 2$ t  t' x'(T!$(T4aX@  '#\#`#d @& r  2@y  2T  3@y  M cd " c\`c\*` * 8 "ؑ*`:      2L L  L %@L  7L` `  ؐ@  2@ڐ   @ϖ   ?'@` ` t@T >"T@㿘x )"u$N  "i$ `N  `   'S  'R@ @[     ֤@,$*` " $ '`" @ @ "` @`   'S "` @ @ 'R@8 @@[[ 2 @` @,`ݠ ,, $,$&`t,&`x 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #㿐\d`'@+N #"^  % ! ? \"  5@     "(T t@(T >$(T x  t x@ " $ t t x'(T! $(T @Ӗ ϢL    @ڐ    "(T t@"(T* @Ɛ    "(T t@(T >$(T x  t x@ " $ t t x'(T! $(T @ @G`=&`( N % # !2    "(T t@(T >$(T x  t x@Y "_ $ t t x'(T! $(T @G C/ )    "(T t@(T >$(T x  t x@' - $ t t x'(T!$(T@    x 5 5@h  /'@%`# 㿘 `( `,?@&%`$`( `$ @_,  @,  $`$ @h `$ 2`(@mE* `$  @Ճ P$`(`$, 2`$ @Գ `$ "@ @hx `$, '`$, $ ` :&$  @ @  $ @hW  2 $$  ,  @hJ !  , `$, 2`$ @o `$ "@ @h4 `$, `$, "  㿘  $ "$ $ . @`"   ` " $@K@ $. @G@  (& $@@ $$ $$ ($ , 289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %s304|Shell expansion failedH''''#L  #D*` * 8  D  70` cX  `cP*` * 8'P'@f / '''@''Đ?''@h   7@g 7@b ' 7@h? 03 7@gl̀`@?"@/? @) @e @#@!@ 7@_  7@h@ބ @ ?  @@`#@ @DĀ:쀣` ` "(T t2(T >&(T@*  x  t@O x "H & t t' x#@(T!&(T*  @:܀ 3 '@"'.@`Ě'@( .@N  2.@.#@  @@0̀   7@h    @+k 2  N@  `"  2  7@f @ @(#)ex_at.c 10.10 (Berkeley) 4/27/96㿘`|  @`Q @ *2 . $ @2  6 . $  &$ "ؐ  #*    !@  `  2   `*` * !X  @V  @He 0g@{ 6`<$`<$`@ @s .`d"`@"`l" `P " `P ,`P`<"`<"`@ 2`<$`@" $`< @   ``@ @, @А  $` @f  ) `$`H$`L`*` @  `@``,`@   | $@  |"  " |  |$` @(#)ex_bang.c 10.32 (Berkeley) 5/18/96!!%s 303|File modified since last write.! 㿀`t` 2 ` `~  @@hB@ $  @e  `@$@2```9c@#@ ``9c@ @@!:`` I  X : !$ "! !*` * 8  $H  @S  "#$n $H "$@ $@*` * 8 2$$ "$$@2 $9c @j $ @ @)M`?;$ 2 `` @ @GY 0: @&``d  `l 2#\@\ 쀢 )  2#\&`l&`d #\`d`l@@& L$ & P L@ P$& P$ @2 9@ cH @(#)ex_cd.c 10.9 (Berkeley) 3/30/96120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s㷘  X "`x`|!2`x  J / :@d| `x  "`t0 :@@"آ@b@L  "J 2 :@dY @@cM 2`xM D`t@ /=` .5 ( @ @ .2  ` .2  ` /& %  `" %:':(`@"@c 2@@oɒ( Ő @e  ` :@e8 .㿘 ` "`%  "@@b @`  2 L@  :9 @@`L@ 2`2-L@ ;! @ǐ  @d # @꽐 $  @c   @+ @ *$ $  "% `L@ â` 㿘 ` "`$  "@@  @  2 @(#)ex_cmd.c 10.17 (Berkeley) 4/10/96 @d 8 0  L    dX   x ph h @      B    11  x ` XB  0      1       x pD 8 h H @v 8 @  " <<h`ZBX08)XBhH@*p8//xpDhP( 2v;hX  81 N,BxXPWT8@( d [BxpWT8X(PSH0XxƜh`dX 8` hd a4 hp@8a4 h(b| 8  H@mdq (n  o$1 hcHpXPwH8H  hx h`Xy@( $ 8xp$hX80   ZBXph\ X@8lL 4 4 hp@8x@ 80P8V; hh0( 8( t!/xPHth8 $ $ph 4$@(  $Hh@8  hreplace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnextedit the file containing the tag[Tt]a[g][!] [string]!w1otag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]re-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalswitch the current screen and a backgrounded screenfg [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, screens or tagsdisplay b[uffers] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangebackground the current screenbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.6 (Berkeley) 5/16/96  p h#  H 8 0$   %  Discard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd db-nameAdd a new cscope databaseadd309|Use "cscope help" for help㿘 $@   @\ " $@P  ,$@`t `"L  `` `-`"L  2L` L ,  "ؑ*`:    L  @Ӑ 2   C@[y CSCOPE_DIRS 㿐D@ "E @ҷ    "'(T!" x'`' @ "+ '@  t x@ 2$ t  t' x'(T!$(T@z`!D@\ "  J @ %s/%scscope.out8 @jΔ 2p `x "  0" `t @LC@Kc[  @=  S `t $DD@"@  @Zܔ= @- @ 8`4 @Z͔ . &`&` `@&`@- @ ` &@`" $``&`@ @@   @א cscope.tpath%s:8(D`E@U @> T@?` &`, @Z| _  @4 &`,@( E@[ J @3F @/`,* `, @ :2`J` 2`J@  @@{  #&`(`,E@\`#E$  @\`2$ @\` &`, @^ &`(`,"@  `,  @U&`,pipevforkcd '%s' && exec cscope -dl/bin/shsh-cexecl: %swrx''ܐ?'''@[ @[耢  E@[9܀?#` !0D E@Y?"@?"@耢?"@쀢?? @㔞@XR @XO @XL @@(E@z`E"8Eb@EH@Q  E@ZP@ @m@k#`$E@b`#` #`E@bh#` 310|No cscope connections running%d%s 278|No matches for query㿐     F@YhX   @Œ  $ $  @Ŋ ,  %%  2 $ " $ $ @   L P  ` !`?'"!+F` `@ŗ@e @=  @R@1^ 2 2 ` F@Y P $``| !`! @/ :   @.` 2 2 $$ 2$" $$@$`2$" $@`"    "`  L"`   P"`"  "  "  @  @ sgdct efi311|%s: unknown search type: use one of %s㿘`VN@N@ "` "`N@ JN`  D&F#J# "LLN@@" L & L 2LL 2N`@`*` * !X` @I N@ FF@Xe#n  `L    L  L 2LC@bV "% L "`L  `"ؐ  #*   `!@`  ` `@`2 ```  @q @K# @X  & &  & @.   *`&   @H *   .  cscope: %d lines%1[ ]%s: "%s"x%G#G(@` ΐ@ޖ @ '* b`@Wɘ??'/D(@l` @ '``? "`@f`?`" ? 2`*' @Yh "   "   @ڐ@  耤 \耢 "X쀤`"U@Ť@n܀ G@ҒbȀ 2 .   .@@  @È`> ($ "  @ݔ  /*  ' @@݇ $ ` $     $ $ $@x`$ $ @2 &"&  &??]'@  @W  `  $ "cܐ E@XG`@  8`( ""'%D$@@ 2 &@9'`@6  '@ '㿘@!%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 㿘`N@ @Hc8@$ Hc`@ Hcx@  H@cC p p " 3Hc @    㿘@s@  312|%d: no such cscope session㿐` $ `  @ `@```2 ` I@VM* ` "` @` "`@`@^ߔ @`"``"``@"@`, "`(@c`( @]@[ 1㿘   " #Ia "    No cscope connections. %2d %s (process %lu) 㿘 ` 2`I@ZbP0   %Ih @O  ` 㿐   @L 2 '''   @t   @.`   & & L& P L@z P 㿘@C p p " @t    㿘 > ``? "`@E`?`" ? >2`?2` % `? "`@)` >`@"@ ``? "`@` `@"@ 2` @(#)ex_delete.c 10.8 (Berkeley) 3/6/96㿐  2 `|` @@7V $   `Q`d`l"  2 `d`l  2 `d& L@K 2  L 8& L @(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstags㿘`t c"`t s b" `tF` $ t"2`t@`  :J@TbH 25` @F6  +J@EbP 2&` Ր'`t J@5b` 2` @  J@&bh 2` @,` `@6Ô  123|No cut buffers to displaydefault buffer㿘 a@ 2  a 2  J@T0\!@ "( # bؐ  2   @]  (T D  @F  2 (T 8 2  !@ "' # bؐ     @4  (T   @Fo  2 (T  2  ! J@ ********** %s%s (line mode) (character mode) 㿘2```*` * !X  @D`` K!K!K@ea``@1%K``"`` *` * !X  @D @k (T   @F    (T  2 @S@@2`@(#)ex_edit.c 10.10 (Berkeley) 4/27/96㿘`x  "`t0       @: 6  @9@-  `t@B9@`@`!@`|@A a 2 `|!,@:c 2 $(&$  㿐 @p 4 @ `|2  @:?  @ @p  "@ "@"   6 L"L P"P "`$"`(& $ &$ @(#)ex_equal.c 10.10 (Berkeley) 3/6/96%ld 㿐  2 `` @@54  @ @I   `d'La@n @(#)ex_file.c 10.11 (Berkeley) 5/2/96㿘  2 `x` @@5 .  & " `t@w2   @Ax @  $  ?#? @`4  (@@ L@UC  @(#)ex_filter.c 10.33 (Berkeley) 4/27/96piperfdopenvfork-cexecl: %sfilterforkwparent-writer@'''''''  ܐ  ܒ 2@a  '?''''\ @S ܒ L%@S耢 ܒ LL@Ȓc 'ܒ L@S)?ܒ L@RH?"@?@ @쀢?"@쀢?, @䠀?"@P @P @P ?"@?@@@X " PP*` * 8@Pݒ /2X " PP*` * 8X " PP*` * 8 L@J& X " PP*` * 8ܒ L@S@ @ۗ@ە\ '@یLcԘ@E   '\ \\      `X @R*`X? 0"ܒ L@Q@W@UY @QL@c2#\@ȼ  #`Lc@6F @ȱ@;\ @l  'Lc̘@   '\ \ܒL @   '\ܒ (       '` @G܀ ?  `X *`X \  @ ܒ@ 2 2 filter read㿐 @1ݔ 2`  (T   @C   (T   4 @  ` @ N@Pєx@/ @(#)ex_global.c 10.20 (Berkeley) 5/3/96㿘`|2@ 㿘@ 124|The %s command can't be used as part of a global or v commandppx  2$` @u @ `  N@PP `x "$` `t'J`'J` ܀ `J`"ؐ@  2 ` `\`|` ` `? J 'ܒ J   J 2#*'*J \J 2ܐ 'J \  *ܐ 'ܖ *ܐ 'ՖJ@  2$  @2: 0@2 L    @f  " Lְ   Ę @\  2ΰ  &  L' P' '@OB  2  @) `<$`<$`@@D܀ 'N#'ܐ 'ؑ* @֟  $` @Oܔ  `$`H$`L` @$`D `P  ,`P  | $@  |"  " |  |$` `d`ly d`<( (T 2@  @AҖ   (T @`"``"``@"@@`@ɐT@p  d @Dl؀    ?? ܔ @ `  ". `@"*`@@! `@  $  @  @OS " $ $ $`@$ `<2`@$`<"$`@(@p  㿘``@2  g  @O+ a  |"] P T<<"P$D<  F `2 ?$  ?:$ $   5$   $   (-2 $@ "` 2 $<"@@!@ $`  $` $ $@$`2" $@$2 $D2 P @(#)ex_init.c 10.22 (Berkeley) 5/15/96㿘 @$D2&`$$ $  $ $ $   $   "@Q0 $  @N   @&   㿘 `2$)  @ @@ [ 2 `4 "` @ծ` @ը@( 2 ꌐ 2 @՜& 㿘``< 0@'/etc/vi.exrcNEXINITEXINITHOME%s/%s.nexrc.exrcؐ!Q!8 @|  2 !Q@Ē!8 2 !Q@!H" !Q@x!H @ʚ K @!P" Q@h!P @ ; @!X"9 L@ 48$Q`Q@Ø!h @9  "$    8$Q`Q@!p @!  2  8@h 2c   |  "$$&2W ! "! !*` * 8 G "D 8Qh @ "2   8, 8Qp @ߘ 2" 8@<@Q ap@<@ Qah@ "     |  " Ő X#\ 5   @. @ij@.4@E㿘 `|   @~ 2`| @MD 3  $`|" $`|`|$ ` $ $ `2 $ @qҔ $  `$ $ @t@q’ $  $   $  125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner㻐@n  @K ` "` `" `` `?`  t @Q@ / =@X$ 5@Q  R 8 Rp R@Lj ,   ` `t@hT >"hT@Ӎ   R  R R@@L<    ` `thT >"hT@_ @(#)ex_join.c 10.9 (Berkeley) 3/6/96131|No following lines to join.?!㿈  2 `d` @@.! . @B   S@K!    "'(T!"  x' @p)! `|  t x@p! 2$ t &`l t x'(T!$(T`| "`d`l &`l`d`l@ `&`l `d`l   @@쀢 쀢`    "(T t(T >$(T x  t x@oז " $ t t x'(T! $(T @oŖ |A `|!>쀥  쀢 5J  /' '`J )"S"(@ ,@`  ,@`쀢  J   ' `'쀢 @?@  @J $@?"& P " ?"& Pi`d& L`d`l@ @@o  @ @Ar$@    ` `thT >"hT@*   ` `thT >"hT@ h `l`d"@  & h @(#)ex_map.c 10.9 (Berkeley) 3/6/96132|No input map entries133|No command map entries134|The %s character may not be remapped㿈`|!  `x  "`t0@mm  2 `TT#@#`@J  @ #B` bؐ  :`     "ؒ` @  2` @ '``t `#\#` #d   @k@ " X ( `t @`IG 26`t  22`t `   'S 'R@ @;{   " `t2`t `*` * !X  @:  T@J  `#\#` #d   @k@135|"%s" isn't currently mapped㿘`t `|!  @@l  2`t   U@K#p @(#)ex_mark.c 10.8 (Berkeley) 3/6/96136|Mark names must be a single character㿘  2 `t` @@+ה  `  @ @`d@H  U@I( @(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96.exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s8`x  "`t0 U #@8`|@`|! @  V]&@!RV@`8 $#@E $V@@l 9 $` @5 $VP@l  , $` @( $VX@l   $` @ $@ZH  $` @ $@w  $#ܐ V@JP` #@g $"#ܐ V0@JB @(#)ex_move.c 10.9 (Berkeley) 3/6/96X    ` @@+ : `d'`h'`l'`p'̐ؒ @Ӕ '' В  ؀  Ȁ /`T''ؔ @^p   Р"@& L& P[139|Destination line is inside move rangex  2 `d` @@*  '`h'`l'`p'`T@ @  V@H `T  8   '"  8    , @@Ւ 2     "'(T!"  x' @l! 耢   t x@l! "İ $ t t x'(T!$(T"@@F &@?` @=܀ 䀢@ld䀢 @#ܐ @=܀ ~  8   '" "$  2 @=W eǐF ?@ @<И܀ R䀢@l!䀢 H@ܔ` @=܀ :"  8 "  '" "$  2 @=  Ő   ` `t@hT >"hT@ؐ& L& P  8 " l  '"   @? 2  l& l @(#)ex_open.c 10.7 (Berkeley) 3/6/96140|The open command requires that the open option be set141|The open command is not yet implemented㿘" " " "*` * 8  X X@GE @(#)ex_perl.c 8.6 (Berkeley) 3/18/96306|Vi was not loaded with a Perl interpreter㿘 X@G&㿘 㿘 @(#)ex_preserve.c 10.12 (Berkeley) 4/27/96142|Preservation of this file not possible143|File preserved㿐  2 X` @@)  '  2   X@F8  X @^ 2 @= 2 @_<  2  X@F͔h 㿘`t@5f`|@4ؒ a 2 @-" ` 2``|!  $@- 2 $(&$ @(#)ex_print.c 10.18 (Berkeley) 5/12/96㿘`|`d`l@7$ 2 `l& L`p& P 㿘`|`d`l@%" 2 `l& L`p& P 㿘`d`l@`| 2 `l& L`p& P %6ld TOOBIG x  2 ` @@(k U PТ"?Y "'䀦 Y @''  @ 25  @;܀ ܀  $2 Y@a  @ 2  (T   @84  2 (T 2 " $㿘 'PP$@ 29  (T 2   @8   $ (T 2 $ YbP @ "   (T 2   @7   (T 2 Y@<a  [ynq]㿈'" "" "*` * 8 Y  Yc'  @P 2J @ @:l쀢 2A ` @= 27 ` '` "   @) ^ 2#  (T 2   @7  Y (T 2 Yc'  @  2 @ %c㿘", ""$ "$*` * 8 2$# "#$# " # #*` * 8Z!h-Y@ *`$( @% 8:m??h` @i (T a  @7#  2 (T 2V& `*` * !X  @5  *  * @ a]@5b `2-? 8@'@N' @E" @  (T   @6ږ  2 (T 2 &??2 82@& 㿘'L'P'T'X$<<$"@ @[wL$<$$< L ; b@%㿘`  $ @$< $$<@* <` `  N@ 2$<@㿘 $<  ( <$$< @(#)ex_put.c 10.7 (Berkeley) 3/6/96㿐  2  L` @@&S  ' P'`|  `Q `d@Yݚ  2 & L& P @(#)ex_quit.c 10.7 (Berkeley) 4/27/96㿘`| !@2& 2 @%K `  $$"&$ @(#)ex_read.c 10.31 (Berkeley) 5/8/96!!%s ! r%s145|Only regular files may be read146|%s: read lock was unavailable `x   "`t0%&   @ !2 `#L   #D*` * 8 2 `  #D "  ` @ @   @) ؐ @* 2    ΐ`xɘ  2 `x?` `   "`t@ʪ`t,@@E $  Ȕ $ `@"$`t,@[b@$`@ `t,@[b0[˒b$`2$@&$$ "`t (€  ` @h $ &$`t,@ #\`d @ 2 ` @&`& L$ & P L@gy P  H  2 `x 3  `t/@C   !  @g"  @  "  ?#? @2 ` 2`(@@1o `t@ @$C [@t@bȠT @   [@C/ <   @ [@B 0  T @1R  [@B`d@ `d& L `& L 147|Reading...148|%s: %lu lines, %lu characters㿐    ] x@#M .`@Q d  (T $  @4  ` (T ` @?h    4@7 8Ϣ` @1@ 2, 2'`/ @G( ]@B    ` `thT >"hT@=   [@CB@\ `h  @(#)ex_screen.c 10.10 (Berkeley) 3/6/96㿘@ā㿘`x  `t@*㿘`|       `   ` `@#ݔ  @_`X149|No background screens to display 㿘     ]@A0Q  9  (T 25 -]+]  @3  2  (T 2&  @ @  8?@   "  c `  (T Ӑ (T   @3   (T ]֒c @(#)ex_script.c 10.29 (Berkeley) 5/12/96150|The script command is only available in vi mode㿘$   ^@A+h `x  i  @@ tcgetattrptyforkTERMemacsTERMCAPemacs:EMACSt-iexecl: %s㿘 2@O 2 @DZ 2&  @@  $ $ ?$ $  @NJ \?2 ` ^- ?$ ` d ?$ d `h@ʒ T?  ^   \@ T? ^ @A?$ ^0W ^(@@ ?" @y ?V @sH"0^b8@CK ^"@^bH@CE ^"P^bX@C? @>0 `a@K @Y  @?  @?  @? @N #X " #P #P*` * 8@?M /`^`@8  ^@Ah@ @! 2  $  &$ hT "hT selectError: timed outError: shell: EOFshellhА @1  ''  2`* ` * ؐ "    @ "  ? $ o _@@@0~$ $ @Ô" ?  _@@X0l _@?p0f) `   'S 'R@ @1.   2 @6̀ H ̖@5$ @  * $@Δ@a'"'  Д  @x " ?  _@?80$@6ỳ   ̖@5E @ @.151|No command to execute x@6V 2  @4Z쀢 2߰ @-耢 8耢 6      "'(T!'   @c䀢   x  t@c x " $ t t x'(T!$(T@< @3܀ ܀ ~  @ޖ耢 @  `@?Hi "  ''  @ȵ@ `  ``h@Ȫ  ` $ "cܐ _@>pE B   `"hT`t@hT >&hT@`x `t@c`x "< &`t`t`x'hT!&hT 䀢 @b䀢 & @@ɺ@5     ` `t@hT >"hT@̐p  В @ ''``  `$"  2 * +@ؐ "  4 2$ Д  @$? +  ` _@>X8" `' `$"  2`*  `?ؑ: "@  2 2$ `@5 ̀ 2˰     "'(T!"  x'Ȑ @b]$ #  t x@bQ$ " $ t t x'(T!$(T  `@Ƿ$?  @@  _@=p| ' `   'S 'R@ @/#   2 $̐'̐ @3z V  * C$@Ā Ā &'a"'А @ `2`* ` * ؐ "`   @] @ȝ@1 * '̐ @32  ̀& L& P& P@{    ` `thT >"hT@Ĝ㿘  @đ@ $  @=Q   @R$  * @D   1 - * K2K %? K"? " KJ@`" KJ@` ?ؔ  2" script-shell㿘  $*@&$@ ?" @ ?"@ƼbX @ @ @&     "(T  䈀 "(T 2(T"(Tttypqrs0123456789abcdef㿘b@,#P ? b#XJ#X Q]#X-b ,M` D` p, ,  @_   t $#܀ 2/:?@:,@;8@;=!@:c @E ?&&@@zВ @=є  `g@0 @<L  p M 2  $ "cܰ?@(#)ex_set.c 10.7 (Berkeley) 3/6/96㿘`x  ` `t@G  0@K   @(#)ex_shell.c 10.33 (Berkeley) 4/27/96%s -i㻘 2@J "#X!    #P*` * 8#P $c@$3   @ $@ &$ vfork-cexecl: %s㿈'' 2@J  d  `(€  ` @@ q d #d c^bPYcUbPt@=` M c@;XK  cX " `cP*` * 8cP@: /2 cX " cP`cP*` * 8 cX " cP`cP*` * 8 c`@3Ә  cX " cP`cP*` * 8 c@<h@  @  waitpid%.*s%s: received signal: %s%s ...; core dumped%.*s%s: exited with status %d㿈! $#d$#ܐ@C ? #܀ "$#ܐ @;D`   M K  HNN " "@@/@}@[ ` `d d #\ d d #` d@; €   ` `thT >"hT@+G  2C :  >2= NN " "@?@.  `d d : #\ d@:Ę ~   ` `thT >p"hT@    xhXH @ 0  pX@(Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d㿘 d#@  ``1  (e@0 @(#)ex_shift.c 10.10 (Berkeley) 3/6/96㿘@ 㿘@  152|shiftwidth option set to 0㿈   ` @@ h #p " #h #h*` * 8  f@9vT  `d`l`  2L `t' J " #h #h*` * 8`'J` >"#p <"#p    "'(T!"  x' @]! `d   t x@]t! " $ t t x'(T!$(T`d`l@   @.쀢  쀢 ; + J # J % # " # #*` * 8#   #*` * 8#@$@쀤    $@  L" `    "(T t(T >$(T@ x  t@] x " $ t t x'(T! $(T@@\ " #@ "` ,#    #*` * 8#$@#  #*` * 8@ `,  @}"" @.ږ"    ` `thT >"hT@9  L2` $ P $ P " & P`@$ & L& P@\ P   ` `thT >"hT@a p `l`d"@  & p @(#)ex_source.c 10.10 (Berkeley) 4/22/96%s8`t @ɔ &H@: CȀ 4  $  @ $ 3"c@  @7 `@2 ,@@̲@ >`Ȁ ̀>`Ȁ̀ $ "c@ g@9   ̘ c @(#)ex_stop.c 10.10 (Berkeley) 3/6/96㿐`|!2  @&   2  (€    2  @  @(#)ex_subst.c 10.30 (Berkeley) 5/16/96㿐`x `t  L   2L@d`"ؐ   \2.  M . L  \L" ,@2 L  \  ,@ ` ,@ `L  2$ @? ! @#     @j  2    Ę @_  2  Ȗ ܘ @U  2  & L   %L"  "& @$& & L    L   Ѡ  *`:  ~  L      (T!" x' @Z   t x@Z " $ t t x'(T!$(T L  \L"N M2%LL  \> 2L  ,@ `6 ~24 "D    "<*` * 8"< 2$   ~2 "D ""< "<*` * 8 2  "   @W  @ ,@ `(&  @t@ &  @64   ` `thT >"hT@Z  @$   ` `thT >"hT@C@㿘 Ȁ 2$ @  @2`x Ȕ   @>  "`x   `t @e 㿘 2$ @  @2`x    @  "`x   `t @< 153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match foundp'L'  2 L` @ ' P'! " !| !|*` * 8  . . '  L J  j!t' $# ?* :  i* ,<<<<<<<<<<$\px`\ a&`\`\?]&`\mL$L@M LJ@ ܐ'L܀ "  i i Ȓ  `l&`d`l@&`l@+I .L@+s`l (L #  `?. $  @ '' `?.    '쀏 $@  'L`'LJ` 2$ LJ 2 ` `2 $ "$` ` $ "'  `쀠"' j' ' ''''`d`l8-  (T '  @&[   (T  L@)  H  E   "'T!'/ '   "TtT >&Tx t@X4x "@ &ttx'T! &T@X" IL@'L ' '    ?  ?(L   @;`(`׆ '܀`D  2A $ 2= ( 29 , 25 `  @`   !'  @Q  @ ' @3  "'L @  '  "& L''$',' 2$''$ 3 ' '& L& P@U  uj``@8 @͔ ؔ @%l e ")  r @'Km иȐј b y [  @O( ?  /䀢 qL  y"N& L  (@ B   0@ .  (@ B  2 a`(a (@ B @ '  @  @$ ' @2֔  L @,, ['' hT ("hT$& P  @ B   0@ .   @ B  2 a`(a  @ B @ '  @P  @ ' @2  L @$$ ' L  @  ',$@Ī   `+@    !'  @   @ ' @2D  "'L @@@' !   /  @(4" I    \ & \  " '$ &  @(x 0 L@& (   "TtT >&Tx t@V-x "9 &ttx'T! &T@V BL@'L"'  !'  @}  @ ' @1  "'@L@'  ` ˨ 䀠`+@    !'  @A  @ ' @1z  "'L @v@'     /  @'k"     \ & \  " '&  @' i  X& X ` & `2 'Ȁ`2'쀠" '''̀'ԐЖ˘$`ЖØ"쀠ЖԀդ  L2& P P& P L@Uh P܀ `쀠` @&`@k  $@  j@0۔x !   ``thT >"hT i@0ð 0  @װ 0 %'@ @㿐'H`S ! "! !*` * 8 2`! "!`! "! !*` * 8 2`!䀢 "!`!䀊 "! !ܑ*` * 8 H` H "ؑ*`:   2JJ  J "`` $@ `@47 $*@&$` $@ @4* $*@&$-' `@n&` H@6 2N ``H@ @I 2? @qH&@TH $&H@     Ht@T >"T@0H` `2 @t `$ &$`$ &$ [[:<:]][[:>:]]㿐@  @ *`:  ["d"D \ *^ ."]"Dl ~"@"Df`L@ <"  [ *$ ."#"DX [ ~ >" O""DKI " "< "<*` * 8 2=`% "D " "< "<*` * 8 2-`)  ""< "<*` * 8 2 ` "`  "D " "< "<*` * 8 2` `L@  @  &    (T!"' @S @ x  t@Ss x 2$ t  t x'(T!$(T@ @  ~ \*`:  ["y"D \ *s ."r"D @ ~"Q"Dz @`L@ <o [ *0 ."/"Dj,* [ ~ >" oa," "D],bc@ X  ""< "<*` * 8 2J,. +C,"D ""< "<*` * 8 22,2 @ "/ @+, ""< "<*` * 8 ,  @  ,"D " "< "<*` * 8 2 @,  @, `L@ o @,&@ & ^.[]$*㿐&@@Ґ     (T!,,' @R  x  t@R x 2$ tQ  t x'(T!$(TJ? / ?*?J $  *L@ / ? ^`L@ ^,`  @ )q \`\  `L` / ? ` `@lKL@ " @,  @,` L@  @ $, ,&@ & ([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*㿐 @   "` L  @$`*` *   *      (T!" x' @R   ^  t@R x 2$ t=  t x'(T!$(T ^,@q`bX@ `@ )q'q \` x"X@   @kN ", ,  N qbX@ה   $,, &@ & RE error: %s㿘r`@ܖ @1 @-n 0 @Ζ rh@-c@㿀'''   Ů@7L&\9 "D ""< "<*` * 8 { ) & t " Lڀ`Or!ܓ*`@(((((((((dddddddddd(((((((((((((((((((((((((((((((((((((((((((((((((((((("D   "<*` * 8"<   L?Ц*@ ?*@  ?*@`?*` ?*@  "@??@ `   'S 'R@ @ܐ   %`  @2 `&  耢 2 @>*` @œ*` &  @,w  耢 "&   &  * )"@'`"  ` 0`` 0 ؐ   # ؐ    *  @ (`@@{` @,- `M@-??`      `   'S 'R@ @I   '`  @2 `&  耢 2 @*` @2*` &  @+  耢 2 & W  &  * )"@'`"  ` 0`` 0 ؐ   # ؐ    *  @ (`@_@` @+ `@-2AL##' @(#)ex_tag.c 10.32 (Berkeley) 5/16/96X#\ 9   @ - @Ð@ D@ $ > &$ 158|No previous tag entered㿘`x . 5` "`t@~`t@- $` @+<  #Ā " # #*` * 8 @``*`   t@+ @g@`"  @  @= j $ $  @5 ,b  $$ 2 $ " $ $   L P   "`|`!2`| `| !`! @  <   @  4 @2 @$$ `2@$`" $@@%% `2@$`" $@ ` @^ `"    "`  L"`   P"`"  "  "  @Ґ@͐@s 282|Already at the last tag of this group㿘 2  @ $  @2 `| u@*o0 @R "$    ~ ` @  255|Already at the first tag of this group㿘 2  @p $   @2 `| u@*3  @ "$    B ` @  㿘` 2 `@o` &`` @ @ʔ  2 ` @ 2  $ >(&$  㿐` 2  @F` $&` @F 2< @  `@ 0` @ @ @ @Gn  "@ "@`"   2`` "`$"`(d > "d& $ &$ 159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]㿐 @2`x @ f   "`t0WX@@^" J `$P @ `2; u@)J9 @@@"   '@( /`@ 2@2 @ v@*d( 2`|  @f`|@ 㿘 @  ``|`@  @0  㿘@   @  & L & P@  2)   "`  "` ` 2`  @– "$ (&$@@  2@@@2 @ 292|Display too small.%2d ... %*.*s %*.*s*%s%.*s 㿘 2 8 @ʔ 0 " v@(x0|  (T wv#Ȑ  @   (T hfZ@ vvcה`Ғc` 2`` @  ?vc   vc  2v㮒c@!`"v 8?• @  8?݀8vv#Д#ؐ v㈒c@@2 (T  㿈 B`@ ^  & @ 2U  "`" "@" "@"` "@`"`@2`$@"@$`Ð "@"쀢 "@` "`` "$`   " @*> $` @'   㿘@^ 2@ @'  $`$ `$ ` $ `$ @*` $ &  㿘`  ` !@8 @'u  @ $ $ $ `  $ & 㿘`  ,` -` ``$@@ @'L  @`  ($ ` "& `  $ & 㿘@` `"``" `@"@@]`@[ 㿘`` `2&` "`2&`"@@> `2@2@`$ `"``2`@$@"@@& 164|%s: the tag line doesn't exist165|The tags stack is empty166|%s: search pattern not found㿘` ` `  0 x@(0  x@&0x@'0@㿘 | N@   / &@`()`@X  @& $ @N` $  @&   @ @ *, $ $  "$ `N@ ˲` 㿘 K@ 0 `  @ 㿐N@bؐ  " @WH'@ 1# '' @E @% (,  @E  ( , ,  P   & & L& P L@J| P 162|%s: tag not found%s㿘@U @/ !J & &  & & @:   @J     ,     2)&  y@'@` 3 $#y   2  &cܐ  @'bX  ,  2 @   163|%s: corrupted tag in %smunmapclose` @Y  $#&`  @Œ  $#\  ̔  @c?  $#&` @M۰ @@+ 'J@ @` '@J@  *@' y@'#  " @     `"@>@*3'`@*. y@%!     t@T >"T@D    ` `t@hT >"hT@/@pe =@P.@@  @`. ($ "  @$  /*  ' @@ $    $ $ $@ `$ $  2 &"J& @s[̀  y@$@z  y@$ %s/%s8'N /"@K `@#l /,@$z`@~N /,@@5 `@&'㿘&2  : !L  *L0@8 2&2  :  L  *L㿘@  ?"    *N뀦  "@ : J @ (8 *8"  ?`J @ J@  @J2  @  J@  ` @(#)ex_tcl.c 8.9 (Berkeley) 4/28/96302|Vi was not loaded with a Tcl interpreter㿘 {@#ڔ @(#)ex_txt.c 10.13 (Berkeley) 3/6/968@  8$ j  6 " @$$ `2@&`" &@ L $  T   L  @t 2p @t   b*@a %a \* | +ؔ @ Q?  *  tV @|R     @G "2 $ ?`|!@*`@Hppppppppppppppl쀊 @  `  @J? \$ $   @ @J? .2 &` "` 2 &@"@Ȑٰ  y р  $` @sc 2ð @    @sW  @$`$ @2`&@"M&`  @2 @  @~2| {@(  @  J  2 `@ *J  @ $  *@ * a?  " @%Ӓ j  " "  ," 04  @''  @F "K ' @r  ''   @ |€ $ $   @ؐ@e 2* |@|€ @&Đ@"ؒ@ ` 耢   $  *@  %c%6lu %.*s㿘}@[ڐ!" "" "*` * 8 }  }!@[`"}!`@[`@/!㿘# " # #*` * 8#p " #h #h*` * 8 `@ `J 2`@$@ `*`@$@  @$$@ `  `@E` 2&` &` &` ` &``*@    ` &``?*@ @(#)ex_undo.c 10.6 (Berkeley) 3/6/96㿐 L' P' '@   2,   X @2 4 @, X $ 4 4 "  @s 2   $ 4@    $ 4@& L& P @(#)ex_usage.c 10.13 (Berkeley) 5/3/96To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" 㿘~ya~ua~qa~mb8~ibx The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s 㿀`x ` `t "ؐ    #* * ;#p#p "@@@z  "@`@ 2@ ``!`  `*  *~b 0o~c``=!Ѐ@ @c=!Ѐ@=`!А~c``0S;#p#p N (T I;#p  @  @ (T ;@2`~##0! [/@J *`@ `/@ / ]/@ / ` * @~c8 ۋ``@   (T 0@e The %s key has no current meaning Key:%s%s Usage: %s %s 㿘`x i `t  ` `@  `t ~/ [ ] ~`t # ~, # "# #*` * 8 ,  !, Ɛ"@  2 `*` * !X  @Kb U J  "`"hbH  C  (T = #Ʋ"  @   ~ (T - ~, # "# #*` * 8  a,  a,  Ȓbp  ~4   (T 2 ͐@ @(#)ex_util.c 10.21 (Berkeley) 5/8/96㿘\ @9 .`* ;cp & & `& d& l & p`& h |!6 |& x & t$ x t( "@"` x" x t( 㿘  $"#ܠ 4' $8   4@CJ8 "3 $44`? &`@m@`&@ @`  ܀ 2 $` ?6` ` 2 ,@2& 2&  `Ġ 167|More files to edit; use n[ext] to go to the next file, q[uit]! to quit㿘`2  0  ,@"  ( "    & 0 @(  㿘 (€  ""  " "  " *` * 8& 4!` " !X !X*` * 8& 8$ ? &$ 168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s㿘 W".@$8Th| ?  @ 09 3А . @@0' "p @0 @0 @0  0 x @@(#)ex_version.c 10.25 (Berkeley) 4/12/96%s Version 1.66 (5/18/96) The CSRG, University of California, Berkeley.㿘`p͔x @(#)ex_visual.c 10.12 (Berkeley) 4/27/96175|The visual command requires that the open option be set%luz%c%lu%luz%c 㾐" " " "*` * 8 2 `d @+z  " & L`| (b  - @  ^  ( +  . L"` "  L@Au P ` -2``|  !X L@v`X!h@v L @D `|" @d" 4$b2 $ !   @+! $`2$@&$$@"$  &  @ "@'@{ 2  2  =ap ? &$ @(#)ex_write.c 10.25 (Berkeley) 5/8/96㿘@h 2  @ ޒ 2 &`x㿘@S  2 @ ɒ 2 `| ! `  $$"&$ 㿘@2 㿘  2 X` @w !  @  2 @  2 `| ! 2  `$$"&$ ! 㿈  2`|` @ !  `x u`t *`:   2`x L  `x ]2\`xL !2X`x#L "#D #D*` * 8 2`     ` @ *`:   2L L  L ` ` @-  2 `t  #\`d`l,@ 2 $ @2 =a `x "`xL >2`xL  >2`x`  *`:   2`x L  `x "`L  ` 2``d`lP @א; 2I `x 4  "`t/@   !  @@"  @  "  ?#? @2 ` 2` (@`@  ` Y   2``d`l@{253|Writing...%s0\` `%'@   O!L @ d  (T @  @ 3    (T 4  @?h   @ט ? @b@27  ? &`&*@  @  @  2 V@  <  @V 2  @j 2    X  @@j  `h  `%'@@(#)ex_yank.c 10.7 (Berkeley) 3/6/96㿘  2 `|` @     `Q`d`lf @(#)ex_z.c 10.10 (Berkeley) 3/6/96---------------------------------------- 㿈  2 `|` @m   "$T `X " $L $L*` * 8? `d'`| (• @& @  \`2(_ V`, 쀢  "   &`dS`d( " &`dM?4 쀢 " &`d&`l L' P' '@E 7`?4 쀢 " &`d?&`l{ 2: l`&`d&`ln 2- _`  &`d@ ' &`d?&`l` @쀢 2 `l쀢 8&`lG 2 2& L @(#)exf.c 10.35 (Berkeley) 5/16/96/tmp㿘`1 0 0-  0  @2 $ 4 "` 2 $ 0"@  @@@d 52  @  @g `# @dΒc؀  0@  & @ @O   0& 4&  0@2 4$ 0"$ 4%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only ``   ?#ߐ @6`@4` 6` @7 \2$` @ w $`?$`H$`T `X ,`X `@zx S @'w 2.`!x  x !p*` * 8!p $@rx@rx? @ǔ`@` x` 6`@G  &` ` 2` @> &`` "@ @ @qx`` *$` &6`  @cB  $@ 8 " x$`<|$`@$`D<  ,  @ᰐؒ @i  /' (T2   'ؐ@/` `L'@ $`L @S ``L' `X ,`X@?  ! @gژ؀  $` @| @ 2|`@ 2v` "  `" ` 2 `@   ` 6`@( @" V``?# @6` ` @`H@ "  "  `!6` @)$@`  `@L<   (    (   @& @ $@& & @>$@ @&$2 "` @&`` " `X@p@` &` `X "`L@p`L`L "`@$`L`  @@Ȑ s -c option㿈 & L& P ! "    2$@I L q L & L& P@! ``!     ^J$! $  @+ L S L 2 ;  ` " !l`& L  & P$ &$ " !d !d*` * 8  0  @ & L  L  @ 쀢  & L& P` P@` `& P L@;u P P& T L' P' '@D 240|%s: remove241|%s: close242|%s: remove243|%s: remove㿘`" @? &@  L$  P$    64  "3`@p'   @@ $   "!&  0 2 "4 "` 0  2 "0"@  @@ݐ& ` `"@    @ؖ@ &@C @@A`X 2`H`L " `P@o  `L@`P " `H@o  `P@`H?"`T@3`T?"`L@-`L "`P@`P @@ 244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters257|%s: %s%lu lines, %lu charactersappended:  @a%      " "" "ؑ*` * 8     ?!@<!x >$ " $| $|*` * 8 0 @w+   !!Ȑ Ŕ @w 2 !" @R  @w  "     D <@  @@   "@"  &"  @#  !0 " !( !(*` * 8@  " @vŔ! \   @   @1 ""@cL ` @@  ''@  2} '#\#` @vn $ D$ <$ @$ D` 2[  @ 0R?# @ 4  `X *`X   @4?# @4@|   | #p##\ H@e|    ` `thT >"hT@ 258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner?b?   ! $$#ܐ @uє 6#܀ :` #\     N N  @K 2D    @)8@7 `    ?(T!?#@"@ *  2# @8 ? *  2 x  t@7 x ?$ t t?# x"@(T!$(T   %`%2 LL  %" * /" * L    %-@ d-``-`@]!h ,@@] /,@` ?#@a   @Dg@ @40@^?#%@@"@ p@m @t )*<    @xxa?@X@  @kT? 6  @`I?$`@tӔ!?>#@  @+ :@ D "@ @ ݀   ` `thT >"hT@+ ?@@l@ @؀   ` `thT >"hT@ 㿐  @   `4 1J@ /-J` *)$!&$ " J@ *2  (J` /& L' `'  @M 262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override㿘  2 X8 2!$ "! !*` * 8 `   `@    4`2 !0@  @E264|File modified since last complete write; write or use ! to override㿘     X   ` @Ԕ @265|File is a temporary; exit will discard modifications㿘  "    @"   4  `2  @@ 266|File readonly, modifications not auto-written㿘  X !$ " ! !*` * 8 2" "" "ؑ*` * 8    @i    㿘 `@` & @ߐ &  @K 㿘"8 " "0 "0*` * 8 1 $&#ܐ@7  #܀ #   @(#)getc.c 10.10 (Berkeley) 3/6/96177|Empty file㿐@`` @Ԙ    @  ` `"&`@j` "&`&` &``` .` 㿐`` ```"*` 067`3@`&@ @Ę` @?&@ %&`&`` `"&`@jJ "&`&` &`&`` .`?`@2`  &` &`` @.`@} 㿘` 2 ` 2  ` "  㿘 "`  " " 2  ` "  㿘``@ *`@=8<=8<=@ '@&@ `@J`  @ '&@` `"&`@i` "&`&` &`` `  ?@    &` &`?&`` @.`@| 㿘 "`  " " 2  ` "  @(#)key.c 10.30 (Berkeley) 4/3/96079|No non-printable character found㿘  @)b0@l @8  @4  @0  @, #^!]#h`0 @X0,R#h`0@:  ,R   *gS 2 R "ؐ ` J  ",p` 㿐 h % "]#h#h "@ ` 2`"@@ 2 `@ ]h^0*  * 0* "@  "0㿘  *` , !X@& ,!] ,@`2   㿘@ 0123456789abcdef01234567+g Ȁ" (( 8 "   g(    " xx(( 8  g   g   g؄H g g*`  g؄ 2 ☄ ^* g g@ ?*H  ☀"␅(( 8 \!* \* g0*   8 ؆ g8  (`2 ?"* x* g  0 (`  (` " (#㿐/^]ch0 @!0  㿘 !( !! ! 2 !!! "-!!("! @`!@ `? @ @ "!Q ! ."* #H!!*"@ *`+ "  @ @v* $!!$!!*`" * !0  `"$ @$`$ `$ ` $ `$ `$ `$ `, `   'S  'R@ $ $ , ՠ  㿘`  ` a  ?aa a"@ ? @@a*`" * a a*`" *  $a` 2#@,` $ @, ``   'S  'R@ 5$ $ ,  0$`$ `$ ` $ `$ `$ `$  h` ب   @2v  A>T "x. 2g x1 2^ `?` #Г*`@GHH4H4GGH4H`   @GC   hT "hT^ 25 A22 * "@*`@ ` `@ &@`&``&`` &` `&``&``&`? $$ $2Z ` ` 2V ` "S ` ` `  2  !H `: "G `   #\  @/Ԁ 3 $ "# #*` * 8 2`t q ` 2 !! ! *` *  8 ! *` * 8*` *  S* & ` bؐ  2@) a@&@`&``&`` &` `&``&``&`? $$ $"   bؐ  2  a.` &` &`.`} * "@*` @ @0 `? " $$  $  " # "" "*` * 8  I E  @7 xؔ  2    (T`"(T &`     " Ԙ  2&    ˘   * "@*`b@     "       "P `  㿘   "   @$    @$276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event287|Unexpected write event288|Unexpected write-and-quit event㿘`?` R"*`@O O<POXOtOPPOOOP @ ϔ<`  @ Ȕ5`  @ .`  @ '`  @   `  @ @`  @ ``  @  `  @ ` @w @ ! !!( (  !"!"!!"!!  㿐 !@* "@*`.`"*   '!@/ 2$! @ $!   ` @(#)line.c 10.20 (Berkeley) 4/27/96㿐 '@ ` @  2 `  @T  ' 㿈`K'H ` * H 1H$@!H x` |     @` 2@ `'@ <`H@" "@'H`H 2&` +'` H' '`  ? 2H @H 2'2& &`&`  &`' `& 003|unable to delete line %lu㿐'H ` 칔 ?  @ =H 29  \H 22 H@ H' '`   H @ zH `@(&`` ?&``X  @"s`X .`XH @ 004|unable to append to line %lu㿈'L L e L ' '''  ? L @ 5L6 @*&  &X  @".X .XL`@ L @ @ L ٔ 2  L @@ 2  005|unable to insert at line %lu㿈'H `H  H ' '?`  ? H @ H3 `@:&``  &``X  @!͐`X .`XH@  @ [H@  {H 2  H @  2  006|unable to store line %lu㿈'H ` 맔 2 H@ H' '?`  ? H @ tH `@"&``X  @!r`X .`XH@b H @ 㿘 ` j  2 $@" | x `"   `?   `?007|unable to get last line㿀  2  : A &@$@"9  | x `" 0 ' '   ? ""&@  @&@ @ $ $ $ $ $@ |  8&@&@ 008|Error: unable to retrieve line %lu㿘 @˖㿘$ 2&  @   " 2 @ 2    @@(#)log.c 10.8 (Berkeley) 3/6/96009|Log file㿘&`&`  &`,&`0&`(&`$ "! @X &`   @x `X .`X 㿘` "` @&`` "&` @&`&`  &`,&`0&`(&`$ 㿘  `X "`,  L"`, P"`0  "`, P"`0@ /usr/src1/usr.bin/vi/build/../common/log.c㿈     @,l "& $  *   ,@'  (' ' ' '   ? ( $ ($ $ ap@Δ ð 㿀'H `X  a .`X`,   2W &`,H ˘ H`"' D "h 'H  28  `  `@,` ", &``*` H@” ` @`(' '`' '`  ?`( &`(&`$ ap@c! 㿈  X " ,; W  23 $ ,    @+  "' $   *@  @y  (' ' ' '   ? ( $ ($ $ ap@ !W 010|Logging not being performed, undo not possible011|No changes to undo`  `X  @6  `( 2 `X @+X ap@!  ,`X`(' ' "\`(?$`(`   ? d* b|b bbbb c0c"`( @  `X ,`XS  Ē @ CĀ 2E `X d & d Ē @ Ĕ  23 `X \ & \ Ē @Ҕ Ĕ 1   X "`(& X ` & ` В @ ''̐@ 2 `X`(@r `X ,`X 012|Logging not being performed, undo not possible`  `X  @ `( 2 `X} ap@C!v  ,`X`(' '!`(?$`(`   ? W* e e\ddddefȒ @W  L@2 `X`( ې? `XȒ @H  L@`( $`( `X ,`X3 Ē @8  L@2  X   X & X ` & `В @ ''̐@U 2 `X`(@rW `X ,`X 013|Logging not being performed, roll-forward not possible014|No changes to re-do`  `X  @h `(`$@2 `X @֔ ap@"I  ,`X`(' ' #`( $`(`   ? f* g`ghhPhhg`h耤`( $`( @  `X ,`XS  Ē @ Ĕ  2B `X \ & \ Ē @ Ā 23 `X d & d Ē @{ Ĕ ږ   X "`(& X ` & ` В @d ''̐@ 2 `X`(@q `X ,`X 015|%s/%d: log put error267|Log restarted㿘@)Ԑ X@/   @  @ x@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.43 (Berkeley) 5/15/96exnexnviewviewc:eFlRrst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s0(h  !&(h(   !&( & &  & & & |&  & | |&  . p 0& 0& 4!,&!,&!0&!@&!D @Ob @Ob耢 2 @Ob @Ob    @  !      (T &(T!L! $@?i? 8b* nnnnnnnnTnnnnnnnnnnnnlnnnnnnnnnnnnnnnnn0nnHnnnnnnndnnnnnntnnnnn! #&! `(T ?&(T  t r rt t# `#( 0#0*  `  @f `(T "  @ Ԁ Ԁ  "" 2 & "`u&  " " " 2 & "`&  a ` ('Ā  "@` 5"@`?"@@ C K !ؐ@]P'@zؐ'''''Ԓ@' Ԓ   @ Ԓ '  @ Ԓ B  @ Ԓ F  @ $@ "$  "  *` * 8" "4 ` " X*` * 8!X"8  rԀ  d&2 r  2 T@Ԁ ܠ ~ T " L*` * 8$L 2 "!   ` "׆   & @zH @   & $c@s   @A4`"("$@r"@"` 28d`$  Ԑ '   $@y$@ 2Ԓ  隖 j  |  d&  @ K Y W d !  @ @@Ԓؔ  C  2 (d耢  (d@  ` "$ Q @aAԀ Ԁ 2$    8 8 `@Ӱ 0 @ %s%.*sex/vi: 㿘   H @   @"   @Ӑ  @  @" (T @ǐ  @(T !h@n~ap l !h!x%#  a @nk `"  "` "@ l 2 ---c$-s㿘`@ e'""@@MLb "[ @J@ +& -J` 2@@ (&@ *@ `*` `*` `>*`@y@y &@ -*@@ c*`@ @@ -`2+`J` 2@@c   &@ $c@*   @ "*@ *` *`J  c T t w2`@J  "``@  %s: %s 㿘!!h`@mޔ!h`@mה`  $@1#ܔ!h@m̒`!h@mǒ`@(#)mark.c 10.12 (Berkeley) 3/30/96"`8 㿘 `8`""`"@@t `82 017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists㿘``" '@` " `*` * !X  6 ``*` * !X  !     2 ``*` * !X  j@İ 0 & & 㿘``" '@D &@h   @ 0 2  8 "@  8"  " 8  8 "` "@" $"`  2     $ $ ,  , ,   8  *  2 㿐`"   `< @l 8`"6 `*@ ?` .`@&`@`2`!   2     "   8`  `  &`@`2` @(#)msg.c 10.36 (Berkeley) 5/15/96020|Error: %s, %d: : %s%.*s㿐'P'T  'X` F `"C B`; "Г*`@~<$ . $ " $ $*` * 8   T $T$ " $ $*` * 8  0  $@0@l`0  "`0$   ` `t@hT >"hT@ѐ,'     (T!" x' @#Ɩ "  t x@# "$ t t x'(T!$(T` b8@  @d@``? ;: 6 ""H` "*` * !X  L@X' L  "@P@X'q @͔ "@@P`'Z`2$ $@/`#ܖ@XX'G  A  / 蔒 !hb`@kA   ` `t@hT >"hT@" 0㿐! $0 #ܐ@$#ܐ    ` `thT >"hT@͐p`P@299|yanked298|shifted297|moved296|joined295|deleted294|changed293|added301|lines300|line%lu 㿐$@& X# " # #*` * 8  , \@`@   t   ," \0    "'(T!"  x' @"i" z"  t x@"]" n$ t t x'(T!$(T     , \ 8 ; ,@`,@`, @W \'@  \ 2`@@@@,@`@@@," \¨  ,@l (    ` `thT >"hT@021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu㿈 @t '    "'(T!'   @!    x  t@! x $ t t x'(T!$(T `@Q  :, ` ,@` `  ?# @2%c   c@@-@  ,,@` ,@`  X c`@ɔ@@  !  ,,@` ,@``@@@ " " " "ؑ*` * 8 0  ,,@` ,@`` @@@  :,@` ,@`(쀢 q쀢  `0@k@ `@@`.`* * @3@6F0 ``@M@6<@s@ ,@`"$@ 8@ @N@ /2 `$@ 8?@@`@*N@@ ..@.@.@$@' (    ` `thT >"hT@LANGLC_MESSAGES%svi_%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog㻀@ /"#L  2@U!XK  @U!`K  $p@UҖ   @K  ^`8 2+"`8 +H' ' '`  2` 2 `ax@UK  ^`@^`8 "`8    0 " 8  h "  @ " h 㿘 h  @268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 㿘`) .`@$ccؐ c `8`X`h@@g㿀Nbؐ  :N   4N   .N  |*' '@,#'䀤    "  h   2   ?& *?  @rV&㿐& @ "ؑ*`:  J  "L@`L@  @L@  { ` `thT >"hT@  @"-1.    (T!" x ' @ 1  t x@  1$ t t x'(T!$(T3"x & @ $!`*` * !X L@  : `, J  `L@  @,@(#)options.c 10.43 (Berkeley) 5/16/96  Ͱxp`XP@8( XlXѠXѠxdpѠhXPH@80(Ҩ @@X@ph` XPH80(p    4writeanywrapscanwrapmarginwraplenwindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerasexph`XP H @ 80( !$%*(.02854<;@:==GxKpGhH`IXJwswmwlwiwawttytypettytstotltagswsmslowshsectscrroreparaoptnumodelinesliichtexedebdircobfawapaicdpath=%sCDPATH:directory=%sTMPDIR/tmpescapetime=1keytime=6matchtime=7msgcat=%s./report=5paragraphs=IPLPPPQPP LIpplpipbprecdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sSHELL/bin/shshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionh'''''' =  @  m,#ܐ .#ܐ   @}  a," ."   @q U,!` .!` 1  @e  I,#L .#L@P# #$@PԔ@n]'@ , @P# #$@P@nD'@  c c?' /@n.'@  cЀ c?7@n'@o  c c?'@n'@[ դ $@Pk@m'@I ä ` `? /@m'@5  ,`  `????@mȐ'@  %$8@P-H@m'@   )``  ``??'7@m'@ m 0@Oϐ  $@Ox@m'@ڔ T 2`  `??' /@mm'@” < 3` `?' /@mW'@ & 4` `?' 7@mA'@  7`Ѐ `?7@m-'@  :$@Oh@m'@p "" < " "  " *` * 8?2 '̀ 2А '̐В$@Om@l'@K " Ť .(`€̀ 2Ȱ ̀"X ̀$ " " "  " *` * 8?'̐В$@O?@lȐ'@  G!! s ` "  h  +, 0`  @   @ W`, *  a  ,  `*` * 8*   @{ <`*  a ,  `*` * 8  , )`*  !, *  a  ,  `*` * 8*   @G +,`@aG`@  @?!@* @@38@l8'@ 2 @`@?*   ,   all032|Usage: %s033|set: no %s option: 'set all' gives all option values291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean㿀    9@?cP  z #   L  = ?2  = #X'k  L ꀢ =',@XL n L o  '@H h!%< , *  ``2 ` 2  @ ?2    "  0        ` ؀` z`` 25  , *  a " ,  `*` * 8*  2 Ҷ*  a " ,  `*` * 8*  2     2   2  @&ߖ 2  (  2     @   @   8` ``L"ؒ@ ` ]@ `L.)䀤` ` `0 ` x@_Z    ` `thT >"hT@z/䀢    ` `thT >"hT@z J A ? "> ڔՔ Ș耢    ` `thT >"hT@y䀢 r   ` `thT >d"hT@yאخ  @  2  Q 2 , *  a  ,  `*` * 8*  @"    2  2 @%Ӗ 2  ( 2   z   x ```2 `"   k- 26 , *  a ,  `*` * 8  , " *  , *  a " ,  `*` * 8*  @=o "6    2*  2" @%Z 2  ( 2   @ " @^ |`@㿘.`*  a  .``* @*``8 @*   @-    `  @x "&`&` @  @x "&@&@ 305|No %s edit option specified㿘.`*  a " .` `*` * 8*  J 2 2  .`   %ld%*s   8@v͒ ? p`  !! V !$:  2I`",  ``", 0 ,   1, , *  a  ,  `*` * 8*  , *  a " ,  `*` * <*  " , *  a  ,  `*` * 8*  , *  a " ,  `*` * <*  ܑ, *  a ,  `*` * <  , C*  ;, *  a  ,  `*` * 8*  , *  a  ,  `*` * <*  @; , *  ! ", @\*  ! `*!@g "!,   9, i?, *  a " ,  `*` * 8*  "Q`P?*  a  ,  `*` * 8*   @I`@gq3@*  a ,  `*` * 8  ,  `*  , *  a " ,  `*` * 8*  @g@@`?@/`. "= ">к` E@xԒ@fd 2     ? 8@uV  6- !/- @.`=*`@B@@@ h' p`@.``ax&ޢ  !#,>Г*`@@ax,ax%s%sno%s=%ld%s="%s"㿘 !&@` ,;    ?+ 0t+  *  a +  `*` * 8    *  !p `N@+  *  a  +  `*` * 8 *  5` *  a +  `*` * 8  +  *  +  *  a  +  `*` *  8 *  !p`@Qset %s set no%s set %s=%-3ld set 㿘!! " \ 2!$:  "-,`  C,`` ,`*  a ,` `*` * 8   *  bb@[ ` *  a   `*` * 8,`*  @Z ` *  a ,` `*` * 8  ` *  @Zђc,  \2``?`&``@ \@`&@*@@`?`&``@ @`&@*@@zL Ԁ `?`&``@ =@ &@ =*@d,`*  a  ,` `*` * 18* ,   \2``?`&``@ \@`&@*@@9`?`&``@ @`&@*@@&L Ԁ `? &`@ &@ * @` @ ʔ   2  㿀'a, $ @ | 1 * !0'a L @ 0"! @d!!  JL &  @F 2 `  2J㿘@8@㿘@8@㿘``@xr#  !, ` 2  ` 2  , *  a " , ``*` * 8* @ ,       _ *  a  , ``*` * 8* @  e    ] 8, *  a , ``*` * <  , ) * @ !, *  a  , ``*` * <* @  (  ڔ    Kq, 㿘 !, ` 2g  ` 2c , *  a ,  `*` * 8  ,  *  , *  a " ,  `*` * 8*  @s, *  a ,  `*` * <  ,  *  , *  a " ,  `*` * <*  @s  K, @(#)options_f.c 10.23 (Berkeley) 5/4/96㿘  A    040|Screen columns too small, less than %d041|Screen columns too large, greater than %d㿘  P  !  ! 042|Screen lines too small, less than %d043|Screen lines too large, greater than %d㿘 !    @! 0   0 2;?& $T " $L $L*` * 8$T " $P $L*` * <$T  $L*` * 8 P $L K G    G  > 2 & $T " $L $L*` * 8$T " $P $L*` * <"$T  $L*` * 8 8  $L (  G  ? G  ? 044|The lisp option is not implemented㿘 Zȁ 㿘) 048|The paragraph option must be in two character groups㿘@b   7( 㿘ۡ$ &$ $($"$ 㿘$@ @ $*@&$$@@ $*@&$ $ "$ 049|The section option must be in two character groups㿘@bD   p 㿘    !  㿐 (`€   $@8 㿐 (`€   ;P.@  㿐 (`€  "@@  b`b (( 8: b0b   b" b `b (( 8" " @(#)put.c 10.9 (Berkeley) 3/6/96053|The default buffer is empty054|Buffer %s is empty㿈`2E2 ! `2= = "ؐ  #*   !@`  `` `@`2``2`*` * !X  ڮ   [  '`ڒ 2R  2```  ߝ   ' \ & \ '' 3 ` "%B?' '``  x   ' \ & \' @&   ' ޘ쀢 2    "'T!" '     @ ٔ耢 Z  x t@ ʔx "ڰ &ttx'T!&T쀢 B ` @ty@' @tq  쀢`"@b  '쀢  P@ ' ` 2` `@tP߯& 2  X } & X ` x& `&'쀦   "Tt2T >&T@x t@ ^x "n &ttx'T! &T@耢@ K耢 ̤@t`@t@_& 22  X "& X ` & `` `  ވ   ' \ & \ v   \ & \     ` `thT >"hT@o@(#)recover.c 10.18 (Berkeley) 5/15/96%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails8 )  V"쀊 " " "*` * 8@J   $#܀ @p  X4 Q-@#  ` N $(@B@!?"@r@껐 &`L ' @Ay  8 `X .`X 057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails㿐  X , XC X , X P 20 L @g 0޸ + (hb   €   L 8 (h   (h   L@h! X , X  篔X 060|File backup failed: %s061|Copying file for recovery...㻘 `"z `X  t `` €    `X ,`X`LÖa `` `X ,`X@h`P`J  ) 2C "쀊 " " "*` * 8$(@A!@#!?' (hc @`L  @q  @ " @@@q  (h  ` ` 8  2 062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery file%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: X-vi-recover-path: Reply-To: rootFrom: root (Vi recovery program)To: Subject: Vi saved the file Precedence: bulk%s%.24s%s%s%s%s%s%s%s%s%s%s%s On , the user was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to ex or vi: vi -r 064|Recovery file buffer overrun065|Recovery fileh@䣶@λ  q  ) 2 "쀊 " " "*` * 8?$(@@@!!ؒ      ?@2 &`T?@Đ@ &`P 0 `L  @ /`?"@ ?#@ !?##\"#`"#d"#h@#l"#p#t##xh∘@?šb/@oj@@#\#h#`#d##h#l##p##t #x 0#|#0P@?cX ? ”8D#+ <@@#ޒ & <N 2& <8N .&@oHڢ?@ @oZ "  傔`  ?&`T @oF .recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. 8 ) ""  " " "*` * 8@ 2 @/    rv / $@3Gf`@F  @`Т  T`ʘ  "  I$@ "b@FҔ  @#$ $@ b@F   @# 2 * !0,%ܐ@F ܀ 2T`@>#0 T`@j@ϐ @ @4!0@!@0 %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover' ) ""  " " "*` * 8@.ې ' `'|?     't@2s `@F  t$@> t @E         {0''$@ޔ "b@E  @"D $@˔ b@Eߔ   @"1 2 , A0H,@ $#cܐ@E   $c܀ @=@ 07@/Y| 2@j@)@e Ҕ @[ ` ǔ @j@j@j@mb@m0^@.  | 0. 㝔 㖔8`z "  @jÐ@j@mX & P& T`2 X`!3` X . X ?c @E- ?+?@m  @m  @   䑖 㿘@l?@!k  " :  @m  0 㿘@=? . h0@Г2`/usr/sbin/sendmail071|not sending email: %s%s -t < %s !!@D  !D0 (0@<@*@(#)screen.c 10.13 (Berkeley) 5/10/96㿘& @O$2& ܔ    & $  $ $  $ , x$ x`$ |c$ ` "d@Q C$ d "`$ $$`, `@ $ ``@T`Ā ,$ `$ `Ȁ`@I`܀ !$ `$ ``@>`䀢 $ `$ `쀢 "* @iG $  ℔  耢 2` | 0 $ `$  `@m{ d $ $$  @{  &@ 㿘 ? & p `"$ @ " "`   2 ""@$ ?&$@@  2 $@2 x $ " x@iV  @iO $ x " ^ x " @iC "$@i=$@" @  Ȁ "$@i0$@" @ؐ  " @i# 耢 @i@i`` 2``%``"! 2 "`  ` 2 "` `"`" ` 2`"` "`@(#)search.c 10.24 (Berkeley) 5/26/96㿐 L p 2o   ! J" N 2N  &@2N& 2$ @G @@ @     0 J@  2J`J@ "`* 2 @J@ \"` @*`2&  Ę    ` 2` 2  @2&  㿀  2 ` @ @  2ְ `@` 20?/ `  & @  ܘ  $x " $p $p*` * 8  `@  ` ``   d   ??` (T     ` (T `@$  d`@  Ց "``f@В c`$x " $p $p*` * 8   `Q@ N`H  "D ? ?耢  쀢 "  @`,` ` (d@&```"&$ " & ! 2&@ &쀏` &@  ? & o `@ x  ` "`@'`%   @ ?$x " $p $p*` * 8 2 @`@:  ? `'`  d   ?? (T     ` (T Ԁ`@M  d@ 䀢 2`@ `$x " $p $p*` * 8  ``@ `֎䀢 䀢 2  `@ْ `'  Ԇ܀    ??     @`o`G`   耢 d쀢`䀦耏` $   ! @ 蒂B?  耢܀1쀢/ܐ ?耢 쀢    @`` `8 (d@&` " 耢̖쀢䀏` &܀@  ? && ?' `@z 072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrapped㿘`1#H.`@`xؐ ޿@0! ޹h0 ޳0 ޭ0 ާ0  ޡ0@J078|Searching...㿘 hh`@(#)seq.c 10.10 (Berkeley) 3/30/96㿈\`#\ @Ú2 ``  @ $  "$ @e$ w$  @J ( S ` $5# $ @ $  $$#$ @ $  $#܀`$ $  @Д $  $#@eY  @eS@eQ $"#ܐ  . $ $ , $  !D $ !D"  "!D  !D@ $@" "$   `  2   ` *@ H *H 㿐#\  @&  @㿘`"  "` "@ @d@d   @d@d 㿘\`2$@ !D L   @8E`*> 2: $ 26  8@7  @8-`*& 2" $ 2  8@  & 8 ``" `2&@0  $@ `2&@ 㿘!D " @d  " @d  "@d`"  "` "@@du!D 2  㿘 !D  +@2 $ 2|  @` *` * !X  ͱ @`@S % $ a$    @` *` * !X  ͆ @j` , '@Sl % $ Ra$  @` *` * !X  V @:`2a2~%s㿘 !Dè 2 $ c@H`F  |   `   'S `? 'R@͸ 2``?`&``@ @`&@*@@ߡ`?`&``@ @`&@*@@ߎ2 `?`&``@ @ &@ *@z "G` `B  | `   'S `? 'R@_ 2``?`&``@ @`&@*@@H`?`&``@ @`&@*@@52 `? &`@ &@ * @$2B " `   ?"` @(#)util.c 10.10 (Berkeley) 3/6/96㿘"*! @bk@b  ۣ   @H& && 㿈&L쀢 쀠#`? @'" J   ` '? 'B& 㿘@= / 2 㿘@b Q @fR. 㿘! $$#ܐ@Ŕ$@#܀  $  #܀ " @8@? 㿘! $$#ܐ@&#܀  $ #܀ "2 #@  @  @(#)v_at.c 10.8 (Berkeley) 4/27/96 %lu㿀`0" @` @ *2 $$ @2  5 $  &$ "ؐ  #*    !@   `    2  2. `*` * !X  Y  :   @""`0 '  @  h  2#  `` 2 `@2 `0( Ĕp@4O` ֘   @(#)v_ch.c 10.8 (Berkeley) 3/6/96㿘 !.` !`$Ő *`@$8L@3 @В@b@ @:@F㿘 !.` !`$Ő!,`@ @ @7@@ @}@Fa "!㿘@ "`@ ?&`@`, "`< @2 `<&`D`@&`H  "a 㿈`0@` *!  "a`4Ξ쀢 쀢 6<  /`8'`0( ` J@` ' " &`@`, "`< @" `<`4&`D `8@ &`D`@&`H 㿘@ 2  `@ &`@`<&`D`@&`H  "a 㿈`0@` *!  "a`45쀢 쀢  ;  @N2 ?`8 '`0( `?J@ ' " ?&`@`<&`D`@&`H`,    @`8?&`8178|No previous F, f, T or t search㿘 #179|%s not found㿘 `* * !X  ɬ @(#)v_cmd.c 10.9 (Berkeley) 3/28/96T@"404p 3333~ 33` 3P38$ 3(332[ D 22}D22q22x}DH2h28}D2(2}4D21q119@ 11~t 111x1Xz$1P181(18h10006009@ 00h80`0@vD 000:<, //B //x(D/x/`c,D@"/X/@6 /8/ `@C(/.D@"..8D@"..}DH..XpD .H. }4DH.---@"--_H@ --h<-H-8D -(-7, ,,8, ,,@",,ht ,`,HM0 ,8, D ,+++++D ++`TF +H+ zEH++{E**N **74 **x|(E*h*H{E*@* @"**O ))nl ))6))V8 )p)X)@) F )( ((lD (( (p(H(0( ((D@ ''D@ ''\D ''[D@''p`$B"'h'XM 'H'0D ' 'Q &&4h &&D &&pF &X&0[ D & &O( %%}D%%}4D%%vD %%``%X%H\@"*%0O % %oX $$qx $$W $$p8F $X$(@ $ $D ##l ##p ##`d@#8#jD@"#"]D ""fD@"""h ""x ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.8 (Berkeley) 5/19/96㿐`02  " ``4`0 `<  Ma 2I `4`<OM 2A `D ` 24 24   &`D+&`H`D  0    (  &`D`0   > &`0`H ` &`H`0  > @&`0 @(#)v_ex.c 10.38 (Berkeley) 4/28/96X#\  `4 ʚ ͔ @207|The Q command requires the ex terminal interface 㿘 (€    L"`  P"` ` 2`$ ? &$^b  Ҕh `4`0(`` pp#\  `4w @7<X#\  `4`<d ͔} @>X#\  `4`<L Δe @suspendX#\ 6   3 Δ`L @180|No previous file to edit  Y    2 X#\     @H@X#\ 9     @H~!0!0@p#\ ;   К @!`0@ p`,ǐ#d@"@!p#\  `4`<  " ,Δ8 e/  2C   ,'  $'6p !b@̖ 21  x 8  L&`D P&`H& @;:p#\  `4`<}  " ,  d  2   ,'  $'@)` "#\ "#\0 " #\0p ,p Gp I   G @<@p㿘`  € @ 2  2 㿐   %  |  > :@@Qက 2w  x 8    @ 2i K J`!T "!L !L*` * 8   @ 2M     ٚ  2C @:$ ? "`$*@ @W Pi@= ! `  , & ,` $ &$@< 2 @ 2    @!㿐 L ĝ  & L & P P ` & P L&`D P&`H 㿐   @ 26 Ԕ 2/ @Pn  Y$   "` "  "`   2 v`L`L 2&  "`L& @ "& $ &$ 307|No ex command to execute㿐 L _   L  @),    eP     2  & $"&$ 㿐   2 @$ 2     @2     &  2 &  ``&  㿘  7  2        `X *`X  @(#)v_increment.c 10.12 (Berkeley) 3/19/96BBBBB%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number` # +.`` + -`(`@(  `0(  ` 6`@  `4z   `8"J  " *Jo`8%P@= "J@ 0># J  X x2J@J"ؐ@   @ " "< J  XE"C"J@ 0J@ "ؒ@ `   Ȑ ,"J + -2 "Jbؐ     "Jbؐ    ,  D%!`  ``"J01!0. "ؒ@ ` Ȑ 8'  ?Ȑ $Т "J"ؐ  2 %J"ؐ@  2  @ " 2  %@:8  À` %  "'(T!' 2    2 x  t x " $ t t x'(T!$(T  @X-@` 8x| y `2o ` - | `#" *^ | |` @ " 4R |@ '|В""" d@'=|$ *`2: ` + x8 1 x + x"`'x d@'x@XR@@XM% @XF"""'`4á @(` ` `t@hT >"hT@TT182|Resulting number too large183|Resulting number too small㿘` ` ``  0 @9K Ҕ(@(#)v_init.c 10.8 (Berkeley) 3/30/96㿘 @9!̢ &`$a-$a !H "!|@S $aD Δ  aD!D@W!H!H$aH!| " !@Dc!| $a|   !,a!$a!$a 㿘 !0 "!D@S!D "!|@S!| " @S ! @S@SŐ&  㿘`0""`G`%"#@%  ! " #8 #8*` * 8  " *` * 8@&@*@(#)v_itxt.c 10.13 (Berkeley) 4/27/96㿐`4  / 2   ? & P   *`" *   א@x@ & `4& Lۘ쀢 쀢 2'! `"   P @2 P& P & P #\`0( `#`#d @ 㿘& P`4Y P "    *`" *   À@x@E  & `4& L쀢 쀢 2'  " #\`0( `#`#d @ƚ 㿘@  㿘@ x@  &  L Ԑ_ 2Z  ''B  '& P   *`" *    Lo 24  L =쀢 2+  L   L 2   L`& L '쀢 " L ?#\`0( `#`#d @J x`4`<@ޘ쀢  쀢 @  & `02 "`4&`8! "! !*` * 8  `4  `4^`8 2 `4& L`8& P   *`" *   2`0`0 > +&`0`4`<@2'`0 ``4`<E 2  "#\`0(`<` #`#d@ʚ `0" ``4`<E 2 > `8 :`4 w 2     "'(T!"`8'`8  耢 > x  t x "] $ t t x'(T!$(T@Ug`8`4`<G> 2H `4^`8 2> `4& L`8& P'`4쀢 쀢 2'+ `8@:#\`0( `#`#d @C `   ` `t@hT >"hT@QHx@  & `4쀢  쀢 2'#   " H`4&`< ? &`@#\`0(`<` #`#d@ x@H  & `4쀢 쀢 * ' " `4&`<`0(`8`@&`@?@8&`@ "#\`0" ``4`<D "#\   #`#d`<@ !!`0 "(( 82 "  "(( 82 <" < <"44(( 82@ |" |@ |"tt(( 8䈀 2 "(( 8 ` `" XX(( 82 l" dd(( 820!!!( (`0 @(#)v_left.c 10.7 (Berkeley) 3/6/96㿘`8 2`0@"F ( ``8 " &`@&`@`, " `< @"`<`8?&`8`<&`D`@&`H 㿐`, " `0 @`0 &`0`0( ` " &`@`?&`@t9`<`@ 22 `< 2`,`@ 2`,`,Ȑ Ā@2`,W 2  2`,@! @ Ȑ"2`<`4&`D`8`<&`D`@&`H 㿘&`@`<Ô`@ "`,4  "`8 @" `8`8`@@2`8@!# `@ `, "`< @&`@`4&`D`8 " `< @"`<`8?&`8`<&`D`@&`H 㿘`0("`,`&`@>,`4&`@`, " `8 @`82`@@!:5 `, "&`@ @" &`@`8 2&`@@!d$ `8`@ `, "`< @&`@`4&`D`8 " `< @"`<`8?&`8`<&`D`@&`H 㿘`, "&`@ @" &`@`8 2&`@@!. `, " `< @"`<`8?&`8`<&`D`@&`H @(#)v_mark.c 10.7 (Berkeley) 3/6/96㿘``4ۖ 㿘@  㿘@ 㿈``<g  2 ""&`@0)`<  V쀢 2~ `@쀢 *`,2`, `,    @"&`@`0 &`0&`@`<뿔`@ "`,_ @3 "`< @`<&`D`@O&`H2`4`<`4@2 `4`@`8@2`4@ j@ `<@8 `42`4`8`@@`4'`8'`<&`4`@&`8&`<&`@`4&`D`8#&`H`4`< `@ ?&`<  쀢 2 `8 `0 &`0쀢 ? ?&`@ @(#)v_match.c 10.8 (Berkeley) 3/6/96184|No match character on this line185|Matching character not foundp`4ܖԀ Ԁ  а `8؀@ ؐ YJ >(> ])# ( <( )` >` ] { [  ]ے` }  {Ւ` [ }" < x`4?l 2      ``22` ؔ` 0l&`<&`@`4`<@* `,2&`D`8 :`<`, " `< @"`<`4&`D`8&`D`@&`H`, "J  @"E `4`<@"@ `4`<  'ꓔЀ 22  @*- `4`<@ `<`4 ؀    ܐ '  " J   ܐ 'ؐ? '`0 &`0 @(#)v_paragraph.c 10.7 (Berkeley) 3/6/96㿈`, "`4 @"`4`8 "`0`4&`<&`@`<>`@ 2 `8`@@8`4`0 &`0`4  2`4`0( ``, @. "?    k``D0c`"?@ ?B J 2?";`,ܨJ .2ب (Ԩ !| ͒J*`:  2J 2J "?JJ@2?J  `"@ 2?2 `, "&`< @ &`<&`@&`@`4&`DU`8&`<O&`@@1`4@@2"`,`4쀢 쀢 ? <&`8 `8?@ `,`2`,@ + @ Ȑ Ā`0 > @&`0&`< ? &`@`, " `< @"`<`4&`D`8`<&`D`@&`H 㿐`, `4 @"`4`8 2?2`4@*`4 ?&`4`0 &`0&`8`4 ~  2w `0( ``, @- "? `8    W``D0O`"?@ ?G J 2?"@&`<ޤJ .2ڤ (֤ !| ϒJ*`:  2J 2J "?JJ@2?J  `"@ 2? @0 &`<&`@`<&`D`@&`H 㿘` @; @;`@"! @J 2  "  !| `@KQ`@O`@O&!| @(#)v_put.c 10.5 (Berkeley) 3/6/96㿘`0@@p`0(* (``0" ` `4`Dٜ 2 `D&`4`H&`8 (T 2       (T   ؠ? 㿘`0@@5`0(* (``0" ` `4`Da  2 `D&`4`H&`8 (T 2   ǖ    (T   ؠ?  `π!܄l(pppppppp 2  3  4  5 6 7 8 9 *`(@(#)v_redraw.c 10.6 (Berkeley) 3/6/96㿘 h€ @(#)v_replace.c 10.16 (Berkeley) 4/27/96186|No characters to replaceh `4 Ѐ 2? Ѐ 2 `0 *X4 ( ``4&`<`8 &`@А?@@,`4! `0@D  & @2 2 ؔ . 2  ?`*ܐ"*`@rrrrs$s  耢    ,<$@$$&$@1؀ А߰ ڰ    "'(T!'Ѐ  ̀  x  t x " $ t t x'(T!$(T@MЀ '@ "`4@ 2`8`4 &`<&`@`4`8  `8Ԑ '`8 А" ''! "! !*` * 8  Ѐ J   В'Ԑ `'Ԑ>Җ 6Ѐ "$&`@! "! !*` * 8 2&`@ "&`@`4  @ 2'  ` &`@ ` &`@ `4    >  @ <@/ `4yР   ` `t@hT >"hT@I2`<&`D`@&`H@(#)v_right.c 10.7 (Berkeley) 3/6/96㿐`4   !I  `0(`8`@`&`@?`8@2`@`, " @2`@@ђ (  &`@`, "`< @"`<`4&`D`8`, "`< @" `<`@?&`@`4&`D`8&`D`@&`H 㿐`0((` #&`@`4`@ 2O `, "` @" ``8`@@8``0 &`0`?&`@G 25 `< !  ") ' 2?`,@Ȑ @^  &`@`, " `< @"`<`4&`D`8&`D`@&`H @(#)v_screen.c 10.10 (Berkeley) 4/27/96308|Enter to execute a command, :q to exit187|No other screen to switch to㿘$@@   @" &  2   ޔ 0  &  @ "$@ &$ @(#)v_scroll.c 10.9 (Berkeley) 4/27/96㿐`0(` `   2  " @`4  2   " &`<@; 㿘`0(`<`? @@-   @' 㿘`< @@   @ 㿘`0(`<`? @@   @  <" D @" H ,'" 0@" 0 < 4*  ,2" D @ 8: 4 ,Ȅ  < 4" D" D 8" H㿘`0( ``4 " &`<&`D`@&`H @`4 㿘$@@ 0 @@0`4㿘`0(`4`@`Ò 2&`<@`4 `, " `< @"`<`4&`D`8&`D`@&`H 㿘`0(`& `< @:   `<&`D`@&`H 㿘`0(`& `< @:}   `<&`D`@&`H 㿘`0( `  @2$T  $$T  @ $L*` * 8   $T$L  @$T   $L*` *  8    $L*` *  8$L@Do  ?`<@:*   `<&`D`@&`H 㿘`0( `  @2$T  $$T  @ $L*` * 8   $T$L  @$T   $L*` *  8    $L*` *  8$L@D  ?`<@9ז  `<&`D`@&`H 㿘`<`0( `@9Ö   `<&`D`@&`H 㿘`<`0( `@9   `<&`D`@&`H @(#)v_search.c 10.16 (Berkeley) 5/8/96㿘@" 㿘@ search+%lu188|Characters after search string, line offset and/or z commandx`0@  @p p  / ?#4 "#, #,*` * 8 "" " " @ 2а  x`8 ʀ 2  L&`< P&`@`, " `< @N `<&`D`@&`H `&`& & L PI=܀ 2   &܀ 2&`D `  " l  d&`< h&`< p&`@`< 2`,`<   ^`@M w&`D "  @   @=i `R @L z2Y "J@  ` @Ӑ *`:  + ^  27    Ȗ a 21  X 2(  @`< H 2  aȐ!2a`<&`D`@[&`H`0 > @V&`0 ۔&`D&`H 㿘 2    @m 㿘  @d %s%s%s[[:<:]][[:>:]]㿐 !4      (T!" x'      t֔ x 2$ t,  t x'(T!$(T !0@Ic @@    ` `t@hT >"hT@D189|No previous search pattern㿘   ( -`4`<`,  @2   `4`<`,  @2  " `,  * @)u "`< @ @  0`<&`D`@&`H 190|Search wrapped to original position㿈`4`<@`8`@@  0F "`4`0 &`0`4`<@8 `42`4`8`@@`4'`8'`<&`4`@&`8&`<&`@`4&`D`8#&`H`4`< `@ ?&`<  쀢  `8 `0 &`0쀢 ? ?&`@ @(#)v_section.c 10.7 (Berkeley) 3/6/96㿐#@ " #8 #8*` * 8" `, "`0 @"`0`8 "`0`4&`<&`@`<`@ 2 `8`@@`0 &`0`0( ``4'` O ] "`J`{" ?`, " `} ?2`J {"3`,9&`<J 2?")`,Ӣ`J .2Ϣ` (ˢ` Œ*`:`J @2J  JJ @2?2 `, "&`< 2&`<"&`@J  ``4 @ )    2  &`< ? &`@`, "`< @" `<`4&`D`8&`H`0 2&`H &`D`@&`H 㿐`4 @* v #@ " #8 #8*` * 82`0f ( ``4  ? "J {J ?"2&`<J .2 ( ڒ*`:`J @2J  JJ @2? &` @&`0`4?&`4`0 &`0&`8`<&`D`@&`H @(#)v_sentence.c 10.7 (Berkeley) 3/6/96x`4'`8', 2 `0( `      2 2 `4@2&`<`8䀢@ "%      2 2     2Y ѢѠ ? T8͠ * Xd<DDD<<Dr  pn  "  e 2c 2` ޒ K `4@2&`<`8䀢@@W < &`<&`@`, "0`< @"+`<`8 2!`@ 2`42`@`4`< &`<  %܀ 2 ܀` &`@`0 &`0?&`@`4&`D`8&`D`@&`H x`4 2'`8 " `4'`8' 2 `0( `  Ӓ 2ذ    {     l   | 2  2  ."  ? h ! S2Q ڠ ؐȒ   )" ]" "" '    2 `4 2m `4@2`8@/ U "  "  `''䀢     ) ] " '~{ &`<&`@`, ",`< @"'`<`8 !? 2`42`8`4&`4  *܀ 2 ܀ ? &`8`0 &`0  ?&`8`<&`D`@&`H @(#)v_status.c 10.9 (Berkeley) 5/15/96㿘`4  @(#)v_txt.c 10.66 (Berkeley) 5/18/96㿈 L&`D P&`H@_ 2Z  !& L& P$ &$ ! "   *` * 8 2$ "$ $ "$ $*` * 8 #\ #\ #`#d   @ 2 $*@&$@i " 4   2`D$ @&$`D& L`H& P `4P` ` ` `@ `D `< `D`@"(`(!!   ` ` `ᐄ ` *` `  ` `(.`ᐄ `@"`@"`D"`< 㿘 4 M a& <a& Da& @ D "  < 8  (  (l@  @(   <*` * ? "a?"a" " " "*` * 8 2$a @6 2  !a@a@$aaȐ 4aȰ 191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter㾈''\ '  $ &$ x x  :$ (4v$ $$ $ "$ $  @BÔ 44 " @$$ `2@$`" $@ $ 8 L$  P $ d "  "  $ ('?'$ d @ t 2̰ d    @ 2   $ d " $ $ $ $ $d   `$  *   $  $ $ $d    *   $   $  @.F ''d  $l " $d $d*` * 8"$` 8 " " $X $X*` * 8',' T  d2  d@   *@'d d   /#/#''4d   '('( & L & P@%  2= 0@ؐ ( 2. 4 "$ 2'4 '\ 4  "@ ' 4'%\%X%T@%@%Β ?`#p*`@$$&$@%؀ Đ ’`d@ *@'d  D ɪ   *@ 'd 2g  d!% !T "!L !L*` * 8 2!T@ @!T " !L !L*` * 8J @" @d & ! "! !*` * 8 2!   ! " ! !*` * 8J @"   B   $@; 2 @4 '   p'.d' d $* "@*`H DHH "H%DD,"* """ " """d ,"* D 쀠" '   2  ( ? '(?    ?$  ( ($ (     bؐ  D2  @ - ?`#*`@<dhhhLh`L  h4Ddh@  @,{   $ @  Ƙ   $@g e$ 8``d` T  0@, 20 d`2 (  d @(d  ?$  ?$  $ 4 $ 0 $  @,&  k$ , (@d ( `"&   @K   `  , $ ,`7@`5K  2.@  , '$ ,K   !  !*` * 8 ` !  `  K     @  1P & &(  &d (` x@6 2    t@T >"T@;    @  &;\ 2 ` 2X "0'\ ` X     "&\` X@@?x \` X  &\ &`&(X& '( !  x   ؐ "&d 'd *   &  & x$ |$  x@2 |& x"& | @+)  n d@#`'`   *@ `'d@@"& ($ $ (@*@'d  $@ $ 8#  ` $  @  $ 8`(d( T  0@/, 2'0 d(  d @(d  @ ?$  ?$ d  x@ : ( "    @ @>@   (" $ d @  x       ٔ "ِ$   *@  ?$  @*  "$ʰ   @~d 2| { @  @td 2r q @d m @  3`"  ?`"# 0J`^d $@  @8Wd''   ׎ "' @>L  ''  `>d $@  @7d     *?  $"  ( $ ($  $$  `#d $@ @@* 䀥@d  $@d " :$ 8  2   x@͖dBʀ $@d ?$  ( $ (   ʐ$   2   x@d#  $@d `"$    $  $   @ J?  2   ?$  ( $ ( @ @    d@ # $  ( $ ( @ J?  ~@  {#d "  ?$  ( $ (   J? Y X @ (  @J?"ؐ@   `_2'0 '0  P "0$  ( $ ( J?@   `_   9#  @J? 1 /@  ,#  2   x@d  $@ d@@  `"$    $  $ "  ( $ ($ #  /#d$@*  Z d@  ''  ^,  ( k'( d @ bؐ  "     d@2$ "ؐ@  8``_4`2" d2  T  0@, 2 0 d @$  `(  d@@(`  "ؐ@  2 `_   @jd 2א  ?$  ( $ (    @ "@& $ $ 80@d 0 "     ' '      Ր "$ d 'd   *   $   $   "  " d@B !   @(  2f "\ ! 2 '@ 2W '\ 2$ T $@ 4 @t 2? 2  ! # & L & P@@ 2, #  @# 2! d@$*@&$d @2%L$@    D  H@( x 㿈'``$@" `?``$6  ?` 2` 0"ؐ@  `$`_"ؔ?  ` ?@  2`_""ؔ? ` ?@  `_` ` 2"#\``$2 @?|  8'@'@ 24 #\  ҡ (/    2       `"&``"&`` " '``@`(@ @;5@' 㿘`?` J  2`  ``$"```$2 ?.  ? &㿘``p`$ l` h@8#&`&`b&` " # #*` * 8` `   L@ 2 2 @%& `??2L@7  2 @%&%`$@ "`$@@:" `"&``"&`` ,@` ,@`㿐'P`='  bP P5 'P J@   `P? 'P@"  @   ә " '  "  @:T@  @'  @:M'  193|Already at the beginning of the insert㿘 2  4@: 'h04$  ( 2 2  *@   $   $   ?&2 &` "` 2 &@"@+Ð `@% @?㿐# " # #*` * 8#p " #h #h*` * 8  J 2`@$$ 8 ` *@ *`  !]OJ@@ `*`@$%@$$  ``$ `@2`$ ``$@ `J? 2` ` J? @$}$$@`?&``( &`(``$8`@   @$g$$ &`  /@5   /@) ? 㾨&`   ` `?`L@  2` `  `$"``` `  $@ g` " &`` @ *,@#\    К B' 2 Bǖ  ,@`(,@`2. @%NP@a H2ΰ @  <  @2  (d@ &@ 2 ` -`@ * -`@@ @2* `     ,@`??  `"&``(&`( `(  ,@``(?&`(` ?&` (````  $@ Ѳ` "R &```&``&``  @@8f?,@`??2 `27 @ 2/ <  2( `` `  $@ {` 2&` ``( 2 `` `@80` &`` &` /,@ڬ  %s %s%*s 㿈 @ /$` * @@h  # @ @  * @ *`  !]e @  2 @8`@" $$@ '*@&$' 8@/?@ #bhT 2 t   ` `thT >f"hT@3cT@2 @2@"m 2   H; @7,@ kbgɔ    ` `thT >"hT@3T )b&@gT `@ Α,gb T  * gb T 2Tgʐ ?&T쀣 $ &$ 㿐'L  "5`LJ@   $`L@!L @*  * @ a]`LJ '(S`` `  `(` 2&`L `  "`L@@@6ݒ``&``(&`(`L J 2` &'L , `L @`*` * !X  `LKJ L'L,` 2 @`L*@`@" 㿘@ 9 `& L & L& P$ @&$㿘`` @*@`?`@  J@@"``$@ J 2` ! $$#ܒ @ #܀ 2`(```$*@`*@`"&``"&``` *?`(" ` ``@ @6C@`  ``@`(@ @67@ 㿈@`( ɐ?&`( "``' 2` @  *@ ``@ &`*@*  * @ a]'   `( ?&`(`J@  `@  @*  * @ a]`iJ '@[@" V'` `  `` " &`"@`@ `(` @`@5 `&``(&`(`J 2` ??(`*@??`'' @` *` * !X   `'J  `@ *@??`' 2}`(`"  &``@`(`  @@5j "'`` `  `Η` 2&` ` &``  2```@  *`@`(` `@5B `&``*@  㿐 4 2 . 8`4&`D`8&`H@J \2 `" J \2 JJ@2"`4J \"`4&`D`8&`H @*@ aȐ 2a$*@&$ 2a   @`4'`8'`D'`H' HJ / `Dȴ  `Dɛ 2`D& L`H& P . !  @Ò ,  .  2%  ?# @2$ &$ !&*@ !@@  @ז 2  (€  㿘@``` "` @ x@"$ xu `` 2  @@ $*@&$ Unmatched %sx@Z  2v ؔ @(Ӗ  2n `'`?') 2c  ) { (  ,`* !X D   2`  : `ߐ؀@*+ @܀@*# & L& P@  2 "P  "H *` * 8  *` *  *    @`` H@  ``"G"`$2?A"``""$3 ` " `("(`  "``(@` ` "`  "` `(@` ` "`"` "`("``"`` `$  ?H@ "` "` " 㿘( % @ x@2``, @@' (8@ @3o("@" &&( & 194|No more characters to erase㿘 N@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96㿐`4`8`0(5 3`   `, @ (  ?&`H "@$&`H? &`H@?    2` ΐ&`D 㿐`4 ߘ 2# `4 `8`0 `<`@@    `<ڐ 㿐     (T!" x'    t x 2$ tL  t x'(T!$(T@2 @@`  `"ؐ   * `"ؐ@  c*`@ `/  *  2    ` `t@hT >"hT@.@(#)v_undo.c 10.5 (Berkeley) 3/6/96㿘&`H  X`@*X  "4㿘  ,"a  X @2`0 @*X  @4   "44   `D ?`D@t@(#)v_util.c 10.10 (Berkeley) 3/6/96195|Movement past the end-of-file㿐`  @@  @ 0 196|Movement past the end-of-line㿐`@  ʘ ?`@ @ 0 Ӕ197|No cursor movement made㿘 Ô0198|Already at the beginning of the file199|Movement past the beginning of the file㿘`@  p 200|Already in the first column㿘       2J 201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi command205|Usage: %s㿘5!.@$ .0! (0 "0 0  0 P @(#)v_word.c 10.5 (Berkeley) 3/6/96㿘@  㿘@ 㿀`0( ``4'`8'̒ 2   *  $`,@  Ȑ `, Ā@!P@" 2۰ ?6 ?%Ȣ ȴ"     2 `,` `@Z@0V  n ؠ?j`, f?#Ȥ Ȧ"   bؐ@  `_ r b I ` `  bؐ@  2`_ @  `_ `,@2!`, "`,R        ?`,  @`4@ `8@`4$ &`<&`@`, "`< @ 2`,&`@`, " `< @"`<`4&`D`8&`D`@&`H 㿘@  㿘@ 㿀`0( ``4'`8' 2̰     2        2 % {?  r   2 H y ` ?\`, X?#   bؐ@  `_ p X ? ` `  bؐ@  2`_ @  `_    "`,C        ?`,  @`4@ `8@`4 &`<&`@`, " `< @"`<`4&`D`8&`D`@&`H 㿘@  㿘@ 㿀`0( ``4'`8' 2°    L 2       2 % {?0  r   2 Hf p ` ?\ X?#   bؐ@  `_  O ? ` `  bؐ@  2`_ @  `_   ] 9         ?`4@ `8@`4 &`<&`@`<&`D`@&`H`,    @`8?&`8@(#)v_xchar.c 10.8 (Berkeley) 3/6/96206|No characters to delete㿐`4    7  2 `0 P, (`@?` &`@?`@ *`8&`@`8 ? &`H`0" ``4`< 2  㿘`8 2`0(' ( ``8@ " &`8&`8`@?&`@`8&`H`0" ``4`< 2 s @(#)v_yank.c 10.9 (Berkeley) 5/19/96㿐`0" ``03 `4`<d  2#  t `<`4"@  & t`D  I  `0  > &`0`H ` &`H @(#)v_z.c 10.10 (Berkeley) 5/16/96㿐`0("`4`'     '&`D`8&`H`0@",`` '$T "$L $L*` * 88$T$T " $L $L*` * 8&`@s` 2n ` -" . +"`0@` ^"!`0:`T P (@x  2M `D @![ C `D <@p = (@b 27 `D @!E  2/ `D% `D <@U " `   'S` 'R@    `(`Y    @.   "<"D4<("<"D<((!"!@" @(#)v_zexit.c 10.6 (Berkeley) 4/27/96㿘  X       2  2   2 $"&$ @(#)vi.c 10.47 (Berkeley) 5/18/96110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted0  @ LА '@P "      *`" *   2@z 2ɪ Ȁa?" @ 4Ȑ $ @ 2 `0!` ?Ȑ# @4Ȑ@ T  *`" *    'x @' |  ǐ"$$`( @  L ` @`#*`@0X `( @"(`0 #L "#D #D*` * 8 2 @`0 "`0 @`*` * !X   @ @   "``(`0 @p@$`0 L' P' L$`D$`<$`4 P$`H$`@$`8`0@ `@ "`0 (T 2   o   (T 2 `0 ((2 ,`<?` $`< , $ ,`(€ $$ 5 @!  2 &@" &  Ϡ Ȑ 4`0@ 2`0  @&; L  "`0$ `Ȑ("` `Ȑ >"``0 ! "*`D % "0 " @"$`H0! 0`D@Ĕ @$`H @ 4Ȑ`D)`H -`D@ `D$ L`H$ P`0@@@ L@`0 @ L@ P@ 'ٖ  "     p (T 2     2$ (T "$ hT ?"hT    a$* @@$$@ ΐ 2   Ȑ 4Ȑ@N  2 $ w$$(T @2&`". &@ l,  ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command modex@ `?@   ;& &&&&& -&$耢 쀊  '@ `"2 `     @   耢 쀊  '@.0"&0 @  耢 쀊  '@ `"ؐ@   `0@P  0(&0 ' @y  耢 쀊  '@'`"6 `0"   n  @V  耢 쀊  '@.0"&0 @A  耢 쀊  '@ ``~ `*` * !X  Ӓ ` | . `*Ɛ"D @0("'&0 7&0  `~@_`~2 # "# #*` * 8  ! K&( ``.`*` * !X   `耢   - `w`0@2   Ӕ ! ,@2 0Ȑ!&(0 &0 ("0`0(&`0&`0".`@# L 0(@C2# @@0"8@@ @  耢 쀊  '@.0"&0 [ ] Z2? @h  耢 쀊  '@+ z2  ~2 # "# #*` * 8  !*`Ɛ"@`  z9 @(  耢 k쀊  '@. "ؐ@  @ڔ j 0 &0 @  ]耢 G쀊  '@. ` @2`*` * !X   ` 06 @ @і  *耢 쀊  '@.@" @    "  0  ` (d@ @0@ @  L   ° @" L ?'؀( '0( @!c'ؐ('0 7$&0@2'(0 &0 L&4&8 L@&<  O < I c !Cv&@ ? p&@'(!@  Ȑ"&(0  !  ?0 >&0 >ؐ ' L''' P'''€ 2R < <  c ! ֔ = &@!&(ؐ !0 !&0&0&,䀢@8 &4耢@ &4&8&< &4&8&<&@&D&H( @@"& L&` 214|Windows option value is too large, max is %u㿘  (€  2i $ ? &$" " "  " *` * 8$!& 4!` " !X !X*` * 8& 8$T $L *` * 8& D& < 4 ?@  & <& D < 4? & @& H ! @  "a  <*` * ? " ! L"@ !"  ! "`$ &$!Ȑ 4!  [  %d screens backgrounded; use :display to list them㿘 ``. `` ! "@"r "!2 $`  "` 2 $`"@$`$ `2`$`"$``ب ` 2 $` "``  2 $`"@`&` & `@2` $`" $`  ?212|Cursor not in a word㿐 L Ƙ 2b   P"J  "     ”E `"& P@  J"ؐ@   `_   "H @   `_   2  *H  "'a4 a0˔a4   $a0a0 @%a0*@ 㿐@ D D S C  $0 Y  _0 $/ d _/ c/ y.@     @*`Ɛ"@235|Number larger than %lux/ !.`*  ?Ѐ@ @& 2! "ؐ   8&?  @ 2  "ؐ  Ց.`& 㿘 " 3 24 ? + *  2 ߠ  (d@ @Ȓ Ԑ  `  @(#)vs_line.c 10.18 (Berkeley) 5/13/96%7lu 'd'\$@2$ !\ $ "` !&@*` *  *  *  :  @ 4 @ ?@`@ 'Td`2   (ptp !&@* @*`@*`@*`@ (:` @ l[h"  8 "*` * 8   `"  ``?@6", " "$ "$*` * 8'D'D$@D*'<'<" " " "*` * 8 0 @ `x X@@(Xdh W`d`"T@ L@2T !&@ *` *  *  *  : #@ 8"\#@T`2J(&`&` .``-.`"<@  ~<`" $ `*` * !X  v *  * @ a]X(X(l@( T &`  .`l'l`" ` `!@ @@    &` .`l@'l 8 "   "*` * 8 Ch" h<`'l @ # D` # " # #*` * 8#   #*` * 8#@F$*  * @ a]֒h *lP$&` H$@`'l @ # D` # " # #*` * 8#   #*` * 8#@$*  * @ a]* $ 8 h*l"  &` $@.`l?'l &` .`d`"T@ L@2 T P@  : PT`* x"x'4'Lhݦ xl`'l @ & D`## " # #*` * 8#   #*` * 8#@ $" * @ *`  !]!"  2 .`$$@.`.` $$@.` 'L&`hHTF`$ 2 L`<T !&@ *` *  *  *  : d#@$ $\#@" "" "*` * 8 2$T T$@ T``\@ #@T`T`2= "6 4 ,(X$ ,$ 4 ,(X$ ` *` * !X   @,`2 @ h ( 7 * @ *`  !]o.``.`.`h?&`<`4  "5 ,x(X$ "0,`2 @x(l@x ,(X $ (tp 㿀$@`  !D`hp !!8Jh" "" "*` * 8 2   "   2* ` 2  "%h !$* @*`@*`@*`@ h:`  X@hX  !("h @(#)vs_msg.c 10.65 (Berkeley) 5/15/96|/-\㿈$  9  "Q!\h!` $!`!\ 2h`2h$!d!t@ hp!l!pȔ @ 4@ h? hXhp!hhl@V @!` [?$!`!\ 2h`h @ 4@ ? hl@h!l@!p 2@h!` ;@ٟ !t" *" * "@*`@ *`!x" @z G@*$!t$!x!d "$!d @ 4@ h?!h!d$!d ahX   @ 4@ h?!hh€ 㿘 @ 4@   4?  (€ %s 㿐$  `     PВ`xQ hp @ 4@ h? hl@` @  8?hX"h@   8@ "hXhh€ %.*s . ; 㿈 $@ T $  T ?$Td@$ $T$@ `5```  (€  vO ` \   !ؒ@Υ`2\  @!$*@`&$ (Ӓ $ 2p@h0ʐaP@ `aX `     @$aX$aP`  @J? " 4 2'  'aX   8     @    @~n N " ""daX  8 0"@ N J  J    8aX" L? " "J " """ &J? ."@+"  @#  (T   9  2 (T 22N €'l  ںx @ S'@X@  8 8"@ X 2\ @ 4`0\ 2\ @ ? 4? l@@RȐ 4\ $\T $T\ @@2\Ȁ  $\T?$T?# 4\  @  @ 4@ ? \ $\T $T (T {    l (T p`  4@ ?Xl x\  x?8M@ " *  * @ a]@ ,@X$@ `*` * !X   ,@``??2 @??̪`@,@X$@l 2l\  l@$X`&4,`ptXx &@!Ȑ 4!$ " !\ (€  "$q   $*@f&$!\ ($$@2($ (T 2#$    2$ (T 2$$" @ `?`@@@@ 27 $ " !Ȑ 4!  @"!$ @&$!Ȁ $ &$$?c &$!\  '!\ 4@ "  ' 4'$!\$!X$!T@x $!\$!X$!T p  hpԟhT  ?$hThd@$@@*@&$ L  `l "(\$ 2`l@f  "`lE    `"  "` "@@ @`l 2hȐ 4\    Ȑ 4@  '\ 4@ "  ' 4' $\$X`$T@hԟа 㿘  4 ( a\@   @@:"@ "  ( (t@  @ @ 4@ (? (@aT @@ @p  @ 4@   4?(  4       F@(Xa\ $a\$aT(l@(€ `2&@ؔ ˖ #   q(d@/(T $(T   q (T $(T :` &@+=+=+=+=+=+=+=+㿘 8`8  (\  (X`(\  %.*s 㿘 @ )@ $ @T$ $   l`2@$" l l$ @ 2@@ $@" "@$  @f!h`@@(#)vs_refresh.c 10.35 (Berkeley) 5/7/96㿘`  *@ *`!@* J "`   `&` `@  㿘$ @ `   "$ @$$   `"   "*` * 8 2 `  " " `   "$&2 !Ȁ"  !Ȓ `@$` aȐ 2a  値`  $  !   @  2 $ &$ h   $  $$!  L$  L   @ 2 $ @&$ D @ "  ! L@:& @̐ @ 2  R @ N "  < @@z a "a@ Р? < m& < <! L@e@ @ @ 2  ( @ $ "U  < @@"P  ! @   !`"! a] ? < 6& < < @ 4@ (? (l@ <!!"*@ *`@*`@*`@ (:` (l@ <?& < a?"a < D@8  L  a L*2$a("$!2 2 <2 a@% L < 2  ?G D??""@  /??"!2w 2q < 2 a@ L < 2 * =  2:  !3@ ??"\"@  ??R"P܀ 2  L' ! ' '@ < < 2  ( L $& ' ! '' <2 @ L < 2   L   L  L @ 2 $ @&$" " " "*` * 8 2l$ a La2`$ L@ P ! L@2( @#" < 2 @ !` !"  @ $ @ &$@ U 2[  ! @  ! L@2($@#$@ < 2 @ !` !"  @] $ @ &$@  2/  ! @$ @`" " " "*` * 8  !""Ȁ 2  L2  P@ ؖJЀ Ѐ 2   P Sؐ ' P"@Ԁ@`   ' @  * @ *`  !]~2ؔ  ? *@ *` !]  ~Ԓ   *  @ *`  !]~Ē $ ]"T$ ؐ ' P"@-`' @ K * @ *`  !]~"  "*` * 8  8"  8?:$$"  "*` * 8  8"  8?:  (p̟ P ! L@" " L  2 " "" "*` * 8 ?   L P@Ę   )#    #*` * 8: # #@* # " # #*` * 8""߀ " "" "*` * 8   8  8  8 "$ 8:$ 8:$#  8`" # #*` * 8  `$@" %$ !  !($  ?'$ !8R P L@Ld ̀?2B$  !  !(, ?'$ !I ̀?" Ā "$Ġ  !$ @  D @ " P <@ 8 P( (l@` @@((  P$ L$" "" "*` * 8 2` `Ȁ  ` 23 `2``` 4 `Ȁ  `$@`@<` (̟`@D T`(€ `$ >&$?#J @4Ȱ LLLxLhLX219|Replace218|Insert217|Command216|Change215|Append%lu,%lu x  8?   L 2 &? /"(  * @ *`  !]|L(? * @ *`  !]|L$   8L @ 4@ 萒?   @2   "+l &`*` * !X  |L *  * @ a]|LX L  l@# "# #*` * 8 4# 0@ܐ  L@娘 'ؐ 2 %2   @ 4@ 萒?ؐ  X` ؤX#  #*` * 8 2  #   X 2? D*`@ Sتؠ$, @ 4@ 萒?# " # #*` * 8 2 0   X  XT YX؁@(#)vs_relative.c 10.11 (Berkeley) 5/13/96㿘 "  "*` * 8   "   ?@ 8" "" "*` * 8 2&@ "&@&@ 㿘  " *` * 8 ) 2 a a   @ @8@8D` " "!"!㿐'H`  Hɘ  H 2", 2'Ұ " "$ "$*` * 8" " " "*` * 8H "   "*` * 8 2 `" `2Q??' "` # " # #*` * 8# "  #*` * 8#@q&@ *  * @ a]{@ 8 *  2 8 @S$@&??'H` "` # " # #*` * 8# "  #*` * 8#@'&@ *  * @ a]z@ 8 2 8 @ $@&`   "5@ $@'㿐  ~ 2    ? T @ 㿐 ~Ƙ  2",ư " "$ "$*` * 8" " " "*` * 8@T 8@ 8 H 88 # `! # " # #*` * 8# "  #*` * @8&@@~#&@ * @ *`  !]z ɠe 2 8  8$S " ` # " # #*` * 8# "  #*` * 8#@:&@ *  * @ a]yɒ* %? 8 @ 8@ *  2 8 @ $$@2 ?@(#)vs_smap.c 10.23 (Berkeley) 5/7/96㿐 ` `      ` !@8  !@/"  " q @&! <?"2 L ?& L! < "2 L  & L!Ȑ K4!!Ȑ 4!$! L2$!Ȑ 4!$@2 `2! !\ ( !Ȑ /4!(p00@ @ 2 !Ȑ  4!@  "   @ ( 㿀 ! < 2, $ @ &$ kL`0 ''' <2 @ < 2 @`1 "'   ' <2 @ < 2 @( 1 `8.  !"@ !"` !c "   !" !"  ! "`  <! @ `u   <2 * @*`@"@$   $ @֔?耢 Բ ? !  <2 * @*`@:P  @ / !  A ` !" !"   a"` !!(, @?耢 2 ? ! @ ! " !"  !"   !@P  L  !  㿘 !@2`" "" "*` * 8  ` `  !@  @2 <`@  <* $ &$^  !$@* @*`@*`@*`@ :` @ 2G ,,  !"@*` *  *  *  : " * @@* !"@ 8  @?$@`@ (@ ,@*`!"  !@@ǔ` 2 ` - 2  !@2  㿘 !2  <* $ a&$!",`*  *  *  :  8  !$* @*`@*`@*`@ :` @H ,8 ,  !"@*` *  *  *  : " * @*  $  !( @$$ $ ,  쵖 ΢`@  㿘 !2" "" "*` * 8      !  a2  `  <@ @$ &$@, k }*,ð ]$ !",`*  *  *  :  8`(3   !$* @*`@*`@*`@ :` @ 2 - *  a"*@ *`@ *`@ *`@ :`"@`*` @* "w  !q$$ ,     `$@  !$* @*`@*`@*`@ :` @< - K @*` !"* *  *  *  : " *  @*  $ ,  ʖ ܠ `2$ - @*`!"  !@E  2   뫖 2  !2  㿐 aȐ 2aȐ@ 27 "!4.@iTitititiTiTiTit@ @  @" ` 2  @`   ` a@ 2m  !@(& D{ 2! D !@͔ 2Q @(  D{ 2 D B  @  Q !@'`'`'` '`'`'@  2& @Ȁ @{k '''''' !"@"`"`"` "`"` 8 2  @  @Ā  > < @@9 a@M  ! " { & `""`"`"` "`$"`("`, a ꘖ k2 <Đ ' < & <&@ &`"  4  a@  K ! zؐ "@ ;  !8?   !(?! 2 2` " `60D,"C 0>"P &@ T@ 8" "" "*` * 8 2    "  ? @ 8*&` !"  ! zo    @   2    &@ &` 㿘 (  @*  2%  4 2  a ! 4?*  `@* !@T "  a 鹖 㿐 4  (l@0(p@ @ 4@ (? (@(2(t ` ! $" " " "*` * 8   !    !܃ _ `? D @  \ !@'`'`'` '`'`'@F 2A (@Ȁ Ȁ 2'" " " "*` * 8 Ѐ ''''''ِ !"@"`"`"` "`"` g  2  @J  @Ā  / < @@* ! 2 " " " "*` * 8  !   a "a@ g < & <&@ &`"  ;  ! " " " "*` * 8 ( !  "@͐ 6  !*    !: ! 2 2v ""  0Z0"Y 0T !!(Q x 2K ? !C !' *` *  *  *  : .* /' ,!`": &@ T@ 8" "" "*` * 8 2    "  ? @ 8&`@+  2    &@ &` 㿘 @ 4@   4?( (l@ <!!"*@ *`@*`@*`@ (:` (l@ <?& < a?"a < D@8  㿘 (  @)  2$  4 2  a ! 4?* `@ * !@m "  a 禖 㿐 4   @` (? (l@0 (p 4@ ?( (t@((@2 @ 㿘." "" "*` * 8 2@  @ &`&@ ` @ & &` & 㿘." "" "*` * 8 2@ ` "`@?&`& "@@&`?& &`?㿘 a L*> a( 7 5 ! L@"   L  2  !8# a"  @2&@  2    2   P@:&@  a 220|Movement past the end-of-screen221|Movement past the beginning-of-screen㿐"+ "s 0 !!"@ *` *  *  *  :  .* @ w@ 2 (!v@ 2. w 2  !@  ! (    !w&*` *  *  *  : 2 @:`*`b !!"@ *` *  *  *  : 2 @:`*` *  .* N!!" *` *  *  *  : 0.* "v 26v 2@ @  ! (    !& *` *  *  *  :  . P * &@ 2    &@ &` 㿘 b "b`b*` * 8 2@ @ " @@.&@+&2@`%?@`? R ?@J `"   A   @(#)vs_split.c 10.24 (Berkeley) 5/4/96222|Screen must be larger than %d lines to split㿐 4      <  2  8  ! @b ` "a ' `! 2` ! L"@`!" `! "` D @ @  8&`8 2  !"@*` *  *  *  : @ "&&`4 4"&`4 H&`H& 4 H`4 & H&@ &``  2"$`&  `4* *! @" *   @ ؕ* 4 4"@& 4 H &`H&@&`` 2" $` & 4 ? & @`4 ? +&`@ <`4" & < < @ 8& < D @ 8& D$T " $L $L*` * 8&`<&`D`<`@ 8&`<`D`@ 8#&`D"  4 ? & <& D$T " $L $L*` * 8&`<&`D`4`< `  &`<&`D  4  <*` * ?"``4 `<*` * ?" @2  &  & `@2  &` &`d@ @&d 㿘 `"   L"`  P"` ` 2`   " 4 4 "4    "   H"H4 4 "4  `2&@ B D @@ 4?& D& < 4?& @2 &   <጑*` *  "?"?"? "?"?"?  <*` * ? "  0  s  $ n $@@ &$ 223|There are no background screens224|There's no background screen editing a file named %s㿐@ 3  2 `!!#H#p ~ݔ#  2 "  "`  2 ""@&& @2""" 225|You may not background your only displayed screen㿐) 8  2   "}U.  2 "  "`  2 ""@&& @2""" @g! "!& $ &$ 㿘 ````  @ȇ "``2&@&@ `" &  L"`  P"` ` 2`& $ &$  !"a D @ 8$ 8 4$ 4 H $ H $T " $L $L*` * 8$ <$ D < @@( D @$ < D @@  @$ D 4?$ D$ @$ < @2 $  ! @  "a | ;   <*` * ? " LD  `)  2 $` "``  2 $`"@$$ ` 2" $` & aȐ 2a$@ @@$$ 227|The screen cannot shrink228|The screen cannot grow226|The screen can only shrink to %d rows㿘`   @"  "  @&@  `& ` @ 3`   1 /`` @ *  2  4 ``##  | J  @   #|  >  4"# 4 H# H4@"4H"H<@"<D@@@@ "D@@"@ࠑ.`*  "@ @" <"# < @"# @ D 8# D .`@*`" "$@ @#$ 㿘@I:LRS:c:dfh:i:l:np:qrs:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %sbad preload value: %sbad packet size: %spacket size too large: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocicmpunknown protocol icmpsocketbindping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom8@  /!$",-% $!'#@$Hh?? .* p`  0PpP@ %# c@tX Đ @$ @x   !#@0  @tH# $ !@Ē #@[Ā # c@t5 $@^ "a #c@t' Đ $  $/@6}# #c@t Đ s$  Đ $ Đ@l# Đ g$  Đ c$  Đ _$ @  @L2` #c@s @/ `/ `/ `/ Đ"B$ @Y^ "` $`@s^ ?#@1# $` @s@B/  $`@@s $ Đ!$ @/^ "a $`p@s@ ##0&*  @@@! Ȓ @  Ȑ , Ȑ ,@ " @L2 `  $`@s,`@@C` @@֔ "  Đ  ^ $@si`  "a^  @ $@sc` Ā  ^ @-`@ @!?c $!$@Jz Д  $@s7`ؒ @d쀢 "`ܐ $@s8` ' Ā"!  @暔   ,  *`"` @n   $@s` Ā @  ?c @w  Ā   ?c @w  Ā  /Ȑ '/ɐ / ܒ  @v ( 6$@{!@n !  ܒ  @v   $@rؒa!  ܒ  @v٘   $@rƒa8!  ܒ  @vǘ  0 $@raX0' ?c@v   !'@Hɐ^$!x @  ^$!`@ )@嗒cܐ &@哒c@2 Ā  @C #!  Ā  @u'' ܓ,'   @  ' ܒ @  $#܀ $@ݐ!@ 䀢` @@ 㿐@< &@=c 䀢`^ ^! ^!B^(ąB' "  ^! )@cܐ@uping: sendtoping: wrote %s %d chars, ret=%d 㿘a *a- 5 ` "`5 !5 , 4 '^@<#a4 @  *@ * ,!  @ ^  @H5  a  @ 쀤 '@G x' `ؔ@ Đ   ^a@˔ packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%.3f ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (same route) RR: NOP unknown option %xx@  -  @ Ā!'@Gr'"@D0&@ ֪`a ` "`! ">` `/ ` / ` / ` / ` / ` / `/ `/"@'"@`''А"@@'^a0DčB?^! B:! ^!):!^!؁-:!`^@`: aJ :@` ` "``?"` `, 4 '^@<#a4 @  *@  ,  Ā = "  ^a@ c '@F'"8@`'"X@ !  '@ݐ"` '@ؐ"p! ^ >`'!^3''' @ @ "x@Œ  .`!^ ?$ @b@ @ ` ` ڒ`  Ā!@'"@@g  + @ "'  " '< ''@|"ب?` @`` @* ` @@* ` @@* ` @@'@c"@a!'@\"}?a? "a`%a*@ @yȒ բ`` @` @?a @ @`D@ܔ  Ā 2'@$" ?%@@" @ D@'@#` @* ` @@* ` @@* ` @@'@"@!'@"?a? "a`%a*@ @yd բ`@#?#@ @? L` Ā ? " " * @yC @<! ` 3f` `: +ff:? :8 3f* 2 #--- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max = %.3f/%.3f/%.3f ms 㿈 @7 ? " " * @xӒ @̐!)#@M`)# @H`)#@@C` 耢`)@<#X ` )@0#p "@ * *  @e* )@ #? " " * @x  `% ! ^^! 8 F @' …D^^a #\a)?@# @1`?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set Source Route Failed Dest Unreachable, Bad Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Bad Code: %d(New addr: 0x%08lx) Echo Request Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply Bad ICMP type: %d 㿘`+ *`@8H 0@P`p*@!0 `%*`+!l@*@"0a*@"(0]*@"H0Y*@"p0U*@"0Q*@"0M*"H *@"0E  "*  " ** "**@̐"*@Ȑ#**@Ð# *@#@*#h@ *# *@#07   "* **@#0 @#0 # +  @@ڐ 0+@ (0+@ 80+@ P0+@ h0 +@ 0 +@ 0+ @|Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐 , +@J#2`+#2`  V @@ V 2 ?, `@8* ,   @2  '@C!,@) ( '@C@" (  !, @ 0 ? " " * @v %s (%s)㿐'D Ā  DD @EД  D'@B l#@Ӓc 1'@BՐ l,ax@1 lTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘n `*`    *`  * , "  , *`  * "P@ @ patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ ,Jؐ  D @l*#J ؐ#\#`#d#h#l#p#t#x#|###,c8@Ġ? #"?#" @6 @ .`@ ò`@. (  Ā ,@'#p @ ,#,`0@`@&`0,@#usage: ping [-dfLnqRrv] [-c count] [-I ifaddr] [ -S ifaddr ] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘!h-@ޖa(@6 㿘@ dfiPRrW㿘@  -@G<b,"!L5--"-, %,#,+,),@0?N? 3G* |\dp%T$\$aP$\$aP%aL %!H@#0&*  @@@@ ,@̐ ,"a`@,@Ð,@ޥ!X%s: %s%sfts_read㿘,!\   ,!P  ,!`@   ,!H 2`@ci 2. @j !#,/.-, + $@dI{ $ 4? >* h<\ @  (@jŔ "2 4a\ "    @ (@y%Xa\   @ < Đ@e@ &   a\ 2  4  @ <  4    ,0 ,0 @n  @n`  !L  @ @I  a\ c܀ . 0@y %X#܀  .@jk`8%s: is a directory8`m 3,8!+,/ $-.), %<@ aH Ma\ 7  !.@  (@yAJ%!X   a\,!T a\.#@y09%!X  8 @  ", 8 @m  ,@nS !L @@͐ "a\ ܀ "0@y%!X` ?c8`2 `@' ,`<   @  ?#@ @=`0   @ ?  ?c @ޔ<@ d `@; |,  @ t,`r ?#@ @`0   @ ?  ?c @P<@ d `@ B,  @ :,`8 ?#@ @`0   @ ?  ?c @j<@ d `@ǐ ,@v  , "!X. 0@x4remove %s? override %s%s%s/%s for %s? 㿀,!P  !h0`@/,!` "\ < ( T@ܒ  "P @ߒ @K( @KV O -"0 8#\!h0`@˜@!h `? "`@  "  ` 5 `y ? & @`& @` `y `Y "." and ".." may not be removed㿘 ; #,@m ? /2 *@@8J@@mܒ /`J@ .2 J`  .2 J` 2    0@wr! $aX   &  usage: rm [-dfiPRrW] file ... 㿘!h0@6c@֐ 㿘@M㿘 @@)`@㿘`@@# @`< <   <`<  `< <  <`< `< <((  <`<(( `< <004 2  <44( < `< 0`04 ?2  4`4?  <`<004 2 `<44(`<  <`0 04 ?2 `4 4? uappnd,uchgnodumpopaquesappndarchschg㿘,*!h  !h1@3aP1!X  `,@*!h,!h1@%a`1!X  `,@!h,!h1@ah1!X  `,@!h,!h1@ ap1!X `,@!h,!h1@ax1!X@ `,@!h,!h1@a1!X `,@!h,!h1@ܒa1!X`,`!h ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐` &@2&')@'%1@ouc@"$ &L "1 n2 L  o2    ?* : `2 T*`@Ȩpp8ppppppppppɠpppp81a@ޔ  1``cH@Ҕ 2 `"1&`"1@&@`?1cX@Ƹ  2ǰ `"1 &`"1@ &@1ap@Ơ  2 `"1 }&`"{1@ v&@1ax@ƈ  2``1c`@|  2`"^1Y&`"W1@R&@1a@e  ``1ch@Y  1cp@R 2a `"41/&`"-1@(&@1aP@:  2``1c@.  2`"1  &`" 1@ &@1a`@  ``1c@   1c@ 2 `"1 &`"1@ &@ COLUMNS1ACFLRSTWacdfgikloqrstu㿈@A @  3@ " @_^"c`h@ 2,`^"#,, "bH", "b(@jq  , "b3!), ',%,1,/,-,+^3@b??π D* D ,8ϰ@P`͌lxόϘϤϸ%"($D$$%"($D$D%"($&"%<%<&","" `%` ,"",""%,""4,"" ,$"b, ,""0,|""H,y""w%c,t"",q""L n%c,k""8@h3#0&* ," ,"D ,,"  ,," ,^# "`,"D  ,," ,," "`,"8 2`,"D `," `,,@\ܒb,,",", &!: "@," (^# ,  0D, ,@,<#19 "< ,02#," ",1* (0'## ,  0, ,,#1 @"< ,0 #," 1 ,0#"a,"( ,6 ","D 6#t,7"@"a ^c@@ %s: directory causes a cycle%s: %s %s: %s: fts_read㿘,"4  6!̐@\2 @dL @^ @l ," _,"  . a5,@]L $`4 " 4  "V`20 !40"@s$`@0!4`@@`#@s0  N`@ .,"  4#@@`  4#@8` &@^@,"  @^~ 0#܀  4@cc -%lu%qu'`#''l,"   ,"D 2'l," "''l' '  '''|'t   4   !4@@#@r `2 L@4`,," ,$ . ,," , $ "H @ @B&&8l`{ <`8   2``< (``<` 8'`  8'`08 `02`<`4(`<`0`<,"D "S` @E @t 4't`@E @| 4'|,b0 5`Dya@@ 4'    @\   @c& $@ $ @`< @@@, ',b0  $ @ϒ$2M4J'''l`.''̠ #5a @-@ඐ''|' a @!@ઐ' a @@࢐' 5@(@'t',!@, "a,"D  @f㿘 4"' @ 4     [@,R 2 2 ,  ,?!€@㿘 #   @ a? "a`$a*@ @l#   2 total %lu %*lu %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd %sxR 2 ","D 2 ," "  ?,b,@> 6@i#-6+<) ," <6# @U`," , ",?: `8@ B  @;   @@`@ 6 $`  , #\ #`#(@0,"0 6#@ @' ` @@2  6#H `@ `,    (6#X"@ 6h@ `0,  (@`0,"< ,`" "` `(@6#p@@," "`@`` ( !@7!? "! %! * @kT 2s 㿘^ X@$"X!, !@F*` $!@p ` ,!` ."``2` ,"   ," , ," 2 ^-# ^ϐ0q#@ʒ@ƒ@V 2`R 2  ,"D 2 ,"  ?,b,@: 6@e# G9  @- ,- @ @; " ?4`!`?`$``@ @`$@*@@j $``@צ!? "! '! * @j 㿘 <,"  6#@ `," ,",?: `8@ B  @ӳ;  6# @6#p@ @," @`㿘'D@%D !L@ ?`&  @  `&*@ @jI  $L@,"L  !L@ ?`&  @  `&*@ @j*  $L@VD;!@f  !L@ ?`&  @  `&*@ @j  $L@1!?`"@  " *@i  !L@ ?`&  @  `&*@ @iՒ  $L@!?`"@  " *@i 㿘<(@"6 @ @ ] I0@88@FT I!?`"@\ / " /X*!?`"@K | " |G*!?`"@; @ " @7*!?`"@* = " =&*!?`"@ % " %*!?`"@ * " **@i<   %s/%s ls: %s: %s -> %s㷈V 2 2  $6p@ @ $9@ @@c$  $@0#ܖ!h9b@30 *79"@J  "؄H ? (usage: ls [-1ACFLRSTWacdfikloqrstu] [file ...] 㿘!h9@c@Ң 㿘@%s><@=!:illegal -m option format: %s㿘@h@2  2 $ $@#ܒ:@@ P$,c\ 2--"c\"#c""c$ $ :@`X $ i$ @$  :!t@?ߑ* :  9*  0DDDDDDDDDDDDDDDDDDDDDDDDDD$ D$ ; $  5 $     $ IJ`N@ : $: `@ C ::.@`@m$ N@ $ , 8 $    "$ : `@$ 㿘,#\`I:#d% $` "` @> 2;@` 2* & T` `?T`6   T`4   T`$   T`&  "@``2`㿘N B" @%s: %swrite to stderr: %s㻘 @4   $@#ܔ; h@B';% $@$ @?@ܒ@.p  $@#ܔ; h@#@㿘!h?` "@ . :  `"*@@gr tset: 㿘'H'L'P'T'XH!!h;@Ѝa!h@Ѱ!h;@Ѕa@% 㿘 !-@곒##  " , -# `" * -# `" * -# `" * -# `" * -# `" * -# `" * -# `" * -# `" * -# `" * -# `" * -# `" * -㔒 s#@" "? @k" # @a"  @d kbbcbsos㻐';#@N$#<@r"H -c` ?"` <@h"P -c` ?"`-c`  "` pcrsisrfif㻐'<#@T  $*b@\-#Ā ,`'<#@@  <#@9  ;@$P '<#@* <#@$ ` `!h?`"@&  " *@e @憐!h@l\ stctchcmOOPS%s 㻐'=!`@=!h@!h?`"@  " *@eT  ;@ܽP=!p@ƒ =!x@޿M -#4)=%;`! @J@ O  -#@ J@ O  @܊P ==!ha@? @}P -#Ԁ`!h?`"@  " *@d   TERMunknownTERMCAPtset: terminal type %s is unknown termcap: %s㿘!==@'#@: "=@ /  @D@ "= #!=@ #Ȁ " NJ /"N@d#N ? %,N    @2%,#!=@{  #Аah@Ɣ@$ ?, $#܀ " @=#,#&@ Terminal type? [%s] Terminal type? 㿘  @%>@͖ap@6 !h!, >>hax@͉0h@ͅa@S"P!@P 2 "P >@vap@ @I 2*L"P 2"P >standard error: %sreset-a:d:e:Ii:k:m:np:QSrsarpanetdialupplugboardcoli|:%s%s Terminal type is %s. EraseKillInterrupt%s SHELLcshset noglob; setenv TERM %s; setenv TERMCAP ''; unset noglob; TERM=%s; TERMCAP=''; export TERMCAP TERM; 㿈@s -@Dc  , $@#ܒ>k",`-cc"` " " "  " " " " "  $"$ ("(@! $4 @@_Q / @Lbؐ  >@ b - P"c@ؐ      ?!l! $,#T,#P,#X>@ x??Ӏ F* @4 >A">>"#J@ ^ #J`  ?  `#J% #J@ ^ #J`  ?  `#J%#J@ ^ #J`  ?  `#Jm$@ >":#f>c a _ ] @oZ>#0&*  @@d@쀤=>@<"1-#&#>@6"!-#$# `h@E  #  #    77 `g@0g!-#,c`@Ӕ ,   @`#쀤 L :>@ b ,@a֐2 , $@#ܒ>#,>#@`!h>c@˜>#( @R >#0 @M >#8 @H  >#H@ْ@쀦 >@#P">@^?>@ucX 2>>#`>##>#@@@@ %s %s isset tokbbackspace. delete. control-%c (^%c). %c. 㻐-#@,#p@:@@""1!h@@,b'@"@v O O  !h@@b0  !h@@b0  @!h@b@0!h@c@-e^H-i^C-k^U6A8A@AHH-2(  "H-2  Heik2 H2 Hi" "ke"" ""  2Husage: tset [-IQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘!hA@ʣa8@C termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐'D@N : 'Aڐ!* 'A!A!'A%AD@_ƒN D@耢 D@!?`"@ : " :*@a %A#!A@_aNAؐ   N "AN倢 E*    ( <  d d PA@%"A@""HNA@"CNA@">NA@" 9NA@"(4NA@ "0/N!?`"@  `"*@ @`q N !?`"@  `"*@ @`Y Nd !?`"@ : " :9*@`C 6A㿘@Zvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedBNRWb:ers:w%sr%s%c/dev/%sr%s%srioctl DIOCWLABEL㿐@m C P!_  #=B@?u? 8n*  4 X | " "'@ '$""  @  $"" "'@ '$"" "$"@ $"cܐ $c"  @  $"@ B#0&* @_b   "b-@ -@"#J /!_"BcB@ c="@N"cؐ " $"=-c"#%='_☐ ` @ `! $#܀ `-#J /BcB@!_@'-cِ $"☐ ` @ ``_= Bc@UI"?`rC#*`@   $  Ѐ @ U@j@ڒ] @ J@_!@|@AM? 5@ 95#=c@`B@c؀ B c@U`@N 05*cؐ `m@. % B@Tc?  @   ``!=@#%5ؒ#@t#@ᚔ!@ @6@Vunknown disk type: %s㿘@UR Da`@T@z! @% `@ ioctl DIOCSDINFOlseekwriteioctl DIOCWDINFO㿐 !W&&6@ݐ6=#܀ C E`f@Ô   $#܀  D<!  @ʖ 6 D!' `m@䦔 6B@q#@ D"@q 0' `m@䎔  B@q#   E`g@䂔  D"@I %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘 $#܀    " DB "DB@b#0@b#0 E@b 00E@bߐ X0@b#Ёno disk labeldisk label corruptedioctl DIOCGDINFO㿘=#܀ =  @   5c@c E= Bc@Sؒ!85#="Ā !W#E="2  2   aH@ؐ*  aH (@S~ =#E`e@㷔  E@S}a`Bootstrap doesn't leave room for disk label㿘`( "&`(&` @ @Δ!!TE!J  @SHb *J# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsect bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # milliseconds track-to-track seek: %ld # milliseconds drivedata: %d %d partitions: # size offset fstype [fsize bsize cpg] %c: %8d %8d %8.8s%8d %5d %5d %5.5s %5d %5d %5d %20.20s # (Cyl. %4d- %d) 㿘=Ech@ń`  _*Ecp Ec`@sEc @m`Ec @g`E@cc`X E@\c`X E@Uc`X E@NcАE@JcEc@E`(F`@@`,F`@;`0F`0@6`8F`H@1`4F`X@,`<F`p@'`HF`@"`JF`@`LF`@`NF`@`PF`@`TF@ a , \ ,&  #F, a(@\ , Fa0@`F@aH ``_"8+F *Faa@ F*aFa @  #FF#F @&a@ıa @a@ĥa@ğa@`8F@ėa@`8  ?`&  @& *`&*@?`&  @&  & *@[H `8 @ݔ?Fa@g@`8  ?`&  @ *`&*@@[%F@Ma`n@wre-edit the label? [y]: 㾀#_@bbG@Gc2T B#@`Vbl B#@`Pc_@"b @V !@ _"!# @Z JB@cؠސ @Ď!@g  @Ք!5ct "_G@E# @۽?? %?@2?``$` @  n? n? $@ ``$` @ ? n N_@" forkEDITOR/usr/bin/vi㿈' ' ' ' @! $@Xr#܀ #$ @aE 0' @ @Uo@T@UK@TH@!8H!@_@O @n,@ @ H@_!0 @-ϐ쀢  @ؔ 쀠`? 㿘H@bN` 㿘H@bL 2,   H@bL` # line %d: syntax errortypeline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐  &`&`/H5H-I_"8#@̔ > H@Ғc02,@@6 :2 ,H#8"$: 6` H@jcP 2(_B#_" 4_"4 " @U _ *@א 'H#X@^_6`H@>c 2*' +ܐ@0㈀  '@' H '@c H '#@^- 2L@{&`XH@c  `"qL@ "m 4j@, @"`\ Hc@    H#@] 6`J H6`F!I@В`  `I@Ȓ` `@1 0I@`  @B '! &`(I@`8  @1 '&`,I@`H  @# '&`8I@``  @ r'&`0I@`p  @ d'&`4I@s`  @ V'&`<I@e`  @ H'6`HI@W`  @ݐ :'6`JI@I`  @ϐ ,'6`LI@;`  @ '6`NI@-`Ȁ  @ '&`PI@`؀ 2 @@  ' @]- }&`T IL` I*`: `@I *` @@{  'I!(@] $I!@\ @a  'I!H@\ $o_"8 D_"| " @ $ *L@"ؒ@ `  @3' : ' I!p@\',  .3@ $#(@ '@ٟ, @ $ @'@و, I!@\x˰ @4!@\k @`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %d offset %d㿘 (  K# , 2 0K#( 2 4K#@@[̒   2 HK#X@[Ò  H 2 8K#p@[  8 2 < ,@ 0& 8 < 2  8@ 4& < 2 K#@[  @ ( K@[# K#@[  @ ( " K@[# `L @[   @.`-L+L)L`a,`     *`X@[i:`  <@,`@[a:`   <  ,@[V:`` @&ے`a`4'L,`    `a@[= ``,`%-43s%s %-43s%s %-43s%s %-43s%s %-43s%s usage: disklabel [-r] disk(to read label)or disklabel -w [-r] disk type [ packid ](to write label)or disklabel -e [-r] disk(to edit label)or disklabel -R [-r] disk protofile(to restore label)or disklabel [-NW] disk(to write disable/enable label)㿀M p#\M #`M #dM #hM #lM #p!hLcLMM (M@`X@D  (    *`2 㿘@Bshutdown: NOT super-user -fhknr-nshutdown: incompatible switches -f and -n. shutdown: incompatible switches -h and -r. Shutdown at %.24s. Shutdown NOW! ???shutdown: forkshutdown: [pid %d] shutdown㿘@@P0 " >!hM@>b@ސ "" 7MM#/> ->+>)>M"0#>@(?^?Ӏ EW*  8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 %% %b%"$b@#0&*  @@>"  >" !hM@b8@>"  >" !hM@bh@p@@$`@ >"$$"$ @@$@`, @@f`@  ,,  >"$#%$@`@ "!>L L $@,, !>>@J"$$">"  M>@}"M@"0@"@@I>b  "b @O @9 "M"$  @N?@R`M@g"@Ԑ "MM@"@͐ " @Zz @㿘>"!, @ __#>#b6>" "@ > @& >"  @ّ @(@a@Z@\!,@T @Z   @%s -n/usr/bin/wallwshutdown: can't find %s: %m*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %d minute%s sSystem going down in 30 seconds System going down IMMEDIATELY 㻈>`  "`> @v!$O#O@ߖ`O@,:`Ѐ ' O`@X`0T O!(O!0>O` >@g "X >@|" O@]a8 > ;@ < <O!O!(O@JaX > OaOa@>>" >"$@S??@&?"$  O@Tc@LV @,N@LR  @K 㿘?"$@&? %s by %s: %shaltreboot System shutdown time has arrived but you'll have to do it yourself /sbin/reboot-lshutdown: can't exec %s: %m./sbin/halt㿘>"  O>" "MO#"#> Oc >@X"$@Yz O@%#>" P@ @e >" >@ >" >!P 0OcP@@G  P`H 0>" !P hOcP@@G  P`H h@WM@fC" @ @0 nowTZshutdown: that time is already past. 㿐P@ǒa >""@uN +  Nbؐ  !>@@* "@*`$"> "%# 2 L* : bؐ  2 L : @,  , , , @ L 2 P@Q!@z@ "(N "3N0c  _N?Г* @*`N @$  N?Г* @*`N @ π`$ ` $N@N?Г* @*`N @$ ` @N?Г* @*`N @$ ` @N?Г* @*`N @`;$ @$@}[>?"b@>>""  "!hP@Œb@e @t/fastbootfastboot file for fsck 㿘Q!0&@!Qa@@ @/etc/nologin NO LOGINS: System going down at 㿘#Q@wa !Q@" @" @" @"a&@Д!Qa@׼ ">@{" @׵ Qa@װ !>@R"$@ש"$@ǐ㿘>" Q@A!@ shutdown: bad time format. 㿘!hQ@Ib@ usage: shutdown [-fhknr] shutdowntime [ message ] 㿘!hQ@1c@ѐ 㿘@ה (    *`2 ,-o %s: option not supported㿘@P' @G  Q@Oߒcؠ5L n L  o  @ = 2*@~3 "   "Q @2    &*@& c@FܔȠ @7asyncunionrdonlysuidexecdevautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:i:k:l:m:n:o:p:r:s:t:u:x:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracks%s: bad sectors/track%s: bad spare sectors per cylinderswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%d㹐@@@J /` "c @"c`#R@Mta ? "cp`c "c@P R!@?#p R!R!S#ܤ ! $@ܔ?!? 9*  T0 T0 T0 T0 T0 T0 T0 T0 T0 T0 T0 T0 T0 T0 T0 P P T0 T0 T0 P Q T0 T0 T0 T0 T0 T0 T0 T0 T0 T0 T0 T0 Q Q4 QX Q Q Q T0 T0 R T0 R$ RH Rl R R SL T0 Sp S S S T0 T0 T`"#`"#@|_#` "c|Rʐ!`#"c@|R#` "aR"@|I#`/"aR"0@|@#` "aR"H@z#`c "c@|1#` "aR"`@|(#` x"cR"@|#` o"aR"@|#p f"cR"@| #` ]"aRx"@|#` T"cRo#@{#``"!`c$HRb#@{#` >"aRY#0?#p  #`a`F0R@McX #`&"!R@Dc` R`"!@ #h@{#` "aR.#@{#y  "`DR%#@{#` "cR#@{#` "cS @{#` "cS  @{#` "aS 8@#@ݐ#0&*   @?#p  ?@?#p (@S@`` "? @c!"' @'  ''$''.7( 7*7j't'| / 7t@I+ /`!_#xS`h#S`p@#x@p? _#xS`x`p@_#x`# N?@ 6 l $@z#ܔS @`l@9=    $@z}#ܔS @R S p@  "? &?5S? r-Sl p@Д ,@g @b  ll@'Ll!?'l?#p !`# "@C| S @#v @ 6  $@z+#ܔS @@p 6 x $@z#ܔS @x<   ?#p 2 @`S c@g@@˒ ?"SJ?`` `@?M@bؐ  ?S @@?#p  `c `"c@mM@bؐ   M@* :@ 2 ` S!(@@M@ ` `S!P@@M@`c `@"c`#@  ?#p yS!@@M@y`D 2 ` H "`D."`D`c 2 ` 0 "cS!@l@`c 2 ` , "cS!@_@`c| 2 ` ( "c|S!@R@`a?2` L "a"a`c 2 ` J "c "c`a  a` "a (c$ "!`! ! ` @`  $!`!* @ "`!! 2 p `@a? $ $pc ``!* "c`! `'`ᰀ !!hS@#b!hSbH@  $`a?2` @ "a"a```#a "`a?!` B "a"a!```#@jc`a" $# 8  !hSbpSS@"`c 2``!2 "c` P"cxy T"`@@'`'`'` 'ܐ@`#  `@ɔ  @v`# @@?#p .@ pS@b'?'`!Ȁ  ''`#'\``#@c|'``R!`@F   $@x#ܔS @V`@& ioctl (GDINFO)㿘E`e?@ɔP 61?3`cy`L "`L@B S @4c0 W@P" `!@,1?"Pioctl (WDINFO)%s: can't rewrite disk label㿘y L 6!6 E`g@я W@Pb"W"@㿘'H'L'P'T'XH @   `# @Qs  @P@Q@ms@ usage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device%s [device-type]where fsoptions are: -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -s file system size (sectors) -r revolutions/minute -t tracks/cylinder -u sectors/track -x spare sectors per cylinder 㿘?#p  `!hWc@* !!hX`X@ @!!hX@`P!hX@`h!hX@`!hX@`А!hX@ `!hX@`!hX@a!hX@a(!hX@a@!hX@ap!hX@a!hX@a!hX@aؐ!hX@a!hX@b!hX@ߒb8!hX@ےbp!hX@גb!hX@ӒbȐ!hX@ϒb!hX@˒c!hX@ǒc!hX@Òc0@c mfspreposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %d %s %d minimum bytes per inode isMinimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %d cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) % NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%d) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d,/h'''@j?#p @y@.'Ԑ h@`L@E2Y@[p!0@c @L ? @X: @V @ ɐ #`!`c@#|`c ?@@#|$c``#@c|@ ` "c@9 y" Ty" P`# p#?"%,"%(# "%, <"%(`#`4#Y@}Ґ!8@ `?c|!p@ 9##`#$ `#`$ Y@}!P@ q h`4pY@}!h@ c`!"`0`!"`4 "pY!@} @ # "pY@}!@ `#c| 6pY!@} @א #o4pY"@}@͐ ##` 6pY"@@}w @ 08 "H48 "L ; :8 ::@  "Pp#`P <"`Pp#" T 4 p#`T <"`Tp# 0 T:@ " 8  " `p#`` <"``p## &Y"@@}):@s !p#`!$%P 02 $ t2 $ x` 4@Zc|$ | $ dp#`d <"`d%p``!aĐ?4@A?8@<@$@@3?@/@$ $?|@$ ?@ @$?$ p#`* <"`q d d "px* "xp0* * ?: :0 : p# t:   @ %0@ C<%0p#`#"|`*@"X  2q: "X <qp#cX: "cX <"cXq##`}T@Ǘc|6`} @G@Ǎ|ؑ* @˰ ?@ˬ@ǂ4#pcШ? h P@˟: cЬ @r l 8@m ?  @ˏ?@@ˉ@_$ $ `!   $%$ p#/pp##`* @GeP*  ``,`: `@;`@a`|`,`:  * @+|L0@O* `,`: ? ; * %<cX* $cX.?@@.@$``8*`$`8`` `$``p##2 `8Y@{א"Y@{Ԑ"@ : $`8``?$```4* $`4`|* $`| `@c|@֒"p@c?#pc`x@@ǒ$`p#p#0,@ ?x@@ƶxv 8 ro!Y#Y@ƥ"@ʒ#c @{0: &08: &8`?&`>?@ʶ@ƌ&* @ƈP*  `,`: @|@ʢ|`,`: p# * @k|L0@ʏ* `,`: 80 qq0* &0 t@P"p@sc?qtĤ@k@Aqt}  (!p# 0* @\ ? x@W@- @'"@LY#@ `` pY#`@zcY#@z` Yq#@z`lY#@z p`q`#a Y#Y@zߒcp`#a Z Z@zԒ`0@ `!"`t@  `# Z xZ Z H@z!p# ?@@Β$ `# #p`"!#pc@`"p@c?`x@ߒ@ŵ$`'qq xp#)px* @Ғ ?@͒@ţx@p "$@Ř"@ɽ#?@ɹ@ŏ$x#/pp#* @ŅP*  `,`: @y@ɟ|`,`: $ *  @i | L 0@ɍ* `,`: 8 !p!p "@$@P"p@tc?x@o@E$# @? @d |$  | `@* "qZ@z @a  t6qZ @z @W ` ta-`# `Z@y! `` `@A  Z !`Z!8Z!P@yqZ!p@y`t`# p@& p#ഡ* @P*  ฐ`,`: @!p# @ @ |`,`: @p#e$ * `@``|``@* `,`:  p#@ BL ;   $`d: "$$@Į|@$@ħ`$ 'q p 4pZ@y!@ʐ #`#"`!"`#" "LD%hL "h !r"X!!@|~* ~@x{\{,{@Ȝ* !  h~ p#\$`%` $`p#%`"%T`"%X4 qqh* * h@pqhZ"@#\Z!ZaZhZ"0@y(?$"DL "h X+-rp#q#? @6,5rL?,` @P* T 2`@&Lq#& p@ctp#q#r! @ |@! @ @ @ @ @ @ @%P@   `<%L?,`, @@%P* %T R? %L?%X@*@?%X@%L?,`, @@ð%P* %T  ".%L?,`, @@Ý%P* %T 2p#p# @ǵ $ , @D `$ ,!p# x ` @ǥ:   $  ,? 8 4 p#@n``,@i`` $`&p@dž`8$@ǁ`8Z"p@x;Z"`Z@x5@ ##?!`@E#"Iܠ-@9 > #p 8*`  @,PZ@x"@Y c@"``-@`` @B`8@>`8Z#(@w@`|Z@w#p`,?$`,`@`$$`%`@`@#`|$$`$'܀?#p 2p#q`l`T#@Р?@`l$`lZ#@wŒ"@pc`"``,* eD `L "``02  "`l "`pp#`p <"`p!yq`\ @`\$ HdF!T$d`!$`!$`!$`#x$y @$`#$y D@˒ <$`!$$b8$`$$`($`,$`0,`4 ,`5,`6?#p -? $@Ž #\Z# [ (@wj  $ 4 ($`@ F ("F #`#\'[ 8? ,@wN ?#p  [@wF p p#쀤,?+?)['[p#@cp 22@w/ @E``,@@```d@w , @!p#쀤ߐ?#p 2`[@w `# ?#p @P @i!p#$ `@;c|`a@e  " -qq Xp#+y)pp#< X@̗*@ " 0@4`H @G #l& p#쀤 p#'`@``,@```d,@(`, ( p##  `( `0?#p @ @:|@ƪ @ƨ @Ʀ [@; Panic: cylinder group too big 㿘!p#@   $4p#@``.@`` %` %`?`4@ŧ y.  H@q`!O#x @`#x$ @"U$ $ ?O`@!`4 #xq`v2 O#xq x4 &$ l  @y$ p#Ocx $`Tq t t*  $`X@D* $`\`\: @ $``r  䀢  O#x``;@-;);X#x``q t t@$?@J?Ȓ`,`:  ?$`hOxh` "hr   *  "l `l;@;;X;<* @*`,`:  $`dOccܐ?"@q `@Ob@uԐ#0@ %xq `x ("  O#x@"UP"L ``:`@ \@@  `` ?$@+ @* ?``"  /qq xp#+`x@ٓ: @@d.@`X,0@c8@  p9pp#O#x@"U@ij#P`#P@r 䀢   : l l   ?$ *@  * $@a`|@ć`* O@T#̒@@ "@@O`|@`@q`@G`@`@A`@@`@;eP@a`*  @Z`* P`L@ @)`|@O`@%eP* X @@ 2@#pc`("`(p#O##" ( $ (@ 83  8"@*`@  "@  8$6(O#x@"UP#P   :`@ `@@    ?%+ @*$  "$p#& &-pp#O#x@"UP L@P`#P@r 䀢   : l l   ?$ *@  * $@`|@û`* O@T#̒@@ "@@`|@<`@å`@{`@3`@u`@@-`@oeP@Õ`* @Î`* @ @_`|@Å`@[eP* X @@ 2@  &@& 0r"Oc*  " O#x@"UP#P &:`@ `@@  ?$+@ @*$  "$r 䀢 7O#x h@ l@ @   p@ rO ` ` 䀢@4*`@  #@  ` *  `耤@耋 ` r 䀢@4*`@  #@ !p#Oc c $    $   $   $ '@'`'` '` @  .@ @ @ d,@ 0@ 㿘xc" " " ?#p #!2cx# 4 `#  a X@0 :  < `"H@( x: :%pxc@`c$ ( e @ C ` :` @ + 3`  3 $ h`0* ?@Ŕx@ 㿘?#x @",`,   4 @ `@$,`@*` 2` ` @"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘pc` `d*`O@-xO#|@"U@f/ O#  f' O#!fp#O#x@"U)P%p'O`#P``@@  ㌀&`f! @rʰ 0q >O#x@"U@P` #Pp#@r 䀢 O#x  : lO#x l    ?$ *@ * + O#x?"p#Đ?"y H`?"`@ !p " "@ "@#@ |@ * O#x@"U@O T@#̒@?"@p#@y`|@2`@`@q`@)`@k`@@#`@eeP@`* O#x @"U@ @`*  Ԓ  #Ocx!p#@L |@r @H%P* `X @@?2@p##E @_ y`H "@ @ "  "  $ Ox$ "$4* `"  (pO#x@"UP#P p ,` :`@  `@@  ` ` ?"@( @*c撆 pc` `d*`O@Dxfsinit: inode value out of range (%d). ?cpc` `d*`O@xO#|@"U@"Of@q @ #x ?" @"U@6` \@P"L` *@  *!p#  d*@ O@x Ȑ?$ y H`?"` @ ,@ !pg"8@q~@Ȑ #@I @  ,@ @ @@ @9 x `* @ d,@'? 0@@ x* @ؔ  0@㿘@ getrlimitsetrlimit㿈#?ch 2&?@d @S?$ch * @\" @1耢 6h@N~ `? @5耢 `h@Ns p`""c?#h.`#8`c" "c@2 㿘@~@0 㿘@ @seek error: %ld rdfsread error: %ld 㿘?#p  `@c|`# @L0+> `| @v;  y T  @˖ 6 yh!@ph@N"@ ! T@ h"@ph@M"@ "wtfswrite error: %ld 㿘?#p  `@c|`c@@ 0/`# +> `| @v\;  y P  @ 6 yh!@pih@M#@ # P@L h# @pZh@M#@ $isblock bad fs_frag %d 㿘 8 "  $  @ !`?*  *@>*  *@>@  `? * >@  `?!hi`8@ 8 clrblock bad fs_frag %d 㿘 8 >  > .@>*` *`  * @ *@.@ !hia(@ 8setblock bad fs_frag %d 㿘 8 >  >  .@>*  *   *@@  .@ !hia@a 8㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@ى " h  9ii#5 % -+@Ԕ"؀?X? 3Q*  , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,  , , , , , , , ,  , $         &h$t@U$t%l%`p@6#0&*  @@+ p   h  i@.b  i " i@.c  h 2  @3D!"`| x@2 * 2 $ x@2z`?. @@b$#a ich@.c@sU!a@Tcc $# $#  .,c*a# `# aa# J /" *  a# # $ . &@ @  $#܀  ic@.W <  3  @@̐ *  p 2 @ h  @@_8@@@Ep8@<  2   h   p  @@@%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read8l@&C  @-В /aa#a#3a)a-<+@'  $4   k !k@d H P@< L& " $k pp@V2 "$@2 / "@ k@i` "J / /*@* $$  @Ɣ ', a#c J /&c *c c #@?2<- @2<@2<k #@!`@  ") @5  @2 n@j]"xd""nb` n@ Ӗb# 4  b@ 1n# 1n"@A"8b "c1n"K @H %b'dL@  K , 'K K + ' €bD "`"P  "H@@`n⠒n⠒@ t 'K #bn@abР n"@ib1n")n'd1n!@a g'K@9#  'K s+ '@{k⠀ K@##(  'K bL@K   'K  ,K 2+b# €bD "`@*1"P " b@!"H@"Pb#⠒n@ h5 b#⠒n@  '@쀣  bd#bnb`n@ ݖ0# 쀣 n"@~1n #@~1n#0n#0call terminated disconnecting...㿘  d"nb`p@ p0"dbb#bnb`p@ pT  p@i  bb#bnb`@ b# 㿘@֒  @͒ 㿘b## " @z    v831vadict3000courierhayesventelhourminutesecondLocal file name? %s: cannot creat List command for remote system? 㾘. > !?`"@ `"*@@2' p"(1@  @ @,! "`Xp"@@h 0p"X@  @ 0d`X@Z0[take] usage: from [to] %s: cannot create cat %s;echo 㻘p#x!@ | + @;`   p@hY#0!  "`@` @+ɒ!6p#@hG 0 pc@h*p@ȁ %d write error lines transferred in x'''!@"H@~"# P@ #`d@  /"H@l 1!"H@  \ O` ` 2"H  @/p@ ؐ v@Ē`\@T # Q 5d#@"H@Ԕ  $   \ O `/ 76*`: @7䀢 0O ) '*'O 2 T` q  @gܠ"d"@q@g  &' ܠ  @q@g dR#B "  @TM "q@   @/!`d@d  @G@Local command? can't establish pipe can't fork! can't execl! 㾈q#@ n K@. q@gO#0B@.q@gG#0:'p"X@ U  @G@E@4 0)@? v@`\d0 @ @+쀢 0@+ @' @$  @אq@g#@Y 㿘 "cĐ @֒ r%s: cannot open 㿘. > !?`"@ `"*@@0a p"(!@ ! @!r@^ax dr!@fϒ!0 b@b@@ T!2 @&"H timed out at eol chars transferred in 㿐 P@ "#Đ r@|aT  @.:p#`d@    *`@<: N dR#r "H@z  @"H@6ѐ   @SA d#+d#p%/  ? & @{a`& @'cĀ qo`T  * % T   ' T  T?b @ @ 0 @ dT  " dR#B q @fU  $@(P#rd"H@  cĀ   @fbx@(ِ   \ N  H@(ɐ   dR#Ҁ @   *`@: N @R @{n @d#@R`  R` r"q @Ԓ$!`d@   @-J́[put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo 㻘s"!@  4 @k`   s@e"0'  "`@ r@]:axdr!@eu0R#r sbsb@eQsc timeout error (%s) 㿐 /"H@  dR#r "!$#d@(#%H@8 @( # . @ : t@e8   `Hc`p@  !㿘 t@` "ccan't find `%s' away for 㾐!?` "@ . :  `"*@@.} q#@  ` P@  @Ē  @   @,p#`d@ؔ @,Yq@dݐ#(d" @Q @ڐ d0"H@)  @Ԑ   @  @ @t!@d@ dR#B " @Qu "t@!!`d@   @,6̐ @o  @l 㾐!?` "@ . :  `"*@@- q#@  c P@t  @E  @B   @,p#`d@Y @+q@d^#+d" @Q @[  d0"H@)  @)  @R   @  @ @t!@d6@ dR#B " @P "t@>!!`d@   @+̐ @  @ [sh] ! can't execl! 㿐u@d !( @ؒ  @Ւ @ @+v @@u@c!0 @  @ 0@  @ #dcP@G / cP@d#P@"[ u@cԐ!8@  can't create %s 㿐 P@’ d# T` !@ ;!@!ub@@ #@ O ndu"H@cc[cd] %s: bad directory ! Hu"@ !쀢 d#`@( 6uu#@cu@c# %s [EOT] 㿘 P@p 7 "uu#@ciu@cf#@V@ #@j@ 㿘d#` !@"H@;@3 ֐ 㿘@I "#@  ؁-c㿘#dcP@Ν / cP@/d#Pv@!  (8  2J J J"@ (8   J  J`"J* J2  %s%d %s%c 㿈 c d,@$@ v!@bג %u'vc t,? ,2쀢 2 2 ,?`` @b s<,u@b!0[set] onoff㾘v"@ K@ d a  ?*a P@ d c  c~ې ?*c !  ?,d b  b ?*bR) dd c c ?*cR v"v"@d c逊 c ?*c *b0d c  ?@ *ch"H@0Ȑv@sb؀ Ȑ$'c$ ;'c̐ ;"c"H @)̔Ȑ  @)ǔ́㿘!"H`{@$ @2x "H`z@ 㿘@'. >   @@ @~{[*?$`'"\pipeecho %s/bin/shfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" 㻀'w@a@ @)H w@?8!PzwaX@a@)d?d#P w!`@@א @&@@ѐ @v@ @ @:  w@? !h@@J @`@$@@쀢  '쀢 !hw@@ap/ w@>!( $!hwa !hwa@(  .?N 2 *` @ (*`J@ @ *`1 㿘 N@̒ "N    send breakget this summaryset variablesuspend tip (local only)suspend tip (local+remote)exit from tipchange directoryconnect program to remote hostpipe local command to remote hostpipe remote fileput file to remote UNIXtake file from remote UNIXsend file to remote hostreceive file from remote hostshellusage: cu telno [-t] [-s speed] [-a acu] [-l line] [-#] cu: unsupported speed %s Bad flag %scu%dall ports busy link down noneConnect failed 㿘 x@`!@  """bD$ f"b4'#%!`J@ -W"!`J  a"` s 94Jx 0Gx/bD s t l"$`<x:x ,\?*b6?$bD  @W`@  x!ha@$`@Đ @W`$4$"`? " "@bD ` `*?" "?@" ` `*?"@`W`? ` !~@! Đ @ Đ @ Đ @ !!xb @`)4@N! ?x@`7"(@ 2 x@`0"8@ #@w !@=f @@ @ x@"Hd#@2 J"\ @p"4@1 " x@` "P@@ #@P J"\ @Y"4@㿘 "!8@!P'Đ y@a'@Ā I'"!8!@D / @$# J"\ 9@!  @" @Œ "bH@" "H @= "a8!8 !"H@ '"H @'A"H` @  @u @ (#0 @m!8 ?tip: flock???%s (%s) <%s, %s, %s> %s 㿈c", 1R @L|  y@<̐#80'@  @#@  2y#H@L* '@R*!c#\#`",ycPy@cp@",",R @LP acan't open log file %s. 㿘!d"z@V`Pc "b,!hz`X@"parercfoexesdiprpnoeieelcucmdvat/etc/remoteREMOTEtip: unknown host %s tip: can't open host description file tip: possible reference loop in host description file brfsdu%s: missing device spec %s: missing phone number hdraecbenbsctbvbnvtantrwtip.record  dlclet㿐z@~~!PJ /d@1@ ` "`z!@"`d` @1Dcb 2N /?"b@Y0  ?""bD""$ *b\*"b4 2$"b4$m"b ???0z!haX@ 0 !hzap!hza@@ #c#Ȁ c@ 2 @3  `!"4  "4z@4aЀ?$$"4za!@4ݔ" ?$$" Jb ! *bza@0 :@ ,"" 2 !hza@@Z J"  bD ""bDJ" !  !!hzb@@> !zb(@0 :@ ,"0"\J"\  "D`  J" @o" 2,@ ,@""$zb0@0 : d" 2 zb8@0 : d#p 2 zb@@0v : d" 2 zbH@0k : d"2 zbP@0a : d#  2 zbX@0V : d#0 2 zb`@0K : d#@ 2 zbh@0@ : d#@2 zbp@06 : d# 2 zbx@0+ : d#2 zb@0! : d#В 2 zb(@0 : d# 2 b 2z""b b@ z""b@"(`z@ C "h`z@ < !`z@ 5 "`z@ . zb!@3˔"T?"$"Tzb!@3”"L?"$"Lzb!@3"? $"HOSTtip: no host specified 㿘d  2  |@|!p!h|@ax@4 5""a@d` "`!@ 1 !@@U ,2*!@"b&!@a@""a@"cuusage: tip [-v] [-speed] [system-name] tip: must be interactive tip: %s, unknown option tip: phone number too long (max = %d bytes) tip%dall ports busy link down PHONES/etc/phoneseventip: bad baud rate %d %s [EOT] Connected connected 㿈@ƀ @ @! "`h@ "a@ "`T"``@@|@nbx   "c͐ !h|@b@ @  !h|@b@ '`!)'%|`J@ -"` J  0 9 v h#  $#`@S^ %"4h@`? ``-L@bؐ  ' @  !h|b@ @Q "p@R `J@ 2*@"p"a|c@[4 !~@ Đ @ Đ @ Đ @ ?|@[ِ# @# 2 |@[Ґ#0@X#@ !@9 @|@{#@ "b|#H"b@T#d|@J#X@b2 |#`@[b@@2#@ J"\ @" |@[#x@@#@ސ J"\ 2 @ !@j l̒ l l `"`"` " `"`"`"`"` " `$"$`("( " ~ ̘ ?" * *!cp"cp" " " " " " "  " " $" ( *****@S*@"!@"# t@`# |#|#@[;@" "`P@@㿘@@###Ȁ   @`@j 㿘!"L @ T $"L㿘!"L @  `$"L㿘@ T㿘  @"́㿘  @"l%sx''"! ~@b' @ '~!@Zْ@"P 3  ? & @o``&` @** : ? '* @ @!쀢  쀢   㿘 @o  "a~@Z""P@` %c㿐dR#"  @*ِ ' /d"`d"-d#d"`? $`@ogฐ`$ @\  `//ON`@,  @j/*  "`>d#  OOM @OU?`?5?  H@ U` "`~@Z5"`# dON @2d`? $`@oฐ`$ @\  `/dbPO@~bPT O"ؐ   * /H@[ U` "`~#@@YO~`㿐d "c/ `? "`@nڐ  "  \ " c J  O. <`%~L 2  T 2  @O@Y @<` L 뀢 O. : @"H@  . > d"   `" * 8J@ ` `2J@    J   n r t fEbH J/  ^ ? \Kc c*8H H *8*@`@ *@2 *@*@`*@*@`*@` Jِ *@!H* :    ^(H*`8H`@ ?(H(H(H("H%c %2s%-2s %c %s 㿘. !@Y:`c J $'%d"`!   T 2 L`@XN    *@X  N 2 h"H@@I@J? @c'Ȓ >'̐ ?'Ԑ :w'Ԑ //dR# d'"H @ QȁJ H/H/Lost carrier.write㿘 \    "x  +  @y   $#܀ 2"@5א"noneoddzeroone%s: unknown parity value 㿘e` ""`e @jc  :"`\" \   @jc  @ic  @ic  |@icX  !!hc@ޔ@!h "xc"h @  *@ ``$ @ 㿘#! d@ ! d@  "@ߒ a㾐!@   #, a@ O ,dR#" # "@md# 2  y/@Oa@ "c n/ y/d#  2 #@ "@ 㿘dR#" # @mX@ 㿘d"R  `?2 "@z 㻘 @y  @v  @raD !@n"` @j` @g"` @cb@E" /d# )-d"H@v$4 `] $#܀ Y@L@ `\ L `,  \ @GU` 8#5U~• 2 @!0+(  ^*`: p " L#?`"@  `"*@ @   * @4/var/spool/lock/LCK..%sCan't open lock file. Can't read lock file. Stale lock on %s PID=%d... overriding. Can't seek lock file. %10d lock write(a@V֔*@~!M @~ܔ  @44!h@a0]?@ǔ P @4%@ؐ!h@qaHL?*>@@  $#܀ @:?!ha`@W  @  @3@!h@Fa!?@a@V{@ @v@  @@v@3Ӑ!?㾀a@V\@v/.tiprcrset %s㾘d!! "   @v* 2$  "  $   2 d@Zc`@LcȐ@McТ'% @N" 㸀 @V.@ 2*@{@kda `u ?*`uaccess denied out of core 㿘'HN @  2 @V!0T  "7H  "  H ' =HB  " @gH <  P@Z dH@ې  & @Uݐ!(0*  ?.  @ZeH!  H & J !V `H0`HJ !@ 6 N J@.   . all 㿘@gUb d!! "!dL @  " @w  2L  !d@9 2 @!d! @U"$!record%s: unknown variable 㿘@ = ,@; `  @LN03@gc d@0%@Β ?"N,@ϐL`@  @0 ! @ 0#@U+%s%s=%s=%-5d㿘d !``""! #d ?`$  @ `$*@@a``"$a!d{! $!   "V   (Wd2 ;Qd da "a!?`"@ ! " !*@K  0 @T#da $a (dL 0d!`"! @T d @T#da $a dkN  a $a @Tda ""a@T"ȁ㿘.`2 .`.`   @`? 㿘d!! " @f   " @f    n r t bf  (R *`8:K\ ^2A*J<*9  Є (8K`*`(8J!J*J/ 74?(ЄJ/  74?(?* ** ( *(8*`8 ?㿘{2   "@K! @ec ɰ parparitylelocalechohdxhalfduplexrawrawftpetetimeoutcdelaychardelayldelaylinedelaytatandemdidisconnectecechocheckHOME/bin/shSHELLverbverbosetabtabexpandscscriptremoterecrecordrcraisecharraraiseprpromptphones/var/log/aculogloghohostfrframesizefoforceexexceptionsesescapeeoleofweofwriteeofreofreaddialdialtimeoutbabaudratebebeautify starting call...K can't initialize bizcomp.... can't set dialing mode...D 7 can't get dial tone...ringing...1 %d second dial timeoutbiz1022 dR#B @R @ "*  '@/@Ѐ " !!7 `/ҠА@I @Ia#@ibH@@! d!@Rʰ 0%R#B "@R!0@!@e L d aH@R  `+e L @W㿘bV㿘c㿘!"Hc8@v @"ڐ "H@Œ 㿘"Hcx@f 㿘e " L@># 㿈!@"H@S @5c'@# d@0" "H@I @)  @" / @ Ȱ  @㿀' @c'e" L@# d @" "H@ @  /J ' J  @e L`?Using "%s" can't synchronize with courier couriercan't synch upAT E0 AT C1 E0 H0 Q0 X6 V1 OK AT D %d second dial timeoutcourdR#B @Qې!P!x"H@ '"H @d@k !@QƐ!`d"=W "Ha@ @" "H@ "Ha@ @z! @!"Ha@ N   ,J@ ="*@`J@  =!@ "H@~"Ha@y @e"`e d a@Q`  e e@e 㿘!"H`x@Z @! "H`y@S @@_"H㿘"Ha@= timeout waiting for reply 㿘@Q; he "`#H@ 㿀' @`'e" J  @  @Ԑ#H 2 d@" "H@ @  /J '  @Ӱ  9600/ARQ 9600 2400 1200 RINGINGCONNECT%s !  x bH@@F @G bH @g @le @`'l'| ?'t@G @e" @t#H Kd" @" "H@ @ =  -/u! 3O @bIaȀ Ta" 2'|a@x  e  @b3 #  0| *?'|t't!@Pm @<l  AT Z +++h !"H@ "Hc@J @F (@  "Hb@Ì "H@: ('̐@Ò 0 20 @ O  @ K " @  "Hc@ @ z "H`x@ @ s "H`y@  `"Hc@  㿘@n@ @ @e@`X'''' @&؀ ;'''@ e @$#'@#* "@*`@*`'"'''!$# @Ȕ @&ʔ # 2  ?#@ #  @  @& @ʐ  㿘@ 㿘@ connection timed out dialing...@''"H''/à@i ' @@3# @Ow#@j 0fdR#B "@Ol#@!Ȑ '@B@$'@ƒ$@ǒ$ @ `k `l@DĐ @a@* @@` @{ c(@" @ c0@ @@@ OàȐ@@ @Oð A`?㿘!"Hc(@ @V "H@A 㿘㿘#@’  starting call...line busy...acu open error...lost carrier...dialup line open failed...0'dR#B @Nΐ!@vŒ  "c $#܀ 2!А!@N 0@o#Ȁ "  e!4@ r#@}`@:* @`  @w@e "a4 @j  @g  @d @ !@'#@t @ϐ@ "@vy  "bH $#܀ 2!"@Np@D e!4@h +#@; !#@B '# @ @' !e@X!4@@!@Q#  "H@H 㿘@  #@ 㿘@ "H `x@" @/"H㿘@p e!4 $@ # $@"H `x@ @"H dialing...ATv0 ATTD01234%d second dial timeouthayes@ dp R#B "@Mߐ!x@V!!"H@ '"H @e"H@  "Ha@ #@a@a"Ha@ @L"H@e "ap"Ha@  @la*   @f!* :  1" @ e "ap!  "ap"H@ђ e!l dx a@Mo  e!l @㿘!"H`x@k @ "H`y@d @㿘"Ha@I timeout waiting for reply 㿘@ML e "al#@ x''ܐ @`@'e"!l@# d @# @" "H@ @  / @쀦 OJ@"' ܀ @ ܁ OKCONNECTRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)㿘@L!X?б. > `+*`"@ 2 24 2H 2\ 2p 2@LՐ!`"@LА!h@Lː!p@LƐ!x@L!@L! , :!@L @L!XATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 㿐!"H@͒ @F ",!@ؐ "H@Ò "Hb@j :"Б* :  0 3@Lq"@Ln"@ !"Hb@b"Hc0@M @ !"H@ "H`x@R @`"HAT Cannot synchronize with hayes... 㿐 1 "H`8@) @ "Hb@2􀢠("H (@!'@ 0 2! @ O  @ K "H "H`x@ "H`y@   ˢ`@L @ Using "%s" can't synchronize with t3000 t3000can't synch upAT E0 AT E0 H0 Q0 X4 V1 OK AT D %d second dial timeoutdR#B @KՐ!p!"H@ '"H @^@y !@K!d"7W "Ha@ @ "H@ "Ha@ @z!؀ @!"Ha@ N   ,J@ ="*@`J@  =!@"H@"Ha@ @e"ae! dx a@KZ  e! e@e!㿘!"H`x@T @ "H`y@M @@Y"H㿘"Ha@P timeout waiting for reply 㿘@K5 e "a H@ 㿀' @}`'e"!J  @}  @ΐ H 2 d@ " "H@ @   /J '  @}Ͱ  12000 7200 1275 7512 57600 38400 19200 14400 9600 4800 2400 1200 RINGINGCONNECT%s "  x bH@@2 @3 bH @S @}le @}`'l'| ?'t@A  @e"!@` H Kd" @ y" "H@ @ q =  -/g" 3O @\5b Ta" 2'|b @r  e!! @\ #  0| *?'|t't"(@JY @}(l  AT Z +++h !"H@ "H`8@O @@ (@ "Hb@5̀  '̀ "H@! ('̐@ 0 20 @ O  @ K " @h "H`@@ @a "H`x@ @Z "H`y@  `"H`8@  㿘@U@ @ؔ @L@`X'''' @ ؔ؀ ;'''@ e"\@ #'@#* "@*`@*`'#'''!$  @  @   2  ?#@ ֐   @   @  @   I  READYcan't synchronize with vadic 3451 vadiccan't synch upD NUMBER?Vadic will not accept dial command will not accept dial Vadic will not accept phone number will not accept numberDIALING:Vadic failed to dial failed to dial dialing...ON LINEcall failed call failedd""$$  !#(@#(@#(@#0@@#8  !@I#@h}p"H@c` "`"H @@Z #@y@#  @H#d"hX㸐@M@?-cА@^@t 2  @H#d"h>@{ !#@F#@C@X  2 d@HŐ (d"h"@R#B "@H P@@ ` @{ "H@   @H hd"hx 㿘@"H㿘@"H㿘N  !"H@p @Ԑ N "H""FAILED CALLH'Ė' '@Zc H*@Z```? 'd" ' @{)a@   00@ $ - @ Ƞ%#@- @" " bH@%    *'*@   㿘 @ 㿘 N@@ ` N@   *8J@` 2   *:J@`  `? starting call...line busy...acu open error...lost carrier...dialup line open failed...㿀''dR#B @Gɐ!@o  "b` $#܀ 2!!@G 0a@j!H " e"@z S@zy`0@6* @`  @ s@e "b̐ @zf  @zc  @z` @ސ @ A@zѐ@ "@o{  "bH $#܀ 2""@Gr@ F e@ B  @z; 1e@l"̀@  @c"` 㿘@ ' !H@ h@ #bH `x@< bH@@ @ bH @ȔbH`@) @6"H㿘@w e"̀ $@z "` "H`@ @"`"H `x@ @"H/dev/cua1/dev/cua0Unable to locate dialer (%s) `@L <eL e Z""Ѐ " @X "   #!@Fϒo Kb`@@4)`@5)`  'Ԑ >'b` @Nb`@  /Ǡb`@  /b`@  /b`@  ! < /Ǥ"`@ L   /!"`@t  /"`@n @Ґ "`@p   M/Oǀ B G2ǐ /#b`@V b`@Z /@m"`Oǁ  =(8؄2J<"  J_"* *@` J *@ ? 4?can't synchronize with ventel ventelcan't synch up dialing...#k$ $ $D$I$A$L$:$ %d second dial timeout%s... @D"H d@F d"~ R#B "@E @m!!x"H@В '"H @ |@ L a%a#bH@”  L a""Ha@  @ @  !@"H@ e# d a@E  %e# @E@e# ;dR#B 7@ 2,@  "+L    #LL " J L"ؐ@  *`@ `, L 2L!0@E_ 㿘@d"H㿘!"H`(@: @X"H㿐/ $ !O # $"H@-  / "H@  @ "H@ /  timeout waiting for reply 㿘@E!e "c !p@ے 㿀/' @wגa'e"# @ᶐ!p  d @w*& @" "H@ @  ` *` '*: @ @w **> @`?tip: ioctlP !"H`x@ @ "H`y@ !@ ay"@ @ b@ 6@!"H` < <@ ?  $ `< ' @Ր ``$ʐ 㿘@hms:t:/dev/%s%stcsetattrTIOCSDTRTIOCSETD`@m#+ P'@?#! $@c?P? 5I*  U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U` U( U` U` U` U` U0 U` U` U` U` UL U8 UL@ @@;H#e"c@k#e"c@#0&*  @@}@1#@l   !  #@c @k k@!9@w, ''''̐ //e@>cА @ f  @c`y@  @c `e@Ԁ  @{c@ ( $'@v @^0slipstrip㿘@UJb耢   @UBb  @usage: slattach [-t ldisc] [-hm] [-s baudrate] ttyname 㿘!h@v$cH@vĐ 㿘@s X X X X X X X X X X X@ X X Xreloadupdatesyncasyncunionrdonlysuidexecdevautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %s @ %' $ "`"0# $!@[? ? oc#@f@N#0&*  @@C@'?' ` ''!@  $#܀  2 $!@@"!(!X@9N#ܘ ap@c@u usage: mount_ffs [-o options] special node 㿘!h@u;b@uې ,-o %s: option not supported㿘@ I @B @ cP5L n L  o  @F͒ = 2*@9U "   " @2    &*@& cX@Ƞ @㿘@G ] ] ] ]x ]p ]h ]` ]X ]P ]H ]@updateunionrdonlysuidexecdevautorwrogroupquotauserquotaego:rcd9660 @ ''% $#@Qᨀ? g"  o ? e" 0  r" 0`@N@7#0&*  @@,@`'?'  '''!@  @s @t usage: mount_cd9660 [-egrt] [-o options] special node 㿘!h@t<b@tܐ ,-o %s: option not supported㿘@ K @D @ cH5L n L  o  @Eϒ = 2*@8W "   " @2    &*@& cP@Ƞ @㿘@0init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess arguments`@@j  @7 !h@s`@tE @s " !h@s`@t9  В @ @ 6@Đ @ +@!+)f"%f !@7a`f`s%"T$P@! #0"@!8!d @M  #\ #`#d!    @@ #    @9 " @4 ?' #\#`#d #h #l #p #t#x    @;  @s ''' @sj  @sf @z @x @v f@"T x'H'L'P'T'XH'?' ``䀢`''' @sA `#####Ȓ $  ` *##("#㿘'H'L'P'T'X @2H@s 㿘'H'L'P'T'X @$H㿘'H'L'P'T'X @H㿘f"X""X@ fatal signal: %s㿘@ߐ!@@ @}lcannot get kernel security level: %s㿈 ' ' '  @ ?  $@6l#ܒ!ذ?cannot change kernel security level from %d to %d: %skernel security level changed from %d to %d㿐'DD ' '   D@J ?  $@63#ܖ"p|D0"kD㿘㿘  @k c@k can't open %s: %mcan't get %s for controlling terminal: %m㿘@n@ @gO ?##@|̐ @k?#@| /bin/shEnter root password, or ^D to go multi-user /dev/consoleconsolePassword:single-user login failed Enter pathname of shell or RETURN for sh: -shPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/contrib/bin:/usr/old/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingݰ   @+yS @磐 Ƞ@ ) %# `@ ,)'@E ТL@ @|  @ @q @P0 a0@#@Tp a@_ * @b ? " ,L :, ,Op 2p'l l@qo !0''!8a@@6 @6#a4! @.a- @ @{ 2f$!? @   ?D1""T) $+1'%f?h@  ?@N? #܀ a0"h   @q ?T ې?f"T h   Ԑ"8@A @{m ΐ"X1"f ""P1#sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootp@1?'' 'ؠؐ @p  @p + "'"'f"P 2 "'' @p ! @\"  >@z ' $"@`M? @ :  ?@  `1)#%?@ , ?@x? ܀ "``G1Ԑ   "`@p) ?ڐ?Ԑ    f"T"P@2Ԑ?'@ǐ0Ԁ  "`1ԑ:  21f""P#c@i<1#"session database close: %ssession database open: %s㿘 "  @  $@3u#ܒ!    @R  "`   $@3b#ܒ!ذ insert %d: %s㿈'D ' 'D?    D $@3A#ܔ" delete %d: %s㿐 ' '     $@3&#ܔ#p 㿀'DD' '      @/ `/ `/ `/ 㿘@y 2  @Q* @ߒc$    # @Ւc. $  㿘@   " @@   @@ @%s%s/dev/㿘 & ,  (@ , @oH , & &@y@ & `@;@&    & (" & $$ (& $%s %scan't parse getty for port %scan't parse window for port %s㿘  @J@H @yd`@ya@@Ő & a`@;@f   & ! @/ &  ` "   @"@v`L&   & ! @ &   㿘    " ( (M " 1"@ `V20@1#can't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %m㿐@? #5 0 '@nW @ 6 &# @!@  @ @x can't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %m㿐@'ː @z?   *?" & $ 4  ! @ <   "'@ 4 ' @m  @@ !8@ @xR 㿘 2K-H-$   $`" ("`( ("` (` $"`$k0?2$ f "bT@'c $  f  f f f T TP T T㿘f""T ʐ  #f   2 (`?2&  $bT@'% &  ( 2 f"T f1f? @ . ?""T{"T ?f"Tport %s changed utmp index from %d to %d㿘    ?&  ( 2  @?@   @Kƒ   ( 2  (  &   & "    ?&  !   &  @l 0’0@ "1 2 ( &  @lҒ  ( 2 1#   (2 #   shutdownsome processes would not die; ps axl advised㿘 ` `  "` `(`2` #b@e֔ "# $1%, ?@l@?2$c܀ """$@T ? @Z ?" c܀ ?c܀ " "  ݓ, F"1"㿘@㿘@_! @Ե`(@ (?@#0&*  @@@0q@ @ @l~ usage: sleep seconds 㿘!h@kΒ`@ln 㿘@CweofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeTAPE/dev/rst0f:t:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGETP@!@9@g$ "`@ @X!%!! $@,? f"# t#@#0&* @? @@=  : !g$ h@= :,@`@ h 2@k @] @'@v`f#%  @=@` "  @?g h  b@`@`e! 6  a@* 3g 7@ @3N 'J  g a@@ 'g h  W@q   $g a@3 6g b@ h @;,a@   @b@:g h @@k^ 76543210SCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %ld (%ld, %ld, %ld, %ld) density: %ld (%ld, %ld, %ld, %ld) 㿘g lT $TV@ !x @7V !V @2 !V @- ?  " "  *!X@7V0 @1 !    @7 $!  ( , 0@7 4%s=%o%s=%x㿘  N 2##@7`vs!?`"@ < " <*@ N`J% , * @: ?`"@ ,`"*@@Ԓ * :  % !:` ?`&  @  `&*@ @* :` :`NN 4N`!?`"@ > " >*@ usage: mt [-f device] command [ count ] 㿘!h@ia8@jK 㿘!@t@  $ @; " ̐ @ib @3 Ȱ86 Lost connection to remote host.㿘 @bshelltcpshell/tcp: unknown servicewho are you?/etc/rmtTCP_MAXSEG setsockopt㿐!g #"@@sbH $  @`bP@@g "` @Tbp#`@: @ `,@X 2@iՐ  " g @ g g  ` "@S "`@: А$'($'%#?!Ȓc @2  <$'! ?c@" $' Ȓ  @  @"invalid user name: %s㿘 *:  ؐ  2  _- @   N  O%s %d 㾘a0@5g "`@FcloseC 㿘!g !x@7a$ statusS 㿘g  !@%a  @w . 7 1 ؁I%d %d ioctl㾘@ @5b("0@?㿘!@sM @@sF@%s: %sProtocol to remote tape server botched (code "%s"). x@R ؐ? ؐ@I$"В@RO؀ F?g" O؀ Aؠ@s ?N "."@8@,ٰ㿐 Ȓ@W  OOProtocol to remote tape server botched. (rmtgets got "%s"). 㿘`,* :  , ` ,@  H@W㿘@&-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%s㿐@   @6?`@@F` 2=@? `@' 0@Jbؐ  2@@@@/ϔ @ J   a@@4?? (x@@xb, ! @4 @h @!@h @F_a( 2@? `@p!0@@@FOaX 6 @J@ -3 `&@J`bؐ   @T6"?0@Jbؐ   @/t @ J   a@+@(?@V@?`  @ " '%@@/R @ J  `@@  @gI?2?x@@ ?`@gsig㿘`@+E  "  x". @+    . ?unknown signal %s; valid signals:㿘!@ڒ@ !h@gY  㿘 )x"%#, !x@f  Xa`@f  , usage: kill [-s signal_name] pid ... kill -l [exit_status] kill -signal_name pid ... kill -signal_number pid ... 㿘!!h@fiaؐ!h@feb!h@fab !h@f]bH@f 㿘@ -%c %s -%c -- %s 㿘@  "c0' $%!@``? @3@3"@3z"#0%!#0*`@3n@ #0 $#0@3f#@f㿘@  p h ` X P H @ 8 0 (       @      nfsv2tcpsoftnqnfsresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsnqnfs only available with v3illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%snqnfs 1/mount_nfs:nfssvc err %m @\)g #"a''gb0@~Ȕ H'g # $+g@?ƒ?΀`F ē*`@  l | 0 \  l @" "$ @b∀ "%" @b  =$ c@,ǔ J 2`6$ 8 b@~c bx ~%bx  z$ c@, J 2 `4$ @ b@ac  (a$ c@, J 2 `4$ ( c@Hc   @H$ c@,x J 2 `4$ < c(@/c t q@c`@v bx %bx    $   ($    @$   " "$∐ @c@@ ∀ "%" @c@  =$  @@  $  g""!   $ $ " "$∐ @Вc` !$ (  $ @g$  "b|'   $ " "$∐ @c` !$ c@+ J 2 ` c@c"!c@+Δ J 2 `4$ $ c@c  $   $ $ g "b|c@+ J 2 `4$ , c@fc  i$ c@+ J 2 `4$  c@Pc  S$ c@+ J 2 `4$ 0 c@:c  =$ g:""@h7#0&*  @@]@`@ @c #@ "  `@%6g"x @  ? @ `@c @@H @F @D @1   @- !'% $#@U  ܀ Q @ `(!@cg no : or @ speccan't reverse resolve net addresscan't get net id for hostNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2can't access %s: %sp?'!!p@% Z!p, Z@4? @   @49 : !  *#@a `$a @ȗ  2g !P@!x@u 0!@@|, g"     "!ج  ` =&`  ! "a !؀ 7!%g! ) , o4`   ab@6- 2 4x ~!@Ӑ!y!ؐ ''g" `  ab @  ''ܐab@7   x R!@!M!@"$ ''`$  %`%`'' #\@ # ! 2xg" u@a @ǒ` !ؐ@ a@Ȑ  ! `@  @%!!ؐ? "%!x  ?@`$x  ? @a@b+ @@~ @~ @~ @А x $x@! <!؀ H ! g"x  $@b  ! @%\"cܔ!@ !2 &` &`!0&`?&`!p&`D 㿘'HH@<$㿐 @:ޒ "J @ "`D    =  &` `@; 5@:` "0 ` ? ?*`@;` $@:   @: `@"` &`2    P`  P&@ usage: mount_nfs %s %s %s %s [-23bcdiKklMPqsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘!h`Xx @`a0@aK ,-o %s: option not supported㿘@ @ @qa?L n L  o  @2= = 2*@$ "   g  @2   "*@ "" 2Š  a@d @{㿘@    4   P |@@    @@ ,skipseekofobsifibsfilescountconvcbsbsunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %dseek offsets cannot be larger than %d㿈""c"<  >"b#'%b@1U =2,  @b L b `8@b'c  @   @ @" `X@ $@  "b`@"@ "#` @@k # @` @R`"(  @J`Ȓ## #@","@`#`!` @"""cc "c#@"c @!`"(   @`""c"< #  @a"<#@ # ! a0@"L#c@x"L@ !#c@w#@ aX@㿘@=@㿘@"c"<㿘!@$"(㿘@ "b`@ې 㿘!h@$ 㿘# @ڐ"b< D㿘# @ː"c 㿘@"c㿘@"bL  P   P  P    x P h  P `  P X P H @ 8unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 .'D#!1D@bc'"H  @j ̔# c@@# c@ &# `D"#D ڐD㿘@<@%s%s: illegal numeric value%s: %s㿐@ה ? `@ `@J k m b".  w . . .  'J x   *2  @u!@!k " a@" `@|㿘#"0`"0" *@`2 @##b0b0$ $  @ @n  $b0 $4 㿘" $",`  ",  2  ","`","`?@{"@ ""b,"` ?"`"0"0`" `#)/+"4","h#"(4@8㌀ ` `   +   ` `  +  ` "(b4*?" ` $?$"( ㌀`" ` "( @]M" %b4 " b4 %b4  b4  ? $b4 2 "b?$"( $@ $@ @ #4 "(",", "㿘#b4"b4bh` "`!#@{ "@ #b4@#`" ` !"("4 @\" c`"( "`㿘# "8"8 @ ,@??",",`"(@ <'##+",(@? " :  " 㘒@z㘐$% $`$ *@@ b(@3 b(@  " %  ϔ"4"4@z"@ ",", "%s: short input record㿘!"4 1"4 X@`"4@? , 2? : ", $  #cc@zbc$c$c` "``"` *    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx㿘@@/3h @ZS`Đ @ZO`@#(` @R` ??&` @@Z stdin%sfiles is not supported for non-tape devicesstdout㿘bD bD#"bD"#bDbD @OA $   6 c@bD@",h  "@ 2 @cc c " /"c##@"&@O!c "``#@"&@O!c"`` "`## 6 c@@## @b<#b< @sې? $? @楒 b,"#"<b(*#b(@sƐ  "b,##b(@s@ $? @憒 ",","##"` @# @#"@K`!&b "# *  * (#3"# ࠑ*  * (#"#" "*@ `* ("ࠓ*@ `* (""c@" @r` h c@ <     a@v9     @vH ?   $#܀   & 㿘#%"h 5"0"H3/"D'",+"`h`  2 0  @Y/ "H?@u?m&?+$c c@D@D@O    @u  c`@D@ $  @ $ "<"<2 " "h $h@"$  $  @$  $ ` $`㈀ b4"c@p %b4@@ b40` $`0@%   $ #w㿘#"@##@@ #"@##@ #cc   ?@X"  $c# @ %s: end of device%s: short write on character device%s: short write on tape device㿘# #`#3#"h-#)c@u4  $ `X@#܀   c@` $`#2,` ` $``  $`   "   %"  p@` "Ġ$ `@`c`""``   $` ##@v"@ ## "%u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %u bytes transferred in %u secs (%u bytes/sec) @Y""@`' 'h #\ dh @D @b  @tc    ""ؐ  d@Dk@a @tJ"x"x  ""ؐ  d@DQ@aِ @t0#b@p db@D=@aƐ @t㿘㿘@Ws %sskip reached end of input㿘"@"@  @o*?     @t ?GE `@ "<"<` ; 1"H",)h-'"H@s ` "%?@ # `?  ?%  @㑒`#$  @D6   @D "H㿐##   ?@)     @s ?_] `@k ##  7 '  a@s I `@W  #?)##+%#@ss` 4.    `@=`7 '# a@si? `@.@ %#@sI``  `@`@  0 #㿘@if%s: destination pathname too long0@A'%# @x? f" $c i$$c$@s#0&*  @@h@nv "cؑ. ?@J  <   $@@Q@@S`@VB. @@'@` /,@`?# )@@ / @@`l # @@  @t@@& "? ?`@Voverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s #Ѐ q@D k#Ԁ   !hb@U:0`#؀ )@-  $@Jt 2  @+@t @Ģ O ""#\!hb@U` `- `? "`@7L  " ` %  ? $ @77  $ 2 `y`Y2J @L  $B #܀ "@8 @J <   @   @A " @I "@ϰ 0<  @@%s: remove%s: set owner/group%s: set mode%s: set times㿈 @I˔ 6z"&@I "@@qːo cȀ #!@@n"cȀ $#@ ` #)+c@q#Ƞ c@q"b"@i@A# !@a@q@q9 @q @% !@O@$ "@F' '''@耢 "@7@qm " @@  !@$ /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿀'@'䀢 2! H`PX@ߠ "@ H@^ @ ?  `@`HK   p@ג`HB :  7`H@ 2! `P@n "@ﺒ @^d @” ?  `@ﮒ`   p@勒` :     `:@ usage: mv [-fi] source target mv [-fi] source ... directory 㿘!!h@SPb!h@SLb@S 㿘@ %s cannot seek temp fileout of memorycannot read temp file㿘"0  "`   @2 @  :  x@ 6  $@#ܔ!h@Sc(i nc0  h!` N h"`""h b!\" @mÒ2&h $@#ܔ!h@Rޒc(i @ cHhb? "bh" h@R h" C @ ? "!`h"!\hb? "bh" h@9 h" h@x h!\ @ x  $@#ܔ!h@Rc(i cX@Ѱ 0 >  @ B ; ha\*a\line too longcannot write temp file㿘@lĐ  $@f#ܔ!h@Rjc(i OcHN 2 &#@i Ab   & x @#  ! $@=#ܔ!h@RAc(i &c0@] x: < "  @8x "$??:  $@#ܔ!h@Rc(i b(@V 0 ! <@ <` @ B <  㿘!@1 ,&"`"& `0 "`0 , $ ,invalid address㿘"0@   "0@@@    "0@i @`X?㿘h"`""h!h + 0@: 4h@Hhhhd"dah "ah<h"4"adh 02"ahhd "dah?"ah(hh!h:`@hhd "dah?"ahhhb0"!dh  "!hhhd"dah "ahhb? "bh" h@ h" h@4 h!d/tmp/ed.XXXXXXw+%s: %s cannot open temp file㿘" "c@I ?* 2 hp"":p&  6 . @>  @Mb "`x $@(#ܖ!hbh@Q*pi @eb@?@ cannot close temp file㿘 x @4  $@#ܖ!hbh@Qpi @;c ?" xh@=ې!p"   :`  㿘 x @3h@=ǐ!p@Q㿘 c@   "0""0"`  *@``$*@ h!!*@"!*  ?(? invalid pattern delimiter㿘 `J   i @ȒaB?@`J, : @"`@! ( ( X4* +)>c `    @b   2@ Ť X@  p unexpected end-of-file& no previous command%s out of memory㿐   `@/&c @ƒ а?i c( cH@O?0# @#)'%hh"@D "  % ,  , @F  @ '@J?  ?4   ŀ  @.ْc  @.ϒc@ 2`i\@j  h" K hb "b "&"@@j2&h $@#ܔ!h@Oc`i @ܒchhb? }"bh" h@ h" A?@T =?""$hb? "bh" h@ h" "@< @iF" `L@ `!@& @ c   ` ,@  ` J 0F㿘# ` G#hb $bb#@j, 2% $@(#ܔ!h@O,c`i @gchb? $bh" h@ h" &?@ "?" "#hb? "bh" h@ h" @ǐ `"#*`"  㿘)3@ 6`@.@ `@'@  !4 !`@ \* c\  \(\\6   \* 㿘#hb $b" @"`\""!@iP#$#b? $bh" h@ h" @? r%s: %s cannot open input filecannot close input file%lu 㿘N ! @bh@R@bbh 2 $@=#ܖ!hbp@N@i &bx@D6N1? ! @U   $h@1 h $@#ܖ!hbp@Ni b@U?0" ""!h@N ,&newline inserted newline appended 㿘! c 0@`?""ch"  ;" ,3h%h@Nb &bY t  b? C&b  @I  {?@ w?$  , @ & b? %&b  @+  ]?@k Y?b? &b  @  "@X  B? `    #  ` # 8@ђah#   "   "` ``"`"c@"ch"   "@%s out of memorycannot read input file㿘 -'h+)hh" "? $@/n`$ @`  @S` Q  C ┐ $┒ b`t" @gܒ 2#%!# $@#ܔ!h@Lci @2c ┐? $"  @m " ?@ ?%`t┐? $"  @Y " `t@ `t*,`   "c   N h"`"" b t" @g2& $@#ܔ!h@Lci @ޒc hb? A"bh" h@ h" O?@V K?" " thb? "bh" h@ h" ` @= ` 2  t*  @ $@Z#ܔ!h@L^ci @c0?   t *@  "` t*#   2?wcannot open output filecannot close output file㿘N ! @c8@"@3`2 $@#ܖ!hbp@Li 'c@@;6N4? ! @%   $h@. h $@#ܖ!hbp@Ki cX@%?0" ""!h@Kؔ&  㿘h"   `&h-+) @h0@ `c  *@ @ ?`@h"   "@cannot write file㿘"( #h%'! $b  N@`ݒ  0`@* @g#ܔh@Kmi @a?b unexpected end-of-file㿘 `J@ ` `"@@< ?&, `&h"H N h"`""h"D" @f2&h $@#ܔ!h@K#ci @^c hb? M"bh" h@ h"  @֐  ""Hh""Dhb? "bh" h@~ h" !h@ !h"D``@dƔ"D `*?/1i-h)h'h+h@& @J?  @ b H B " %" bD" @e 2"%H!# $@#ܔ!h@Jc @c "? %"b  @' b  @g  $D"? %"b  @ b D@S D@d]D`@m  D `*?h"H N h"`""h b"D" @e52&h $@L#ܔ!h@JPci @c hb? z"bh" h@Đ h" " @  ""Hh""Dhb? "bh" h@ h" h@ hbD*&bDstdin: %s cannot read stdin㿘  5 3)h'-h/? $@,G`& @Y `< D  " %" b" @d 2#&` @ / @ m`?8``J@. `+$``*```$``@'J`! )?`` $``b( "b( ; ,"`X &@`0`` ?`0  @? invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiterawcrypt unavailable%d ! unknown command㿘   `J"ؒ@ `  `J@  `"`J`  ` `" `J`p{ǐ *`@ >` > > > > > > > > > > > > > > > > > > > > > > =T > > > > > > > > > > > > > > > > > > > > > > > > > > > < > > > > > > > ! > $ & > > > > > > > - . > > > > $ 8 > > > > > > > > >  > \ T !h # $ & ' ( )| *X + , > -D . / 1x 5 7H $ 8 :X > ; ``J n"   p l" 2 `` "``````"``J i #耢 2@@ v XӀ  ,@  ``J n"   p l" 2 `` "``````"``J i #耢 @ (@ `X @ ; , ? ,@  ``J n"   p l" 2 `` "``````"``J i #耢 @\ (@ `X t ,` 0@$   ig" , d h" \?"( i Pb `Jbؐ  i Bc@? ``J n"   p l" 2 `` "``````"``J i  @ Z`0 &?@I &? 6L ?  !h"@0L hJ" 2Li c0 h"ے &?@" dii?"a""( i Ԓb `Jbؐ  i ƒc@0"İ?L ! i cH``J n"   p l" 2 `` "``````"``J i L h"@h@ ڐ"@+"x0#耢 i c` @`0 z`g `G ' o`G `V # ``J n"   p l" 2 `` "``````"``J i Bc "c^& "( i 1b ``J n"   p l" 2 `` "``````"``J 7i "( i b ``J n"   p l" 2 `` "``````"``J i h ""@ `""i J !h@Bbx0 X  i Ȓa``J n"   p l" 2 `` "``````"``J i #耢 2@ X@ )?  , @`  ``J n"   p l" 2 `` "``````"``J i p#耢 @L (`X f@ K ``"`` X Ji Qa ``J n"   p l" 2 `` "``````"``J i.  X@   ,@) # ``J n"   p l" 2 `` "``````"``J i  (`X^  ,@  (k X "( i c X` 0 6i ֒a`X" (@ "`X i Ȓc ``J n"   p l" 2 `` "``````"``J i #耢 @@ ֐  ,@  ``J n"   p l" 2 `` "``````"``J i r (`Xє  ,@n h ``J n"   p l" 2 `` "``````"``J i D (`X "( i 6b ``J n"   p l" 2 `` "``````"``J i ##    $# 2 "@h#"@"( i b ``J n" `` p l``2`` "``````"``J i  d ٰ?h" Ԁ`q0 `Jbؐ  i c"( `0" X@$ ``J n"   p l" 2 `` "``````"``J i #耢 h@oh"J" L ! @L 2 LhJ" 2Li tc0 h"]`X&l?j 0f c"`d##%h``J g"  p ". ) 9( 0%  `` r"   `` $````@Ԕ h"# @@2  $#܀ ""  ?$ #i ``J ``  h#  i c h"# `J@  hJ` hi c#hb  "b %h@ p%hhb? "bh" h@  h" ?@  ް?@ "h@֗@Yh"#h "chb? "bh" h@  h"  @ А   h#h@ yc #耢 hc c ? "chc "c hc  ?"ch``J n" p l 2    "`` "```` ,@z t ``J n"   p l" 2 `` "``````"``J i P#耢 h@,hhh#c@ x-  ,@B < ( X 5"( i *c X` 0 6i a`X" ("`X ``J n"   p l" 2 `` "``````"``J i #耢 @@Ȑ؀ "( i b ``J n"   p l" 2 `` "``````"``J i @  `JqQ?`` "`` `Jbؐ  i c@ "(   0  " X"`( @`0 &? ``J n"   p l" 2 `` "``````"``J i fh"J" L ! @L 2 LhJ" 2Li Nc0 h"`W## (]X; 06" d d 2h" .q",?0*"( i b ``J n" `` p l``2`` "``````"``J i Ɛ ` "`( , @`  ` ` ?ϐ  @~ h"# @#@2  $#܀ "  i @ \ah"# ``J n"   p l" 2 `` "``````"``J i  Xh Xc 0@ 4 @8  0 ``J n"   p l" 2 `` "``````"``J i u"(  X 0@  0k"( i `b@] ``J n"   p l" 2 `` "``````"``J i 9ƀ  8Ð"x@ Ԓ` 8@vB h" ,@ ɐ 0( "`( , @#`  X@ ?i  `(iŐ @ ah"#Ɛ b@ ?㿘"( " (" X (`X 4 i  0@ i @ ma?no match㿘3 ,'+)`0  ?,0 ,;ߢc ` B   @   ,ڀ`i @ 0c?filename too longout of memory㿐 `J` L"ؐ@  `J@  `"`J`  ` `J  i @b` _  "```J@ !`@"` '  8Ð"x@`w 8? i @Ӓ`xm h#Ȁ`4I'!h" $"hb#@V\2%h $@s#ܔ!h@;wbxi @`"? H$"h" h@ h" = @+ 9 "#h"#hb? "bh" h@Ӑ h" "'@ ' `J h'c ``# ` @*  `J 1h#*@@)#Ā #İ shell access restrictedno previous command㿐'h"  i  cﲒ "``C? h#Ѐ N h"`""h#̐ "&"@@UȒ2&h $@#ܔ!h@:bxi @`hb? "bh" h@W h"  ?@ ?"#h"#hb? "bh" h@> h" h@} h#̐ !*@ `J z -h%h+h573 $/i9'h)h#``J !V % Ѐ >  $ bc̒" @U] 2%@ucܔh@:{x @ ? o$⠀  @ ⠀ ?@3 ?%c? $⠀  @ߐ ⠀ c@ c ` *@ `% `J \ c̒% ` *  `@J Ѐ > $ " "@@U 2%@cܔh@:%x @b ? $⠀  @ ⠀ R?@ݐ N?%c? $⠀  @ ⠀ c@ɐ c ``% ` @*ð  8 " J   c Ѐ > $ " "@@T 2%@cܔh@9Βx @  ? $⠀  @F ⠀ ?@ ?%c? $⠀  @2 ⠀ @r  8` @@ f `c @*@`8  @  Z `hJ" h@"@Dm'Ѐ E $ " "@@TN 2%@fcܔh@9lx @ ? `$⠀  @ ⠀ ?@$ ?%c? $⠀  @А ⠀  @ c @*@` ??' ``% ` ``J ``  D U h"`"" b 8" @S2- $@ #ܔ!h@9bxi @I`hb? "bh" h@ h" 6?@ 2?i ƒc0@-?0*" D" 8hb? "bh" h@b h" !@ !h 8c@R"  8*L@ ! % 㿘 " ,- )!h'h+#耢  `?@J?  ?5 u` N  ` % `J   `` "`J ` `"`  N . "N  "T " $""? $"⠀  @ ⠀ =?@/ 9?`,`,$ @ ̒ "? $"⠀  @А ⠀ ?@ ? "`d"? $"⠀  @ ⠀ {@ w 㿘 ` 0@  IF@^1)h/h+h#` E " %"`"Ԑ" @RҒ 2#&#!# $@#ܔ!h@7bxiА @(`"? %"b  @c b İ?@ ?%"? %"b  @O b @ Ԑ@Q``@@# N h"`""h b#Ԓ" @R~2& $@#ܔ!h@7bxi @Ԓ`hb? 8"bh" h@  h" m?@L i?"#h"#hb? "bh" h@ h" h@3 h#Ӕ# #*@@ *`@Q !A?$ ,hb "bh#Ԁ   ,@  hb? "bh" h@ h" ?@ ? "`dhb? "bh" h@ h"  @  㿘 X  0   (?  Xh hb  "b%"`XZ" , @ ^   0@   @ R hb? "bh" h@T h" U?@ Q? ( ߐ$" `"`$$$` , (6 "  X`(" "#耢 砒 "`dhb? "bh" h@ h"  @C  㿘! (  X (" ` @" , `& `"`N1h)h?-" &"@)"I$ , @  "? &""  @ " '?@ #? %d"? &""  @ " "@ @¢  ,@ ` 㿘!h" $" @w `"? $"h" h@z h" =?@ 9? 0@  ?#耢 "$$$`0?&@" "0?"`, "`dhb? "bh" h@B h"  @  㿘  `i @a$? 0@ ʐ@" #i `$`, & &?@@ invalid mark character㿘"ؐ@   i @b ?".`@ `l "`l".`"@ 㿘"ؐ  ". b@i @b ?l `*`  l"ll`㿘@Ov  $ >  & @#ܔ!h@5bxi @S` 㿘"  N \2 `?㿘h#܀`H %h $hb#@O˒2%h $@#ܔ!h@4bxi @!`? $h" h@[ h" . @ * "#h"#hb? "bh" h@B h" h@ hؔ`N \  * h#؁㿘h"  h? *  "@㿘h"  h? *  "@Ned.hupHOME㿘h" h㊐ h? * *@" 00א"(ƒc8  (@!"0#@?@  @N @2J /" /.*`@ؒb(ƒc 0N 㿘h" hD h? * *@"!@F?㿐h? **@" `h@Qf   h?"c h?"c..㿘h" " N ! @` @ /  i @)c invalid pattern delimiterno previous pattern%s out of memory㿘 `J  i @`Z *:    `" `J  *i!H ii @`i?!H@M: ": i!H` h# !i@ h!i@M  $!H $@#ܔ!h@3`i @Ò` h"#!i!H@} 2!i !H!Hi @g!'@N7!H$!H unbalanced brackets ([])trailing backslash (\)㿘 ` @* : %!i*`:   [ \ `L@@` ` sL@ k`L@ @ `$@i!P N h"`""i b!L" @M2&i $@#ܔ!h@3`i @N`hb? ?"bh" h h" ; Ɛ 7 "!Pi"!Lhb? "bh" hn h" 1i 1i!!L `@L!L*$ `#  i!Liؐ b@  !L  J^" J]"  ]&(8 ![2 J `.`:`=2  J ]   J]2J 2J J] J]@?number out of range㿘&@& `J " F @V A? `J 8 `J, : @"` ` ` ?ϐ  @  @&@#@2  $#܀ " i @b&@? `J g2   ``" ` & no previous substitution%s out of memory㿘 `"`J % J-`: @"` 4 i @Fch 4& ` `J-`: @`-%h')h1/`h =  $ b4" @L 2%h!# $@#ܔ!h@1֒ciِ @c? $"  L "$4? $"  > " 4~ 4 ``& ` @* ` `J@ "\% `4 ``& ` @* `#耢  ` "   @J? ` ?4 &a  `J-`: @`` h N h"`"" b 4" @L<2& $@S#ܔ!h@1Wci @chb? "bh" hː h" #    " h" 4hb? "bh" h h"  " `4*`4no match㿘`, ("`,  X s +'h)h`, 3%`,@&}?Y`,  h p@┐ $v┐? Y$"  f " \? X?`,`,$ @C ┐? :$"  G " =? 9?┐? $"  2 " "r `, X`(" `, " ,` `i @ϒc ?`  ,֔ ? infinite substitution loop 㽸    CU# ` ߥ `@ @}d ]`-3h)'h"b$ D` b &b b p" @K 2#%!# $@*#ܔ!h@00ciِ @kcb? &b⠀   ⠀ %? !?% pb? &b⠀   ⠀ Ґ # $ >  p@IӔ@ \$? Eb &b " "`p@@J 2#% $@#ܔ!h@/Вci @ cb? &b⠀  F ⠀ Ű? ?% pb? &b⠀  2 ⠀ r #  ޖ  p@Is$@ L@ `  2` '@ @|  ,'@   N h"`"" p "&"@@JA2& $@X#ܔ!h@/\ci @chb? :"bh" hА h" N? J?" " phb? "bh" h h"     $ 2 i @Yb( ?#  O ! p@H p@۔"H "H*@@ *``  㿐' 4  -5h+9;7 $)hL &O \`` " ;  & "`p" @I 2%@ܔ!h@.Œci @?  &"  ; "%`p? &"  - " @m @6`p *@`@ ^ L 0Y 9X? T * @  " < &  "p@II 2%@aܔ!h@.gci @? &"  ݐ "%`p? &"  ϐ " @ @6N`p *@`@ E < & " "p@H 2%@ܔ!h@.ci @X? b&" Z  U"%`p? &"   " `pŐ `p *@  4$  @& L   N h"`"" b p" @H2& $@#ܔ!h@-̒ci @chb? "bh" h@ h"  ? ?" " phb? "bh" h' h" f  p*%s out of memory㿘i!ii!Ȁ  `d"ȓ* @ @HW*` $!i$!#iȃ*` * "۟a!ē*@ *` "ۖa!ē*@ *` & $a@R#ܔ!h@-Vai @a@!i@H!$!i"!Ȱ nothing to undo㿈 , 0i!Ѐ?i!Ԁ? ii @oc?!̀  "`dS hb "bi!̐@Xi!đ+` *  +`  +`@ =  +` *  ` @" @  ,"`@ *` `"`"`"`@" @ *`@ `"`"` "` "``"``" +`@ *`  " i!̔ `2  : *i!i!̐2  :  +` * ' ''` * @*` "" ""#耢 ia","aia"0"ahb? "bh" h h"  ;  㿘'i̐??!$)ia!ē* @*` 2 ``@  @@G@̐??$i"!i ,"ai 0"aԁ㿘@benstuvusage: cat [-benstuv] [-] [file ...] stdout㿘@c- @֒ch % +#)'ߐ@h̔p?]? 78T*  T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T  T T T T ( 4 L$h%P$b\%bl$h%"`$b\$X!@M $b\ߐ!h@+cx@,P #0* @"P "l "h "`  "X "\ @@@z! " @c@,!"dstdin-r%s㿘 "8"bT-+)'%  @ d@  @obH2"P@  $T @"@; 2%6d 㿘   '! ^ ? & @ }`& @?` 9 )"`  2 ?` " "* `@ ? Ң"h "P  "h  c @*` @2  "l ?`"@&  $ " $* $@ ?"  +"X ?`"@& ^`"*@ ^@ ??`"@& I " I* I"\ c ,?`"@&  M " M* M@a ?j?`"@&  - " -* -@L ?U "ؐ  0?`"@& ^`"*@ ^@1 ?:  ? @?` "@ *:  "  "   ?` "@ , :  "  "* ` @?"  @ "P@DbT ?6 ! @ @-c㿘R "8"bT)' % @"@   @E 6 P@ T`$T @T`"@GC 28R!"L %@C " bP@T؀d"H$"!@D "H $"L @Ւ %+)ߐL@FbH L@ @F 6 @#@"P@bT㿘@#$NetBSD: sysctl.c,v 1.9 1995/09/30 07:12:50 thorpej Exp $usermachdephwdebugnetfsvmkerntimexntptimerawpartitionmaxpartitionsdomainnameboottimesaved_idsjob_controlngroupsposix1versionprofilingfileprocvnodeclockratehostidhostnamesecurelevelargmaxmaxfilesmaxprocmaxvnodesversionosrevisionosreleaseostypeloadavgvmmeterpipsipipxrtipcntcoipxtplink_layerrouteappletalkhylinklatdec_dlidecnetibm_snaccittdatakitemcaisoxerox_nschaospupimplinkinetunixdiskstatsdisknamespagesizeusermemphysmembyteorderncpumodelmachinetzname_maxstream_maxposix2_upeposix2_sw_devposix2_localedefposix2_fort_runposix2_fort_devposix2_char_termposix2_c_devposix2_c_bindposix2_versionre_dup_maxline_maxexpr_nest_maxcoll_weights_maxbc_string_maxbc_scale_maxbc_dim_maxbc_base_maxcs_pathAanw㿘@_+) '%#@e$b`? a"$p n A"%"t0 w"$bx0$@N#0&* @"t "p  @' i"j!. @@@  . @(Ґ  @*@`@  ?@( 㻘@  @@2 ., ` #@. @`" @@bt `&@%sMust specify -w to set variables top%s: class is not implemented second%s: kernel is not compiled for profiling %s: %s offrunningUse pstat to view %s information Use ps to view %s information %.2f %.2f %.2f Use vmstat or systat to view %s information Use netstat to view %s information Illegal top level value: %d name %s in %s is unknown %qd%s: value is not available %s: specification is incomplete %s: type is unknown to this program tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s = %s %d 0x%x %s = %s: %d -> %s %s: %s -> %qd %s: %qd -> %s: unknown structure returned %s: unknown type returned    'Ē$H@@ ="x 2 !h@'!`P@' @ڒ =*, @L @1`xj@? '@, j! i"' '!h`Ӕ  , i"@ɒ0`@?“, '@  'Ȓ?`  *`@  p t L t t t̒?` !D*`@ ` ( D ( l t t t t h'А 'Ȓ  @D `"  !`@&!h@&`0v" s   !ے`؀`d!h]``]!hVaE C ̀ `@w "  !`@&\#\#`!a8@&R076!h/aH̀  `ĔȖ@0#"!hax ' !haĀ!ha@&$0    $@ꥐ'  a@ꦔ $'` ȒȖ @D? ` $#܀ " -  0!hϒa!h˒b!hǒb0@Ў0" !`@%Ԕ #\!bX  @% 0 " '@V!b "  Ȑ @?!b@%0!b?`z!ԓ*`@ p " !b@%!bc"  !b@%t!bS" !b@%b!bA"  !bؔ@%R!b1" !b@%@!b@%:0"  !b@%.!b@%(0 !hc!hc @%㿀jb &""b ''  $"" '%'  @C ?, ""   $'idpudpegptcpggpigmpicmpipdirected-broadcastforwsrcrtmtuttlredirectforwardingmaskreplrfc1323checksumthird%s: no variables defined for this protocol fourth㿘@ jcT:?a8j@IT/` &*`j#\@  @ !!ha@@$?@ a?ap@#  & *`  '?.%s: incomplete specification %s level name %s in %s is invalid 㿘  @b !hb@$C?. @`" @= " & !hb@$'?usage: %s %s %s %s sysctl [-n] variable ...sysctl [-n] -w variable=value ...sysctl [-n] -asysctl [-n] -A㿘!hc#@#`@$ 㿘@Q_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] 㿘!h@#ɒ`@$i vnhboot: %s proto: %s device: %s sysctlSUN-4open: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@Z)' %#@`S!? n"$0 v h"$0"$c,#0& #0* @"c(! $#1 &##,  ! @ !0@#!@@# ' ' d' 8 @AV ? @faP  #8aX@   "c#@貒!@#Ӑ # @}  a`@C##(@ @# @@}#0 3"@! @ap# @Y  a`@# "@@g  b@a@@@0耢  @a@@G nlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8j@Ԓc  j# # k k  @ 0@ !`@ @<  @w0kȒaB  "@"Q2`* @ *`  @"  @U0U@?}̖: Ȁ̀!@P0B@? #  `  a`a >@?@`?# @@! ?@@ ?# @  ?Q@@ 2K@@?@ `?# @! 2 @9@@ ! 3@? ?c @ ̀@2 @%@@@@ ̀@@? ?c @! @"  @@@@! @# #?B ?@ `?# @! 2 @6 @@ ! 0 @? ?c @ ̀@2 @" @@@@ ̀@ @? ?c @! @   @@@@! @ @?@ ?# @!@ ?@!@? `?c @! @ ?+" @@@@! @? " ? `?c @! @  @@@@! @##? "@? ?c @! @ "@@@@! @""j## "c  "c "c4! #!8#4 !`@@;@>B0 #"c#, !@&`# !!!@!@j!c@&@# `  %s: devread: lseek%s: devread: read㿘. >@>   "ap@@=Ք a@statfs: %sffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: Too many blocks%s: block numbers: %d %s: block numbers (indirect): indirect block8@  a`@S@! Ԑ b @Ib0@   b8@   b@@*@Đ  bh@,@9Ғ  `@#@=e!#( Z"x#(@:F 0 @b@9 @8[  ,@8V @ @@)d @9 x `* @ d,@  03"@)T x* #4 0"@ 0?: `@ B  @'ɕ;  # b@Ȕ#"#, "@`(`(  53/뀤 d*@,"@c, @   뀤#, @ڐ"耤C#, "@В`X 0Ҙ# t" /-+뀤 d*@㤑,"@, b@쯒  t ꀤ#, @읐"耤 b@R 㿘@q$NetBSD: if.c,v 1.16.4.2 1996/06/07 21:46:46 thorpej Exp $ifnet: symbol not defined %-5.5s %-5.5s %-11.11s %-17.17s %8.8s %5.5s %8.8s %5.5sNameMtuNetworkAddressIpktsIerrsOpktsOerrs %5sColl %sTimeDrop%-5.5s %-5d %-11.11s none%-15.15s %-17.17s %23s %-15.15s %lxHns:%-8s %-17s (%d)%x%c%8d %5d %8d %5d %5d %3d`@#0o "@0i@  d #\ #` #d#c @` (@`0  8@`@#  8@ݒ`H? " " * @K `$ `&X@ l@< /"`\@a `@W/  2, *, ,d P@`! p `@떒 x@뒒@c ݢ Ȑ"      Y5 "K `S `!@o p @k p@,@b `@+`@\ " 8 #!@& $@+`@J  r`7|`7~`@$|@-^ @4@-3@. Zؐ @ ` `@$`% @ ` @@?` 8L ? (8L 2 8`? (8L "?8`?      .@? "!  ?`$  @ `$*@@V @ !@W# !@? " " * @+ `〤`(%s)%s: %s: unknown interface input %-6.6s output input (Total) output%8.8s %5.5s %8.8s %5.5s %5.5s packetserrscolls%5.5s drops %8.8s %5.5s %8.8s %5.5s %5.5s %5.5s %5d %8d %5d %8d %5d %5dP@5  P!(/x/P"  `&!(-l)Ģ x X@ @  @ @"`"`(@ "`(@`\` ` @!hb@@g  @bp* @#@a(% *` *  *  *  :   # "@#8@#@!(o@ Đ &`&`&`&`&` &`$`(@*&`? " " * @R #`c  @ɚc# #@ca(% *` *  *  *  :   #c  @馚c# #@青c? " " * @  @4! $$$$$ $$`R!(@O X@N F @`````  $@ $ # @` # `$#@V" &`&`&`&`&` &`$` $` $` $` $ `  $ $`$ $$\``(a(% *` *  *  *  :    #ؒ$@ $ # @ # $$#@" $$$ $ $$$$ $ $$$? " " * @] @3V!@ @ @* @@$ ($NetBSD: inet.c,v 1.15 1996/01/31 04:01:48 mycroft Exp $TIME_WAITFIN_WAIT_2LAST_ACKCLOSINGFIN_WAIT_1CLOSE_WAITESTABLISHEDSYN_RCVDSYN_SENTLISTENCLOSEDtcp??? Active Internet connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8x %-5.5s %6d %6d %d %s @cX`?@  /-k% )+k ,@ \@ #`0␀  '|@~D| `@ `a@ݔ X 8@#h␀ @#? "`$*@ @k # #@c# ## H#\ `  (@Κ`8%X#  ` P P@` X`@$@ 5@ 1`!Ā` *` h:`R!ē*` p@@? " $ * @ f%s: %d packet%s sent %d data packet%s (%d byte%s) %d data packet%s (%d byte%s) retransmitted %d ack-only packet%s (%d delayed) %d URG only packet%s %d window probe packet%s %d window update packet%s %d control packet%s %d packet%s received %d ack%s (for %d byte%s) %d duplicate ack%s %d ack%s for unsent data %d packet%s (%d byte%s) received in-sequence %d completely duplicate packet%s (%d byte%s) %d old duplicate packet%s %d packet%s with some dup. data (%d byte%s duped) %d out-of-order packet%s (%d byte%s) %d packet%s (%d byte%s) of data after window %d window probe%s %d packet%s received after close %d discarded for bad checksum%s %d discarded for bad header offset field%s %d discarded because packet too short %d connection request%s %d connection accept%s %d connection%s established (including accepts) %d connection%s closed (including %d drop%s) %d embryonic connection%s dropped %d segment%s updated rtt (of %d attempt%s) %d retransmit timeout%s %d connection%s dropped by rexmit timeout %d persist timeout%s %d keepalive timeout%s %d keepalive probe%s sent %d connection%s dropped by keepalive %d correct ACK header prediction%s %d correct data packet header prediction%s %d PCB hash miss%s %d dropped due to no socket Ȁ ϒ@#X(@ d  Ѐ  h@d#`@dh  l  Ѐ 4p@h@l#xh@lp  t  Ѐ 4x@p@t#p@tx  H  Ѐ 4@x@H#x@H  Ѐ  |@#@|  Ѐ  @| @|  Ѐ  @ (@  Ѐ  @s H@}  Ѐ  @d `@n؀  ܀  Ѐ 4@Pؠ@Mܘ xؔ@UЀ  Ѐ  @<Д @FԀ  Ѐ  @-Ԕ @7    Ѐ 4@@ @    Ѐ 4@@!@䀢  Ѐ  @!0@    Ѐ 4@@!P@    Ѐ 4@@!@  Ā  Ѐ 4@@Ę!@̀  Ѐ  @̔!@  Ѐ  @ (@Ȁ  Ѐ  @tȔ!@~  Ѐ  @e" @o  Ѐ  @V"H@`  Ѐ  (@G"x@Q(  Ѐ  ,@8("@B(,  Ѐ  0@),"@3,0  Ѐ  <@0"@$0<  4  Ѐ 48@<@4# <@ 48  Ѐ  D@8#P@8D  @  Ѐ 4P@D@@#xD@@P  Ѐ  L@P#@PL  Ѐ  T@L#@LT  Ѐ  X@T#@TX  Ѐ  \@X @X\  Ѐ  `@\ 0@\`  Ѐ  @` P@`耢  Ѐ  @p x@z쀢  Ѐ  @a @k  Ѐ  @\ @\  Ѐ  @C @M %u datagram%s received %u with incomplete header %u with bad data length field %u with bad checksum %u dropped due to no socket %u broadcast/multicast datagram%s dropped due to no socket %u dropped due to full socket buffers %u delivered %u PCB hash miss%s %u datagram%s output p @#X@Ŕ $Ѐ  Ѐ  @Д X@Ԁ  Ѐ  @Ԕ x@܀  Ѐ  @ܔ @؀  Ѐ  @ؔ @  Ѐ  @ @䀢  Ѐ  @ @耢  Ѐ  @|!0@Ԓ"@ܒ"@ؒ"@"@"@蒢@ Ѐ @o!X쀢  Ѐ  @`!h@`  Ѐ  @G!@Q %u total packet%s received %u bad header checksum%s %u with size smaller than minimum %u with data size < data length %u with header length < data size %u with data length < header length %u with bad options %u with incorrect version number %u fragment%s received %u fragment%s dropped (dup or out of space) %u malformed fragment%s dropped %u fragment%s dropped after timeout %u packet%s reassembled ok %u packet%s for this host %u packet%s for unknown/unsupported protocol %u packet%s forwarded %u packet%s not forwardable %u redirect%s sent %u packet%s sent from this host %u packet%s sent with fabricated ip header %u output packet%s dropped due to no bufs, etc. %u output packet%s discarded due to no route %u output datagram%s fragmented %u fragment%s created %u datagram%s that can't be fragmented 0@3 h#X@Y  Ѐ  @@ H@J  Ѐ  @1 h@;  Ѐ  @" @,  Ѐ  @ @  Ѐ  @ @  Ѐ  @!@  Ѐ  @!(@耢  Ѐ  @!@@  Ѐ  @!h@  Ѐ  @!@  Ѐ  @!@  Ѐ  @!@Ѐ  Ѐ  @Д"@Ā  Ѐ  @}Ĕ"(@  Ѐ  @n"H@x  Ѐ  @_"x@i  Ѐ  @P"@Z  Ѐ  @A"@KȀ  Ѐ  @2Ȕ"@<쀢  Ѐ  @#"@-̀  Ѐ  @̔# @䀢  Ѐ  @#X@Ԁ  Ѐ  @Ԕ#@؀  Ѐ  @ؔ#@܀  Ѐ  @ܔ#@܁address mask replyaddress mask requestinformation request replyinformation requesttime stamp replytime stampparameter problemtime exceeded#10#9echo#7#6routing redirectsource quenchdestination unreachable#2#1echo reply %u call%s to icmp_error %u error%s not generated 'cuz old message was icmp Output histogram: %s: %u %u message%s with bad code fields %u message%s < minimum length %u bad checksum%s %u message%s with bad length Input histogram: %u message response%s generated @@ #X@7@  Ѐ  H@@#@@(@H  Ѐ   @H#`@H  '%k \. ?T  `. @㘲 . @@@T  .   Ѐ  @#@  Ѐ  @#@  Ѐ  @ @  Ѐ   @ @  '%k \. ?  `. @ް@ . @@@ީ  .   Ѐ  @ X@ޖ %u message%s received %u message%s received with too few bytes %u message%s received with bad checksum %u membership quer%s received iesy %u membership quer%s received with invalid field(s) %u membership report%s received %u membership report%s received with invalid field(s) %u membership report%s received for groups to which we belong %u membership report%s sent p@  $#X@"Ѐ  Ѐ  @ Д#0@Ԁ  Ѐ  @ Ԕ#H@؀  Ѐ  @ ؔ#x@܀  Ѐ ܀ ###@  Ѐ  ###@䀢  Ѐ  @  @ݼ耢  Ѐ  @  8@ݭ쀢  Ѐ  @  p@ݞ  Ѐ  @  @ݏ%.*s.%.8s*%d %-*.*sH #  ! " @>cP@W@H !  `@t   ` .` #`cXch2@2#   #p @=%u.%u.%u.%u㿐k` ! "`!#@!  #@H .#@ᬒ`*#! .  ,'@s'@s6  `@tN  2`2 @uӔ "@Hs .`@cꀢ ",@  `#` #`* `*#@e1&3`3`#`3` @ܲ `1#$NetBSD: iso.c,v 1.12 1995/10/03 21:42:38 thorpej Exp $%s: %d esh sent, %d esh received %d ish sent, %d ish received %d rd sent, %d rd received %d pdus not sent due to insufficient memory %d pdus received with bad checksum %d pdus received with bad version number %d pdus received with bad type field %d short pdus received 㿀-@ 9  ("@]"@X"@S"@N#@J#@@F#h@B#@>#@:%s: %d total packets sent %d total fragments sent %d total packets received %d with fixed part of header too small %d with header length not reasonable %d incorrect checksum%s %d with unreasonable address lengths %d with forgotten segmentation information %d with an incorrect protocol identifier %d with an incorrect version %d dropped because the ttl has expired %d clnp cache misses %d clnp congestion experience bits set %d clnp congestion experience bits received 㾀B@ ~! = @ۡ  @۝ @ۙ!@ە!0@ۑ@ !X@ۊ!x@ۆ!@ۂ!@~"@z" @v"P@r4"h@n8"@j<%s: %u incomplete header%s %u bad data length field%s %u bad checksum%s 㿀@ #  @ 9#@B@ 1 @;@ * @4%s control block: symbol not in namelist tpprev 0x%x next 0x%x isop_prev 0x%x isop_next 0x%x??? 耦  @0I@췒`耢 2 H@O0? @08@ Δ 2!"@'v "쀢*%"-+# @  `@  @] a? "a`$a*@ @G 쀢Active ISO net connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8x %-5.5s %6d %6d () *.* 㿐k >@t"x" @m"? " " * @ے # "@Tb# ""#X#\ c (0#8@<cHk" #   `"@.#`#h`@%$`   `@x@##`" @ #`" l"  "\@& "b@ ϔ "@ ` F F  `@єx@#0 # @ސ#0# #  Đ#x@&W #Ēc@  Đ#@^ undefined tpcb state: 0x%x %d %-12.12s㿈@  * @&k@ ~* a#x%#'l! #  "N @ g!` "p@ى"   9 7 5#`@ M    @1 ㌒b@ =  `"*`"@@Wa? "a`$a*@ @ǒ  * *tpip0#@  \" 2 '@o] # #`@%#h`@$!  TP not configured 㿘 @!@0 @"!#@є!Ȑ#@d %*sReceiving: %*s%d variable parameter%s ignored %*s%d invalid parameter code%s %*s%d invalid parameter value%s %*s%d invalid dutype%s %*s%d negotiation failure%s %*s%d invalid destination reference%s %*s%d invalid suffix parameter%s %*s%d invalid length %*s%d invalid checksum%s %*s%d DT%s out of order %*s%d DT%s not in window %*s%d duplicate DT%s %*s%d XPD%s not in window %*s%d XPD%s w/o credit to stash %*s%d time%s local credit reneged %*s%d concatenated TPDU%s %*sSending: %*s%d XPD mark%s discarded %*sXPD stopped data flow %d time%s %*s%d time%s foreign window closed %*sMiscellaneous: %*s%d small mbuf%s %*s%d cluster%s %*s%d source quench %*s%d dec bit%s %*sM:L ( M mbuf chains of length L) %*s%d: over 16 %*s%d: %d %d: %d %*s%d EOT rcvd %*s%d EOT sent %*s%d EOT indication%s %*sConnections: %*s%d connection%s used extended format %*s%d connection%s allowed transport expedited data %*s%d connection%s turned off checksumming %*s%d connection%s dropped due to retrans limit %*s%d tp 4 connection%s %*s%d tp 0 connection%s LOCAL, PDN LOCAL,~PDN~LOCAL,~PDN~LOCAL, PDN %*sRound trip times, listed in ticks: %*s%11.11s %12.12s | %12.12s | %s CategorySmoothed avgDeviationDeviation/Avg %*s%11.11s: %-11d | %-11d | %-11d | %-11d %*sTpdus RECVD [%d valid, %3.6f %% of total (%d); %d dropped] %*sDT %6d AK %6d DR %4d CR %4d %*sXPD %6d XAK %6d DC %4d CC %4d ER %4d %*sTpdus SENT [%d total, %d dropped] %*sRetransmissions: %*sCR %6d CC %6d DR %6d %*sDT %6d (%5.2f%%) %*sXPD %6d (%5.2f%%) %*sE Timers: [%6d ticks] %*s%6d timer%s set %6d timer%s expired %6d timer%s cancelled %*sC Timers: [%6d ticks] %*s%6d inactive timer%s cancelled %*sPathological debugging activity: %*s%6d CC%s sent to zero dref %*s%6d random DT%s dropped %*s%6d illegally large XPD TPDU%s %*s%6d faked reneging of cdt %*sACK reasons: %*s%6d not acked immediately %*s%6d strategy==each %*s%6d strategy==fullwindow %*s%6d duplicate DT %*s%6d EOTSDU %*s%6d reordered DT %*s%6d user rcvd %*s%6d fcc reqd B㿀#aa!@ 7!@|aa!@ -@r aa!@ # @h ab!@  @^ ab8!@  @T abX!@  @J abx!@ @@ $ab!@ $abȔ!@ @/ ab!@ @% Hac!@ H@ Lac !@ L@ Xac@!@ X@ PacX!@ P@ Tacx!@ T@ `ac!@ `@!acȔ!@!ac@!@ Dac!@ D@ @a`!@ @@ \a`@!@v \a`h@p!@! a`!@f! @!$a`!@\!$a`!@U!@!a`Ȕ!@K!a`@E!aa!@>!( '%#, !(, , !(#\#` a@+  $, #aa8!!@!laaP!@!t@\!paah!@ !paa@!@L ,aa!@ ,@B 0aaД!@ 0@8 4ab!@ 4@. ab8!@ @$!|abp!@!|@!xab!@!xab@Ŗ!#`#\#p#`ac!#@@cP )'%k , @@a#\a#`a#d!〔@  ,  d  h' kȉB$# d' kȉBą"?   d#` <#d#\ #ac!!@l h #\ #`a'! @`  #\ #` #da% ! @R a`X! l@J 8 #\ #`a! @?  #\ #` #da ! @2 a`@,! |#\a`! t@" x  '  kȉB$# ' kȉBą"?  #\!`@   '  kȉB$# ' kȉBą"?  #\#a`ؔ!!@ a`!@ @ ܦ@ ؤ@  #\#` #d#ha)!! @aaP!@ @ @ @  #\#` #d#ha!! @@ aap!@ aa@!@!aa!@u!@!aa!@k!@!ab!@a!ab(!@Z!abH@T!ab`!@M!ab!@F!ab!@?!ab!@8!abД!@1!ab!@*!ab!@#!ac!@!ā{}[]<>㿘  @L  2    2   "   `  @9x  2   "   `   @ @(  `  @  @ @!?`"@  " *@ %s㿘@ % @  .k @`*`  ` *:` @ * @ *@ *@*`**!@`$NetBSD: main.c,v 1.9 1996/05/07 02:55:02 thorpej Exp $_viftable_mfchash_mfchashtbl_mrtstat_ip_mrtproto_igmpstat_file_nfile_cltpstat_cltb_rt_tables_nimp_esis_stat_tp_stat_tp_refinfo_tp_inpcb_clnp_stat_ns_errstat_spp_istat_idpstat_nspcb_unixsw_rtstat_icmpstat_imp_softc_ifnet_udpstat_udbtable_tcpstat_tcbtable_ipstat_mbstatigmpicmpipudptcpns_errsppidpesisclnpcltptpAadf:ghI:iM:mN:np:rstuw:nsinetunixiso%s: %s: unknown address family %s: %s: unknown or uninstrumented protocol %s: kvm_open: %s %s: %s: no namelist %s: no namelist %s: no stats routine 㷘@<*  "#!l % $'/@-@Ax?? 8*    P        0    D X                   \   h  t $      L `  l       "#"""#@l`0  $@c`8  $@Z`@ $@R`H  $!h`P@C@ " %~"b|y"#pwt"! @ !h`p@#@Ð d"!a""L`А \"`Y" @Ƞ"aS%@P#0* @@Jbؐ  "@@ȇ  "a@`Đ "`@  `` `@@/  @6;Ā  "c@!h`@ʖ@j #k@7&a\ k !`   @!h`@0@!h`@@J #p "k@%!d@A !    * @*`k!\@`€ 0 @ @) @_; @А  Ȁ " k!a@ "L  Ѐ kk@!0@ ~"`@     Ѐ k""@` 0""$@D0@ #  %@ @a #k@$b  @? "      @60@#   k#H@'   #   k#@   #  Ѐ k@A!@ 㿘 Ѐ "   * @*`k!\@ `` #  €%s: %s 㿘#@6!@  @4#!h `@ ?s  8es  `㿘k##؀ @᠒      2 㿘   @S@@8 @\` @t   0@7 usage: %s [-Aan] [-f address_family] [-M core] [-N system] %s [-ghimnrs] [-f address_family] [-M core] [-N system] %s [-n] [-I interface] [-M core] [-N system] [-w wait] %s [-M core] [-N system] [-p protocol] 㿘#@!!h b@ `!h b@`!h c@`!h cX@`@ $NetBSD: mbuf.c,v 1.9 1996/05/07 02:55:03 thorpej Exp $socket optionssocket names and addressesfragment reassembly queue headerspacket headersancillary dataoob datadata%s: unexpected change to mbstat; check source %s: mbstat: symbol not in namelist %u mbufs in use: %u mbufs allocated to %s %u mbufs allocated to %u/%u mapped pages in use %u Kbytes allocated to network (%d%% in use) %u requests for memory denied %u requests for memory delayed %u calls to protocol drain routines 㿘l ,!@!h  `  @!h `@i0`" k#     *     2 !@Σk#   !( % *`  *`"*`0@@΋    2 "a( l ,6!!( % #l,  2  , `P@k `,, !  ` !x@^" .  ؑ* @`*  < "*` *  * @  !@F` !@@` !@<  "@8 %u%c㿘  # k2  m21!p @ `!pip_mrtproto: symbol not in namelist no multicast routing compiled into this system multicast routing protocol %u, unknown mfchashtbl: symbol not in namelist mfchash: symbol not in namelist viftable: symbol not in namelist Virtual Interface Table %s%sVif Thresh Limit Local-Address Remote-Address Pkt_in Pkt_out %3u %3u %5u %-15.15s %-15.15s %6u %7u Virtual Interface Table is empty Multicast Forwarding Cache %s%sHash Origin Mcastgroup Traffic In-Vif Out-Vifs/Forw-ttl %3u %-15.15s %-15.15s %7s %3u %u/%u Multicast Forwarding Cache is empty Total no. of entries in cache: %d 㶸$ @`!03 $   @V!00 !`@P$0ǀ` @I!0 @C!0 @=!0a  "a x (    "  '.  2    "b @ H ' .4   @ _ p@  @ S " @ $* 2  Ұ D 2 @" ʔ Ɣ   T P 3 , @  "@ 2    "ؒc@є0 ( P! @ 0#X@Œ# @ 4\ch@̺8  .2  7B@̭c* 2 $. @̣#( ', 2  @̓# #@̎ @̋#"! mrtstat: symbol not in namelist multicast routing: %d datagram%s with no route for origin %d upcall%s made to mrouted %d datagram%s with malformed tunnel options %d datagram%s with no room for tunnel options %d datagram%s arrived on wrong interface %d datagram%s dropped due to upcall Q overflow %d datagram%s dropped due to upcall socket overflow %d datagram%s cleaned up by the cache %d datagram%s dropped selectively by ratelimiter %d datagram%s dropped - bucket Q overflow %d datagram%s dropped - larger than bkt size X @!0k    @!00a !`@0[` @Ԑ#h0T 4 @͐#̔ #@Ȕ #@˿Д #@˸Ԕ  (@˱ؔ  X@˪ܔ  @ˣ  @˜  @˕ ! @ˎ} !X@ˇv !@ˀ$NetBSD: ns.c,v 1.8 1995/10/03 21:42:46 thorpej Exp $dropresponduseroutputinputspp??? Active NS connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8x %-5.5s %6d %6d %-22.22s %-22.22s %d %s8 ː @ܿc耠`? T!"@ T"5"-"' +k ,Ȕ T @#0  "" ` "`    `  hl}l H 9 @Ð# @ʽ ? "`$*@ @- c  (@ʧ`0c  8 h #\ ` @ʐ`l" Hc  @ʆ @~$@"@w @"@p! ,` ! ,*`!@@_? " $ * @Β W%s: %d %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet   X@ӒW* "W4 `x @š`W4 "W* `x @ȱ`W* "W, `x @Ƞ`W, "W. `x @ȏ`W. "W0z `x!@~`W0 "W2i `x!(@m`W2 "W8X `H!P@\`W8 "W6G `H!p@K`W6 <6 `H!@:`< "@% `<x!@)`@ "D `@x!@`D "H `Dx!@`H "L `Hx!@`L "P `L!@`P "T `Px"@Ԛ`T "X `TH"0@Ú`X "\ `XP"X@Dz`\ "` `\h"x@ǡ`` "d ``x"@ǐ`d "h{ `d"@`h "lj `h"@n`l "pY `l"@]`p "tH `p"x@L`t "x7 `tx"@;`x "|& `x"x@*`| " `| "x@` " `0"x@` " ` #@@` " `0#@@` " `P"x@՚` " ``"x@Ě` " `H#p@Ƴ` " `"x@Ƣ` " `"x@Ƒ` "| `#@ƀ` "k `#@o` "Z `H @^` "I ` @M` "8 `H @<` "' `H @@+` " `H `@` " `x#@ ` " `#@`Ā " `H @`Ȁ " ` @֚`̀ " `#@Ś`Ѐ " `#@Ŵ`Ԁ " `H! @ţ`؀ " `!8@Œ`܀ "} `H!P@Ł` "l `h"@p`䀢 "[ `"@_`耢 "J `!@N`쀢 "9 `"@=` "( `!@,`  `"@` %d %s%s%s smaller than a header smaller than advertised with bad checksums㿀5є  X@耢 "! H@!0䀢 "! H@٘!H  ! H@ʘ!h too large to be forwarded forwarded too many times while gatewayed Refused due to lack of space at DestinationPacket at SocketNo ListenerBad Checksum at DestinationUnspecified ErrorNS error statistics: call to ns_errorerror ignored due to insufficient addressingerror request in response to error packetserror packet received incomplete received of unknown typeOutput Error Histogram: Input Error Histogram: 㾰  @@#H "+! `@1#h "! x@"# "p ! @#p "l! p@#l   ! l@ '. ?$ ". @  . @@0ذ  .   '. ? ". @ѐ@ . @@ذ  . in transitat destinationUnknown XNS error code 0%oxl P  l L*` *   `*` *    *` *`"p"ؐ@wb  * l`L    q! @y㿘l 2  2  2  2  2  @2 $NetBSD: route.c,v 1.15 1996/05/07 02:55:06 thorpej Exp $Routing tables rt_tables: symbol not in namelist Netmasks: @? 0#  l!  @@. @01Ēc l Ĩ#'!%#l.   t  # " # 2 @h0 2  @  @d$a@  ޑ. InternetXNSISOX.25 %s: Protocol Family %d: 㿘         !!!!`!!Ȓ@%-8.8s Address%-*.*s %-*.*s %-6.6s %6.6s%8.8s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface㿀# "x@—b"#\"#`"#d"#h"#l"#p"  ⸘ @| 㿘!!|J  !|!|D1!|%-8.8x (root node)%s => 㿘a1 R! P# #@O! ! # :` ##@:#-l! !! x@$!# @Q! @^ ,? " " * @ ! 0# l! " #@@$!! mask (%d)%6.6s %8.8x : %8.8x %d refs, mk = %8.8x {(%d),%s ->㿘!!T     @ɐ!O  @?a0!Đ!8a@R!ؒ!8`@` @+!Ģ!8" }y a@ Ua8 "@! @͔?!?`"@ }`"*@@ !@s" ̐? " " * @ޒ route-sysctl-estimateout of space sysctl of routing tablex ' ''' ''  ܘ @ @ @ @,ܠ2@. @x  ܘ @ך 6@w 0@j  @  %-6.6s 㿘 M%x L$x   $ @:  @ @ ,@ @@  @.  @a@? " " * @W defaultlink#%d%s%x: %02x%02x%s %-*s %-*.*s   x   " J " F   `"`@]@@ YV"(@'R    2 `xb0@z E `  ` @"8 `67x)'"@@d@H  ``'x@U# za@O @)'@`@C"P@ @`@;X@ x"`@E0! "h@<0"p@5pl R ̀ R@"` `*`R@ *@Ё%6d %8d %6d %6s - %.16s%s =>㿘 V 4E  0 @ V 4˒a@!V 6@ 8 P`!(!0a8@ <`!"@ a|ﵔ  <$"  !P"8!@@Вa? " " * @> %u.%u.%u.%u㿘'Dla !"a#!@!  #!@++ .#!@4 *#!!  D @Xs  @+ . @9c! ". " @!1D'D3`3`" b3` @] `1" %u%u.%u%u.%u.%u㿘! % "`` 3?  0 ?3?  2>@`6``2 @V  2  "@T!41? ? "c@6 (1# 6  "cЕ6 @ 1 6 6  "cؕ6  @  16  "b6  @ 1 "rtstat: symbol not in namelist routing: %u bad routing redirect%s %u dynamically created route%s %u new gateway%s due to redirects %u destination%s found unreachable %u use%s of a wildcard route 㿈@!0. @!W!@W!@W!@W" @W"H@*.%xH*.*any*%02x%02x%02x%02x%02x%02xH.%xH%xH.%s%sx 7 7 7 7 7 77 7•l ! 2l !!#@AcH@{!#O1!#@8cPH1l!@{  l'#X!@q  #`#\#`!!_@chL!_ 0 !_!k : J 0  !U@c1*!U1!#c@!U@,!#!#0H.㿈7 7 7 7 7 7 7 77!x!x7`7p!x@  "  (8f4 a* J TP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0)$NetBSD: unix.c,v 1.13 1995/10/03 21:42:48 thorpej Exp $Out of memory (file table). p#  @—@!00"""*` *   $"∤ h'T " (T 2 ( 코 2 (`  8  (` @L  (∀*T seqpacketrdmrawdgramstream#0Active UNIX domain sockets %-8.8s %-6.6s %-6.6s %-6.6s %8.8s %8.8s %8.8s %8.8s Addr AddressTypeRecv-QSend-QInodeConnRefsNextref%8x %-6.6s %6d %6d %8x %8x %8x %8x %.*s ^ $ V耢  PU 2   %lĀ @r"x##\##`##d"b"@\b$Vl*` #\`#``#d#  0 T@I`  #@@A? " " * @ 㿘@ = u u u u u ux up uh u` uX uP uH SEPOCTNOVMAYMARJUNJULJANFEBDECAUGAPR㿘!` @  virtual memory exhausted㿘@֐    @X@ 㿘 `@ 7 0@ D    @:@ -%s㿘@Vb @b 2  $ c@@ސ  ɐ "a(error closing file㿘@  X" @  $ c@ Xy@  ?6 write error㿘@  $ c@ ֔^@ %s/sort%5.5d%5.5d%ssort%5.5d%5.5d㿘%@] Z  J? /@4  " `H @(!ɖ  " ``!@$@a`$`"a`㿘 !\@̶@ "    2    @ڋ@l $ @h ƈ łǚȘɖ   *   b؄*   b؄H *  b؄   *   b؄* * *   Ȁ 㿘& && & read error㿘 @ @ ݐ" - "  @3 2*`   @2*`& &    " @` @"   $ c@ w@ @& ` " ` "  `" @J? "  @2 *`& & &  *@  㿘& a.`&& &  @H `EH @ H *H*:1`+Ƙ&"( *( Ɩ ( "*۔`ƒ(  *0  ` H $`MH HH *H 2`:1`+Ƙ&"( *( Ɩ ( "*۔`ƒ(  *0 㿘 !Xr&`ƨ  @$j$`` @e$,@``@2 `*`&`@n*`&@`@* "@`@* @$@<"`  `* @ X`@*` " @* @"`  &`* @ ڒ`@*` #" "` *   ƒ   *  2 `@* @ "``@* @"``@* @"` ` ` &`$&  .? @.< .ņ ` @ *2ņ* *?" ń*  0!Ŗ 0ń*'0Œ` @0`. 0ń* @  ` @0`ń*`  㿘Ɛ *@  @ƒ  * 2 Ɛ *@  ƒ `@* 2`-- Œ *  * ` `0 @ 0" 0@0"` .Œ *  . `@ *. .Ő *@  . Ő *@ Ő9  *  *   Œ  *   Ř Ś * `@*   Ś `@*  `@  @  |" 0{0Œ * s `*  m@ 0" 0 `@0"` .Œ *  . `@ *. .Ő *@  . Ő *@ Ő9 *  *   Œ  *   Ř Ś * `@*   Ś `@*  `   "  㿐 ` ƒ *  `` `/ ɘ   @ *?$@ / 2  : . @@ 2  : $@ , `@ ,   @`㿘 !X ƺ    "  2=  /+@@  "   *  *  *    %@ `&  "!$M 2 M@   @-@----@'",(   51",(LL~"@ L Lx"@`0 /`pn * @ *  * @ * 䀤ဤ LL ͤ׀`, A? * @ *  * @ * 䀤ဤLL@ـ LL 􀤀@ռ2l(",(    㿘!X ڒ&!$ " ! `@$@@ @ @Ղ ɰ$@! 2 h !l!̦%l!@В`v"֐'ȐP ['ɢ ؒ  @ $ `6K `4H  ܐ?, ܖؑ*  ?   * ? ,4,'ؑ*  ??@ؑ*  ?'̐̒ؐeؒ$ `6  `   ̐@@@ȁ!$  l!^' 6N -l7l,̀,,  *`&&,.`@@JВ`”", "=ȑ, 6  , "=p, $`,@=l* * =*  =p*`*`@}*`  ڒ@ =l=p$=l$=p ,`6ɦ !$ x`!h* * =*` @  J? &`&*@ @~ `qh* * = * @` ** = * @` - &- 'h** * @`' * @@h* * = *   `h "@ 'h* * = *   `#  "@ 'h* * = * @@ ٖ? & & * @}h* =`"=h*  @] *   h*`  h* L"= 6,ph@"p&,h* wh* @ih* @eh6 , & ,?"??"??"??"? >">>">>">>"> " =`,=t"=p4` " h* * =*  ,@=p*`*`@}*`  @ h=p"@ h  h*@=p"=l,@"=l`!$ ` &? & & * @|@㿘`!6`t  l& & & &  & &  &  & & & &  S& @: &@,@Ӕ ͔) '> 4@$`$ `$ ` $ ` $$ $  $  ?$`$ `$ ` $ ` 2@@$@ $` $` $`  `r%s: disorder on %s 㿘  +&)&'ɣ, =a  2 !h@  , wX`p -&  ``: @) ,`* , @  "z,`& b m- *   - & Ӣ`,``` ?&@ * , @" L&ܒb`` &@ : ,``` ?&@@* a -  `& @'&,`ሠ`@$? @,`A`@,`x !l!Ȣl!@aВ`W,i7ɮ  &}a TĒ܀ ,@4,G,  `  Ĩ &Ub%  ` ,`ؒ? @ "`ؑ,`@@  ? $ `$*@ @{[`܀@&$PL2@<@:@8 - ɀ  !`,`$ `ؔ@ Ɇ,,2, ," ,invalid field specification `%s'㿘  '@㿈'''@~ @@䀒㿘V' ȈɂǺ(8%F( x ̀ &` (&`  &` &`&`&`$&` &`( NTMPDIR/tmpoption `-k' requires an argumentoption `-o' requires an argumentoption `-t' requires an argumentoption `-T' requires an argument%s: unrecognized option `-%c' fflush?c@@    "'@"ah"!((@Ч ɀ "a( "a'#@'''  @㾔  @㷔   @㳔  @㬔   @㨔  @㡔   @㝔  @㖔 ?'''''''''. ?Ŧ ,@J +2`,`ؐ 0$` $`$`$`$`$`($`$$` ,@ `*  `Ր *   Ŗ + @ *`*: @  * L .   *  Ś *@ *`*: @  * Ѐ2$@ "$@$@$` J ,@@J@ -- J`  *  9``2 @  *   Ŗ + @ *`*: @  * L .   *  Ś *@ *`*: @  * $` L "E\ L o"L  t c"  k  T"L  m" Հ t u s쀢 y"L    2 (  @&`,@` 0$` $`$`$`$`$`($`$$` *  2 ,@ *   Ŗ + @ *`*: @  * Ѐ 2?L .   *  Ś *@ *`*: @  * Ѐ22$@ "$@$@$`Ȕ L  ,C,L A  *   Ŗ + @ *`*: @  * L .   *  Ś *@ *`*: @  * Ѐ2?$` $` J ,e@Q^ AA ,U@ ."aL  ɠ  &*a 5  (@^PL ɠ "!-  (@OxLɐ  "a$!h(a@@lL@2 L 2 L ݐ  (@1(ɤ,@  *a ɤ,@ "!- ,@ % ,`!X`1` 2)`,` 2%`,` 2!`,`( 2`,` 2`,`$ 2`,` 2`,$`$`$`$`$`$$` $`(`,`2`!X  䀢 Ѐ  ܀ 쀢 耢  "a "D@႐@ @b H ,@ &,1&oaٰ&ib?#@ @  @  $ c@{@B qo,%&?b!  0@T   $ c(@Q!(  @e ?  $ c@A!` @2 $@T ? $ c@1@ Usage: %s [-cmus] [-t separator] [-o output-file] [-bdfiMnr] [+POS1 [-POS2]] [-k POS1[,POS2]] [file...] 㿘!h+b@2h@Ґerror %d:㿘@!h+@#cp!h@ @໐㿘@2iklnt:only one -t option may be specified.-l or -t does not make sense with list of mount pointsretrieving information on mounted file systems%s/tmp/df.XXXXXXffs0@A-+,!)Ѡ '%#ѐ@?W? 5P*  , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , %!$$$al"|  $+ @lc@#@#0&* @@ !  l"|  ,@lx` @b 2@ ,@lz`X @r@. '@ k %,)<'@@Ԑ  @@N,`S  '  2A@@o@=,`,@uK @̨@$ᜐ@pƒ! 5,  @pᜀ ,`@pv,`@@ 2%`"`@p * L`@{&@@o @pY`,`@p @@{`@   .  @Ð 4 &.   . @@ . @i 㿐@aq  6 , @ @  @ L,  㿘l"|  l !`?"|@    !@ empty type list㿘  N  n -@kb N  oɰ ɐ "a"!  @& ,``!l`@* $"|2$ @kw   @ ,,`*@`$`$㿘! 2l"| 2! @` /- ( +)'a ,` ,`x < ጀ ,@! ,`, L@o `@a1K-blocks%-*.*s %s Used Avail CapacityFilesystem iused ifree %%iused Mounted on %-*.*s %*ld %8ld %8ld %5.0f%% %7ld %7ld %5.0f%% %s 㿐` $ ax  ,"ax!  $"ap. "a|@! $!tɐ!t@bǒap"a|. (.P@!|! "..@ `.@ x. @   &@  `!t!p@6 @ @   @ap@  `!p@6 @ @   @ap@֐ `!p@6 @@   @ap@ . @ l'' b Bb.?@ ! .  ` "@'' lb Blb.  ?@m.@i . @e L㿘a  "a@n@O р "a, @y!O? ɔ@O 26@@K!A?6`ɠ!!&`?&`?&`  @J  @&` d " @A?@g d?"@" &`&`ɠ!!@3 &` &`&` &`$2`L.#`L@N Z`@J Z`<,`@ @ !  df: %qd: %s 㿘!!@ !@@ $#܀ `4 @!h/@܃a  usage: df [-ikln] [-t type] [file | file_system ...] 㿘!h/@jb0@  㿘@nMemory exhausted㿘@/@;ΐ"/usr/src1/gnu/usr.bin/grep/dfa.cn != 0㿘@ /" h/@lU /@;"㿘@`/" u/@lA /@;"2 (  (@2 *  (@ "@ 2 *  (@ ("@  *"@ (" *`8``" *@ * 㿘 Ғ "`.  (Ұ b` b`"`  @"```* "`!"` *`"`"@"`` "`. @ ҄  h dҁ l  ؄@  ؄  ؄@   ؄@   ؄D@   ؄@   ؄@   ؄@   ؄H@   ؄@   ؄ @ :cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]㿘@Ð"x Ґ@8bt`? Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [x  %')7#5;11!311!@l"x t`$t @x??`rY$x1!*`@ @ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( , ( ( ( ̀ ` ( ( 8 ( ( 4 4 4 4 4 4 4 4 4 ( ( d ( | ( ( ɬ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( Θ ( ( (  ǰ ( ( ( ( ɔ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( Θ ( ( ( ʼ x  1@9  "d  !|?!! 2"‐!&|!"d:!x`5`t Jx  tJ@ \2"dJ` )#!"d @x t J  tJ@ \"dJ` |!"d(x tJ Ґ!&|!|"d@y"‐!&|!p!&|!j!&|!d!&|!^!&|!"d$XҀ R"d !  2J"‐!&|y!B"d !   2:"‐! &|i! "d$1Ҁ +"d !   2#"‐! &|R! "db@&$bx t ??@8Đat`$t @x? )$xؐ  "?$bx t %?@8at`$t @x? $xؐ  b*` * ?Ѐ ,1@8!( ,"bx t ?@8at`$t @x? $xؐ   *` * ?&&"d@ } \1@8`!(x t Ұ?@8Wat`$t @x?$x }1@8K!("‐! &|! "dd @  "d$yҀ2w" (s "‐! &|! "d@eb "b "‐!&|!"d@S" "d@2J"""""‐!&|s!<"d @  f"d  _O" $iؠ  ؐ  Bؠ    W\ҀMx 2t3?@7a@t $t x? ^$x 2t"?@7a@t`$t @x?$x  [? \"d ; \ 6 ,`4 * ,` @ ؠ  $ ,`@t $t@x"@`$x?@7la@t`$t @x?$x`,` ϑ,` \x"d x tʰ?@7Oa@t`$t @x?$xx 2t"?@7?a@t $t x?`-=$x t"?@7.a@t$t x ]$x$t)$x \x"d x t"?@7a@t`$t @x?$xx t"~?@7a@t`$t @x?$x4-5Ґdl  ؐ  #.  R  ؐ    .  R B ڐ ]/ [ X"d!ݐ ْ""l 0 .ؐ  (9ؐ  #.  R  .  R @ذ! &|  mx@?㿘"`  @"```* "`!"`  Ǔ*`"`"` "` `"  *`" ?`5 *`@     b ?"`` "`b "bb`"@4"Unbalanced (㿘"`a!Ґ~  ~ ~ a "!"$"!$"@ "!5@6 !@"b!㿘"` ,  ?! !  !4 !  ?  ? $ 㿘  #b` *`P  b`㿘I"! ?!!"` "` "" 2! "  +! "6'ҐȒ!  ∀"'Ґ!!  ⌀Z"b"S$""~ Ґ~ ҁ㿘"!! !"  ! "!!  㿘"! !"$" ! !"! No syntax specifiedUnbalanced )㿘""`""t"bp""xҐ?"b|Ґ "b"""h 6@5#!!$""b "?" 6@5!  8!   !  &    *"@@ "`&#  `@*:` *`6@* 2   #h #l`"`@*#`#d@h l `#hd#l`&@#   "`@\  @W+ @+` (@ "* @ "@@ "`/ + +`  "*  "@@ "`* @+  "@@ "` "(+` " ``& 0 "* @+  "@@ "` `&  "* +` "@@ "`` @&  *" *"* "@ &㿘 @ @  `@ @,`` `@   (@6> ( $ (,`*  21` ``* J` 2'`J` 2#` 6`@ $,`* @`(@   `2 `@  @2`(``@ʑ,` ( ,@ (*& ,@ ,* @ $*`& $ $,`, "`*  $@"` $ ` $*  $*  $*  $*  $"  `6 (,`* ,`@,`* @(  * @ 6X@  @ 24 $@ 2% $ 2 $ $ 2 $  $" $ $@ ` *` $+`  2@(@ * @"(@ * @!2  $  *  $  * `&@ ( & (㿀`?*  $@ `,   m8#,,  ` *@ ^!\!4[ '  ''@ '@ `'* @ F?*  $@` * @>  *  D P \ h t       '  `0*` , @''' `0* *?  &@͐h& 4 * ' * ' * ' * ̴ *  *  * @ *  % &, * ' x & 0  6E'  , ? 9* !8  t | T T% $%@`''3 @*` 0@ k@* @.`@ *` * % @ * @6@ .`@ 0* *  N*`@ 0*`" .`@*` 0@ `@͡.` , ! 2%?''* 3 @*` 0@ &@* @.`@ *` * % @ * @6@ .`@ 0* *   *`@ 0*`" .`@*` 0@ `@͡.`? " %* ?  * ?, .`$@@ "`* $?  ?@  % $?  ? "%? %?? ,  !`?"@$%@`%& %&%   0,"  &   67' ,@ !!$, 0'' 0 쀢 6,q*` 0"@, 0  & '   ' `', 쀤 ,  `2  `0 2  &, & ,& ( ,*` #* & $Ж @$@"@ @@@@?cbH   "bH #!р` bؐ@  $"``` b(?#ؒ2@ `$ . * @`@6Y`?#?#؉. ?ct@ @?ct@@?ct@ @?cl@ @*  -`@ $@ `'`` * @ 8ߒ?* @!* ?a @ ?c  `$. @*` J   ? Ē ?#`$?ct@@(` J @ ? і"(- @@   " ?#`$. @*` J ? і"-  *@  "?c`$. @*` J 2 і"- @@   "    ?#ب  -   "   n ??#` * @ - 6 "[   - ?, @`" ,D   -  ??#,@@* "@ ,* `" (, ?#- -  `ˑ* -" -  -  `" *`"  ``" &2 `?- ?#l ?cl@@`* -"@ @  "@ "@`"```$. *  @&Ɛ`* ?c$ `|* ?c$ `4 a  `$ @ `-`   `2  `0 2 `$ -`   ` 2  ` 2 ``$`@&``$?c        ?c    "؀` ` &(@  -`&-`&```    ?-```& @6 ?#?#?#? ?#d!'  -` @`65`4     - @`0*`   * ,@ &@ `&`0*    -`  &Ѧ `4 "  `$ 6 `- @ &@ `&{ `$`&` -` ?#dÒ  ?# ?#-   `2  `0 2   -   -`?і"-  @   -  ? #?#@-    ` 2  ` 2  @ &@        -` ? - -  : ` `&(@  *`&`4*`&(   ( `@&'  @6 ?-`@`@&-`?#@?#@㿘`<#  ,` "`H@ `@ "`@`H"``8@&`@&`<`< &`<`L. "@`$* @J`  ``$.  `$. @*` J `2`L `$`"`$`L.   " `$. @*` J `@`$. ``$. @*` J `2`L `$`"`$`L.   " `$. @*` J `@2`$0``$. @*` J `2`L0 ``L.   " a$Q ,``8 *  *&`8 @`8``D[*`&`D &`@`8`HT*`&`H`8`LO*`&`L`8`PJ*`&`P, " `H"  `8&`@``Б,``P. ("@ ?$(`$* @ ` "`@`H" . "@㿘 & 8& < 8  & D & @ 8 & H 8* & L 8* & P 㿘bL  "bL є"L "ؚ  ` ` "(@  *`" *`" ``` 8    @ .Ѳ"L, ` * @,``  * @, `   '%, H ! L* @ @`7$*` J   .'@,'@H,  * @    ?  '  z@?  ,`P@㿘 & \ && & W & & & & & & 4& 8& Tout of memory㿘"l ?@ΐ2?@+!Ҕ ""l 2, * : "ؐ@  *`@ ` , * @@& &&&&Ґ "bl @:㿘@@   , @*` @   (& $@ $  , @  @ & 0@ 0 , @  H, @ " @Ϡ  8& @@ D@ H@ P T   @ @漐2 㿘` @ϐ   @Ő @@& @欒` `@㿘 ْ㿘@֧ @   N  㿘@s㿘    ,`@f&`,` ,`㿘 "F ǐ2.@=   . .. .  ,  ,   @1 . && ,  2, @0*` .&" @0 㿘  `"8 @吐 2$@1  , *`:`   N J @N 2N 4 N@2N  " N 㿘 `2@  ,`@@g`,`@ ,`㿘 `0 @5 2&) :%  ! @  ,,`@ ’# `,`@ ,`, 2@㿘   **@* 㿘A!p   @*   @:Ҕ"P,`P$  "`"` "` ` @,`% @֐ ,`$@Ґ $ @ΐ $ @ː $  6 2  .`,`*@**" @ܬ  -@! x!  !!!?t`0 !! 6` ! ` ߀?݀?0ޤ  @9 " *J    JJ@2`J  *@@    @ 6  $@ " JJ?@2 `@ $  $ * * E@$ *@  ,`@Ի@@Ը`@@,`@ ,`@` " 0} { q$J@ "` J "` ߐ b]@ԃ$@^ P` J "  ` E$` J `*` 9$`` J " `  J@ "`  "$` #*' %! *@** * *`*  $  & @( @㊐ $@@ㄐ $ @ T$ & T {x v t ` @$,`@%s: %s: %s %s: %s 㿘@@!Ҙ!hBc"@ !hBc@Ґ "b㿘@ɒ memory exhausted㿘@4  C p 㿘@㮒`@` C pԒ 㿘b (Ґ "b@-"c $@&$$"*` "!@4  $"C p """"""ā㿘!"  @ $"@k"b* "b"*` "@3ؐ  C p} ""̔"""@""*@`??2 %$#b"bĒ @囔" b@ @ """b "́ H b"b*Hҁ %s%c%d%c%lu%cwriting output㿘"؀  ҕ.C#xb@k:"܀ ѐ"`"", C#@[:"""  "Ȓ& , C#@ @J: &@!@^!! @C $#c""㿘b ""b" #!b􀢀"?$"  @Ô& `b -" b--㿘"Ѐ  " ͐"Ѐ @"􀢠 ""䀢@"䀤@ ( `@ (`L 2`@ @ "䀢 "耢 " "@D@p!@ @ @m& M -@ @ %Ґ @Z&@ Ѐ 23 :@   &"Ѐ Ґ$ :""bҐ "b㿐 '%⨐&@@2 Ԁ@@N @Ԁ   d  ^"Ԁ  P㿘<""""""""   -'%)+Y  $"c0l% 2$"Ȑ"@ Q "  "L? ""̠? 8L?"̀ " "  ߐ "䀢Ȁ"䀢   J 2  򀢀 􀢀2$$ "Ȑ" "b %b"܀ O 0`"Ȑ!Ґ"I"̰" "́usage: %s [-[[AB] ]] [-[CEFGVchilnqsvwx]] [-[ef]] [] 㿘!hEbH@]@ 㿘m  m ')ґ, * @L@   @ $ %"  , *  ,  0123456789A:B:CEFGVX:bce:f:hiLlnoqsvwxyegrepyou may specify only one of -E, -F, or -Gposix-egrepfgrepgrep%s matcher already specified-rdefault(standard input)%s:%d (standard input) 㿀@T!  $"@XY / "@XT / $"   '' '"!3l1Ӭ ;E@XDЀ In* F!  < < < < < < < < < <              X                               L  |                 "*` *  ?#""*` *  ?#"@c#"@c#"䀢 6EE #"#"!  E@Qc E#T E#p&!!  E@A#Ȁ E#D E#`&!!  E@1cЀ E#4 E#P&!!hEcl@PHE! E#  c=&!:""'bИ 6'@c*` -@c# cF@` cF@`   $ccܢ @,`@(,` - $@@/2 ,   @J? "׮  '"!'bζ?'b˶ """"'bИ '"""!"!Ȁl@ `"*`@ea 2""a! 2 F  @E"€l#'  l쀣 #Ґ "bl#W %l'Ү"F +E* F@D` * @  ` 䀣 /`*  $c'`* $% "؀ F 0@jF 8@f  `c@[Ⰰ`@b $F "b  F 8@A  2F@6 @"  @z㿘'% $ ,  j ?#`*` @ݡ*  *#lc"  @ݖ*c  " * @݌c " $$ POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿐l"#l㤀 #Ґ ""c ""#N - +Ґ "cH"# @X! "#Ґ "c# "J # /!l#c  l#@<ll# c "#l " * @J@ -J` lc"# !l#'* @H@a !l# $##c @  # @l#""# l"#l㤀 l#c 2"?#* @J@ -J` # l?l "* @" 'Q #l#*  @ J  -`? @  " l#* @J@ -!J` -`"##    `="L    +c @Ô$ 2c$@> 2 '   l#  l#*!hHa@@8@ !@## $# ul#`"#L 2  lU"cl# l#* ?J  - l!hHa@@ !#* ?!hHa@J@!@## $# ? )!l㤀 ll"㤑*@"c#  l#*!hHb @@!@̽## $#N : ? :!@̱## $#' `  "@ `l#* @J  - #@jJ@ /!l# l#* @J  - l!hHbH@@#* @!hHbh@J@#H""clc "ci ?!#`$# @@3J@#J lc "c :2Jl#  . !hHb@@\:l. : "cA ? :2=. J : #J@  l/"##J@ l"#lc $"cl#ll#  . !hHb@@,:l. :`"#N :  ?  :l "* @""#. > 㿘   㿘%HI  C&@#D& ,  " @ϒ   $  2( "(  * " "@"@4"  " & 0# 0"  0"  0"  0"  0"  0" #& 4?& 8&%<&%D@B memory exhausted8@4 0 %D` @''  ` ,`" ,`"`"?`  2 2  "  @U  @$  2( "(  * " "@"@4"  -"$$   "  @+  $  2( "(  * " "@"@4"  " $ 1Kɰ!H " "  "  "  "   "` " , , ,` ,`"?" `,` 2,` ` ?? `   *` ,` ?J " `p,`  ,` ` ?*` *  ,` 2_ `  *` *  V,`?J ? ,`B,`?   ,`8,`?$",* ?`   ,``$"`*` ,`?`$"`$"L  @?*` L 8`?* , ,` ,`"?"    ,*  % , & , 4@&& 4 8@4& 8 㿘   @ "` &@㿘 ' `" `"` @" :2 "` "``2` " 㿘   @*.㿘` @ `   `  @" :  2 @ 㿘    *  &@㺐 4     7*  , @ *? , 2f 0%D 2b 0 4  " @` $`  2( "(  * " "@"@4"  "&%< 4?  0%<` *@ `   46&%@%<   7" * 4&%< 4&%@  4?6%D%<  K J?@2" &%@ 4 s%D5'` 4$` 4$```2`` 0` "`  9` 2 @` "  @&$ @ "  ` "   4$   2 ` `2` 0 ` `` @4$``` 4$`` `2` * "; 0 %D * *`@ {"!< %D* ;"a<%D    * <0   * < 㿘 4`@`  <%<J@@ɔyw& %<@%@+` * I@ @" 8D@?  ? `# ?  ?  ? ` ?  ?  ? `  ?  ?  (?@?2Ұ  46& & @  & 4(& @? ? ` N?  & @  &  @  㿘4 `<<D4`X0 4( K I"@@ @:`@@@@@@@@@`@`@@`,"@(?  " :2    "@"@ R "@84 "@> @@`25"@(.?  " :2   €`"@ "@6ǂ@ 0##  # 㿘 , %D   && 4&.㿘 @ @>㿘" `"/& & &&  ( *@& ( @&  & &  "& "  (*@& (㿘" `"/& & && & $ (  & (  $€ @& `& & @"@& "` (*@& (㿘  " @<`@`d@  ( 6   $€& @& $ & $   4`  *@  "  $€"       @ *     (@  $  ( &  @ & @&  (*@& (  :     @ 㿘 '`# %: ( (  $€  @  (& (`& & & & @j㿘 '`# %: ( (  $€  @  (& (`& & & & @:㿘m X (Ґ# @ה! aҐ# *@``z$*@ AҐ# *@``Z$*@ 0Ґ# *@``9$*@Ґ# * _m "`Xm\ \Unmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit㾸'ĺ'ĸ@   '@ߐ"  ' ''& *@* *@&&+& 2 @N &@Կ &  Ԑ &䀢 /@'$䀢  '  ?`r Q"*`@ \4 r r r r r r r r r r r r r r r r r r r r r r r r r I r r r \ \ J J r r O r r r r r r r r r r r r r r r r J r r r r r r r r r r r r r r r r r r r r r r r r r r r P \ r H r r r r r r r r r r r r r r r r r r r r r r r r r r r r \` \HĐ`䀢@ `2 @ j*   q $@  -  ( * &&@Ԓ  & $@ %` %@ $@ %@$@   ؀  䀢 `2 @ H*   / $@  -   * &&@P  & $@ %` %@ $@ %@$@   ؀  Q?d 2/`  ` 퀥 /  `. :  +` *:  ?` 䀢1  '  *".   +".  ?ޑ.  \䀢"   w  '`` + ?Ĥ?'䀤 J* l$@  -  Y * &&@  O& $@ %` %@ $@ %@$@   ؀ ?NJ?`.N.@. $$"$.  䀢"J N` N @`@$ $`@ $ @  /$ @ `$@  -   * &&@Y  & $@ %` %@ $@ %@$@   ؀`  $@@ Ж .   `$@  -   * &&@  & $@ %` %@ $@ %@$@   ؀  @  a`$@  -  s * &&@  i& $@ %` %@ $@ %@$@   ؀, /䀢 G $@ " -  9 * &&@ң  /& $@ %` %@ $@ %@$@  " ؀$@  -   * &&@o & $@ %` %@ $@ %@$@   ؀`J ^  *@J@ ^`''$@  -  * &&@* & $@ %` %@ $@ %@$@   ؀ ,@` @  ؀a1 ` ,`1䀢" |  ' ` \ ]䀢"s j  '`ސ` ]`䀢 ` -J ]2V -Ā J [Ā J [J ^J ]J@ -`J` ]@' '@ "!` [2/J@ :2/@  '䀢 䀢`'䀦 @  : ]䀢 ` ` $@*?`$@*? :NJ ]IQ@yaP`?/Q@raX`?/Q@ka``?/Q@dah`?/Q@]ap`?/Q@Vax`?/wQ@Oa`?/oQ@Ha`?/gQ@Aa`?/_Q@:a`?/W%Q@3`?/O3Q@,a`?/GQ@%aX B@  =Q@a 7Q@ap 1Q@aP +@ a &Q@a  Q@a Q@a Q@ax Q@ah Q@a` 2H 䀢= '䀢4 '<'4','wog_WOG<` "ؐ  q 4` "ؐ  f ,` _ ^  "ؐ  T ` "ؐ  I ` "ؐ  ?  "ؐ  5  "ؐJ  +  "ؐ  !  "ؐ   ` "ؐ   "ؐ  D"  2  *@ @  ,@ ~< /?'  `  ,` ` ,`// 2   *@ @  ,@    ? ,@ ?  Q@@2 @` hd  @d "@@=? 䀢O F ' ?ـ`U|W ȓ*`@ pt ^ `\ r r r r r r r qP qP qP qP qP qP qP qP qP r r lP r m$ r r r n r r r r r r r r r r r r r r r r r r r r kx r r r r r r r r o r m r r r r r r r r r r r r r r r r r r r r j r r r e$ c(@ &`'쀢@*`*`@@F*` '* '* @*`%" *` * `%@ ""*` * $@" * * @`E"`*` * $@ "$@  +  * &&@ & $@` %@ $@ %@$@   ڀ ,@`,@`,@` '  ; @ `@N ?$@  - > * &&@Ψ 4& $@ %` %@ $@ %@$@   ؀ ,@``$@  @ @C  ?'* @*`    *` *  Ǩ  @* $@  - ֠ * &&@@ & $@ %` %@ $@ %@$@   ؀ ,@`,@` @!@܀d݀ $@  -  * &&@ & $@ %` %@ $@ %@$@   ؀$@ @x ``$@ @b$@  + Q * &&@ͻ G& $@` %@ $@ %@$@   ڀ`  b]"@@XĀ?@Q?䀢?@2.' +`' @  !"ؐ@   & . *   ?䀢 `' @  `@ ,25䀢+`' @   "ؐ@   & , *   ?䀢 `' @  `@  # c@@@ \䀢`'䀦 @  }@2'  ` y` < $@  - o * &&@ e& $@ %` %@ $@ %@$@   ؀ $@@T`  $@ - 2 * &&@̜ (&@ $@ %` %@ $@ %@$@  ؀ `"" @`  @ `$? @` $@@`'䀢`'䀦 @ @ Ā J? \ $@  -  * &&@& & $@ %` %@ $@ %@$@   ؀u $@  -  * &&@ |& $@ %` %@ $@ %@$@   ؀? $@  - Q * &&@˻ G& $@ %` %@ $@ %@$@   ؀  $@  -  * &&@ˆ & $@ %` %@ $@ %@$@   ؀Ր $@  -  * &&@Q & $@ %` %@ $@ %@$@   ؀ $@  -  * &&@ & $@ %` %@ $@ %@$@   ؀k $@  - } * &&@ s& $@ %` %@ $@ %@$@   ؀6 $@  - H * &&@ʲ >& $@ %` %@ $@ %@$@   ؀ ,@`@V А`'''А@`*  D $@  -  * &&@d & $@ %` %@ $@ %@$@   ؀ ,@`,@``  "3   2-`)J@ *% ^#` \ bJ`J + ?bN@J {"FJ@ \2AJ` {2=$@  -  * &&@ |& $@ %` %@ $@ %@$@   ؀ ,@`,@`$@  - M * &&@ɷ C& $@ %` %@ $@ %@$@   ؀,@`  -䀢V䀥` $@@  @r$@&          *@*`:*`*@*`:*`*`:*`㿘  *㿘  ?? +ې J\`?H(  2 2  H| 2 2 J\`?    J H)"  J|"  0 H|"   , ((  (  24  "2  )  8%   8   8    (@  *@ 㿈     ` '7? '' @D! @ *@& 2  2@ *` * &  ?'* @ `^!̓*`@ } zL { z\ z } } z@ } } } } | | | | | | | } }p | } {` { } } } }   - * ? Ӥ ``:  `` ?$@:@ 2-` * `4  -``$- ,`?  ``:  `` ?$@:@ "-`  Ҕ# L@ "-``$L@   Ҕ# L@ 2-``$L@ |   -``$- @2 n- l { L* @`c  ^ L* @S*@MJ' L* @#쀤2m @@`8E?, h#`@ơ, '* '`'*`"    &   L* @` î @~ 耤 䀤 2@ *` * &    (" "@"` "` (" "@"`"`㿈#\#`#d  @㿐\`d`` 4??84$` `@  `  4y? ` `@ ) l?) j?) `BA `= * &$&@ " @ O@  `?? " @O@ `"&@& @J   2 #\`"#\`"?#\#`@ ?  $ ? ??㿐#\#`  @'''''` ' '  !!'l'T` ' ''  L/```c ?#`'`c ?#`'`c ?#`'`c ?#`'|`c ?#`'d`c ?#`'\`c ?#`'t`c ?#`'L`c # `'D c`` ]|`Zt Wd`T\ QL`ND T?`OĐJ? Ĕ?07#;#=#. | @ !  @ ! t@    @ Ā  Ԁ`'''̸@Ă'Ԇ''̲&@̀  @Ԧ̦$2" "[\ :̀   T@̐@T@ `?@l` `T`a^  'l'TV . @d!@\  !Il`"\TԀ ( \. d@!\@  !\` @2@2" ` 8 @ \ @\@ב* \ `@@ґ* \!   t`r`* @! `  \`\@ : @`@=*`\!  @7*`\ `` N`U?\  " $$̐"@ ?̖@\@@ =.  ?@ ? \\ .  " +" `̀  . @ Ԁ ". @"̐" \`̀  . @ Ԁ ". @"̐"  \@:?\ .  " "   \$̐&߰"@ܰ"@`bb ܓ*`@ ( P L   , \ X H x t 8 `9 IL@+?@%LL@?@*t@    @ ~ @ `"L H@  `" L H@ @ @ٔ*t   ! G  `? "`" @ * @ 2`  `: 2  @*t   ! ' * t@0 2 @t ** t 0* @! * t@ 0@  * @! *  @ *t  ! *` *! a  * t@ 0@  * @|! *  @ *`t *@! ?* t@@ * t "  !! * t@@ 2Ē '         J *  `' ' ' 2\ ` 2X ` @2S*`t@ @*@ @ *  @ | @ @   * ' J *  '"%`*`  %-m*`  %`*`  @쀢* h#`@* '* '"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" `'*`J" *@C?> ̀`  Ԁ@` ̀`  *Ԁ@  ̐@ `? *@*@ @@ %%$4`@i @f @Ц̀ Ā 2L`    @@2LN  `@@-̀ "Ā  L* "%`*`  &5m*`  %`*`  @l쀢* h#`@͕* '* '"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" L* ' `': ` @ @   ` `a "%`*`  %5m*`  %`*`  @쀢h* h#`@E* ^'* '"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" `'*`'" L*  ? 8 * 9   @ @1 20  ' ` 2 `      `? *  @ 2`  `:  `?2 ,  -,''* '*`  * *?'* @D @ ?'* @L! ?'* @ ! L* "%`*`  %1m*`  %`*`  @ 쀢v* h#`@S* l'* '"@@ @`'*`+ @ " `'*` " `'*`t@  " `'*`" `'*`" `'*`" `'*`" "%`*`  (1m*`  %`*`  @ 쀢* h#`@* '* ' ?"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" `'*`" L*   ?,> ,,, L* ?,> , L* ' L* *> *`̀`Ā`""Ҕ#2N@2LO?J `?Ҁ#N2LO?@J `?g̀`Ā`Ҕ#2N@2LO?J `?Ҁ#N2LO?@J `?0Ҁ#N2LO?@J 2̀`Ā`"Ҕ#N@2LO?J ̀ Ԁ{Ā xҔ#N@2LO?J hҀ#N2LO?@J RPҀ#N2LO?@J 2;@3*t   ! )Ҁ#N2LO?@J @ *t@    @ {@X n?'* @ 2'* '* '*`  *?'* @t! ?'* @ @ ?'* @! :+      Ԁ Ԕ ' L*  ' '   (  l`MT?㿐 ]' @ H K`' `J`*`  H'@G*  @'  `' `J`*  ' ?  ?   ?J?*  @@!*   '' & @0*  "   㿐'  @*   `' `J`* `@ '  㿐`' @`gi"x*`@      D p     K, 0 **0* &*-  J *`  '-  ' J *  '?' ?J?*  '' * 0@    '&  @JJ`  2  㿘* *@@ "mC\m``*  No previous regular expression㿘  !  2, 1j)   2!@  Ȁ  $ !Ӡ  $ @! $ 1Q (!Ӡ  @ $ @m\m``*  㿘@Ӑ    82 㿘"@"&& & !& @ʐ! & :    bؐ  #*   * & @ ?!   @*@& 6 `*` * & @/槖 " h@! @ @ ' ' ' ' ' ' '  * *@ 7  `*`* * @`''.@Z'@W'쀢 `& Ȁ`  `  ** &    "`@@6 Success㿘  m@ `. @ k @  @d/*?@r㿘 "&@w&& &   "& @n&  *@&   "& @c& gfgrepfgrepgegrepposix-egrepegrepggrepgrepdefault㿘׌ memory exhausted㿘!̀ Ӕ  0 "ؐ  *   * 񀢠!̀  0 KӀ "ak"0W 㿘!! D!') Ḑ $!@| "4 2!' 2@a " 2%!   ^\(\(^\|[^0-9A-Za-z_]\)\(\)\([^0-9A-Za-z_]\|$\)\)$㿘Đ+Ӑ+Ha̐ " :!<!Ѐ !Ȁ E@`2l 0,@!Ȁ  l 8 8,@ `,` `,` `,`!Ѐ l`@@ @@@!Ѐ l@`X@} !Ȁ  l p p,@@ *` *` *`@x@Ӕ< ?^((^|[^0-9A-Za-z_])()([^0-9A-Za-z_]|$))$㿘!k@~ra耢 !*!.C##>!Ӑ!a̐o "b Ҵ!<!Ѐ !Ȁ A@`2l 0,@!Ȁ  l" ",@ `,` `,`!Ѐ lb @  @@@!Ѐ l@b8@ !Ȁ  l"P "P,@@ *` *`@@Ӕ<Ҁ 㿀˶Ӧ!?#/-Ӫ!0! )$T谒 @$" Ӱ?8N?!@ Ӑ!<  ј䀢 , Ӑ!<  ы䰒, @$" ?8N?䀢 {$ $  /0j!8"!Ȁ !Ѐ b!Ȁ $\!Ѐ Q`P$`@ ? 2 @* : ؐ  @J? _<@  2 @ * : ؐ  @ N _+  $@ 0`@` $$@˚`"`` A  @&㿘!Ӕ  N@ "!`@*N@! g&@ @ @*` )!  㿈e'Ӡ@%ᴒ$^谒Z!Ȁ  N? 2?  :A N 27 ; !Ѐ 5-* `ؐ@  2   _"  : `ؐ@   _ᴒז   @  @"   @ &N? ?8N?㿘@sumo:12illegal argument to -o option%sstdin㿐@@ n@|ib pp"p"< p!)n! $#n@"(?! ? o#@|Nb0 np"p"<#@|Cb8 np#p"@9T"@@Eݐ#0* @   -nn"`)n@  `@o `@9C   "h@95 Ā@e@ @usage: cksum [-o 1 | 2] [file ...] 㿘!ho@`@@  ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@?c  mb$8"b$? o 'm@@ , 4   * @$* 2  * @$$ `  &o m, 4  ` *  @$* 2  *  @4``"$8&@mb$8"b$ %lu %lu %s 㿘p!@hݔ "pp!@h֒p@hӐ!㿘p!@hʕ2 "pp!@hÒp@h!㿘p!@h2 "pp!@hp@h!?c  ?@)@?#@  24    &@& ?c  ? @f   ?# 4  4  &@&  㿘@Ҕ㿘@?  2" @(  " 㿘@2  @0 &  @'  &㿘 @ @2  '"@& J-`?    ؅*8 ((J J 2 "@ 㿐 ̒  @V & & %d㿘 @̐  @' qb@g  && 㿘 2  `?J   ǐ "   |&=<>+-*/%:()㿘! 3 aؐ "aL`&L   =q"@k "L  L <  > ! 00   3"aӐ "asyntax error㿘 q@'c㿘! !!! @! %sh! ROM`@ϔ " @编!r `@&Ҕ  @Ø Ȁ ̀ ؀   *@ @"@  2r  @1! non-numeric argumentdivision by zero㿘.(ؐ rӐ  r @&wb2` @`&   r @&ib  @`& @z`& y! ? 㿘 r  r @&;b ` `" & L!  㿐A ?< :?` xs D*`@ ̬ |         ̔@4a  0^@6[  0X@&U  0R@$O  0L G`?A DB?` ;s!8*`@ ͨ p         ͼ ͐ @V 4"  0 @N84` @H2  @C $  0  @;`? @5@ ! m k? h? e㿘[! #Q   b }a 㿘! #͐ b^a %d %s 㿘@χ` r@ݒ`"!! "@@ 2ss##@e_`@㿘@=rsh8KLdel:nwrlogin/usr/bin/rloginrsh: can't exec %s. rsh: unknown user id. shelltcprsh: shell/tcp: unknown service. rsh: can't establish stderr. rsh: setsockopt: %s. rsh: fork: %s. 㿐@"     ' '@@p / @t@v`@ " '  ,`  -t`J@ -t' ,`-tt"' $&@@RH?R?Ȁ ?K*                                                              @&0@"0  `"0*`@ '@#0* @ 2!tt X&@ `@#a!ht`p@ `@ #0* @(̲@@ !ht@`@ "@It t@`2 !ht@`@ `@!a褒@ !耢  `!ht@ݒ`@} (?c @'  6  $@Z#ܔ!ht@ǒ`!?c @'    $@Z#ܔ!ht@`@'Ӑ@'%  @Ғ   v@̒a @ɒ   v@Òa @   v@a@+Z6  $@Z}#ܔ!ht@a@! !! "~@˔"~@ǔ@@ @  rsh: select: %s. 㻐 DA@! $"#ܢ @$0 *'   @m  $#܀ " @Z0!hu@4b@Ԑ : @m & $Т@ِ #܀ #Ԑ@'7 @ @&1 $Ӑ a* *@3Ӵ .8'   @mZ #܀ 7`!@Y#u!h@b@ a:  &#ܒ@9$  #܀ #a.,@@$: &#ܒ@#$ #܀ #2 @`@`2'㿐/!@ rsh: %s. 㿘 @@`@ 2 @ @Y !hv@a0@A @  @g|@@gy@L 2 ` `, @ usage: rsh [-nd%s]%s[-l login] host [command] 㿘!hvb vPv@iX@  㿘@&_msgbufpM:N:dmesgkvm_nlist: %s%s: msgbufp not foundnamelistkvm_read: %smagic number incorrect%s@̚  'v# $@Ȓ `M"c`N"c@ @&@&k  v@ǐ"а@ n@m`? n@E v@"b  n v# v@"b?#`@Ȭ   ? @ȣ  @ v@!c@p?# a@? v@!ےc # /8' ?#?c `  @  F ?#?#"N`>25  1 `<`* `'` `?@ @ N@ vN@!?`"@  `" *@ @+N  #8@a˒@ Ā ? " " * @+3 @ usage: dmesg [-M core] [-N system] 㿘!hw@Kb@ 㿘@X$Id: compile.c,v 1.14 1995/03/09 11:19:24 mycroft Exp $㿘!@ " @@ @! *` @ * $ !  @ |* $ unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 )Ӑ!@;( `w @ 'c0    "ؑ*`:     L  `*`  L #"Ӏ @  &*  *@$ w#@eL "`$ @  $@"L  2L"ؑ*`:   " L L  `*`L ,2<$ "  "ؑ*`:   "  L  `"*`@ f $@L `"L  "L L  `  $L 2  x@ ` ,n $J $  L@L  ` L@  L@ 2` x`@ nL`  x`0L@ e`` 0y!h*`@ $  @ x "  "ؑ*`:   "  L  `*`2` `*` * $ "$  2$"ؑ*`:   " $ L  `*`$L   `$ x@ `h@" "L  2L"ؑ*`:   " L L  `*`L ;"l L Ӑ x`x@LӠ "L  2L"ؑ*`:   " L L  `*`L \ x`@L "L  2L"ؑ*`:   " L L  `*`L  x`@L@AZ$ "L  2L"ؑ*`:   " L L  `*`L  x@jax@a $  ?,$& @!?%$ $@U#ܖ xa0@NӠ "L  2L"ؑ*`:   " L L  `*`L  x@*ax$a8 "L  2L"ؑ*`:   " L L  `*`L $ xaH@C$   "ؑ*`:     L  `"*`x@$aP$ @  x@ْaX@Ӡ L  \ x@ʒah@ $@L`? x@a?@@"L  2L"ؑ*`:   " L L  `*`L ;h$  @"L  2L"ؑ*`:   " L L  `*`L ;2L O ?Ӑ x@la9Ӂ\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D  j'D \  { a8Da D {a`@2DJ S, : J@ [DD@NDD{ @a>DJ@ \2DJ` [&`DJ@ \2 DJ`2D`#'DJ@ \2 DJ` n D .@`D 'DJ@ \ DJ` \D`'D @.@`J".@D 'D .@`DJ@  [  *@`J^*@`J]*@` ; ]6*@J[%\J.:=\` *@`J]*@ "J!` ]*@ 2J 2Jn*@`J J]2 "` RE error: %s㷐, @ &@@   &@@ߺ  @;@ |@X`@ @*"123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘   m ,@`$@@ e&`&` &` @̐  \, : @ <`\2&N |!@aN "N,@`N`    |@a`&&` & \2,@ `" N 2| @גa,@` N $@$(է,@~հ!@˒( @ |@amore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D &@&`&`?&`  #D J `Dbؒ J@   D`'DJ` ` DJ g"  p 9 ; 1 s "|DqD"xDmD wDgD| @Qc d&@ a&`| @Fc DD@V U&@` 'DJ` `DbDJ@   `'DJ` `DDJ J@  `'D @*DJ@ * }@ `(@$}&` D& @!? &`  $@RD#ܖ xa0@ D }`@@JD Z'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \ }@c@_2? }4cc?S  })c?  ?"ؑ*`:    ? N `"*`?#@@@ }c@l 0@!  +  (+?#@O   +J &@㷐 @ '@N( 8@ O `& J  " J `  `\" *J  " J \2 *$(̐, @ĐƢ@Β unterminated regular expressionexpected context address㿐N 9 \ 06  $ /   j`2&@ ~@ڒb&@ &@ &@@Uq &`~@ɒb whitespace after %s㿘L@  "N     N  `. ~@c& @Y@undefined label '%s'㿘H !# ?* :  :*  0 @ 0 @   $  & @N &  `h@V @r  2 duplicate label '%s'㿘    `,` `*`א!@ @' 2  @k` 2 @   2 @Ґ $$ $ $ $㿘 ` ,`  `,` `א!*`@ "   2  @kJ` 2$   2  unused label '%s'㿘 ר!',` "`   @@ @2 ``,`$Id: main.c,v 1.8 1996/05/08 21:36:05 mark Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@K / +ؠ )% $'ؐ@Ȝ?M? /8D* %`%    @$!h@`@0 #0* @  ` @`@ `L@  @@`@ 0@ @T @ @nU!   $@OT#ܔ @`p@ r%s: %s"%s" ..."㿘n! `  0# $ $  "  $   !F! $ @P9b׀  "c $ $@O#ܖ b@  $ "`n "a $ؐ  @xb ؔ" "* `* `* `* `* `*ؐ "` $ "cn "a@P%` _"`L@ #[L` nWU" `$"`$@m#n"!.` "`D #J@ # J` nnؐ "`nؔ  J  ".  $@W $# $.` #`.  "` #` " .װ stdin㿐 A'% )"8( = ($ % % @Oqb؀  $ !  $@NK#ܖ "@ `? "`@l ? " ?@m. ( $(@W`   !& i  "`e ؐ `"` @6k  @ؠ  $#܀ " @N  b@@w` "`%' )"8 `? "`@lC ? " ?%@l (  $(( ($ % % @Nb؀ $ !  $@M#ܖ "@w @V`  㿘@% " " "n"@"㿘@ " n"@" "$Id: misc.c,v 1.4 1994/02/03 23:44:54 cgd Exp $%s㿘@  $@M#ܔ @=a㿘  @_  $@Mw#ܔ @'a㿘 0 "@:@@b #ؔ$`0@Y`0sed: %lu: %s: 㿘'L'P'T'XL!!h@Lb 4 !  ؐ!hb@?!!h@a!h@6bȀ @Ӑ $Id: process.c,v 1.17 1995/07/11 04:09:50 cgd Exp $%s%s: %s %lu 㿀" )ؤ L195-خ T  $ `+ئ 837@ "@ `?Ƒ* : `C x*`@|<   l,lL  t  *`' *`@ *`& t*` * $ $$`  x "-@#&`  )$T % @v/ L?$ " $@  lؐ L`8  L`8 `8 L@ϖ @`8 L@Ȗ @#` @) L@  T  @Oa@ LȒ  2$@ݐ @ L 2@  T  L @1a@ǐ T 2@ @&a@T 2@ @  L?$% L @a 2$@  T  @a@\@  t  *`' *`@V*`& t*` *  $` $ @` $  t t& t@)| n&|| "k@&|`T 2d@`? L` & @} !? $` $@K#ܖ cX` ` L@ G $@K#ܖ cH` >@`8   L`8c @  L''' ''`8% L$$ $ $%`8$$$ $T 2@L` @,  @#`@T@`a  T  @Y@B %T㿘" x  2   2  b @"+  2 ؘ`L`L  @  2 h    @"  \  X  *@$ ؐ "`x 2 ؘ`L`L  @  2 ?    @"  3  /  2   @ " x  $   2  ؘ`L`L  @n @   ` `?   @`?\%d not defined in the RE㿀   L  @ "`  ah;ؐ  @/ P  " d P    k#W?!-ت ``  @ @"@Ζ  @A @  @  $  @   `  ` `  @    $    @Ҙ `.ؐ `(#` $  @ ?`#`  L$ !ؐ ` @s   `@`  ` $ @g ؔ L L''' ''ؒ``" L`"`"` " `""`"`"`"` "`"`    @ܖ `0 T 2- ` ?2  & @{! ? "`   $@I#ܖ c^  ؠ`L `L@     $ @I#ܖ cJ  rstdout: %s?c  t@@')? ,`* @  )`,`*  @}!`,`@*`  @J}a"` @RŖ @e!@hI` t@! @  $#܀ " @I< a" |"`tCOLUMNS\ \ \abfnrtv%03o㿐!n"?2N@rH#@ " @I$"`h@j  n`n""n <"bN m % \#`n"@RS#H  2$* : "ؐ@J  `\ ?`"@  `"*@ @ 7 #P?`"@ \`"*@@ @V~N "J?`"@  `"*@ @}  #p@Q  N n!?`"@ $ " $*@^ ? " " * @N ! @  $#܀ " @He afirst RE may not be emptyRE error: %s㿘     b " J? "?   : :؀    @@7      ` ʒb㿘  , q'ؑ:` & \  ?N"ؐ@  ?`଀ \2  N \ &2    & [ & &  , 7 ,` ? ଐ  ?"/ଓ,` `?2` ?"$଑,`@` `$ "? @ @& , & &  ଓ,`  @ @G & , `   &  & &  ,㿘 ` @d&  & &"&  @@ & *@%s: %s㿘?'% $?N  w"!  { s" /"* + ?" @    @GKܖ H " ?"& @ "&  @G8ܖ H& 2N 㿘@"HLPRXfgorstuwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %sfts_read㿐@m     / X!@〔g 9`* %%%%%%%%%%@%%%%L%%%%X%%d%%%%%%|%%%%%%%%%%%%%%l%|%t%%%%%%%|%%%|%|%|%|%%|%|         #0*?J@ -J`  J` $#0@#0*`& @@  ` @c2 "@ ? @ @?А !% $$ܐ@J  $ "$ $#܀  c@~J   c@i  @  c@]`@Ҕ   @_ #d'@H $ 4? -* '(('('0'(('('0'0 @ ̔  @F @2   @F @)Ͳ   <@`* .2 @> `@  #܀  @ c@usage: chmod [-R [-H | -L | -P]] mode file ... 㿘!h@֒`@v 㿘@ / %s 㿘@#! @ya@x!?@`#0&* @? (@@T@N  /@(a@N@9 2N N 2 ?N /"? .?@ N /"`? :N`@  @[@X6 "@`m@ ".!@N@ usage: basename string [suffix] 㿘!h@Ob@ 㿘@& /sorry, arguments too long (%s) 㿘@  @N#(@&#H@N|  ,  Ȑ"@@F] 2@& @ L ", @' @& &@4  Already connected to %s, use close first. tousage: %s host-name [port] %s: bad port number-- %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transfering binary files from this machine. 㿘'D'H!8  @'`D  ?DHSpD? !@ D H@E *  HH @MH x@@M?"`x*` @:`  "!8 * `* `* `* `* `*"#" H *H `* `* `* `* `* `* `* `* ` * " t * `* `* `* `* `* `*"  * `* `* `* `*"# * `* "ch# H@ " `?"`@s 耢 2ဤ 3`@Q `@Q  N? ."?. @M'`܀ 2. a@u-  (!Ȁ  "` "`"#!( !(* `* `* `* `* `* ` *!0@L !Ȁ " "   aX@t 2@Lߐ!h" LtenexEebcdicimageIAusage: %s [ %s%s | ] %s: unknown mode TYPE %s %sTYPE %s㿘 "P@L@"`n##  !3"h@L  bp@L"x&ဦ  n!0@La9" x## "`@^1 "  2` 2  "@Lt`?"`x J "@  "@   !@P "c"ftp: internal error: unknown type %d 㿘ဦ    ;" n`#" n## " @`"@`@ 2`@   8@L0!J! "@A` "@;` " " type㿘nc!("`D 㿘nc "`: 㿘nc" "`0 We only support %s mode, sorry. 㿘"@Kђa?"`xWe only support %s format, sorry. 㿘"P@KaH?"`xWe only support %s structure, sorry. 㿘"@Kc?"`xlocal-fileremote-fileusage: %s local-file remote-file STOUSTORAPPE㿘'D'H   'D`&` D  DH  D HDH  HH#@Kc@   @   H?@"`x`H`""`HJ a !< #@#H#P  " H@ K H"`  # H@  H"`H   `@Zlocal-filesusage: %s local-files Continue withmput%s: not found`'D 'HDHn(  H!8@J@?`"`xH"a "cĐ @}`'@甐#p!Ȁ !%#H@ @ N #$#Ā H@ Z H#Ȁ /J`ؐ@   ؔJ   "J  /Jؐ   * *" @  # @ 9 !< #@#H  c8    @#Ā H#4 Hc8 $c8!P@ a` #Đ $#$c8 D %+)#"( KĀ H, @@ @ b H@ KH, @# @  !< #@#HH, @  c8  @T Ā 2y #4 sc8 $c8!P@ a` Đ $e$c8 @}- ,H, @, @3 HȀ  H, !h@ 0J H`DĀ >H@ m 9b "@ # @  !< #@#H@  c8  @ Ā 2 #4 c8 $c8!P@ 9a` Đ $$c8 2@,Ƞ DM @|b"#ār+w㿘 @6Pw㿘r"8"8  #P#x@! usage: %s remote-file [ local-file ] local: %sMDTM %s%*s %04d%02d%02d%02d%02d%02d%s RETR'D'H   'D`&` D  DH  D HDH  HH#@I)@?"`x  @    ?"`x:#Ȁ 6H J`"ؐ@  2 JؖJ   "J  H  /Jbؐ   * *H"`  " H@  H"`  # H@  H"`zH @p  rH#@` h:8gH" `?"`H @` 2O" #\#` `@?֚@:א  & @` d @4P @Y d @ @4E  @ @4<  @ @43  @ @4*  @H@  0 0@HR`" H    8`@r  :"8  㿘@H1 @!#Ā #4 !#8 $#8!P@a $#8#p@ "#8"##p@ے remote-filesusage: %s remote-files mget㻐'D 'HDHlP  H!`@G@?"`xH"a "cĐ @z`'@䒐#p3%#!H@aȰg N c&cĀ H@Y "#Ȁ N  ؐ   c*   +@J+" @  # @ L  #8   8 @xcĀ #4 H#8 $#8!P@ax cĐ &c$#8@z;"#ā/tmp/ftpXXXXXXNLSTarcan't find list of remote files, oops 㿈#Ā "( !ni" # { @\w$#"( n` ""``"` ""d# L!n##?' 7 /@g@ " "`""!Ȁ@`?#x  `#!`@v    `"!Ȁ@`?" ""@>`!n$#@fs# !n@Fܐ  ؐ $@># @\l#$# @K2 2*1ذ onoff pxConnected to %s. Not connected. Connected for proxy commands to %s. No proxy connection. Mode: %s; Type: %s; Form: %s; Structure: %s Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s Store unique: %s; Receive unique: %s Case: %s; CR stripping: %s Ntrans: (in) %s (out) %s Ntrans: off Nmap: (in) %s (out) %s Nmap: off Hash mark printing: %s; Use of PORT cmds: %s Macros: %s 㿘!8 "@F@`@F;"!Ȁ @H !8 ""@F*`0@F'"@9 #aH@F#X T" P#8L"(#8@FB!<>!#p@E6#Ƞ2#<#@E"  #``@E@Eܐ##  #`@Eє@E̐  "! @E#c @E @ c'!Г, @*`P@E@ c&, " xBell mode %s. 㿘!" `?$" @E"" "`xPacket tracing %s. 㿘!!Ā`?$!Ē@E~#H!"`xHash mark printing %s (%d bytes/hash mark). 㿘!"`?$"@E`#" "`x#@EW$@ET#ЁVerbose mode %s. 㿘! `?$ @EB 8 "`xUse of PORT cmds %s. 㿘!!`?p$!@E+ !"`xInteractive mode %s. 㿘!#8`?Z$#8@E #8"`xGlobbing %s. 㿘!"(`?F$"(@E!@"("`x%s: bad debugging value. Debugging %s (debug=%d). 㿘 @<`6!@D`?"`?逢`""` ` ?"`! "!@D"" 4  "`xremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD XCWD %s㿘'D 'HDH   H"@D@?"`xH"@ `  x!  @Dw"H#@ `usage: %s local-directory Local directory now %s getwd: %s㻘   n#&` #@DQ@@ `  @ D`  #@`?"`x@ #@D5#@" xusage: %s remote-file DELE %s㿘'D 'HDH  H @D@?"`xH @ 8`mdelete㿐'D 'HDHpP  H!`@C@?H"`xH"a "cĐ @v`'@#p3!H - N c&cĀ H@a H @ cĀ H#4 H#8 $#8!P@Iah cĐ &c$#8@v|"#āfrom-nameto-name%s from-name to-name RNFR %sRNTO %s㿘'D  'HDH耢 HD HDH  H#@Cy@? "`x#@ ` H# @ `-usage: %s remote-directory local-file LISToutput to local-file:㿘   &`   #&` #@CA@/@J n  `@Tߒc "`@` "`@TӒc `J |@ې`  @` ?"`x``x@ usage: %s remote-files local-file 㿀'D  'HDHiP HD DDH]  DH!h@B@H*`@'"@Tc J |H@  @[ H?T"`xHJ  l2  'H"a "cĐ @uz`'@[#p#Ā 0  w a!#D?' 2//H.  @ #Ā 2 #4 c8 $c8H!P@@ #Đ $#$c8#Ā ذ  @u@"#āSHELL/bin/shsh-c%sTry again laterh @u*  @u& @ ɢP @X   @u  @u @b#آ#@Q /"#7Р @8o@Sגc耢  +/"   0@B@!  ,@ @ #@ڒ?"`x@uM  @̀ @tʒ @tǒ? #@`" x" xusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'D'H  DH/D?  H!@A@?P"`xH"(@ ` 7 D 4 H@L"0H"`D 'DH"@@ ` # D 4H@A"H@! O@9l@@*H" D 'DH"X@ ` ` !@tb`0 ` D H"X@ ` PWDPWD command not recognized, trying XPWD XPWD㿘  " @ t   x!2 @A9 @ f H" directory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD XMKD %s㿘'D 'HDH  H @A@?"`xH @ ,`  x!  @@ H! @ `RMD %sRMD command not recognized, trying XRMD XRMD %s㿘'D 'HDHD  H @@@?"`xH!@ `  x!  @@!H"@ `command line to sendusage: %s line-to-send 㿘'D 'HDH ؀  H"@@@?"`x!xD@,Harguments to SITE commandSITE 㿘'D 'HDH  H"@@d@?"`x#D@H㻘@D`@}@D@}ڠ  *< , @@D @}ˠ @ e @ Ӑ modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'D  'HDH؀ HD 4HDHw  HH @?@?"`x!@ SITE UMASKSITE UMASK %s㿘`  "`!!@ `" SITE IDLESITE IDLE %s㿘`  "`"0"@@`" HELPHELP %s㿘`  "`""@`" 㿘!8  @ @ !8  @  @rݐ QUIT㿘!8 @#H"$ "@U""$"!8r?"b,!Ȁ "#%s %s? 㻘#8  @?`#@א!$@7D O n  N@ 㿘 c@h"( Ȑ @rn ,, @v Ȁ  !h@ @绐 @&@紐Ȱ Account:` `?@@5- 1 / 1?`@@|$@! ?@祖!@&"X㿘!Ȁ @ !8  "`" @ #@@۩ commandusage: %s command ?Ambiguous command ?Invalid command ?Invalid proxy command Not connected 㿐'D 'HDH(  HH" @>@JH@ ? '@>"8@!S" x2 J @>"P@!.ဢ  @>"h@!#@6#@ 2 @qJa@ J !8 D@>i"@!@x  @q3?"`xDH ?€`!8  "`" @^  @qCase mapping %s. 㿘!#Ȁ`?y$#Ȓ@>4 p#"`xCarriage Return stripping %s. 㿘!#<`?`$#<@> #<"`xNtrans off. 㿘  !$"@> !(""`xb "b"`x! ``@4  ` ,  *!!!`@4  !, ٖH   4J K J(` K` `JJ@ 2 `@   @*J@ `2  * J *ف Nmap off. mapoutUsage: %s [mapin mapout] 㿘'D  'H!$#@="#A"`xD DH  H"@=@?,"`x "#" x",@Aے !Ȁ ", L " "",@A˒ , b,@3y# L " #@3o#nmap: unbalanced brackets     *` ``"?Z UJ P $ \23JJ*/: J 0$*JJ  94%JKJ@"#J?ϓ+`@ ""ؘ   J*`: +` K  +`"?K@2 K 2 J 2K   K +` "?ژ * #J# "+J [ [ \ $"J 2 J ޖ J $20 Jbؐ  ") J 0?N  @+`J@  f +` _@ @+`@ Q * C: :  ]D \2J9 $20JJbؐ  ")JJ 0?N & @+`J@   +` @ @+`@  +  J  ,*`J   *`:  ] \2J 2J  J ?@< @0EJ ,] ]"5Ybؐ  "* J 02JN # @+`J@  ϑ+` @ @+`@ + J  [+ڒ J 2 Passive mode %s. 㿘! `?$ @;"@ "`xStore unique %s. 㿘!!<`?$!<@;"!<"`xReceive unique %s. 㿘!!`?$!@;"!"`xCDUPCDUP command not recognized, trying XCUP XCUP㿘@#H  x!  "@;l#P@#restart: offset not specified restarting at %qd. %s execute get, put or append to initiate transfer㿘 @;F#0!r@` :<"8   @;7 㿘@a Limit of 16 macros have already been defined macro nameUsage: %s macro_name Enter macro line by line, terminating it with a null line macdef:end of file encountered Macro not defined - 4k buffer exceeded 㿘'D'H# 2D Ȁ DHY  H!@:@#8 @:Ӑ! !#*` * aH`@0 # #8(& @:!`" x$ "`"*` *  ?" ~" x#*@ *`@ * *    "` #*` * aА  #8/# %!#8`? &`@Os``$` @?, :  .*` *  `N? . 2`3  ? & @OJ``&` @ ?2 ? ?  & @O5   ` &` 2 !@:/?"`xfilenameusage: %s filename SIZE %s㿘'D 'HDH는؀  H @: @?"`xH!@4`%s %02d/%02d/%04d %02d:%02d:%02d GMT x'D 'HDHd؀  H @9@?4"`x" `?"`H @` #\#` `@1H#\#`!x`@9 0@9`" STAT %sSTAT㿘 ""@`Local file "%s" is newer than remote file "%s" 㿘?=x #`@9`?verboseumaskusertypetracetenexsuniquesystemstructstatussizesitesendruniquermdirrestartresetrenamerhelprstatusregetrecvquotequitpwdputsendportproxypromptpassiveopenntransnlistnmapnewermputmodtimemodemlsmkdirmgetmdirmdeletemacdeflslcdimageidlehelphashglobgetformdisconnectdirdebugdeletecrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!%s: %ssocketconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt㿈 !#  @k @#c$ #  * ې #@! $@=#!@h?"`x# ,  @@  @@ ې @. Pے`"  #! @Bm 6 @O!?"`x# 2 # ) $-?@%u  60  *#`'@N%#@,!`$``@ !#`'@<!@ja@Q` @B- 6Ґ@!q%x@ "j%x 'a@=  @"B'  @  6@"@Lb8!$"@Lb@""$" `@ʐ"H "X@7`@ " "@M"$ @M?"`x '?c!@   " @"p @֐ Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init8 '''@M ?"`x /)'@0 @@ 2 "h@7~x@7y O@/`@u@*O 2'' "@  2@"'"@  @"'@w" @ "A  `@f"!Ȁ  1 " "* `* `* `* `* `@* @P` #6 %!!. @*`@H@ ذ #&.   㿘@6!@p!rb0 "b0r"4 !h@ӷ ---> PASS PASS XXXXNo control connection for command QUIT㿈'D'H'L'P'T'Xr""0" @6!HD!@^ʔ  2@6!!@j@6!@#!"$   @u"?"`x) @ikaD!"$@jcH"$@i8b(@"$ "a@H2b0@%`?r"0 ` @  @iG%c%c%c421 Service not available, remote server has closed connection %s:㿘     @i&a+)79%`x   "`? "`@K8 "" ׀ F?"`? "`@K$ "" "  `?`? "`@K  "" $c  "`@J "" $c  @h@n$"`` @+ @5#@\!!%`xϰ  5 4 ဢ?/ 5.``* ``   @5`!?` "@ , :  `"*@@& `"ؐ  `x*` * ?А%`x``x " `  "ؐ  2  `  )"--- ` - 2%`x " ׀", 4? 5!?` "@ , :  "`"*@@ @!`x "%`x@h %`x! 1,"! @g`x!r@ `r"0 " ?!@`"?П@ ?Ё㿐''   @? send aborted waiting for remote to finish abort 㿘"#r""0@4!p@f!!@ѵ local: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetoutsent''|'t'd'D$'< ` tN@ -!@4|t`!@4t!Ȁ |@ t0 c "'\ H '\'T'L"@'4@<! #! 1 ! 1r", T@}?&",T  @g;TL`e @g5Lb @g/a'T|@Fb | O'lK || @g 'L|`@֨b8 'l"@ @g T @gL5| .'\@+b8  'l"@| @fT"#'\lS @ <  !b(@f| @fT@Il@r  @fTL` @fL?"`x\ l0@С! ڐ r"8"8 ` Ht@Eb@ @EbH ;t rlb<@G ',  ,  rlS`b<b8@̖ ',,  1r"@|r  -:"8"8"P` r  !>"8  :"8"`'4t`"ht "  @fWTL  @fQL\`@l0@4 e'd@=|  @f? 'L 58 7\ 4  $"#ܶ# #lS @J$7D@'DdS @7$&@`" lD<@ ! ?`&  @ #`&*@@<d'<D 6 @}al" ,`*c!?`"@ # " #*@ ? " " * @p @}i!`"@|\ $ #l`? #`@Gll`# @]` Ad" "d1D<@ ?`"@ #`"*@@1 @}+<d'<" 2Dd @3 ?`#  @  d@ #@ *@dD 'Dd`?` #``@ .`:   d`#*@@dD`'D" ,D< !?`"@ # " #*@ג ? " " * @ǒ @|!l @"@|d` @" \ $#܀ ?@"p?'D\`@l@Gd@<0 Ő  @dTL  @dLD`C"xD< @dTL  @dL! 1r?,"`x", d@?&",d`@Gd ?"`x\ l`l@; D "xD@ receive aborted waiting for remote to finish abort 㿘"#r""0@1"8@|3! @΂ RETR.mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode File may not have transferred correctly. received㾸''|'t'l'\','$$'@C(b`? '<  ` tN@ -!@1f|t`!@1_v\A M63#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  LMTACTWETWET DST ... . ..termcap#!/bin/sh - # # $NetBSD: MAKEDEV.local,v 1.2 1996/05/08 17:19:17 thorpej Exp $ # # Copyright (c) 1991 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV.local 5.1 (Berkeley) 3/22/91 # # Local device MAKEDEV script. PATH=/sbin:/bin:/usr/bin umask 77 for i do case $i in *) echo 'MAKEDEV.local: no such device.' ;; esac done %pK{Րɑ_bA瀣n}#Oɶ2]zp0rP2Zրǀ︀mx{hlX]?8?:X=.q˵àYܱ͕CYpr̀u%ϬuRХUьW2t҅YI90)00 000ܹg0ݲޢߒterVbGR8B)2" 70 (00 0000000z0j0cSC3#rcT  7t(dTC3#ܐ͐㽠ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y         FMTACT DSTACTACT DDSTWETWET DSTt!Ȁ  < |@ht0s'T'L'D'4#< < @ '4@ ؀ ! !ސ ! !r", L@<?$",L   @cbp'L|@B̒b e|K@ |b<|@+  R|@( / $#܀  "@|b  2, |"@+   /, "@|J !  $#܀ |@ʒ!  "@| @cL2 ! < $#܀  @I|  '|" ! <@>| '|<    0 c  b @   @crL?"`x@Q ؀ |D<`r"8"8 2r`  tr"Pb< t  "ht   " @"8 N'\|@Bb |!*'dK@ || @c* 'D| @Ҷb@ 'd"@-D| @(l 'd"@|D#'TdS`@| Ȁ ې$'!@! !@}@}Ȁ $!@""!"a@:  "rƀ T r"8"8 2r` rdS b<b8@  $"@|T` @d0 $ "#37 #\S a@1dS`a@)$'$" " ! ?`$  @ #`$*@@0$'$@ 6 @z#" -$ *#!?`"@ # " #*@ ? " " * @ @y!   $#܀ ?@@"К?'$6'T "@)|T"8"8 d` 6d @ Ӕ %r"<  d ? # @D:d?d@`#@ @? "  d @   61"@|T Fd0B1 #\`? #`@D\\@`#@ @?~ _ , ['," "$!$@ !?`"@ #`"*@@l @yf!d'" $$ '$\`? #`@C\\`# @ 2d4` d @28, ?`#  @  d@ #@ *@3d ?\ d ?` #  @ , :   d@`#@*@@d$ t'$,`"@.,@.# " ,$ !?`"@ # " #*@ ? " " * @ڒ @xӐ!\ @  $#܀ @""К?'$d @T"@|T` @d @a LD  @aD@C\@89 ΐ $`H< E#P$@0>D` @`L @` ! ?+"`x@\?" x!r", T@~ $",T d`"\d\ @C\@7 $`#P$@ @`Lftp: socketftp: setsockopt (ignored)PASVPassive mode refused. %d,%d,%d,%d,%d,%dPassive mode address scan failure. Shouldn't happen! ftp: connectftp: setsockopt TOS (ignored)setsockopt (reuse address)bindsetsockopt (ignored)listenPORT %d,%d,%d,%d,%d,%dp ' o   @7r r "b,@ ֐"  ?r",c @E  6@ ""8 @-c"@!r#\#` bX@$䀢 @-O"p!r!!(@# !( , , , , , , , r",@?   @ "!r'r",  @   @ v" (!!"(`"`"` " ! 22r",?" @}  @6 r "b,@ΐ! ! r",?c @  r@"m!r",a(@6  @"`!r r",?c @  6 @# 'r",a(@Δ؀ r@"?!r",@  !@#!! a, a,    ? ?#\͐#    !?$!w "@  "a 'r",  @U   @O"  @|",?$",  "a accept㿀 ' %r!r",@a䢒6 !r@+#@|a",?$", @|[",$", '  @  6r@"r",@@%ld bytes %s in %.3g seconds (%ld bytes/s) 㿐 3"@'"@`''А"@@'r@čB'́"ɦ"#&?   '@+r0 0㿘r""0 @^a  aȀ ݰ"ۤ!  "aaȀ ۰!ݤ""aa8&"a8 `  @! @iR* . "`  &!`&!`&!` &! " "`"` "` &!`&!`&! ` &!""` "`"` b&!$$"bb$&!(("b$c&!,,"c`&!00"`a&!44"aa<&!88"a<a&!<<"ac&!@@"cb&!DD"b!H#``@! @h*!H``@/H!Y#a@!s @h*!Ya@/ޒYc&!ll"c!p#`@!a#@hӐ*!p`@/̒p%p#c@!T#@hƐ*%pc@/p @]rb0 "b0 㿘@+!@u!aD "aD"#r""0!h@ݒ STOUproxy server does not support third party transfers. No primary connection PORT %slocal: %s remote: %s abortH''''!@<" " '! !H"@'#     Ѐ 2  "y "8 @*!P0Ȑ !8  @*! ?"`x Z !˒` @M!h 8 @]b`'"hĀ  @]W 0@Ґ  '"h̀  !r"4 $"4     @]8x $"4!@*^0@]- r""4@<b !Ȁ  @;b  !!Ȁ  R!!  !"hà k0! "@ !Ȁ6`?!! !"hD̀  # ! H@ 0D! "@ !Ȁ`?! .ؐ @]) " *`:`2*:` ` *  "Ԓ 6@!!D ?"`x@q o !Ȁ ِ א !D ?"`x @\resetxؒ @\ - )'?R 2 * -@ " @k"@$x  2 runique: can't find unique file name. 㿘@ / ` 1,@`"@$ ` /,@ !"@7: @)^#X5 #@-@f## .*'`1ߠ 1  d,,@`:  9,@ 0#@# ,:  02 L .2 , ," 1߰#%cABOR xc  @) "$R  @#  !@!!"$`@[ @s"$ؒ @\6 " * : 2`*`@ :   +{ "{ * : 2`*`@ :  +{ "{Ӓ  6@!!D ?"`x@ V 2`*  `;ؑ:  V @x$ 4V [  x"(R P ftptcpftp/tcp: unknown servicedgintvusage: ftp [-dgintv] [host [port]] p'@'Ԥ "@Qb• "a@ @=b ""("#8"#)##!31@ٔ#?"<? 82* <ĜĜXĜdĜĜĜĜpĜĜĜĜĜ|ĜČ` $`" $"""("#8"#aĐ &a  & !h@Zޒc@[~ #0ܖ"'ܑ* Ԗ'@sR • "c4` "`"!"!"  "c<?@ݴ"a @L@l@քn"c@,܀ @İ " @[@ @ZÒb\ @Zbx@ '''''ܐ@Ē `?   @Zb\ @Zbx@] 㿘 @đ 㿘!8 !"$ " !rR @y @=O"$$"$!r", & @o @w",?$","!8 !8 !"$ " R @[ @=1"$$"$"!8"  ftp> sorry, input line too long ?Ambiguous command ?Invalid command Not connected. 㿘 +? " " * @ܒ +-#  )'#4 @'N#P@qƐa @4`  硒 @dҐn J@ `ƀ`f *@@'0#X ? $ @<``$` @` O2 L @ ܀ "@L? @' #x2N @'#•  !8 2 @&#  ܟ€" " N  a?`"@  " *@W  #L@ @Yb\ @Ybx /   qd`$dJ J@ `JJJ@`J2  "  "  ` ?cannot realloc argv array㿘  "`#"c0" " %#' `|@``|@sh P%`@s*`%؀ `| @c0 $`|ܑ* ؠ @$  ܐ $܁!$ 0J@! $% J@ ࠄ J@!wHuP  ,J@   H`  J@   ,J@ ", "& % @\2 @` `*J@*` J@ "2 @ڒ`*` * 0ဢ       , Commands may be abbreviated. Commands are: %s ?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 2? @%"q!dr!* q%r!d@c 4 *    P@t" r!?@t @q!d;   6d`-`@pf*  !Ȁ L "@%<-   @b@a?`"@ `"*@@ `-  r!* @ @%"$`@b6!  ?`?`&``@ @`&@*@@v `@ 0 )'%`@? #@ @$ؒ? @$ ? `macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrcr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined Macro definition missing null line terminator. 4K macro buffer exceeded Unknown .netrc keyword %s8 @D""@$/b@b  "c $#܀ "@  @! &/@( .-"##%)!;@ s   0  >@ @ 4`@ /`@(e ."@ ` @$ `$J @(M .@ג à$@ L @G ) ' % "%@   0> W@0 @  @aB@p &@@(;0@5V 2-0Ӏ @5MbȀ  R @p   ?@  @a@p~ &R @o  ?@  @a@pe &@'0!Ȁ `? "`@8S "    2#@#F#x #*` * *  `? "`@8( "  bؐ  ,``  ,`? "`@8 "  h# ##8$ `%#*` * ?:" *` **` *   " #* @*`@` #8##8`? "`@7ǐ " -*:  ,L? #, #8@"#! @u0@r"#@@8@# @"#@"# @^"#@Z@8+#?㿘# @ !#`? "`@7q #"   (#` "#`,"#d`"+#!#`? "`@7O #" H`"F`\2.#`? "`@79 #" .ڰ . !#`? "`@7$ #"  ` `,`\2.#`? "`@7  #" .հ .J# r ## " !@3# "    macro nameUsage: %s macro_name. '%s' macro not found. ?Ambiguous command ?Invalid command Not connected. %s 'D'H   DH5Ѐ  H!#@ #@!!H,`@*` @@I #`@H#@ 0H!`@!?"`x@&`,`* aА   '7,5/,`@!Nؐ    N  2  X*`:  $ \"F  @2SC <  @@p\X<@`bT U2S00(pA2Sx2Sz U2Sz U 82SHC2SD-D2SD0G2SD2 2SRA2SEI2S-D2S-D 2S^ğ2S+2SI 2SI 0 ( 0 8 @ H P X ` h p x2Sm 2Sz4΀2SP 2SP  2S!2SP!`2SP!`2SP!`2S!2SP#F2SP#F2SP$s2S!2SP'V2SP'V2SP1xˀ2S!2SP4s2SP4s2SP92S!2SQ2SQ2SQÀ2S!2SQĴ2SQĴ2SQ 2S!2SQX;2SQX;2SQ  2S!2SQv2SQv2SQI F2S!2SQC2SQC2SQG2S!2SQ82SQ82SQ4΀2S!2SQ /2SQ /2SQ!`2S!2SQ$[܀2SQ$[܀2SQ% 2S!2SQ(2SQ(2SQ)'2S!2SU052SU052SU05 2Sb!2SU3B2SU3B2SU3B 2Sd!2SU52SU52SU62Sf!2SU;32SU;32SV 2Sh!2SV,2SV,2SV]J2Sja2SV 2SV 2SWܓ2Sl!2SVI 2SVI 2SWܓ2Sna2SVܓ2SVܓ2SWܓ2Spa2SV2SV2SWܓ2Sra2SV4΀2SV4΀2SWܓ2Sta2SV U2SV U2SWܓ2Sva2SV$s2SV$s2SWܓ2Sxa2SV) 2SV) 2SWܓ2Sza2SV,2SV,2SWܓ2S|!2SV052SV052SWܓ2S~!2SV52SV52SWܓ2S!2SV92SV92SWܓ2S!2SWÀ2SWÀ2SWܓ2S!2SW2SW2SWܓ2S!2SW !2SW !2SWܓ2S!2SW 2SW 2SWܓ2Sa2SW2SW2SX#F 2S!2SW /2SW /2SX#F 2Sa2SW$[܀2SW$[܀2SX#F2Sa2SW'c2SW'c2SX#F 2Sa2SW,2SW,2SX#F 2Sa2SW0G2SW0G2SX#F 2Sa2SW3%2SW3%2SX#F 2Sa2SW8C2SW8C2SX#F2Sa2SX2SX2SX#F2S!2SX,2SX,2SX#F2S!2SXX;2SXX;2SX#F 2S!2SX X2SX X2SX#F 2S!2SX߀2SX߀2SX#F 2S!2SXC2SXC2SX#F 2S!2SXp2SXp2SX#F2S!2SX2SX2SX#F2Sa2SX+2SX+2SY4s2S!2SX0G2SX0G2SY4s2Sa2SX3%2SX3%2SY4s2Sa2SX8C2SX8C2SY4s2Sa2SY2SY2SY4s2Sa2SY,2SY,2SY4s2Sa2SYX;2SYX;2SY4s2Sa2SY X2SY X2SY4s2Sa2SY߀2SY߀2SY4s2S!2SYܓ2SYܓ2SY4s2S!2SYG2SYG2SY4s2S!2SYe2SYe2SY4s2S!2SY!2SY!2SY4s2S!2SY&%2SY&%2SY4s2S!2SY)'2SY)'2SY4s2S!2SY-D2SY-D2SY4s2Sa2SZ2SZ2S['2S!2SZĴ2SZĴ2S['2Sa2SZX;2SZX;2S['2Sa2SZ X2SZ X2S['2Sa2SZv2SZv2S['2Sa2SZC2SZC2S['2Sa2SZp2SZp2S['2Sa2SZ82SZ82S['2Sa2SZ /2SZ /2S['2S!2SZ$[܀2SZ$[܀2S['2S!2SZ(2SZ(2S['2S!2SZ,2SZ,2S['2S!2SZ0G2SZ0G2S['2S!2SZ4s2SZ4s2S['2S!2SZ8C2SZ8C2S['2S!2S[2S[2S['2Sa2S[沀2S[沀2S\ "2S!2S[2S[2S\W"2Sa2S[W2S[W2S\  2Sa2S[t2S[t2S\ !2Sa2S[2S[2S\ #2Sa2S["2S["2S\ $2Sa2S[&62S[&62S\ %2Sa2S[*T2S[*T2S\ &2Sa2S[.}2S[.}2S\W'2S!2S[22S[22S\W 2S!2S[7n2S[7n2S\W!2S!2S\2S\2S\W#2S!2S\2S\2S\W$2S!2S\2S\2S\W%2S!2S\ 2S\ 2S\W&2S!2S\I2S\I2S\W'2S a2S\e2S\e2S]$[܀ 2S !2S\!2S\!2S]$[܀*2Sa2S\&%2S\&%2S]$[܀ 2Sa2S\)'2S\)'2S]$[܀ 2Sa2S\-D2S\-D2S]$[܀ 2Sa2S\2b2S\2b2S]$[܀ 2Sa2S\52S\52S]$[܀ 2Sa2S\92S\92S]$[܀ 2Sa2S]À2S]À2S]$[܀ 2S!2S]2S]2S]$[܀*2S!2S] !2S] !2S]$[܀*2S !2S] 2S] 2S]$s*2S"!2S]2S]2S]$s*2S$!2S] 2S] 2S]$s*2S&!2S]G2S]G2S]$s*2S(!2S]e2S]e2S]$s*2S*a2S],2S],2S^5 2S,!2S]0G2S]0G2S^5* 2S.a2S]3%2S]3%2S^5 2S0a2S]8C2S]8C2S^5 2S2a2S^2S^2S^5 2S4a2S^,2S^,2S^5 2S6a2S^X;2S^X;2S^5 2S8a2S^ X2S^ X2S^5 2S:a2S^߀2S^߀2S^5 2S<!2S^ܓ2S^ܓ2S^5*2S>!2S^t2S^t2S^5* 2S@!2S^e2S^e2S^5* 2SB!2S^#*2S^#*2S^5* 2SD!2S^&62S^&62S^5* 2SF!2S^*T2S^*T2S^5*2SH!2S^/q2S^/q2S^5*2SJa2S_bZ2S_bZ2S` S+ 2SL!2S_w2S_w2S` S+*2SNa2S_ !2S_ !2S` S+ 2SPa2S_N2S_N2S` S+ 2SRa2S_z92S_z92S` S+ 2STa2S_ 2S_ 2S` S+ 2SVa2S_t2S_t2S` S+ 2SXa2S_2S_2S` S+ 2SZa2S_#*2S_#*2S` S+ 2S\!2S_&62S_&62S` S+*2S^!2S_*T2S_*T2S` S+*2S`!2S_/2S_/2S` S+*2Sb!2S_4s2S_4s2S` S+*2Sd!2S_8ـ2S_8ـ2S` S+*2Sf!2S`2S`2S` S+*2Sh!2S`Ĵ2S`Ĵ2S` S+*2Sja2S`f2S`f2Sa4΀ 2Sl!2S`ׄ2S`ׄ2Sa4΀*2Sna2S`2S`2Sa4΀ 2Spa2S`(2S`(2Sa4΀ 2Sra2S`#F2S`#F2Sa4΀ 2Sta2S`'c2S`'c2Sa4΀ 2Sva2S`+2S`+2Sa4΀ 2Sxa2S`/2S`/2Sa4΀ 2Sza2S`4s2S`4s2Sa4΀ 2S|!2S`8ـ2S`8ـ2Sa4΀*2S~!2SaÀ2SaÀ2Sa4΀*2S!2Saw2Saw2Sa4΀*2S!2Sa !2Sa !2Sa4΀*2S!2SaN2SaN2Sa4΀*2S!2Saz92Saz92Sa4΀*2S!2Sa 2Sa 2Sa4΀*2Sa2Sa% 2Sa% 2Sb,2S!2Sa) 2Sa) 2Sb, 2Sa2Sa-L2Sa-L2Sb,2Sa2Sa1xˀ2Sa1xˀ2Sb,2Sa2Sa5 R2Sa5 R2Sb,2Sa2Sa98p2Sa98p2Sb,2Sa2SbÀ2SbÀ2Sb,2Sa2Sb]J2Sb]J2Sb,2Sa2Sb h2Sb h2Sb,2S!2Sb 2Sb 2Sb, 2S!2SbI 2SbI 2Sb, 2S!2Sbu*2Sbu*2Sb, 2S!2Sb92Sb92Sb, 2S!2Sbe2Sbe2Sb, 2S!2Sb!2Sb!2Sb, 2S!2Sb&%2Sb&%2Sb, 2Sa2Sb5 R2Sb5 R2Sd 2S!2Sb98p2Sb98p2Sd 2Sa2ScÀ2ScÀ2Sd2Sa2Sc]J2Sc]J2Sd 2Sa2Sc h2Sc h2Sd 2Sa2Sc 2Sc 2Sd 2Sa2ScI 2ScI 2Sd 2Sa2Scu*2Scu*2Sd2Sa2ScG2ScG2Sd2S!2Sce2Sce2Sd 2S!2Sc#*2Sc#*2Sd 2S!2Sc&62Sc&62Sd 2S!2Sc+2Sc+2Sd 2S!2Sc/2Sc/2Sd 2S!2Sc3%2Sc3%2Sd 2S!2Sc7n2Sc7n2Sd 2Sa2Sd S+2Sd S+2Sez92S!2Sd沀2Sd沀2Sez9 2Sa2Sd2Sd2Sez92Sa2Sd>2Sd>2Sez92Sa2Sdt2Sdt2Sez92Sa2Sd2Sd2Sez92Sa2Sd#*2Sd#*2Sez92Sa2Sd&62Sd&62Sez92Sa2Sd*T2Sd*T2Sez92S!2Sd/q2Sd/q2Sez9 2S!2Sd22Sd22Sez9 2S!2Sd7n2Sd7n2Sez9 2S!2Se2Se2Se 2S!2Se,2Se,2Se 2S!2Se2Se2Se 2S!2Se 2Se 2Se 2Sa2Set2Set2Sf#F2S!2Se2Se2Sf#F 2Sa2Se#*2Se#*2Sf#F2Sa2Se&62Se&62Sf#F2Sa2Se*T2Se*T2Sf#F2Sa2Se/q2Se/q2Sf#F2Sa2Se22Se22Sf#F2Sa2Se62Se62Sf#F2Sa2Se;32Se;32Sf#F2S!2Sf2Sf2Sf#F 2S!2SfX;2SfX;2Sf#F 2S!2Sf 2Sf 2Sf#F 2S!2Sfv2Sfv2Sf#F 2S!2Sfܓ2Sfܓ2Sf#F 2S!2Sfp2Sfp2Sf#F 2S!2Sf82Sf82Sf#F 2S a2Sf2b2Sf2b2Sg;32S !2Sf6=2Sf6=2Sh:2Sa2Sf92Sf92Sg;32Sa2SgbZ2SgbZ2Sg;32Sa2Sgw2Sgw2Sg;32Sa2Sg !2Sg !2Sh2Sa2SgN2SgN2Sh2Sa2Sgz92Sgz92Sh2Sa2Sg 2Sg 2Sh2S!2Sgt2Sgt2Sh:2S!2Sg2Sg2Sh:2S !2Sg#F2Sg#F2Sh:2S"!2Sg(2Sg(2Sh:2S$!2Sg,2Sg,2Sh:2S&!2Sg0G2Sg0G2Sh:2S(!2Sg4s2Sg4s2Sh:2S*a2Sh2Sh2Sh+ 2S,a2Sh 2Sh 2Sh+ 2S.a2Sh߀2Sh߀2Sh+ 2S0a2Shܓ2Shܓ2Sh+ 2S2!2Shp2Shp2Sh+2S4!2Sh82Sh82Sh+2S6!2Sh!`2Sh!`2Sh+2S8!2Sh% 2Sh% 2Sh+2S:a2Sh3%2Sh3%2Sik 2S<EN ؐ  * * :    ؓ, @*`*: @а N  D?"?H,  @%`H N  i2 D H@%@H@^@.@`N 2 N .@E? @!"G%x2L  "(  !8  "@@ ?4%x "P@   ܟ€" L  !?`"@  " *@F @%T08 'D'H-` 2 ,`*  29ND,`㿘@xresolvexnsx25staticssthreshsendpipesarttvarrttrejectrecvpipeproto2proto1osinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoinetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeaddroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] 㿘!h@RÒ`!h@R`@S^ route: %s: %s 㿘 $#!!h@Ra@ !haH@R@!h@RaP@S= nqdtv/dev/nullsocket㿘@ / /"`+ )'%#@;Ȁ?N? 7G* hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh`hhhhhhhhh@hhHhhXhP%aT%!$$$ce #0&* @R@"c@!$#! !В @Gh   @)T "c# 6@U!@ 4@ ^?`. D*`@"#@=@R{ @C@D@Rt @must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl route: write to routing socket: %s got only %d for rlen %-20.20s done x#  $ "#Ԑ #@❒ R N`@J@ -I@ Ӑ`?`C"p*`@```````````````````T #"` "` "` "`#ah!! $@4#ܔ@Q:!@0 "`g@ ' ''' ''  ܘ @o' h!@kgܠ2`!0 ܘ @o 6S!8ܦ# @R!`P +)c @` > ` `M 27@#؀ 22@ ,`$`#@n@@@!  c @@` `L@$@Ր@! @@!@!@ cdefault%u.%u.%u.%uiso %s(%d) %x㿐sa #"abb@ !  bb@"J .bb@"m *"b 2 0! !*0 `* `* `* `* `* `* `w* K  "  VJ DP'    !  !T   @v  @! . @/<bb ", "0@":1'3`3`"0a3` @a `,1@Ґ)@%@6 "0@Oa1  !!"0a@D "0  %@:  1"0%u%u.%u%u.%u.%uaf %d:㿘  s   "  } q k 0w %!!T ! `  ?0 @ ??   2:@` 2``2 @R  2 #c@!_1? ?#c``@ە6 S1# 6 #c`h6 @͖ E1 6 6 #c`p6  @ 816 #ca6  @ ,1@%)@%@ #c@a1  !@!#c`@ #c@ 1@`@!@ 1#c㿐 ` H#D*`@DDDDDDDDDDDDDDDDDDDDDDDD(8D                @  a"a!X  "`"`` 2"`@o$0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %s: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐  '# ( $ "#ܐ @M g#@ߡ ? "p%#s- `@J@ -@Ґ` )* TD4$@,x,\ Hp $ $a $ $a   $ *$a $ ,$a $ $aԐ % 7$" "!Xc "c  }zx!v"t(?`l ?`h ?`d ?`` ?` @@9[@?` @@0 a  P"a ?`@K?@ F?!P  @ @:!P  @0@O@ ?! @@,`   `@% %Ԁ ! 2%@ @!%Ԑ @ @? 4`# 2 ! 2   #Ԁ "  # $-%$cM@c܀ 3 2M 2MM@ 􀢠"M`  `"`@g2 ߲`M g $@M #! 0  @#!8@M@  !H@`   !8'@m@x!X  @r!`  "  7 "0 "0 !h!x!@@X! P  P# ?* ??* ??* ? ? ???"`"`(*`J` ` H  *@Internal Error%s: bad value 㿀` 2 "`s "aaP"aP?`>!*`@,8DP\h ,   # X  ,!(s !,@+ca 2ꀦ ",  ذ ",԰ a  "a   ˰  ?`}#8*`@|D #` @L ,  ,`s!!4 `4 aP "aP#@@x 44444 4  &  ~ @Ő@eΔ   2s   ,@J@ ""@,@^ @  @XTR ,,@K "&@? 2$!  $'@5  1 @l? @       @1 '& ,@@eb   !ha8@K@L P P ?(*( (ഁ *.**.%XHany*%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx 7 7 7 7 7 77 7•s ! 2s`211M"#b@gF#s!@8#  s'"!@8  "#\#`!#@DbL#р 0 ##݀ : J 0  @#@.b1*#1#b@"#ǰ#actual retrieval of interface tablex ' ''' ''  ܘ @h˚  !@e ܠ2!0 ܘ @h 6 ܢ @ got message of size %d 㷘 "c#؀ '@K+ %@g͔(@Ւ@_uwriting to routing socketroute: read from routing socket: %s 㿘! $"#ܐ? @J"L a c  g    `Y  `Y *`Y *aP "aPa\*`"` *` ""`!P"`   "`$"`("`, "`0"`4"`8"`<"`@ "`D$"`H!"` @!P  , ?``  ,@cߔ# @}bH!P  ?``  @cÔ# @abH!P  ?``  @c# @EbH!P  # ?`` #@c# @)bH!P  X ?``  X@co# @ bH!P  ?``  @cS# @bH!\$ 2!\#  @G#؀ 29 #a\@f  @"P+?) %!\#!@f"L c @ #܀@`  $@ *#ܔ!h@I.bp !\@ @ (J@@8PM- "Ä(ഄ"@(  p  p p p  H p p , 14- ? *ഄ.@ .? @ @ *@--"(RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘# B `@i# 0: sa*Ð#P @_    2Ð#`@S ! s@  TÐ#p@G ! s@8 @ 0Ð#  @7 ! s@ڔ8@v route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘     ,@͐  !h@Goc 0!hĒ`@Gf  "  @ V!hĒa @GY 0뀢 . L  & "  "      2  2 ?` @` ـ  ,  @o!8 !!T $!Tv@c!P$!T     h@U!h"Đ! @M@J!! s@8Đ!@?a $   LĐ"@6 4 $   LĐ"@- 8 $   LĐ"@$ < @!@_# $ @  L@" D!@_# $   L@ " $   LĐ"@ , $   LĐ"@ ( 0 " $@  0"@& 0 $   LĐ"@ 0# " @&0?H@ِ"!! s@|!? "! $! * @B  locks: inits: 㿘@"x#a $!s@Z!@"a @S! L@   sockaddrs: %s㿘`B@"!!s@<!? "! $! * @  #ŀ"@zc  ? @ ? " " * @ܒ @]Ր!㿘`Y @>@ 6  , < ?`&  @  `&*@ @ܶ !  ?`&  @  `&*@ @ܟ 4  8  ?`&  @ > & >*@|㿘s 8 8 " @$ "    %s: link %s; %s: iso %s; %s: inet %s; %s: xns %s; 㿀  "    " , 2(@!@ !'@"7 7 7 7 7 7@Ɛ"@@]!㿘@@   @Eɒ `Ɩ#А *`: ? *`: ? *`: ?N 2    ,  @((*  ,`  * **".@㿘  @E{ * .` *.@N p r h"  p p h r .`2 ` .` N p"N r"N hN ,2u  N T`` %`*`:  , . :2 B@ <6` .`?А 6:P ,  N N C ``* 6` `, @6` 6`N V` "6`N # V` ``   `, @N V`  `$6` J\2 Є(  *@  J  ЄЅ*(8  Є Ї**8Ѐ4*@ *@㿘@X-link2link2-link1link1-link0link0nsellengthsnpaoffsetipdstbroadcastmetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupisonsinet-a'%s' requires argumentencapsulation routingSIOCDIFADDRSIOCAIFADDRp@{) ?@`@@"`   "!?`! @@" ? `t! "a! @"@   !sa@ *` "  @a@@D& !!@a @ @Ȑ!@  @D  @R@D 9?#s#c  c@@"i "  2@ 2 ! 2   "? 2 ` 2 Ȑ `@V@`?`@€ ? Ͳ`s# @ s# ! А@\  @\  `  @@ " 6@: #쀢 a @z  `@`T s $#܀ 1!` s@ s#耢 a @\  `@`6 @  @C 㿘t!?@`3 ` @ 뀢 "``t?"at"!socketSIOCGIFFLAGSSIOCGIFMETRIC㿘s# `  @ǒa( `0a@_ @Ȑ!0?V "c `0a@_ @޸!@"! "a SIOCGIFCONF?cp?c"  " "`s# `  @ϊa(? `0a$@_ 6 @{b?#*@ ?#@; ?#?#ئ?# `  @7  ! @ $ $` $` $`  $` $` $` $`p @&㿘a "a!`  "c!!`8  €2`㿘! € 㿘! € 㿘@> ` "`"#s"#㿘! !` 뀦`6"!`!`` @[ 뀦`"!` "#s"#"#Note: trailers are no longer sent, but always received 㿘@!8㿘! € SIOCSIFFLAGS㿘 `0a@^@  @Ωa0!@a @ R!P`" "c@"c@#2 ` @^a  @ΆaSIOCSIFMETRIC㿘!!@a @Δ @!@$  ` a@^ @v"%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d㿘ʐ#@sa ʐ#c@!`@e#? " " * @Ӓ ! t @ 0! !  !@ ,` @   2 SIOCGIFADDR inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿐  `  ! $#܀ +Đ @Ԓa(!@ @A= !@a @   `0a!@]!@ 6! $#܀ 1 /2 ˀ !P @A! !@ܼ !!@#a @ !T'@ΐ@ ِ !@a @  `0a%@]˔!@  $#܀ 1@ܙ !P @@ aT"!#耊 ( `0a"@]@  $#܀ 12 !P @@ؔ @s !@a @ !T'@@  ː @ a#耊 + `0a#@]|@  $#܀ 1 !P @@ @C !@a @ !T  '@R@ ]!? " " * @˒  ns %s 㿈  `  ! $#܀ + @a(!@ @@i !@a @L  `0a!@]%!@ 61 $#܀ 1 /2 ˀ h!P @@M 1@ 1!@a @+ !P 7 7 7 7 7 7@h@  X#耊 1 `0a"@\!@  $#܀ 12ː @@ @۴ !@a @ !P 7 7 7 7 7 7@4@ Ɛ ? " " * @4 SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOhk  `   $#܀ + @Ua( @? 0a @  `0 a!@\z 6 $#܀ 1 /2 ̀ iؒ @? @>"Ȑa @ @,ݒ@ ]" `0 a%@\S  $#܀ 1̐ @?  @" @ @ ?"#耊 " `0 a"@\1Ȁ  $#܀ 12̐ؒ @?^ @"a @= @ݒ@  ? " " * @Ո %s: bad value㿘t!.`@ `, ,  @ϒ @7@@Xn 0@ "  @ $ ͒a`@˖%s=%o%s=%x㿘  N . .`" . ͐"(@ 2t!?`"@ < " <*@* N`K. 2 % ,>@ : ?`"@ ,`"*@@  * :  % !:` ?`&  @  `&*@ @* :` :`NN 4N`!?`"@ > " >*@ʒ Attempt to set XNS netmask will be ineffectual 㿈t!.`@ ,  ,#@@B 4 4 4 4 4 `4 @  X㿘t!ē.`@@ @W `  ,, , , 㿘@9"`Negative NSEL length is absurdSetting NSEL length valid only for iso㿘@s "c @ʛa! " R   @ʏa s* 㿘t!!  usage: ifconfig interface %s%s%s%s%s%s [ af [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [ metric n ] [ arp | -arp ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig -a [ af ] 㿐ΐ#(#\ΐ#h#`!hΒbΔΖΘ#@=c@= 㿘@ Vlost+found8(x cx@  @ `pJ2 `J2`*`@ *@cxwrong type to dirscan %d 㽘N 0`@-  $   a 2 ` aB  "@<2`* @ *` >  H @U!`4 @1   =   b> 8 & @<&  0`@Vr& ( @ @   "@V_, -2@2`  4   2     DIRECTORY CORRUPTED㿘 H @T`4 @\ !8  4  3  (.  6* `@@ 2#  f@,Nbx @7`  "4 " , , ,  ,` "&  ~B?\>  4  2W   (S  6O  `@ &     b>  !=`:@  25  (1@1 2, ` a >"@""@ & <  b>   @+bx @ђ`@ 4  ,`  " @:; `. 45 22 @2 `,   ? `  `   ` ` ` H  /   &HH`?㿘 @%s NAME=%s %s=%s DIRFILE㻐А"X@+@@"`@*Ô`#@@9@&P <  ""А"x@+0А"h@+UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘@ T .`>`  @ EВcX@ 0? ( @ <  2""t" @+p#`@ T ,`: А#p @="J#D  6 @3"`@+:#@-#J#D 2  @&#  "@\4 㾐 (@E ,/    ` `  " 6  " 74   $4  x # @, , ,    ,@Tn 㿘 (   ,@' "  $ x # @, ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%lu CONNECTED. PARENT WAS I=%lu ` @: 8@@<  `?"""@*{"X@J#D  ` `  J#D 2 @%/"x ! @5"h! ( M@ tb ' /ؒc'Ē '@ڒ 1$ (@*C"J#D !@%" $!t  @$ (t @ J#D  "! (@m $ (J#D А"`@ ( 2Z"@w (<  7@)"@$ʐ# ! (t  @ $ (,# t b @w(  # @# /#''c,`*`<:`c2@; ( p (J@ ѐ#P@) 0M@ (@\  ѐ#x@) @"09#.  ?22 #!ђ#@/`( 2 !쀦`(@;#!@ (` @4` (#*`  2 ѐ#@)ѐ#@XJ#D  @P"` ` @9| 8 /ѐ!'''''@А@X G#C`A@? @9^ 8 /ѐ!'?''@ "@@` 2```aB  "@@2`* @ *` @E>`@  @(@@ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘 H @P 4ڰ , ( "԰     H@'R 8ř,  (# ,# (`H 0 : @ B > `H 0:  h & h `H`P* :  8    H  0  He< eD`L  ,@5 ` s,`@R"'H@&`0` d,`@Q"`"H`0  )t"@Q "H` 0@  ,`,  H P*@:`     H  0  He< eD`L  ,@ ` ,t`b@Q Ӑ!@(SJ#D @"! @#!  @W,` , ," (" , H 0 :  b>  H 0:`  h" & h H@'`8 㿘@8  x tt","D&@&` @| H (@`4 4@Q_ b H 4@@  't%@QP bH 4@@  . @4   # 2`@d '  p ? @R @Up @*@pJ  #.  2@ ,`@  2@ @&  @4 㿘@ @2 @'㿘#`   @PC 2 ?,$?@@  0,@P1  #,㿘#( ?"@#$"c(@ 2&@&`$ >`< @@@(@x H%(:  8   H%(  x h xz x@P  H 0?: @ B  @>; Ѐ3 #전?`H`He<@ :e@@ B `L ;  @ @:`T&``H 8&` " &`N`0 `@   Ѐ Ӡ?`H 8&``H 0+  * :  b ; а + " `H&`@! 2`H t: @   d  $ PARTIALLY TRUNCATED INODE I=%lu㻘L`0  `@ 2`0 `@`  ! H`@"T`0 H 0 : ) H t: @ P   H H t: @ B4쀦  H t ?]%`F@B@5 `"<@+- H t6&`* ` - 9ծ   #@`@% " $-` *#@"b-`@:` `$`@m 2`f *` ?%` blk %ld < cgdmin %ld; blk + cnt %ld > cgsbase %ld blk %ld >= cgdmin %ld; blk + cnt %ld > sblock.fs_fpg %ld 㿘c 'U H@R `@M``,@M``  `@= ֐!@H@M  ,@M @ ֐!В@@ % 'H@M`@ Đ@M``,@M``֐!@ H֐"@|  bad inode number %d to ginode 㿘 #֐#@%Q!l`  H x@ 1 H@N! @Mf  ,@@Ma  @>o @N x `*  t`!` ?"` H@!`0"`t# H@M x@MA x$al t H@>M`x*  bad inode number %d to nextinode 㿘#H "#H#+א!@$+c =""" H@M @M   ,@@M  @> @M x `*  d,@>`|  "" %c# b "! #<@"b#<"ah!h "!hCannot allocate space for inode buffer 㿘"!l"#H"#"" He<8`H "c 4 "")`@Pڒ% |%`@>h$*  " % |""b# "b!#< 2 @Nr# $#<@$c"#H !\#H#H 㿘#< "@N"#<cannot increase directory list㿘 H 0?:  @ B  @;;  8 ,@N6 4!@=dc* #0 $@`" $`$`$` $` $`,$``@M (#8@2`d"!#x@N*` $#x@$ 8`"8#x*`" cannot find inode %d 㿘@='cc0* @     2 ؐ!h@#֒ 㿘#0 #8* ?cx #@NF?cx#@N>c0!@N;#x$#x$c0t (%s %sDIRFILECLEAR (CLEARED) 㿘D <  2""ؐ"@#ǒ@h J#D 2@" J#D @"b?"b<c@M  p  * 㿘 ( @2   ,@L 㿘 (  @  , 2 ` #@8 &    I=%lu OWNER=%s %u MODE=%o %s: SIZE=%qu MTIME=%12.12s %4.4s 㿐ِ H@1 5#1@$ P@ pِ X@ِ ` p@ِ h@J#D ِ x@ c  @  '@Cِ @%ld %s I=%lu BAD STATE %d TO BLKERR㿘ِ!@"@! pJ "    p4쀢  0 p  *@ p *@ pِ!@"J@㿐   pJ \  #  pcJ "  *J#<@ @"(@ 9 @4  p  p *@@!  $ ( p *@4@=$ $ $ H 4 :< H 4: $ hb "b x #6` *@` @2 8 /#''ߐc@KȔ  p *@b?"bdfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o %c option? 㿘@i @´5 *#ڶ!'/! $-+t%#ڐ@na +w* klkkkkkkkkkkkkkkkkkkkjjjkjkkkkkkk klkj|kkkkkkkkkD .D, b#@ ""@ ,ڐ c`#@v "c %, l#@h ڐ ma#@` p%b@!z!ڐ! @b , ,,,cL cL ,cL,,@!g!@}#0&* @ @1@   @1:clJ#D  @12cԀ  @@&`  @   ?@1 J#D۔$@T# @1 @1 -%c flag requires a %s 㿐@%"J ې @!ufsffsrwro㿘 @a "   @a 2  @a "   @a 2     starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %ld files, %ld used, %ld free (%ld frags, %ld blocks, %d.%d%% fragmentation) %ld files missing %ld blocks missing The following duplicate blocks remain: %ld, The following zero link count inodes remain: %lu, ***** FILE SYSTEM WAS MODIFIED ***** / ***** REBOOT NOW ***** (J#D  @0`"# J#D @ \!@<?e  J#D _@ 0!\ J#D  Hې!@`J#P "@"@"@H#4 J#D "@ "@@"`@J#D @"@J#D @"@ J#D @"@ J#D @ڐ"@ %H``'!@G`8ې##@@ . * * H@L (. "* *  (2`@ :@K @9 ې#8@ H Ȑ c"@" `$@#h R' H``" @G`,@$@`$@`?`4@KÐ $@!@G`8#"@$ `$@@q#!#4 @j##4  #ېc@b  2c@[#!" @T#"  #ܐ`@L  2`@E#"""#4\" #  H H@  , # ) LJ L #  ,71 H@G4``,@G/```d, @6 H ,@ @Iu# @Ir p@Io## .J#D 2@ J#P "!ܐ 0@ 2W@'''ې! 0 @  "  J#D @ΐ 8@x 0 `  H ,>+ `H@F``,@F``!  H@F``,@F`` : c    ?$- @ @*   `H ,`H H``?`4@J 6   : c    $ +   *  @. 8 /"<'Ģ "#@"b  H`H 6'쀤`@m H ``H ,& PARTIALLY ALLOCATED INODE I=%luCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %d bad direct addr: %ld bad indirect addr: %ld LINK COUNT TABLE OVERFLOWCONTINUEINCORRECT BLOCK COUNT I=%lu (%ld should be %ld) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%lu㿘Đ@< 4`(c@v 0 ސ`X`@n @  ` ` ސ @@ ؀  ;c@G(  p *@"#$ H 0 :`@ B B?` 8`   "}`` @} vJ#D <2@b  H 4 :<` !4@ H 0?: `@B @5; @6 "Fސ!@E>@@((v# A` ` 9` 4 2`h` ;/`h *"j ?#` H`( d`@+ @!  ` ,ސ!0@` `(@F{` 2$`h H%(: `8``   H%( `h  ``B   @4    ) H@D`t?   4ޑ,  (`  "@Xޠ  , 􀤠  ) H@H`t  ޑ,  X`  "@pޠ  , @7 b "b#. `2 T` @Fq 2"@}!@c!  @Y!b""b`  `  p  p *@ p *@#4 *@# "`?"ϐ`$`p?4``$`tp4`"!t"ap&` H 4: @D=`$&`$`h 0ސ!@DJ#D @!0@" `$" hސ"@! p *@@ ؀   p *c@Ew .BADEXCESSIVE BAD BLKS I=%lu (SKIPPING) DUPEXCESSIVE DUP BLKS I=%luDUP TABLE OVERFLOW.㿘   " aڔap "ap!@ J#D @! @!  _! $/-35#+뀤 ƒ   p   :` J   ?$:@ 2@ %@  :     ?$ *@  I*  bat  "at"@ J#D 0 @EO 2"@["(@Ba 0 @8+ ` `$`%c4"@""@c4`@ `"`@@ 2``@2 $`2$` $ & $ ` @+L 8 /"'#4"ax  H ,* ) `H @6'쀤 (`"`' pJ   `H @ `H ,ܢ DUP㿘  2 '-+  2 x `  ` ֔x $ " $x`"` 2 ` x@ բ`ROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORTDIRECTORY %s: LENGTH %d NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..' p ?* : `V *`@44@;"@!# & @# ! @-#H@#` @#p 6@# 1@#@#`     !퀢 @#(@# @#   / +2  p#@J`p *` x p *`# *`#!cx#8 @;ऐ @) 8 /#|'#8* cx  @S8+@@  F   cȐ"$ #!% @ # @Ȗ"McD @  ! >$ McD  @     :  @) 7@  ?Hh @B  ' '̐)`@*@#x@W+'%@ "L`  G pJ@ 2   J@ 2  *@    6?4 2 $   퇔(@2c "(`  8 * 2 s@@c "` *`  2  *` ?2  $  8 `@*@.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀 (#  ` #@# ,  $   '@aH 2"     쉒aP $@F# "` x "a $  \ uap P, na ' x  // /!H7  @Ғ`8 !@)3 $6@ !* $,`@6 7@A$7@A $ & $#*` ?2  @()4@# "` $ 4  ' x  // / 8 87 `/ $    @z"@74 $ & $#*` ?2  @'4 @Z`8 %  x "X  S Βb ,@# "H`G @8aH    ʔ("@?   뼔(@}"P?% %   뮔(7@@@R# "` $ & $`#*` ?2  "` `8  $L . $ `2L  bj$@(# "`` .2 $ b & $#@  D x $   2     2 I $ ,@# "` p @?* : `!*`@ 00 $  @ɐ" $  pJ@ 2"J#D  " @"{I p<    * #*` 2  p J  *   & $ $ @ @ #@J#D @v#@  $@e"2 $  %  x ! #J @  ꞔP# @,@D# "`#*` ? 2  p#`@.J@ ` $`@ 㿘#8* ?cx >)+ `"3   pJ 2+ p J $  `  pJ  c@ `  ($ $ #*` ?2  p *@#x:UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d` @& 8 /#'Ġ #$['"#%'p ?* :  B* T#, R@`b85 "2 "b2( +`  ` a b "$b@? ˔   p"J@@c #$('ȁ㿘  `M '+)   >  & $4@?ǐ  :`c J   ?$:@ %4   "4 2  2  : c    $  * *@* #@?%#@` DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%dFREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSSUMMARY INFORMATION BAD?b H"?#H@?$  p *` @$``5 # $eL`X !e$ J#D @! J#D 2 %e$@!@ " `X%e$ "c 0 * `X $eLe$   !Xe$`X@`!`"eL`X e$ %e$`* @A` ,`T T @ "@@:`|@+`@>+`@:`@+`@9`@@+`@9eP@>`*  ,   X@9eP*  4e$ <@>`8 & :  l@=`8&` ?"@. @&,$ $% $:  " `@ @ ?$: `8" :@   4@Ֆ `8Ee$ 4  h l   p@ @ ` ` e$@4*`  #   *   p瀋@ ` e$@4*`  #  $ '  '  '  '`p> *`@`l.* bؠ @ ޔ  @@b  $ $  $  $$  0* # h` " \\ @  x@b@ \ " \ @:s(?<@   T TTT ?4@ | $@b` ?<@:ETT  T T ?4@:2( `,eL??,%eP`@ F  @@Ob  =`=`-`-` 0 * Can't open checklist file: %s /etc/fstabBAD DISK NAME %s Unknown pid %d %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s SUNEXPECTED INCONSISTENCY:%s (%s)%s, 㿐  @}  @27 ƀ   @         @ 2  !hc@˦@Z0 `#|#|@4  ! @  4  @4  Ȥ`)+u%5@ې~      2 @#0逊  :    #@ `   `"@ %` $ "@$ $ ?$  `|?&|   @(  4  *@А  @|@``" ` "`` 2` @  4  @  0>9"܀ ,"   !hc@ "܀ !h @%#   P`X@Ӓ 2  !hcp@ǔ @k out of memory㿘@)@@ "J@  2-"@@:J@@@)  @  J .  2@8ِ   $!h@a(@# ٤ @8ʐ  &!h@ta(@ @*& & & c| "c|%s in fstab more than once! 㿘     @S 2 2 @8   $@!h@?a(@ߐ @@)!@8   $ !h@0a(@А  @@)@8u  $ !h@a(@ "@o0 @$$ fork㿘@  & @Ȳ#      @ @` "` /Can't stat root Can't stat %s %s is not a character device x *#P! `@ 6@} `@# h0M@8  @@q @@<  "@L@ cP *cP@M@؀  @S @"<   <   `@ @ ` 8@ /@ <  L  r @K /r㿘@͒ /1,!@< /,!@b!@ ! vndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%qd IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%qx IN SUPERBLOCKINCORRECT QFMASK=%qx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead *#?"cJ#@ޒ 6  $@߆#ܔ @ <    (@ @Ɛ H " @ǒ 쀢  "` $@f#ܔ X@ J#D  p@趒J ,  @ 뀢 "c?"cJ#D "@  x@蜐 J#D 2@蔐 "#" (! 0, ?$ $ #`P,`$`$`@5{$ @5x$`  `2@ d  @`  (""b"@ې  Q"؀ 2 J#D 2 `@,0 " @@ Ȁ | \@%@3\L,@@3WH8,$@ \`@\@!#\ a(H!p@aM  !@ =b  H!@ J` H р J#D "0"8@ "(?J#D 2@ "@ H $"c# ,@2 $c 0 :`*` * ?:  ! H t:   @ @ E  H! H  H@ ː"h@" 2! H"  ,`! H <`c H@ "@"  H " < ,` H `! @$ H"@ ` H "`J#D @犐"J#D 2 @u"   0 *  P*  H  @* @%!! H#@ ` H`"`J#D @^"J#D 2 @I"  ! 0 *  P* ! H`0 `H@!@ k#( H`0 "`HJ#D @7"J#D 2 @"#P  ! 0 *  P* ! H`4 `L@!@ D#X H`4 "`LJ#D @"J#D 2 @#P   0 *  P*  He, e0!e4% H He4e0@ # H:%0J#D @"J#D 2 @̐#P  ! 0 *  P* ! H%(`< @ # H <"e(J#D @潐"J#D 2 @#P   0 *  P*  H`H8: e8 !e< ( He<e8@ # HH8: :8J#D @抐"J#D 2 @u#P   0 *  P*  H`L8: e@ !eD ( HeDe@@   HL8: :@J#D @W"J#D 2 @B#P   0 *  P*  "`xHH8: :8HL8: :@" x# 5 H%, 1J#D 2 @ H O @ C (c "cHH "e,H:%0H <"e(HH8: :8HL8: :@ +  P* # i H%L?eJ#D 2 @ܐ  @  hc "cH "eLH "ePH#\"eTH%`"eXH* @0P*  `,`: @ H @0 @4 |`,`: @ He$ * `@0``|``@4* `,`:   H H%@ B L ;   $ +` P*  lJ l "؀    H? @2h#@Ē?   H < +`H`"`04 @֒`H-  "b `Hؐ@0t 8  d* @ 2`H@T @: H 2@0 ج`H 0   ɒ#```:   !@  $#  @#0Q!#c @  $ pc!!#c @~  $#c!0@`05!#c @o   $#c`!X@*`0%% H $"c8 "b#@X $cx!@S $#0cx ` #!@֓*`0@S 0@  MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %d, alternate %d VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘"؀ #:  @4  `H@ 2  0" "  %\F!T@bP H , bh H b H ,@/f    ,?@/^ ܒb H h@!ђb@/J# H H  d 4@3i* $#@3e$"؀  H`,?@/0``,@/+`` P @)`h ` 2 #`h! H"@`h H% "e `h H "` `h H`"`"`"`"`h H""b`h H *``h H *``h H *``h H *``h H X"`X`h H <"`<`h H "``h H @"`@`h H \"`\`h H"ؒb@0E |`h H#T"cT`h H Ԓ`@0;"`h H$\d\@05 `h H d"`d`h H "``h H "``h H%P"eP`h H%H"eH`h H%8:8`h H%@:@`h H%H"eH`h H%0:0 H `h@4h % @~" H h ?`h)'@ "H$ @l:`  `c@  *c %s: BAD SUPER BLOCK: %s 㿘 J#D  @Fc @L%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘@猒 ??" ? *`: bؐ    @ @Lbؐ  "L`* :@ ``u!\*`@#h @e  @%h &4 &8 &&$`0&`,&`8&4@.`(&|`` ?4@. ?8@.@-ߒ&?&` * :``& "* &?|@1 ?8@1@-&@-@1|&$@1?@1ؐ &,&d|`$ d :``&d`("c ioctl (GCINFO): %s %s: can't read disk label 㿘E`e@2l 61뀦  $ @#ܒ@#p#@M1!bad file type 0%o 㿘< @@"$  (@"  @" 0 @" 쀢@    @, INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘J#D "@ @a`?@! J , # !@` J#L 2   J , !(@ڒN !' !8@В@,H?? %?@?ฐ`$ @, :  , : ?  $@ 2  , ฒ $  ,  ` 2, :  y Y n N2@ᔐ!, :  y Y  cannot allocate buffer pool 㿘"#("`t H@.q 02@b#X"" * ?" " cX" "cX H(@0`0$  6'1/)#X?@.K  H@.G 0 `2$ @3X$ $ #X$#X" %#X, $ $ "#ddeadlocked buffer pool 㿘#X#X  H d,#X  "# 2 c\c\? #X  "  2 #X2@ @c, "c, "@ "`cX& cX&cX" "cX  & 㿘 H d.@ #@!c "c  @j& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` E` ` @/c"""`@`.`&```@`  0@'  ` !)'#`H,`"ؐ@+ 8   d*  " 04@H 0 ` CANNOT %s: BLK %ldProgram terminated 㿘J#D 2@Z!#Ȓ@_E! @<#UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) 㿘#   #a`0J# 0 8: #:  @2뀤@ J#D 2 X "!#:  @ 0$  , #/#*b@-Q"#\`#X'뀤@ 〤`@-A`@-?@#d@ x@"@"#( #"`t H р J#D @֐   "   H H **`# "##, * * @.c, Ȓ@߅c,@/ #@/SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘>#: @? @/h # @/<\ #ߒ@/O  #Ӓ  @d@,#> -9@/ /<@ E  ;  B  @/' ##@*"@.G@.CcВ@  !@.8##@ Ȳ@@!WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 `>#: @ @.ٖ #] @. ="c!N@. 6#B@ޠ! %#)@.cc <  D  ;  B  @. @-c#@ c@@w!㿘wH8@s  1H#8 i ; `H8 V ,8 H >2?  6  ,8N >@ 6 #@@,8 @ *@ .@#@@"#@ `H8 `H8 `H `?닐/?..`@ u2!! !!䀢   p ? ! !. `K. u "a @ 8 / '#@-.#'ؐ#'!'Km "u''ؒc'>'` u@4$ @*#? /,  uȀ2'u"!? ?,<@* & 㿘# Y @ǐ returning to single-user after filesystem check 㿘@g# "c @3 㿘@  @+  @(  (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 &   $ "' "N 0 c @W J#D @& 0   @   & &  H@㿘@ @W %s: %s: UNEXPECTED INCONSISTENCY; RUN fsck_ffs MANUALLY. 㿘J#D "!!`@#@@!!h@#@+ @ۖ㿐J#D \!`@c#\@ƚINTERNAL INCONSISTENCY:㿘Đ"p㿘 8v0. . @..`uu   &@>/`  8@/`@2 / &/./  8. ` 8@۰ffs_isblock㿘 8 "  $  @ `?*  *@>*  *@>@   `? * >@  `?#ffs_clrblock㿘 8 >  > .@>*` *`  * @ *@.@ ^ xffs_setblock㿘 8 >  >  .@>*  *   *@@  .@ 3! 㿘@㿘@E@@) 㿘@ Ffs.%s8@E)' %#@K,"8? f"$ s ? F"$0"$`@#0*`@&    H"耦 "@   . 0" @. @@b@@4 @`@/ @?@p  bH@><    @@@ `@@%s: is a directory%s/%s8 @A "HK <   @= @$ <  @> / $@   @  $#܀   € "H@Ұ 0 usage: ln [-fs] file1 file2 ln [-fs] file ... directory 㿘!h@ a@/ 㿘@V฀  (  (㿘!b  @f!b` "`!́㿘!̀ a̐""a!b@ Cannot close descriptor %dcannot dup %s㿘@*   $#܀ #H@8@  @B#h@8@  @6cannot fork(child) pipe to stdout(child) pipe to stdincan't open archive %sarchive to stdinarchive to stdoutchild can't fork((child)) pipe to stdin((child)) pipe to stdouttar (child)[child] pipe to stdout[child] pipe to stdincan't write to compression programwrite to compression program short %d bytescan't read from compression program-dcan't exec %s㿈 @7A@gv "a@7#@ 3 v!܀ J!  a "a"b|@60"b|@50J!  G @ @5"J@ -J` I!  !"@ :퀢 <"b!"@ 5J! " @!퀢  "b|" 8@7*@@ א "| PQ!"@!퀢  "b|" 8@7@@  "| h9@6@ @6 @  J!   Ք@5} ̔@5t "bJ!   @5["J@ -J`  J! C""| >"b|J! "|! !"@t :퀢 "b" " @!$@"|! !"@Y :퀢  "b""!@R $@"@\!$@"| 6 " 8@6r@@  J! =-)+1/" | ?" @Rbh|" @(bh@M|~" b" @(8@6>!@  @5$ @%)-+h`" b" @(y@,` " h"$hh " @ b| ?" @Rhb|" @(Mhh@Ɛ "h@$h"b|@5!h@   ?" @Rahb|" @(+hhh@h@  J!  "@@ "@@ !@5b@@ 8@  < `?invalid value for blocksizeNo archive name given, what should I do?could not allocate memory for blocking factor %dcannot verify multi-volume archivescannot update or verify compressed archivescannot use multi-volume compressed archivescan't verify stdin/stdout archivecan't open %sArchive not labelled to match %sVolume mismatch! %s!=%s%s Volume 18v!!Ā !h!"@"h 2@4!`@ ֐ ! 2@4!@ ͐ !  !"h@u$ $" $@u{"h$" " 2 !@4b@  " "a"*  "b*!!  "\ "@4!@  "@ ( "\ @4"@  ! @4"@@ ~ < "J@ -J` 0v"J@ -- J` ) a "a"\  @4j"p@ S  ""|v!h"ab g"bd""| "b|v!h["a"\  "|! !"@C :퀢 "b"6""""|! !"@) :퀢 "b" " @!$@"|! !"@ :퀢  "b""!@O $@"@!$@"| 6 ""@4'@@ Ԑ "|  @"<   "b"b(" "b!"D F2!"@3"D@  @! @C 0"bD@3@  1"D $!"  @ y"! " " b@$"D" @bD!" "!Ȑ V*`@ "  @ @ u"   8 ⨄" Write checkpoint %d %s Volume %d㿘!䀢  `" @Ւ !(@3Z"쀢` v*` !  $ "c "|  ?b @Oh "|b @%h"h ! @9 "4 bh " va"a"h- !  v!쀢  v* "!$"!(!J / vv "J  /v @#a#x"a$"X"a(  $#܀ ? @@4 v"!"D  J  b <"b "D  J " b >"b #bD  !" @"v" a@bD@8@ "  @ Ȕ"  V*`@ " J 0"D %b ""b   @g" @ٽ`  M*`! !( @ |!$!( "@ @ q!!$!@ g $!"D  >$ "|  ?b @O"h "|b @$h"h@b v"4 bh "vbh@"!, " @ "" !"*` @ !̒"@@!\!̐@$!a("("a(!(a,c: v* !J / vv "J  /v @>a"X"a(#x"a$can't write to %sonly wrote %u of %u bytes to %s㿘 "l"*`"@2& @Ӑ "l"*#h@1 @ǐ read error on %sToo many errors, quitting.㿘 a *a"l"*`#@1 " @   " @1#@ Read checkpoint %d Volume mismatch! %s!=%sReading %s Warning: No volume header!%s is not continued on this volume!%s is the wrong size (%ld!=%ld+%ld)This volume is out of sequenceBlocksize = %d recordsarchive %s EOF not on block boundaryonly read %d bytes from archive %s㿘!䀢  `" @ƒ  X@1K" #``@!̀@ "@!#@ ["`"" " ! b @#"h"h@+ ! +v!쀢`" @"J@ / #vv "J  /#v! @0a $a#x"a$"X"a(* "!$"!("|  ?b @Msh "|b @#sh"h@`" $#܀ `! `! `"䀢     @ "|  ?b @M:h "|b @#:h`"h@" L V%#bD !@! @@   pbD@0Vv! v!`@"D @0m  J HL M@䭐  @0Z`/v#| @)ْq @)Ԓa$# @)̒ @)Ȓ cx@0;v!$a($ @)q @0,!va?"ava?^"ad"!̀`P)" @"h" !! " 2! `!(@/:` "h" >b  8"! ) 2"| ?@Lq"|@"r`2 $ "l"*`!@@/ @ @ "l"*!h@/ @ Warning: can't close %s(%d,%d)㿘"b " : ⨐ ""!"*  #"J /zc )v"c*! !"| $@L?@"3"| "l"*`  |@/ va""|@Couldn't backspace archive file. It may be unreadable without -i.㿐 7 '"| ? a@LN "| a@!ߔ ^  $#܀ "|  ? a@L6 N  "| a@!Ĕ C "| ? @L  "|  @!ɖ "h"@ "| :`?@K :   :`"|  @! 2@ @.!X" bd   @"  child died with signal %d%s (core dumped)child returned status %d㿐z# J! "䀢 "|  ?@K  : "|  @!_    @0"|"\ @ "| $@K?@!>"| v"l"*`  |@. v!܀ .!v@n!!܀@" ```  ##@.a#x0:  i@E : ``@.R#r%s%d㿘#a@ȡaȠ  $#܀ !@.va耤  av@A@kw%d 㿘#a@ȁbPv!@.Ya0bX@`@PPrepare volume #%d for %s and hit return: EOF? What does that mean?Warning: Archive is INCOMPLETE! n [name] Give a new filename for the next (and subsequent) volume(s) q Abort tar ! Spawn a subshell ? Print this list No new volume; exiting. Can't allocate memory for namecan't fork!SHELL/bin/sh-sh-ican't exec a shell %sHv!! v"Ѐ v"|   y!@a$ $v"x s?"\ @ "| $@I?@ %"| v"l"*`  |@- va "ava "al "la v"lv "av! "Ѐ  %v"@퀢 :)'#(! v"!%"X$x"쀢6&a >@"@ @s"@.2"'쐄?,! >@2! 쀢`! v"!쀥`@)!쀢 \@릐?W !`@)Q!@)j  :`#(@ c !  @)쀢 !/$"X @#"G>'쀢 ! v"!쀥`!@#< ( #`@$ 7 c,@n K"#\b  :`0@9 @Ҕ d-! 2B- ##<  2@ 7d@''e@  /J? /2 / /,,"T b  :`0@\"  D"T  5- " @" O"   N@ " @ @ @Ԕ |@/+)v'a %!$X"#x"@6@a >" @f" @$@?@! >`a! `v^"!" ! $"@ !  " ! $$#@۱ #܀ "  "P"h 3L .-L /" 3-@G'`@~ @r @l@&v`@b`bP @R 耢 ܐ 0@I@2! ^@hΒ0Z#<    3#<   4#< @@0@ #< @@0@2  6"T , b  :`0@^ 6 - !# 2   @!I#  @!Q@!쀢 @?  !`@'0"@'Wrote %ld of %ld bytes to file %sread error at byte %ld, reading %d bytes, in file %s㽘@ [ -+w @k"ԓ,  ` @ & @'C,@:   @0 b@ "& @$@@"&@hH @<"b@@@~" 6 @@`8& @' "&@E@ @V!԰ 㿘# $b8!@%^ P$!Ԓ b8@ !"8*`"`@ " 㽘    .a@ P +@N3@"0b8a@%H*`&ab8* %b8"!@? aԓ,  "   8@0 2 @ aԑ, "@@ΐ, !Ԑ  " !ԕ, "@ @  "` @z? *$* J $J " 퀢 ԅ*"ԇ*򀢀 Removing leading / from absolute path names in the archive.ustar 㿘@ c@ʒ L[ @O"! N /#v% b8  $b8@&hN /" "!Ȑ@ d, c"T "`` / @r d`  @n l` @j t`4 @f |`  @b "   `@Z!Y`( @V!e"T  0,  ,! `,! `,! `,! `,! `,! `,! `,!! @#` !)@#` 㿘" ". `. `. `. `. `. `. `.  !   @ . !  """T`?@"a *  0* `:  2` `* 㿘 "@ ././@LongLink8@  @ `<? ",`0 @Ɣ?$! >픐@t"@@ @_$, >@could not allocate memory for diff buffer of %d bytes㿘!v#@fbh $"| @%ibh@R Verify Unknown file type '%c' for %s, diffed as normal file%s: not a regular file modeuidgidmod timesizecannot open %sError while closing %s%s: does not exist cannot stat file %s%s not linked to %s %s: no such file or directory cannot read link %s%s: symlink differs %s: device numbers changed %s: mode or device-type changed %s is no longer a directory cannot open file %scannot seek to %ld in file %sh $ "c!a"""b@ !  v"x v!@ap@"J `V^*` @I|I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I\I|KLMdMxNMI|I\I\I\I\I\I\I\I\I\I\I\I\N0I\I\I\I\I\I\I\I\ODI\I\I\I\I\I|I\I\Q"!xJ`@$b!@!Ȓ?!J /B`@ "J!• @ @ #,v<   v!a@@ q#,v /7c @!#@@!#@@ !#@@!"J S#(#(@@@!@ 7#,0#a@ %쀢 $!   //001@aȐ@ $# !@$a"J!• @ 1@ #,?v"J S2?@#(?@V B#\@K  $#܀  v!b @v"8@#avvv!bP@\0!!Ȓ@Q f $#܀  v!bh@!v"@#av *>!#\@ Ȁ v!b@#\v" " @  2 " @ 2 " @ # @ v!b@v#@v!b@v!@ 퀤  ""#,b4@7#, b@K!Ȓ?` J /* @ <   v!c@Fkv# o /@v@ސ!0r!@!Ȓ?!J /Ѐ`@y e<   v!a@ !@ #,Bv /7"ؐ @Paq< (@ B Ȁ ̀  @!@#,$v#a@I 쀢  "c# @"a@#,v< #  @N @ #8@"vb "b#,~ad@1# "@"a can't read %s%s: could only read %d of %d bytes %s: data differs 㿘v#b|@ v!@"av!a(@vvb|@䒔 v  !aP@vb "b?㿘!"@z v"$"  !aP@ivb "b?%s: %s differs 㿘v!b@UCouldn't rewind archive file for verifyVERIFY FAILURE: %d invalid header%s detected!s㿐v"|  u 7 '"| ? a@>ݔ "| a@n 6 $#܀ "| ? a@>Ŕ "| a@V "|  ? @> "|  @X `@!ِ"0' *av :"bx#'%@` @  @8@!`*!v""xcan't stat file %s㿘", @! @!Ȁ   $#܀  v!b @ !8@!aȰ 㿘 "@g"@ w/3v5+!ԓ-  h  : 〒  @ږ +b- @^!b@"" -aؒ(aȖ@U【@R" v$@&b〒@ 6a!@!'a0"b "b!@!a〒(aȖ@$0@" vb "bǐ& @!v" v!aP@ȁ㿘 ""8!@Ԑ P$!Ԣ )',`* !"ؒ@' ԡ,`"@"ؒ  @` Ԓ@``"`"J!• 7'v+)e ℒ@ b8@!@*%!b8* %b8,`,  @ℒ@ !ԓ*`"  @ ℒ@ !ԓ*` ``"L ℐ $U0R㿘@ v@"b v "b@ * 2 ! @v8"bȁextractRemoving leading / from absolute path names in the archive.Unknown file type '%c' for %s, extracted as normal fileCould not unlink %sCould not create file %sUnexpected EOF on archive filecouldn't write to file %scould only write %d of %d bytes to file %sError while closing %scannot chown file %s to uid %d gid %dcouldn't change access and modification times of %scannot change mode of file %s to %ldCould not link %s to %sCould not create symlink to %sCould not make %sCould not create directory %sAdded write and execute permission to directory %sReading %s Can't extract '%s'--file is continued from another volume Visible long name error h!"v""b@ " " @HaȀ  "J!• "@! @P!  '!v%#J / "̪`  $"@D(a "J `V`"4*`@a_______________________________________________aeLfg<gPhha____________h______l,l,ll_______k"!"hJ`@Ԕ@  ""8!@ P$!Ԥ )',, !"ؐ @H ԣ,"@"ؠ @@ Ԓ@ "`$,"J!• 2 /-惤 8@@ܓ*%8* %8,* ` "L@ ԡ, "@ @Ԓ@"`L  x0u!!@@?!Ȑ@J@ /瀤`!؀ &*"J S `!Ā 9 "t !؀ !!@@?2 ! $#܀ !"@@ !!@@6!@@ !"@m@ "J!• "{@w"J S!!@M@ @>!Ȓ@@ 9( '(@M@"I#, D'3v'1#(-! &a&#x%X"쀤@4 $"#ܐ@k֐?  Ȑ"@@  Ȑ#@ʖ@ @"" '! v"!!Ā @^  v!#H@@ v"Ā #" a!#@#@  a#`@ #@"` " #v"'#'!!Ȑ@@^- !#@@ "t !؀ 2!!@ߐ@?  $#܀ !Ȑ"@@ !!#\@J@ !@@ "  $#܀ #\@˒ !Ȑ@@Ē(  (@,@x!#@ @[\0o"t !؀ #!!@@@? # $#܀ !Ȑ"@A@ #!!c\@R@ N!@\@  @/c\0C" " @ 2 "t !؀ !!@ @?2 ! $#܀ !"@ @ !!c@c@ !@$@ 2! "t !؀ !!@ސ@?2 ! $#܀ !Ȑ"@ߒ@ !!@@c !@@ 2!\ !@@?` Ȓ@J /2* " @ "J D2@#,!Ȕ@#v"Ā "`@M -!!@@ !Ȓ@J .2  $`@ J? / $#܀ !Ȑ@@ՒȀ  <  ! 8@q@ 0v"Ā v `  `2! X@"@ v"Ā #" a!#@#@  a#`@ #@C"` @$ #a@+@@ $a@#@ ##$ `$ `$ a$ :"a!؀ #.2#a%v!`#@@a %a##@ @ 0!  @aa0@"0 @a@ @#,+ cannot change owner of %s to uid %d gid %d㿘 $#܀` K @› /B)# /7 L? /2 .2 , - L? /) ,@e! 2,v"Ā #@  v X#@v"Ȑ$@d `, $#܀   $ @[ /ƀ $"#ܰ㿘@ O +) a@>"0H,:   @  aԐ b@ "6$@"@`$@@"&@b@ "@K @ #@@=@@"&@@ @ !㿐!  㿘'%$ ,  j ?#`*` @* ᜓ*#xc"  @ *c ᜐ" * @cᜐ" $$ᜁPOSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿐x"#x㈀ # ""a""!N - + "a&"! @̐# "! "a! "J ! /!x!a  x#@<xx!c "!x " * @J@ -J` xc"!!x#'* @&@_cȀ !x# $#!a @  !@x#""!x"#x㈀ x!a2"?#* @J@ -J` ! x?x "* @" 'Q !x#*  @ J  -`? @  " x#* @J@ -!J` -`"!!    `="L    +a @7$ 2a$@ 2 '   x#  x#*!h&c@@@ !@!! $! ux#`"#L 2  xU"cx# x#* ?J  - x!h&c@@!#* ?!h'` @J@r!@V!! $! ? )!x㈀ xx"㈑*@"c#  x#*!h'`P@@M!@1!! $!N : ? :!@%!! $!' `  "@ `x#* @J  - !@J@ /!x# x#* @J  - x!h'`x@@ #* @!h'`@J@!' "axc "ci ?!!`$! @@J@!J xc "c :2Jx#  . !h'`@@З:x. : "cA ? :2=. J : !J@  x/"#!J@ x"#xc $"cx#xx#  . !h'`@@⠗:x. :`"#N :  ?  :x "* @""!. > 㿘   㿘 㿘 㿘@ B 2@C!$"!$ $ @B@ 4 $ @;$ $ Couldn't get current directory./rCan't open %s㽘!y 2@ $$ @R!"J /y @8$ !y)@ ސ"@ǐ  )@c# @b $b!")@*c  $#܀ )#@ "0a _"@Fa   "a@"b #"@5 E@ՐL? ",?@Obؐ   ؠ L  2 @nLbؐ   ؠ L  2 Lbؐ   ؠ L  2 @  G @ĝwCan't write to %s%lu %u %u %s 㿘!"*@a*!@ "0)*a@! '*  "@     @t@;  @k  2 @W㿘! "   @\  2  .can't chdir to %scan't stat %s8@2" "x 2*@3:""x :L  1  2.L  2*   @sk  *"@  @k *#@ <  2   ,  @ 2L "x   `!"x +@ $"x,  2, " <㿘N  N`   ? 2  @ƒ`㿘@ @`can't open directory %serror opening directory %sNdirectory %s has been renamed.Directory %s is newDY8! $$#@@q d@ b#܀ +!H@ p +!`@ .   @Q@QJ? /)@c@G@ e7+5 +!@@? @3 d@ :@@&",  @Ղ  * @ *#@ 0"  "P  @5 T<  6` @ @  +!@ $ $ $ $  "+!@ +!$ `2$ +a!" @ @တ+a@ @ꨐ @ْ0e+a@Ӕ @@L  @= @ꍐ  L  @x* `@} L 2&@&@ +@L($@a  @ @,`  `@ 2@,@:@@6㿘Ӓ"x ," @] 2$ $   8@1`c d`d@@%@J? / /,@`,@N D@&d@@ @1+N @ߐJ.  J .J  Can't allocate %qd bytes for restoreUnexpected EOF in archive delete%s: deleting %s %s: Error while deleting %s 㿘!@ݐ@#,0@@   @鬐 @ݒ0@+a@Ք @!#(@#(-#(#,@ a @`0o@ \ H#,0-_"4@k@=?$L@ H%M  @} " L@\ L 2 L (!Ȑ@2Y" - h@2w ! v-!ؒ`p@P@ - @@@* @L@ 2M@M@8@ +<  '@*"% @Ր    @2   @ې0@@oo 2 @Ґ@ @2 Omitting %s Hmm, this doesn't look like a tar archive.Skipping to next file header...㿘@/t Ӛ )'#(@Nd``Y0^@0q!Ȁ ! #b   "P 1@31!Ȁ , J V& !"L  J 5. (@Z!J!• 2 L  5@ 5@`0=؀   .0.@8 8.@5 h0,"H 9]@0EOF in archive file?only wrote %ld of %ld bytes to file %s㿘 !ԍ"!  "b@6 @" Z"J` DU !  v!"a#,"cx#,&/-+ $)vᤀ 2%X϶1."8%cܐ @t!ئ@?2.! v"!6 !v @!@!00"@@$@"p "J!• 2 ϓ"؀`@! va"!@#,! v"!Unexpected EOF on archive file㿘R퀤 ""?@m!0 @  !J@ `  J `"$ ~   y L 1 "   : 0@Œ |: :0, c  1`L!!%@ "@7#(@E#($@ `/%"4@1?$@`0!`"!Ȁ !@@$@ $!@!`"آ #\ !@@@ $#\@"!"a ustar 㿘 @Q d /6` @L &` "   @D!Y&` @@!e&`(!/c@b  2,& &N!  @4! &` @) l&` N!)  @l!)&`@ t&`N 4 3 @!I @!Q,  &` @  l&`  @ t&`&`J@؄ ؐ? &`J@2?  @Є *(8І? `  J@` ؄@?rec %10d: %s Visible longname error %d%d,%d%ld%s %s/%s %*s%s %s %s %s -> %s link to %s unknown file type '%c' --Volume Header-- --Continued at byte %ld-- --Mangled file names-- 0"$ v!b ": !0a@A !  ?#@aȠ"av!0a@0!Ȁ"v@v/"J `V*`0#@DŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰŰDDňŘŐŀŠŨŰŰŰŰŰŰŰŰŰŰŰŰxŰŰŰŰŰŰ00 (ŰŰŰŰDŰŰ% V# M! N0@r" -/!@!!Ȑ J? /2 d  d  d  l b c p C/##@ '@--`-`"J !   "ؐ `l0@b"K!) !  !)"ؐ `t0@b"J 3 4 S# 20b @ 0"ؐ a0b(0b(,@@&@#@  y`84"`8%@Ȣ"vy 80"H#\#``#d`#h#la0b0@#@!Ȁ@@ِ"J `V*`2 @((ɬp((((((ʄʸ(p!@8#\"#\v!0bP@٢#\!@)#\"#\v!!0bX@ْ#\#\@";v@U7vv"a0bh@قJ-vv!? " " * @pD vv!0b!v"ؐ aq!0@^b vv!0b@Vv@#!؁%s %*s %.*s Creating directory:㿀! / d/@d"$ v!b ": !0a@+ @"vy 8#\a2b2"@@ݐ㿘! "#x""X %/#!˕ @@ٝ ˪>a  "X>$"X㿘~Ja ˕ 0˒ 0rwxrwxrwx3! - "*@*@``2 ( $Jx S s*$ "Jx S s*"Jx T t**@Unexpected EOF in mangled names!Rename to Can't rename %s to %sRenamed %s to %sSymlink Can't symlink %s to %sSymlinkd %s to %sUnknown demangling command %s㿘#,@P-+3@ax0,"4@8$@ ?L z)3@  ,3a@ͪ  )3 @ !@͞   ,L /", @0@i 3!@H! B38!Ȑa@|  63 @͒ !@p   ,@ @@i  @ 3@h 3!@ !  3"@ " @L 㿘y`@ "`!*!@S@@8 a@3 㿘!NJ!@  @ !@ @R> y  "`y 1y 6$@iT& $y 㿘y`@"`!@[8*!@Z@@ a@ 㿘!NJ!Ѐ@  @Ԕ !В@۔ @Z y  "`y 1y Ā 6$@i1& $y %s:㿘y! !h4@Eb!!h@A!h? "!h $!h * @n @Ґ Couldn't allocate memory㿘" @o4ϐ#p㿘Couldn't re-allocate memory㿘 @ 4#؁㿘Ӑ  2&& & 㿘@ & && @㿘 @`2& &   @@ &  㿐`A`2  8'&3$`2`6`6``"ߖٖ ` 6@$$@ "$$can't close a file #%d㿘@ 5"@l@ 㿘    g \*`:  \2*$? @D*  @U@/**F"ؐJ  ">L*:2*$? @"*  @@3@ *  n   t   f   b  r<  ?*  0*<   0*  0*L  2* J6J\ 2*@ Ѕ(8Dv( XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXhXXXXXXXXٸXXXXXXX٨XXXXٰ        *@`'JД Є(*@JД Є((*@JД *@  \*@` *@`Js\J@2*@can't open a pipe㿘@j 6@H"@ %s: rec %d: 㿘'H'L'P'T'XHv@!3ah6b@:"$ !b ": ⨐ah6b@) 3ah@Kah? "ah &ah * @k @!h 㿘'H'L'P'T'X $#v@!!!h6b@"$ !b ": ⨐!h6b@ !!h@H $"#6@#@찐!h㿘y!H (! @_! a! *@``z$*@ A! *@``Z$*@ 0! *@``9$*@! * _y "aHyL LUnmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit㾸'ĺ'ĸ@   '@g"  ' ''& *@* *@&&+& 2 @֒ &@G &  ѐ &䀢 /@'$䀢  '  ?`r 8 ̓*`@                                                                         |`                             @(Đ`䀢@ `2 @ g*   n`$@  -  % * &&@  & $@ %  % $@`%@@$@   ؀ ސ 䀢 `2 @ E*   ,`$@  -   * &&@  & $@ %  % $@`%@@$@   ؀  Q?d `2/`  ` ꀥ`/  `. :  +` *:  ?` 䀢1  '  *".   +".  ?ޑ.  \䀢" }  t  '`` + ?Ĥ?'䀤 G* l$@  -  V * &&@K  L& $@ %  % $@`%@@$@   ؀ ?NJ?`.N.@$$"$䀢" NJ` N @`@$ $`@ $ @  /$ @ `$@  -   * &&@  & $@ %  % $@`%@@$@   ؀`  $@@ ͖ .   `$@  -   * &&@  & $@ %  % $@`%@@$@   ؀  @  ^`$@  -  p * &&@e  f& $@ %  % $@`%@@$@   ؀) /䀢 D $@ " -  6 * &&@+  ,& $@ %  % $@`%@@$@  " ؀$@  -   * &&@ & $@ %  % $@`%@@$@   ؀`J ^  *@J@ ^`''$@  -  * &&@ & $@ %  % $@`%@@$@   ؀ ,@` @>  ؀a1 ` ,`1䀢" y  ' ` \ ]䀢"p g  '`ސ` ]`䀢 ` -J ]2S -Ā J [Ā J [J ^J ]J@ -`J` ]@$ '@ "` [2/J@ :2/@  '䀢 䀢`'䀦 @  : ]䀢 ` ` $@*?`$@*? :NJ ]I7@c0`?/7@c8`?/7@c@`?/7@cH`?/7@cP`?/7@ޒcX`?/w7@גc``?/o7@Вch`?/g7@ɒcp`?/_7@’cx`?/W%7@`?/O37@c`?/G7@c8 B@ =7@c` 77@cP 17@c0 +@c &7@cx  7@ch 7@cp 7@ycX 7@scH 7@mc@ 2E 䀢: '䀢1 '<'4','wog_WOG<` "ؐ  q 4` "ؐ  f ,` _ ^  "ؐ  T ` "ؐ  I ` "ؐ  ?  "ؐ  5  "ؐJ  +  "ؐ  !  "ؐ   ` "ؐ   "ؐ  D"  2  *@ @  ,@ ~< /?'  `  ,` ` ,`// 2   *@ @  ,@    ? ,@ ?  N@@2`@ `hd` @d`"@@9?`䀢L C ' ?ـ`Uy="*`@ H0 p d p p p p p $ $ $ $ $ $ $ $ $ p p$ p d p p p p p p p p p p p p p p p p p p p p p pL p p p p p p p p t p p p p p p p p p p p p p p p p p p p p pt p p p@ &`'쀢@*`*`@@Γ*` '* '* @*`%" *` *  % ""*` * $@" * * @`E"`*` * $@ "$@  +  * &&@ & $@  % $@`%@@$@   ڀ ,@`,@`,@` '0 @  @N ?$@  - > * &&@3 4& $@ %  % $@`%@@$@   ؀ ,@` $@  @ @C` ?'* @*`   ? *` *  Ȧ @* $@  - נ * &&@ & $@ %  % $@`%@@$@   ؀ ,@`,@` @!@݀dހ`$@  -  * &&@ & $@ %  % $@`%@@$@   ؀$@ @y `$@ @c$@  + R * &&@G H& $@  % $@`%@@$@   ڀ`  b^"@@YĀ?@R?䀢?@2/' +`' @  !"ؐ@   & . *   ?䀢 `' @  `@ ,25䀢+`' @   "ؐ@   & , *   ?䀢 `' @  `@  # c@@@ \䀢`'䀦 @  }@2'  ` z` < $@  - p * &&@e f& $@ %  % $@`%@@$@   ؀ $@@U^`  $@ - 3 * &&@( )&@ $@ %  % $@`%@@$@  ؀ `"" @ `  @ `$? @` $@@`Ū '䀢`'䀦 @ @`Ā `J? \`$@  -  * &&@ & $@ %  % $@`%@@$@   ؀u $@  -  * &&@{ |& $@ %  % $@`%@@$@   ؀? $@  - Q * &&@F G& $@ %  % $@`%@@$@   ؀  $@  -  * &&@ & $@ %  % $@`%@@$@   ؀Ր $@  -  * &&@ & $@ %  % $@`%@@$@   ؀ $@  -  * &&@ & $@ %  % $@`%@@$@   ؀k $@  - } * &&@r s& $@ %  % $@`%@@$@   ؀6 $@  - H * &&@= >& $@ %  % $@`%@@$@   ؀ ,@`@V`А`'''А@`*  D`$@  -  * &&@ & $@ %  % $@`%@@$@   ؀ ,@`,@`` `"3 @@  2-`)J@ *% ^#` \ bJ`J + ?bN@J {"FJ@ \2AJ` {2=$@  -  * &&@{ |& $@ %  % $@`%@@$@   ؀ ,@`,@`$@  - M * &&@B C& $@ %  % $@`%@@$@   ؀,@` @ -@䀢Y䀥  $@@  @$@&          *@*`:*`*@*`:*`*`:*`㿘  *㿘  ?? +ې J\`?H(  2 2  H| 2 2 J\`?    J H)"  J|"  0 H|"   , ((  (  24  "2  )  8%   8   8    (@  *@ 㿈     ` '7? '' @ϔ! @ *@& 2  2@ *` * &  ?'* @ `D#*`@ 0xxttDp4l   - * ? Ӥ ``:  `` ?$@:@ 2-` * `4  -``$- ,`?  ``:  `` ?$@:@ "-`  ! L@ "-``$L@   ! L@ 2-``$L@ |   -``$- @2 n- l { L* @`c  ^ L* @S*@MJ' L* @#쀤2y @a8E?, h#`@,, '* '`'*`"    &   L* @` î @  耤 䀤 2@ *` * &    (" "@"` "` (" "@"`"`㿈#\#`#d  @㿐\`d`` 4??84$` `@  `  4y? ` `@ ) l?) j?) `BA `= * &$&@ " @ O@  `?? " @O@ `"&@& @J   2 #\`"#\`"?#\#`@ ?  $ ? ??㿐#\#`  @'''''` ' '  !!'l'T` ' ''  L/```c ?#`'`c ?#`'`c ?#`'`c ?#`'|`c ?#`'d`c ?#`'\`c ?#`'t`c ?#`'L`c # `'D c`` ]|`Zt Wd`T\ QL`ND T?`OĐJ? Ĕ?07#;#=#. | @ !  @ ! t@    @ Ā  Ԁ`'''̸@Ă'Ԇ''̲&@̀  @Ԧ̦$2" "[\ :̀   T@̐@T@ `?@l` `T`a^  'l'TV . @d!@\  !Il`"\TԀ ( \. d@!\@  !\` @2@2" ` 8 @ \ @\@b* \ `@@]* \!   t`r`* @! `  \`\@ : @`@ȓ*`\!  @“*`\ `` N`U?\  " $$̐"@ ?̖@\@@ =.  ?@ ? \\ .  " +" `̀  . @ Ԁ ". @"̐" \`̀  . @ Ԁ ". @"̐"  \@:?\ .  " "   \$̐&߰"@ܰ"@`bH"*`@#$$ $$%&+,,-\:3x3x/0-21h35,677L:;9H: 78t `9 IL@+?@%LL@?@*t@    @ ~ @ `"L H@  `" L H@ @ @ٔ*t   ! G  `? "`" @ * @ 2`  `: 2  @*t   ! ' * t@0 2 @t ** t 0* @! * t@ 0@  * @! *  @ *t  ! *` *! a  * t@ 0@  * @|! *  @ *`t *@! ?* t@@ * t "  !! * t@@ 2Ē '         J *  `' ' ' 2\ ` 2X ` @2S*`t@ @*@ @ *  @ | @ @   * ' J *  '"%`*`  %-y*`  %`*`  @ 쀢* h#`@k* '* '"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" `'*`J" *@C?> ̀`  Ԁ@` ̀`  *Ԁ@  ̐@ `? *@*@ @@ %%$4`@i @ @Ц̀ Ā 2L`    @@2LN  `@@-̀ "Ā  L* "%`*`  &5y*`  %`*`  @쀢* h#`@X* '* '"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" L* ' `': ` @ @   ` `a "%`*`  %5y*`  %`*`  @o쀢h* h#`@Е* ^'* '"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" `'*`'" L*  ? 8 * 9   @ @1 20  ' ` 2 `      `? *  @ 2`  `:  `?2 ,  -,''* '*`  * *?'* @D @ ?'* @L! ?'* @ ! L* "%`*`  %1y*`  %`*`  @}!쀢v* h#`@ޕ* l'* '"@@ @`'*`+ @ " `'*` " `'*`t@  " `'*`" `'*`" `'*`" `'*`" "%`*`  (1y*`  %`*`  @!쀢* h#`@x* '* ' ?"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" `'*`" L*   ?,> ,,, L* ?,> , L* ' L* *> *`̀`Ā`""!2N@2LO?J `?쀤!N2LO?@J `?g̀`Ā`!2N@2LO?J `?쀤!N2LO?@J `?0쀤!N2LO?@J 2̀`Ā`"!N@2LO?J ̀ Ԁ{Ā x!N@2LO?J h쀤!N2LO?@J RP쀤!N2LO?@J 2;@3*t   ! )쀤!N2LO?@J @ *t@    @ {@ n?'* @ 2'* '* '*`  *?'* @t! ?'* @ @ ?'* @! :+      Ԁ Ԕ ' L*  ' '   (  l`MT?㿐 ]' @ H K`' `J`*`  H'@G*  @'  `' `J`*  ' ?  ?   ?J?*  @@!*   '' & @0*  "   㿐'  @*   `' `J`* `@ '  㿐`' @`gP L*`@AAAAA@AAAAAAAAAAAAAAADAAAAAAAA K, 0 **0* &*-  J *`  '-  ' J *  '?' ?J?*  '' * 0@    '&  @JJ`  2  㿘* *@@ "yFLyaP*  No previous regular expression㿘  !" 2, 1P)"" 2!@՘ Ȁ  $"!" $ @Տ! $ 17"!" @ $ @yL yaP*  㿘@ "   82 㿘"@"&& !& @W! & :    bؐ  #*   * & @ ?!   @*@& 6 `*` * & @ż欖 " h@Ů @ @ ' ' ' ' ' ' '  * *@ 7  `*`* * @`''.@'@'쀢 `& Ȁ`  `  ** &    "`@4@26 㿘  @?@C  @}Ɣ*?@3㿘 "&@&& &   "& @&  *@&   "& @& 㿘. #ya@׊!y!@ׅ ?&$ 㿘 @B @. y!@`@P  @1ې $ "c?@( P . y!@=  ?L ",``? `@4O  L 2  L  ? 8L@~_  $"cܣ. y!@@  O 2@L F2?? A@~C  $ "cܰ?/usr/bin/rshrsh-l/etc/rmtcannot execute remote shellO%s %d Ƞp0 y!y!,`@ ?2`@  ?```,``2 $ "c? @  :" ,,  N @, N? @2+ @B : ,  N :,   , N ,,`y!@M?y!@M?"a?@N? ?,`@֏ ,`!y!@KR@@ֈ@@@օ @փ !y!Ф@@KF@|@@z@J@J6@J@JbO0 #\R!RaRᘘ0R@Dۚa RR!RaR@Dј R@c!@Ȑ y!@Py!Р@K RaДp@"Ò??ߐ?b@C 㿘S`؀??͐R%d XSa @? ??  ?| $ "c?,`y!@& @W%d XSa@ɔj? ?@ . y!@`@ո  @C $ "c?@kL%ld %d XSb@8?"?TI%d %d SX !@!@ 8 $SbV@v?":?36S c?"/?(? y. !@@a $  V 4   ݐ $ "c?    `. *` unlinknorecurseatime-preserveforce-localvolno-fileshow-omitted-dirscheckpointignore-failed-readremove-filestape-lengthsparseuse-compress-programungzipgzipblock-compressuncompresscompressportabilityold-archiveone-file-systemdereferenceverifyconfirmationinteractiveabsolute-pathsnew-volume-scriptinfo-scriptmulti-volumelisted-incrementalincrementalnewer-mtimeafter-datenewerpreserve-ordersame-ownersame-orderpreservemodification-timepreserve-permissionssame-permissionskeep-old-filesignore-zerosto-stdoutstarting-fileread-full-blockstotalsverboseversionblock-sizefileexcludeexclude-fromlabelfiles-fromrecord-numberdirectorynullhelpdeletediffcompareconcatenatecatenateupdatelistgetextractappendcreateTotal bytes written: %d Bad regular expression: %s %s you must specify exactly one of the r, c, t, x, or d options For more information, type ``%s --help''. 㿘@1@"b *b""@#` @"!耢 #"䀢` {U!*`@W UUVUVdUVUV@ ei@ eg"4 ]!hU`0@V1"D !] $!@f"D"D!؍ >1"D !E $!@N"D"D! !hU@\`Pb #"b.n"g#X!hU`pz@DXU x!hU`@8@ؐ !耢 "@"-01234567Ab:BcC:df:F:g:GhikK:lL:mMN:oOpPrRsStT:uvV:wWxX:zZ-CThis is GNU tar, the tape archiving program. Only one compression option permitted lmh/dev/rmt%dinvalid date format `%s'Unknown option. Use '%s --help' for a complete list of options.TAPE/dev/rst0Multiple archive files requires --multi-volume You must use a compression option (--gzip, --compress or --use-compress-program) with --block-compress. 㿐?' "b!ޅ ($" "a"!""l%x#75+3-)1/'Uy@? zUV", @Y\YYYYYYYY\$\<\X\t\\\\\YYYYYYYYYYYYYYYYYYYYYYYYYYYYY]0]0]0]0]0]0]0]0YYYYYYYaY]^ \YY^^YYY_$_X___`Y`H`p`Y`aaDYaYYYYYYY]^ ^<Y^X]^^Y__D_lY_`Y`,`\```aa(Ya`U@8#@6mU #af#ab䀢 ` _$bU@G#@@  &b䀢 N M$bP &P@ PGUC*"?"ab@ U߄#@m 4%b@bT . %)"bV l m   h  #V`(@!!@!*`&!x*`%! %!* c"@b䀢  $b@y"ba "ab䀢  $bb䀢  $b!!@ `*`&!F*`%!`%!*`" bА "b2"abT  %""b, "b,bH "bHaؐ "aa "a@EUb "b@x"bb` "b`ᤐ $ &ʳ 퀢?"b V 8@  {bT y&bTaĐ t"aa o#aa j"ab䀢 d c$bb$ ^"b$aܐ Y#ab T"bb䀢 N $b"bb E"bb䀢 ? >$ba 9"a5"bDb 0"bb\ +"b\b䀢 % $$bP &P@Ub@ TUb#@K ! %b@b@ TUV#@? !H%b@V XLb@5 "* "bha 2 "aV@ "@@ V "@!  ! 2V$ @  !  "@ V @ choose one of the following:-A, --catenate, --concatenate append tar files to an archive -c, --create create a new archive -d, --diff, --compare find differences between archive and file system --delete delete from the archive (not for use on mag tapes!) -r, --append append files to the end of an archive -t, --list list the contents of an archive -u, --update only append files that are newer than copy in archive -x, --extract, --get extract files from an archive Other options: --atime-preserve don't change access times on dumped files -b, --block-size N block size of Nx512 bytes (default N=%d) -B, --read-full-blocks reblock as we read (for reading 4.2BSD pipes) -C, --directory DIR change to directory DIR --checkpoint print directory names while reading the archive -f, --file [HOSTNAME:]F use archive file or device F (default %s) --force-local archive file is local even if has a colon -F, --info-script F --new-volume-script F run script at end of each tape (implies -M) -G, --incremental create/list/extract old GNU-format incremental backup -g, --listed-incremental F create/list/extract new GNU-format incremental backup -h, --dereference don't dump symlinks; dump the files they point to -i, --ignore-zeros ignore blocks of zeros in archive (normally mean EOF) --ignore-failed-read don't exit with non-zero status on unreadable files -k, --keep-old-files keep existing files; don't overwrite them from archive -K, --starting-file F begin at file F in the archive -l, --one-file-system stay in local file system when creating an archive -L, --tape-length N change tapes after writing N*1024 bytes -m, --modification-time don't extract file modified time -M, --multi-volume create/list/extract multi-volume archive -N, --after-date DATE, --newer DATE only store files newer than DATE -o, --old-archive, --portability write a V7 format archive, rather than ANSI format -O, --to-stdout extract files to standard output -p, --same-permissions, --preserve-permissions extract all protection information -P, --absolute-paths don't strip leading `/'s from file names --preserve like -p -s -R, --record-number show record number within archive with each message --remove-files remove files after adding them to the archive -s, --same-order, --preserve-order list of names to extract is sorted to match archive --same-owner create extracted files with the same ownership -S, --sparse handle sparse files efficiently -T, --files-from F get names to extract or create from file F --null -T reads null-terminated names, disable -C --totals print total bytes written with --create -v, --verbose verbosely list files processed -V, --label NAME create archive with volume name NAME --version print tar program version number -w, --interactive, --confirmation ask for confirmation for every action -W, --verify attempt to verify the archive after writing it --exclude FILE exclude file FILE -X, --exclude-from FILE exclude files listed in FILE -Z, --compress, --uncompress filter the archive through compress -z, --gzip, --ungzip filter the archive through gzip --use-compress-program PROG filter the archive through PROG (which must accept -d) --block-compress block the output of compression program for tapes -[0-7][lmh] specify drive and density --norecurse don't recurse into subdirectories when creating --unlink unlink files before creating them 㿘X@"X"!@GX!!Y`@ Y!0@GO!!YaV@Y"(@GE!Z!8@GA!Z#0@G=!["@G9!㿘l#p@` "l쀢`#h#hس*$#lؓ* $p`"p#h*`" too many args with -T option-rcan't open file %s㿘" %x#6\E!x@. "\@a 1 "c\"\@ta쀢  "c\\!g"@ "#d"#`㿘 @'? &@`& @?L∀ 2.`dD`.?  2.`d2`.&@Missing filename after -CCan't chdir to %sCan't change to directory %s㿘 'H  ! f$#D d$HJ" " #\ 2A#ct#p6x"ct #hc#d `"c#`*@g\٥#Hd `L - `L  C`L  `ˢJ@A' Ģ \#h cDcH\\"; $cDL @?@ L@ / ,@@8L@ L - L  CL  "  @@  \#ل ؏ 㿘#\` @@n Missing file name after -C㿘!܀ RcP  d"cP!@ |$#LB KL@ -%L` CLL` 1 "cT- 2]"@@ #L#T"` %L@$4 LR!#P@ (`$LR $#P!#L@qR#LR  * #L"* #L""x ""p @ Couldn't get current directory.cannot allocate mem for name '%s'.cannot allocate mem for chdir record.㿘N -3 N  C/ N  + ɐ !$#XŐ #X 2]ؔ"@@} #XJ / ֯$@Lܒ$ !]؂#@k @#X$#X@Ȍ " @@ ^]#h0e @N  $, 4  @q*  , , ,  , #X$ $ @O *  @I [  @C ?   , N * [ ?, "p 2"""pbx ""bxCan't change to directory %d㿘"x 2L    " @? ^"> ""x@- W '#)\L  "L L N@2GL   7  2=, ᰀ " @bx$bx "F @?p #  = T 4$N  /2 @nT  2, ᰀ " @bx$bx "  @?J #   2L !܀ !"xJ  "  q"xJ   %s not found in archive㿘"x`"""x#_J` @`}`2J`""x""p!܀  !_ j 0㿘"x "B @ +N  "N N L@2N      20(V 4L  /2  @V   2N !܀ 1"xJ  "  "xJ   can't chdir to %s㿘bԀ "x"b"Ԁ  1J` 1@ "1"Ԁ`" ` *`" " @> "_"#` "԰  x(2(Can't allocate memory for name '%s/%s%s/%s㿘@@@T 2 _#ֵ@ _c@y7%s %s?Can't read confirmation from user㿘!v!``X@@ï!z"" z"|   y!\@pa$ $z" 2z`y `@b "`? "`@ z"@"@ 1z?"`? "`@  "" ? y Y 㿘Վ@q!z"  %]$"$@"a<aԿ"aԼ#4"䀢 P!Ƞؒbޖ !@9 a#(!0 #@  , J!• %a̦ M'z "c!"bd%a#e  8Ӓ b䀢 @,0?Q 0can't open file %sread error at byte %qd reading %d bytes in file %s%s: file shrunk by %d bytes, yark!8@˒  b@͒  b!ib @"b`;1"@6@a >" @"@Ơ6?b<`Ț@ c !  :@ $@! >΀`b!@@ƕCan't allocate secondary block of %d bytesDeleting non-header from archive.㿘  ̐ '#(P`"3 2`"- ,؀    a" aӨ"aӥ#=!Ȓ J!•  *` Āb 2"b!z#@bh $#b#hzbh@c z!b " : " z"" "cz# @ˆ* ![""J!• "Ϸϐ#,)1/z35z+z-z!"@ %`"H ``c *   @* c  %c %@ 0 b"#b!!Ȓ#c  *`b#(aB  "@b  " : V$ %"!̐" : ", !̐ %!* @b@"c  %c ?%#(aB  "@9 b "@F "!̤"@< 4!"@o %" %!"4c * ,` @!@הc @%c "@%!̠%!̦$`$@ !S"㿘"| z#@88z "cz#" b|  "b|b| ""b|zc  "" "| z@#zc?"cz""cz"# Couldn't re-position archive file.㿐  7' 7 '"| ? aF "| a@ה 6W  $#܀ "| ? a. "| a@Ŀ = "| ?   "|  @Ö  @bh"| <? : d <"|  @Ģ 2d@ d!@ϐ 㿘@*$Id: chown.c,v 1.7 1995/06/03 07:01:19 jtc Exp $HLPRfhthe -R and -h options may not be specified together.%s: %s%sfts_read㿘@]#d@@߰ /  @$#dJ  o`?"ch   /de + )@㛔؀?E? )>*  Ȣ  Š    %cl%#x @#0*`& @@#l    d@3c2 `? ?"ct"p#h @@x) . 2 *@@x# : *@j @@`@d@`@+   @3n e#(%e@,ĐD $ 4? -* \#l @-ڔ 0 @j @BA   @j @B8͠  cp@8Lt #x e @B2  #܀  e@3`(@group㿘N "#`#t@)F 2 f@"`@$$user㿘N #p@ m 2 f@ `$$%s: illegal %s name㿐! $$#ܐ@ٔ #܀  e` @2ԔJ  f`@2 usage: %s [-R [-H | -L | -P]] [-f] %s file ... [owner][:group]㿘#d#h "ff! @!hfa@@( 㿘@unionsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevlocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%ldsignal mountd㿈@J    f#(g 5 # $/f@ᗔ0?k? 8d* lllllllllllllllllllllllllllllllllllllllllllllll P\d  &cJ@ "f@v { f @1c@@(cc@% ?@f#0&* @ Z   0{01@/Gf @Rch f @Lcp f @Fcx @  f @Œc    `?#\@$ 2Ԣ 0@&֒   f@1=c. @@ < " @.@ &. @{ @@@@h@ ' fc@1@@/f L2&  fc@0@) L@/Y@2  @/?@2  fc@0@f@ْch f @Ӓcp  f @͒cx "  g`@0@ #\   2 #\@g@g`8 g @#\@` @@`%@5V  g Hg@h``g`h@ᣔ  @ے ?  $#܀  g@0`p@m@,㿘N@ n N` o `@9 'h`? @9@PJ@ n J` o  `@g "  @g " @ /usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdateexec: mount_%s %s vfork%s/mount_%sexec %s for %swaitpid%s: %s'T'L\L@ݢ` `h#@`'Lh#P  O@ f#ph#P@9 @ؒ'DLh@cX  @'%L@3h ҰL@7 Z T@/  # ƒh#p h@pc Dh@c'DDf@ch'D@Dh@c'D'\T'h '\D\@h\`'\*`">p`'\*L"p*`@"~p# h#@oT \h3h, @c@o~p \, h@o#o @7I?  {0-h@>#@%D_ !L`7h5 $3h$@T@.h܀ c@>oL   $#܀ h#`@>aL@א @DX@>e Xh@>S#,  X>  0#   " @ h#@>0L0#  L@3h h#`@>,L @h %s on %s type %.*s%s%s (, %sunknown flag%s %#xs) 㿘j @  L @o3 Ds #L$@ ,@}"@$  ?"c}"P" "$}"@ @D !#L@$D@Z#LD $D OD@^ "   !!D%}D@m"#  #L$D}"L?2: C # D}@"PD#L@$DD#L"@ c @$DD#Lp@!Dfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflow㿘}"@ #L}# bD@q@Ր#}"@  }"DcL" } { "DcL" @ } . `@ }"@ $ }A"#"@ "`-'}%})r@D "   "&  *` 4 2` * &   @`&   @  $D@ "?`@}"@ a"a *@ ###  `  }@K"P}"@" $@ "}@ * @` * @ "cL㿘}LL}DJo4nppnpp4N(  . P . "c"#P(Pppn. P . .`. P(P. . Pp(P}D*N}Dn*`P   p*`P pn(P pp4ppn*`P ` *`*  *`P (P *`p*`P p(P` `  flex scanner push-back overflow㿘}"D #,}"@"#`  @ @    @*"@ @8" @}"@` "` s@ ?,"#L *c}""Dunexpected last match in input()㿘}D #*@DJ <}}"@ c :0*}bD"L j"bD    }!}s}@y }cL""D?# }}@"P}cL""D@&"}bD *bD"bD *㐁㿘!}"@ }}"P@B$"@}"@@i@㿘}@  }D #*@@D"`#"`}@""@ "c}@` }` D"#L}@""P*#out of dynamic memory in yy_create_buffer()㿘@א (2& t@Ɛ `& @ΐ` & t@ ` & @㿘 }b@""b@  @ @㿘@& ` & @mV` 4  & & 㿘&  * *  &  & & $}"@out of dynamic memory in yy_scan_buffer()㿘` @J 2 J  @l (2t@[!ؐ& & & & & & &  & & & $G㿘N  `N 2`@out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()㿘`@. t@" @ @ , `@& @* ,2 t@# & %s 㿘!htc@@ 㿘@Y㿘@ޒ㿘@ɐ㿘}"P㿘a p"`@Ld"` $ #@h = " @Lޒ   㿘""" x"#"d "" "b@!"!,""!耢 !@A?!耢  "` "`! @x$ 㿘@@z""@!~?2`" H ~"ؑ*` ``* @2@@AL@G!` @  !(J@ "*@`@ *J@@M㿘@D!#@us 2! $!!@0@,.$!?$!! 2`t+ 2#a $aa@, @,$@1@+ $@ *@, $$a?$aa  t @t㿘@ "1 #'@u!  2$  *a $aa$@ @ @ѐa?$aa  t  @B  א 㿘a "aa !ȑ,`  "@ @ @ ``&,`!"!!  t @㿘@ " @t  2 `    alias %s=%s alias: %s not found 㿘   !#v,  "  J@ a@H  2   &, * `@ %)'v%v @g4 =2*@  Ȓ@Hy  @H ```@  a㿘!v@3="Ȱ a\ 0 h  ! h h`$ h`  h㿘*   : *: @ N  @ '* 1!ȁ^  t G] d_d HlHp c٨lްިޠސވހxph`XP H @ 0 (    ݸݰݨݠݘݐ݈݀xp ulimitaliaswaitunsetunaliasumasktrue:trapshiftsetvarsetreturnreadpwdlocaljobsjobidhashgetoptsfgfc-hfalsereadonlyexportletexpexitexecevalecho.chdircdcontinuebreakbgcommandHOMEHOME not setCDPATHcan't cd to %s0 @25 | h 2 Lw"@JՒ 2Lw@"L -2LL  2 L#0  }# L /w"@J  ' |''<%@ ""w@]  2`N .N  /" @s@ ސ0"@t docd("%s", %d) called %s 㿘x `@Aݔ!! $!!@&0 !?$!! 2&? t !?@t@B!"!!  ` t `@` ~J" x~ x@Fb  / `"HH/H2(  ...㿘@ !@m@)X $"@ef~"~" "bN /#}# N "N?#b? $b@*, N  N? /#b "b?# /=x@rPa 2N~"~"b $b?L /ꀤ b0 x@r6a b? $b@),N Ҡ b? $b@), N  0~"b? "b@) /, " 2,@)*a "aa#0 @!}# "c0~@("$# a?"aa  t @ 㿘@1}@E+#  `? "`@EM   @"@ * getcwd() failed㾘}#  @1! y@-!0@(t}"c -n-e㿘  `@ y@qa  y@qa 2@`@ `y"|# .  :` \2t`Ā"q` ?Б* :  Fh *         L?Ѐ  . а@  L?``? "`@D `"* . `{ @ "@``? "`@Dn `@"@ *@ ``! `? "`@DY   @"@ * 㿘#\ @""d#\@ 㿐!  t`" t t0" t' @ !؀  ~J" א 0@r %s: %s㿘z!@error("%s") pid=%d error(NULL) pid=%d %s: 㿘'H'L'P'T'X" ta "aa  H@z!@?c @z@?[" !!䀢 z@Dgb @D1 `? "`@Cΐ   @"@ *@D u P 8(Ex`P 8F < >argument list too longsymbolic link loopremote access failednot enough memorytext busyread-only file systemno such device or addressdisk quota exceededfile system fullfile table overflowis a directorynot founddirectory nonexistentno such fileI/O errorpermission deniedinterruptederror %d㿘z##h "!{#@>`*`| @t0 DDXHHHHHHHHH Β " wC  Ē " m" h4   " ^" Y% @j  @9  @:8K@*F  " >" 2   "0@F,@(@ђ# @ % "" l b`?"b@g@  {#@B@BF #` `@Ag` ~J"݀  " `@A"㿘`x "`x !#% 0 " ""  b? $b$"" b? $b$"        "   x" x""㿀@%3'  '%#$⨐@ ܔ b ;  """`x "`x )`x%#  @D  ̒    b? $b $ b?  $b$ 2 `x?"`x@$㿀@$'"" @    $"  #  " @`  b  0     b " @$㿘 `?@. @k @4  2 @7  Y` !! $!!@1"b!?$!!  t 㿐 &%#'b$    @   & 4    @  `@0U   2'evalpipe(0x%lx) called Pipe call failedevalpipe: job done exit status %d 㿐}#h@<    !`"!!@   T?%@ ?'  @" 6@S}n# @  /`?$  ` t ` `$ @6 @8 @1 & @+ "  @% @8 @   `&@@ !"!! 2   t "   !! $!!@[""}@;#!?$!!  t evalbackcmd done: fd=%d buf=0x%x nleft=%d jp=0x%x 㿀@#?&@&`&` &` ?""  b"" @f02""@" 6}ѐ#@5 @  "! t @ " @ @8 @ @&@&` @#P~"(@``@;` evalcommand(0x%lx, %d) called evalcommand arg: %s PATH=%s: not found Shell function: builtin command: normal command: _'H'd~#@:@# ''b""b  $ "a` J@  `J@  2`J@ =@  @    〤`""_ 'p p 'p p @"~* 't t#~c@: t 't " ct"'l~J"  #  pp t?'lp*`t" 't~J# _! `?  "`@>   $  +*`"` +*؀ "#  `? &`@>ݐ``$`*@@>  2` #  `? &`@>Ő``$`*@@>  2`! `?  "`@>   $  *`"` *@> p  ';'#X؀  3~ c@r  2   2 tȔ @6Ȁ?  ""@>ɐ 02  t@ '̀  t 'tp? 'p  Ȁ H " ?Ȁ  ̀  7Ȑ@ H    @ sЀ 6}6#@f  H "! t @Ԁ " H@ @6m @H 'HȀ 2@9 @:t @4ɒ ll'`'`'` '`'*`p?"lt "`"` a "aa'|"a?"aa   t @  "d !@( 0@( "l"l$"l"`"`"` "`@C|"c"c\@y #\'"#\؀ " !@C  !# $# #?$##a $aa@Cn|"c!@'ΐ"l"l$"l"`"`"` "`@5"c\a?$aa   t b=b H"b""H l@="l 2@8 @9t̐ @ H 2  "``" @"`   @4 !'"c?'x@ "d'x"x   "@c\'"c\t@"`"h"!v#*€p@=f"b "` @="`x  "!H @<""#\x?x  ̀     x"! t ̀ H@4H _ld# " # S"@8[ 0@9Lt@5 @3 ؀   @@7  2 @@#Xt@5l) !! $!!@"b!?$!! 2#l t l]l! ~tc@= "b@<ܐ0 ld#@ad# l` H@? @ 㿐   @2    cX  @㿘@@/#"㿘  @#` x@4` "@J c  """ 㿘 @#`"#   "b "b  㿘 ~"* @%A* %#   @?  2 @@M`#X@  㿘'L@[6 / @( $#ܠ %# $L@;8  @c܀  2@bL 㿘@b $#܀2"#!@P @@"b$!@%͐`m  $"#܁㿘 2O  * :  $ L  :`%$@~"  ~!~@b" ~ "$@ܔ@ /,@`@Zߒ"a8L % :"a8  `:"LL  L :2&&@rv㿐 !@&  r v@a 0"`0 h "$ |E" "  @N  *03 h /)}'%@ XV    #̀ @X @Ŗ` ?@ @@;Mh`$h` ؐ builtin %sfunction %sinternal error: cmdtype %d㿐V    #X '- @e@:GN 2V "H@;g ?N 8"X@;^ `"5N a "aa@ 3``? "`@: ` @"@ *@:@!"!! 2N  t " N [N "hV N ! `? "`@:   @"@ **! `? "`@:u   @"@ *builtinfuncsearchexec "%s": no change %s not defined in %ssearchexec "%s" returns "%s" %s: %s 8'P@Y / &@&`@ƒ }L` }#̀ `@!! $!!@  4`$``?T` 2`}#̨ ?Pd`@!8`@!E @!! $!!@  4`X$` @!-a8 ِPL /2 4  @5We,` @|   $#܀  2P<   !8 "@)@ @j@D T`  @94,`  ؒ@5 !! $!!@) 4`$`!?$!!  t ",` W,` @b !W  `@: ?&@,` T`&@`&`㿘w , , "?JN@2   @e 2   2?$ |} " P2̀&( 2P  *㿘#X  # ?)LN@` :" L :N N  %2 N6 N @ K  2N :"` ؠ }c̀ 6}6"c}#̀ & @}"#́㿘a "aa"$`|@&%}"@`R`  `6 @R` 2  ̀& @$@ `2R``@*@!"!!  t w㿘a "aa"$|" T  2 $@@! @ܐ@@ 2T *!"!!  t B㿘 @*   : J@`J@ 2?* @ * b$    @dޒ `  `$ 2#!! $!!@@y $&?6 .  @W!?$!!   t "!㿘!! $!!!@g"!?$!!  t 㿘a "aa V  2`@  `6 `& a?"aa  t 㿐!! $!! '@_'В!?$!!  t 㿘S   R` @ G` 㿘~"" @  ~#b @:?" 㿘 "b#~"$c!~" $""""#  @e``"? $"c`$c*@@ "*~" b@Ԑ"#`@ $ @0 "$ `@@@@ " D"@"D" 15#! &!!@&!?&!!  `t " DD"``"D&`㿘`N ~ `@%#)N? ?66"?"/n?`[ g :?-0Q. =-M?? $c`$c*@@ $c* ? 9$0<@Œư  @'"%"@? $c`$c*@@ $c*`"N ~2 =2" @? $c`$c*@@ $c*HOME㿘` @,  `:` /". :?"Z 2 `2 . , `:`.L`  @:z#"B. N@@` ";. N@ 6.@, 2` Q%#?`:`J ? $c`$c*@@t $c*? $c`$c*@@e $c*@, `ٲ`0missing CTLARI (shouldn't happen)%d㿘"  @e"cb?"bc"c*~"c*L@L@?@L@?@ !8@ L?  @* : ? *`: ?"``L@? @ `@<``Q @6`L@ L@ `c"" "cb "bexpbackq: read returns %d evalbackq: size=%d: "%.*s" 'T#~"`&#I"Aa "aa%'X '\ '` 'd)# '#~b?$b~" b@"@גX$\$ `$ d$ %# $$b8 h@F ܀ "@0 1?h'@,`:   `N bb? "b@u?. b? "b@i. ? '耢 6% $`  b "bN@ ?耢 &@쀢 "@q T@g"bT ~"& @ ~"& "# @0 "#a?"aa  t %s %.*s: parameter %snot setnull or 㿘 ~b"?"b " @"c#*~""""~"``#*`@'l','($(l(@7 c'"cb" `"b,N?  b8@55 &`?"` |"@l g L,@4 F, *LX  T L,@" 4,?:LF  B @ 2?6 1 @ 2   $ @c$"cb" "b$ &@c""cb" "b   /    㿐 'N  Nba `?@ST = `@N @8 L     #~c"`_"@`\` N @ ` S`c#`@E"##I"A` 2 L 9` L 2` .%#?􀠠*`: M ? $c`$c*@@ $c*? $c@ $c * L  ``?  N @ "l `  ` c $*`@,d,,-H-H,,,,,L!@#$#N`~#b" @ D``:+<``8b? "b#"# *@i "*~#b " P `` A ` ``@`" N  `| `"N"    2N2N* :  !*`~P 8@* t    t 㿘?߱. > `# *`@/3D//3D3D3D3D3D0\3D3D/3D3D23D3D3D3D3D3D3D3D3D3D3D3D3D3D/0P "h""l~R !@8#7$# ~"%#, J ? $c $c @ $c, @ `*  , 0  "t  %1?"CL`#I"A ;*`: L@ ? $#`&#*@@g &#*? $#@[ &# * L  ? $#@H &# * L  "? $#`&#*@@/ &#* 0񀦠7"`#I"A %1?*`: L@ ? $#`&#*@@ &#*? $#@ &# * L  0pL m#1b? $b#@ &# * L b0Xϐ T. bt: 7@`#I"A C%1?*`: L@ ? $#`&#*@@ &#*? $#@ &# * L  0L #1b? $b#@ &# * L b㿘# "@ # ""# "@"`"`"` 㿘# U" !`  |@Pq 1@ ? L @Pf "'@` ,@@r "``"&``? L @PI 2*L*L2L `  @C "``"&`㿘 Z%#' 0 @~J"倢 <D J@ 6` * ? [ !2J@Da $aa0  @' g( @%@0@0 @0$0a?$aa  D t DkDDD"@  $D"@$@ 2@%  ~./8  J@ * ? [ !J` !``J?"J / J ]? 2J@J` !2 J@@"  J /" J@ ?"`J@ /2Β`'`Ȓ`! 02 J@?"` @.J@  ` 0@r @ 00 @ J@?"` @.`@   0  0` J@ /  0.?@[ X 0 /.?L@   ,@`L .  ?L . t 4/ /@_ -N` .`"`@v " @O)@ 0`*@` *@ `* , t @\  /,㿘@@ @O@ " D"@"D㿘 `@㿘`)'D>` D?$D&@D @[  6 &@&@ 2 &@@ 2 &@D㿘@㿘N *  * ?? "N@N@ ["5NN@N@N} N@`r N`?`*`[@* :   *: `N@ @Œ "N@\  `W ! J@ E?"``J@ ] N !    @ ` * : *: ?2N N -*N  ]* N?" *: @&  N@$  : @" N ]ڰ  2t  N@*: @k` `? (8"  J H"(J"  ( J(㿈@/ "b#~"$c!~" $""#  M "? $"c`$c*@@ "*~" b@"@x6 /?@  0,@m ` -?,L 1"? &"@_ .@ L `sh: can't initialize history rwsh: can't initialize editing viemacs㿘~J" #aĀ $~!! $!!@?$a!?$!!   t !Ā @~@-֐!H~#-J#- J P#( M~@! Ga "aa!# 2! @]Oah$#!#  @]Eap$##`!#"@G^"`"#(!Ā  @G#( @G@-!x!"!! ~#-J#- !J 2#c(`!! $!!@GR $c(!?$!!   t @#(`9~J#%   @Gf0/~J#- +#( @G[0$!`"!!!#( "!@G$#(!!Ā "@>$!!"!!  t HISTSIZE㿘!Ā @1'!@  dJ@  @?4  d!@?Ӓ history not activemissing history argument:e:lnrsoption -%c expects argumentunknown option: -%ccalled recursively too many timesFCEDITEDITORed-16-1too many args%s/_shXXXXXX/tmp/can't create temporary file %scan't allocate stdio buffer for temp %5d %s %s8'D'H''''''!Ā 2D蹐!D 2 $貐! $ " "#0# # $#0H* @ @ bDH@ܔ?[?Ƒ* :  98Q* IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIHIIIIIIHIHIIIHH"'''''!F`"B`Dc0" 'D*`H@'H " ' 2' "L'/@Ѐ ~" PO "@f"c\@ؒ c\'̐"c\~`P  "`P"`P"!"0 $ "X@0   '"`@0  '"h'J@ - J`  '' D H@K ='H'`'*@D?'DH 'HD H  ""H ""p"x '@' @"x' '矐"@* @&     "a "aab@F>@fp"u@Zap '@Ni"!!@> !Ē @>>%1   "@+@@+*`%@`"``@b ܀ @+t܀  !Ā " @ @=@@@!@=ے "*@[@@~@h b@EΖEa?"aa 2  t @ @e^  ~`P ?"`Pa܀ 2"a܁ 㿘@K~"~" "b 3#*`: N@ b@m bN? $b@, N b .@? $b@,  N " 2,@*~" b@ "㿘 2N  -" @`?history number %s not found (internal error)history pattern not found: %s㿘 !@=! L@ + -  @Đ 1@   ~J" 0!* @*` @ : J "J  @g ̀`%d㿘@4` V` #!`. `@%R  `? "`@%P  " V`   *V` &` No current job%s: ambiguousNo such job: %s㿘2LR P   , *  J? !@, . ? l %DL?Ѐ 8L@ ]Z!W , *  J? L?O %L  !?  'N  "?V   @ ` `PԒ? `#0&@ - @  !? N  " ?V `*` @R  ? !`਒ makejob(0x%lx, %d) returns %%%d 㿘! %!#<SN  $! !@ P&$``*` @* !* `@ѕ* !`!* *  @"" *@`$`!* @*``@ !`$!`*` * *?$  t    a "aa.  . . 6  K`. @\.`& & !"!!   t  &* *** :#@{forkshell(%%%d, 0x%lx, %d) called Fork failed, errno=%d Cannot forkChild shell %d TIOCSPGRP failed, errno=%d /dev/nullCan't open /dev/nullIn parent shell: child = %d 㿐 &* @*`@*`@*`@ "(:`@3!! $!!@` $"P@#c!?$!!   t "dߚ"h`2@qq@ "x!"!!?  N` "??`!"!!  t 6@!," H)~J" % V 2 @q6'R' @􀦠   `v@  $"Ec@" @" "@" @"  V @d @  "@e  "Y~J" U@!ؐ @!֐ @!Ԑ 0M!؀ ~J"  " 'V 2 'R'@􀦠 ~2   6 * :   2 ?4  |$ ~J"  !؀ `@0$ !"!!   t ޑ"@>waitforjob(%%%d) called 㿐@'a "aa $@* @*`@*`@*`@ :`#@`L`@L`  L`   `v@e 6L` $"ދcL` 2T`  $@ *` *  *  *  :  2PT` `*  ?* :  2 2  2 <   L` {" t  @p3@p) !"!!  t dowait(%d) called wait returns %d, status=%d Changin status of proc %d from 0x%x to 0x%x Job %d: changing state from %d to %d %d: %%%d - core dumpedNot printing status: status=%d Not printing status, rootshell=%d, job=0x%x 㿐!@w#! $@a0@m?#܀   a "aa !*` * @i /+-L` W `T` * ! T?2 T PT @<4 T ?2  "  T` * ` *T.  L`'`$@ *@ *`@ *`@ *`@ :`!` @ ,`UP`$@ *` *  *  *  :  "5P`!*` * ` @*L`!"!!   t .!؀  ~J" `po ` :`'  \' Y W a@!Д !؀ ~J"  &@* *** :`a@!` !`*`@ "@   c@! @ !! `? "`@!   @"@ *@!I 0!@g0 !a@`  . 㿘   @خ You have stopped jobs. 㿘~ ؀    @ "~ "`  ! !J` J`  ` 㿘!@ې Ȱ$ 8 "`<@7 8*; && || | ()if ; then ...while until ; do ; donefor in ...case () ... >>>>&<<&<<...???㿐 ` *`@y zyXyyyy y4yyzz@z`{z{{{H{({8{T{{  # # #@ 0  !  "@# 0@# # 0@# @# z#  @z @u  i @m @k a (@e 0 @b X (@] S 8  " #t  " @M`@   @1@C @b  803  H  P   X  ` h     0//@@?퀢   0// 0 0 p x@}-+?=㿘<U 8.`L  $9 { } .>.`(+ 8`=( <' <(N  .`( .`8`| ( <' <( < ' <(((.`  8you have mail  "`  l@## 2`  d '  U"# V`|JJ ? `J@ 2`J /"*@lT @a ,   ?:   2,   2, !8 !h@``? "`@͐ `"*, "@  " @`Shell args: /etc/profile.profileENVH'@''@[Ѐ \"d  "b"d @lj"bh "a"! '0  ~J" !؀ @& "d ! `? "`@k   @"@ *@ @"! t  /  0  "I 0Y@"c\@̐#X@@l "bhԾ"!@ѐ@  J - '@#h '@#x '@Q@ @j@2 @"#  J@  '@  '! "~.~J# ! 2@ @" cmdloop(%d) called Use "exit" to leave shell. 㿈 "@H@m!,%~'#` ~@@~J"     .  @ @ @` '`1% 2`~J"퀢 @}"`~J#  ؐ `?$آ   @3ⴀ $@,㿘!`"!!@`H &7 !"!!   t  +  Can't open %s㿘!`"!!@` &   C!"!!  t _ ^0#X '@*@@L ` ~" $? $+, " 2,* ~@b@) `@  !@ |@  `@  |Su=%s,g=%s,o=%s %.4o Illegal number: %s㿀 !@@" "! ! $!!@E * 2 @A!?$!!   t ր h 2UL`M!  r/   @  w*?  x*? *?   r/     w*?  x*? *?   r/     w*?  x*? *?"@05"@00bؐ  # ?А bP`. ?L  L 2 . 2 @ 28";8@ԗ a* 2 8 !@ tfdshcXm@l(pnnofiles(descriptors)process(processes)locked memory(kbytes)memory(kbytes)coredump(blocks)stack(kbytes)data(kbytes)file(blocks)time(seconds)HSatfdsmcnplulimit: internal error (%c) ulimit: too many arguments unlimitedulimit: bad number %-20s unlimited %qd ulimit: bad limit 㿈   f1@"  S"  a H" " !l!l " N "  2N  "Ձ h@@ `@ ` "p"@Ec  !#?0,  L94`,  ,`@B2`* @ *`В:  B L/D#  : @9 3!l!l a+#% @而2c8@2  2 @@ : @f  @#P 2 04 @ޒ耥`2?而2? @耢 $#X0 2#2  2 @|#@0: @fg @n#P *@ `4 *@ (8J@`  J  Illegal number㿘@  #hԍ@*JЀ  J      㿘 #$c@!$!@c@!@"c8c@ "<@l 㿘 R#*`R@@ "@`F ԓ*`@4<L44444X44h4X"  ! @# 0  #a @p $a@ #a @p $a   㿘  !#@ $#@  #@㿘 [ 8#*`R@"8`L"p*`@$44dddPPddx ($  $  $ " @& $   $ @3 $ @ $ @,  $  $   $  $  $ $㿐 #c8$c8 $c8 "` $< *@ ` (  < 㿘@nounsetnotifyallexportnoclobberemacsviverbosextracestdinnoexecmonitorinteractiveignoreeofnogloberrexit㿘 "`h`"`h ~"ؔ *` ``* @w  h  1~! N"~"ؒ * 51~N" "J` ~@}]  ~@}X   ."~Jb b *b ~"ؑ*` J "*``*`@#"~J# 2! 2 `h"`h#""  h"bt  l "lh`"h` l@㿘~"@lJ"cL Bad -c option㿘 "! h`_%~")-h $hL@ -`L@    -E L` 2@L@ FL@ h-`E?-`=@ ;@ 07 +h?2$h& c o h`$h@ ! "%!{%! oh@.h@ "L@`$h@]L@ ڢ` h`hCurrent option settings %-16s%s onoffIllegal option -o %s㿘   @   ~"1%, J   @Ȑ  , 0@J @0~"أ, @B@   $,  Illegal option -%c㿘 ~"ؑ. : * J  2 `* V E +`U" +`M0 *. !:`㿘  `,` 2``* " $  $!@ "l"l *`$"l"`"` 㿘N    @~  @~ can't shift that many㿘  `"lѠ#Xa "aablbl""bl? 3Nbp "?@}? "t"@  `""xa?"aa  t 8 㿘 @  "a "aa  h@ l !"!!    t Usage: getopts optstring var%dOPTINDIllegal option -%c No arg for -%c option OPTARG㿈 $!bx bx"bx""| L 23 "x  L -2 ! L !"x"x?": 8@!@@" $"xQ "l `" L -2 L   `  *`:`,`: @ ,`:`J :"J  J :!L "x 2 ,`!`!H@O:`  ?"l `" !x@ڔ  ""|//`@є  No arg for -%c option㿘! L 2  h "P L -2L  L   h`" hL -2 L  2 :  *`:`,`: @ %2 a: N :" N,`:@N  :L  h" h ,`#A:`"" "!,`> xphXPH@80( "!""esac""case""}""{""done""do""for""until""while""fi""elif""else""then""if"wordredirection"`"";;"")""(""|""||""&&""&"";"newlineend of filexph`XPH@80( !esaccase}{donedoforuntilwhilefielifelsethenif@=}-+?=㿘" $   @ (@"   1 !, a, "a,@  㿘  "b@aHJ b  @a@` ?  $    $  "@"`"`   "@"`"` ``` &$@`@n0a, "a, @"baHJ 0#D @V(2 @ i?a, "a,㿘@+%@`` ,  $, @T "" " pipeline: entered pipeline: TNOT recognized 㿘 @^"H!@b @V"``?a, @A"a,@T $  $$ $$` @,$`@>$ "$@a, "a,  "" expecting DO got %s %s Bad for loop variableinexpecting "in"㿐 "b' #@  a%@@^ 0a, @"a,` D*`@LL4ppppLpppLpppp@ppp   &Ґ @&  @ ɐ &  @ 2 $ $ @$  @  $  , 2$  $ a, "a,@ % 0!u  ,   & @& `!d` *` (##x@ | @N z @}&   0@w  " 2@ ( @]#:  &! (@^& +" ' (@>Xc ! '%@L 2 $@ $($ $ $@ &  ,? @?  $#$ $ $ &  ,? a, "a, @"b    @ې? @ & 0ِ  @& @Ȑ ΐ &  $ ($ "$ $ @  ,   (@=c  @А#  @"b /-)  $ $ '$@"@("`"` @%" @ 0"  , @|  $ @%"  @o @%" , ˠ$j  & & @&    0 @  @M "b @C?a, "a,@($@8?#@h a%@@ 0!,`"!,%@   '  $$ & 㿐`'HH' )#%@; `,  $ ($ "$ &@  `,!&@{ 0瀢 , @, @  @ސ  $$  $,&@&ې  $$ $ H$ 㿘ΐ  "" `(" b" Fix redir %s %d Bad fd number㿘 p@ ֔"& N@?Ѐ`  -N` 2N@& - N` ? & @ 0& Here document %d Illegal eof marker for << redirection㿘@! "@o? 2D""  $!8@ `  (J 2 !( "(J  (!@ (  @h` (  O!@f!P!< ( ($`$@cD "cD#D@ 2@"@?퀢 `(s 0W$ 㿘#D .%#+) D$D` @G $`  #I`Q  @{  "" `(" b"  "` #D D㿘@,`",keyword %s recognized token %s %s reread token %s %s 㿘"!,@ub Q 2  "b@f  0"" >" 9""Ā #`(JJ@2   @;ђ "  2 ( @g  S"""Đ$:  "`,ad. #@  ""!d .  (# #!d .  (# @  㿘a, "a, , "`,  "`,  "`, 1  @x & ~`"!'%+#~)! ? $ `$J@G  ? &V ; "E` ?I  m #0fT ; \ (Y )[ \ |=0V ?  ` $`%a $ @  @  3 $` $"` $ ,0 $ ,- } &u傰  #$ ,s |ox  $ ,i ;in  $ , $ ,  $ , bA @ Missing '))'Unterminated quoted stringMissing '}'Bad substitution'H'L'D~ "a#I@' '''P'''~"'~" {"b" HN'HJ` " *`@@4D\ŰĤ,´"AH@b?"b`'*@~` "` $   @l?L  b?"b`'?*@? b?"b`' \ $ @? @;   \ ` $ "L  b?"b`' \*@ QN  b?"b`'?*@b?"b`'*@ p' Ql'H#I'H f'L [ !Y"A'H 'T' H?'b?"b`'?E*@ 9'  b?"b`'*@?2'D )? 'b?"b`'?*@'H9b?"b`' )*@ ' Hb?"b`'*@b ? "b """JrH!Y@H@k!H"A@ ! 2 L 2@Z! ~ "a@P!0b?"b`'*@~"'L "@ > <  J "c?Ѐ 0] "`, "bP"b"`( "`, L D   L LKui P nLK    JJ@2JJ J J  ~?` "` $L"`@dȐw E ﬐  > Y$  > & +$&  &$K$  < & $  $1 &";"  -"  "` ""   $$3,`:  ?$ d"! ( {"a  (b?"b`' $*@ (  ("'?"`'?*@~""@?"`' *@ {  #2   }2  #"a 3"ab? &b`'*@ '* b"a @!@b?"b`'*@b? "b ' =* ' % : #33ᆴ 3c@*c"@  #  t w 2 ~~" J*@ F'!'<@ X  @s"!T"c\@ a "aa'!~""@ c'"@rc\'TX"c\a?"aa   t  w~"~" "b#5~'3 \` @ $` \  ` 36b4b<  \ &$ @l `@h ` ` $  "bb? &b.  &$$`b? &b. b? "b. 3~b&  Pؐb@q⇒ P P 2 $" "a $'4" $  4 " $ "@ "  ~"!,~"  ~!~9" ~"'!~" $" " @q'""$"!! $!!@r'!?$!!   t <"!T"c\   bb?"b`'?*@?"b`'? *@  'H'!Y'Hb?"b`'?*@b?"b`' (*@ ( A8" H 2  (  Ja  a(8  J  %s unexpected (expecting %s)%s unexpectedX  ,!d*.  @  @ \@ 0  ,d+  @@@ P @ %s: %d: Syntax error: %s 㿘!䀢 c@  c@ y 㿘" L#( @  @ LL"   #T H  Out of file descriptors㿈 @?*?``/g  ?,   2 a%"a耦 AO'+~`, ,`T?&ἐ $ἐ@f ?4@sἐ?$ἀ  ? t ?? `!`@sԐ`c̐ %c̐@#  ǀ`O逢  "`Oꀢ  "`ȁcannot open %s: %scannot create %s: %s㿘 a "aa.@?`Z#P*`@lPP،، @K{  @ $#w "ğ@=@@sz8 &@Ka!@ $#] " " @KQ!…@ $#M א" &N@   .@ @ @Ʋ@U!"!!  t Pipe call failed㿐 @~ 6A  2  @`   `@ ”0& `  !@s  @U̒  @Uɒ  @Uƒ  @UÒ  @U  2  `@ 0R@`` @r㿘! '~, R ? ̐?$@r֐, T` & @A@rT`  $, !! $!!"a@p%!?$!!  t Ö~̀@ 㿘!耤`? , R  &, @r,   2 @` 㿘 @B  $#܀ "?showtree called 㿘@$#  @; && || | &㿘 j@`M p*`@ܐ݈݈݈ܜܨ#    ݖ@>  Ֆ0?@L`:? ,&1  " !@:  @2   @ހ`` @T`? & & * @f>>>>&<<&*error*%d㿘   % `?`"@ `"*@@< @i    V #4#`2!?`"@ `"*@@ ? * HxXh߄! ! !  """  @Tb@낒?퀢 b@T   @    㿘`"  @!L @kÐ!@S   $ # } %`* : `y *`@p娰 N`?`t&``@u 2o@r `?`&``@ $@`&@*@@ꍒ`?`&``@ {@ &@ {*@| N 2`?`&``@ #@`&@*@@g =*`:  `?`&``@  @`&@*@ @MN =  `?`&``@ :@ &@ :*@5 ?` "̓*`@ \<`?`&``@6@ }`?`&``@ -@ &@ -*`?`&``@Ӑ +@ &@ +*`?`&``@Đ ?@ &@ ?*`?`&``@ =@ &@ =*`?`!&``@6@ #`?`&``@ #@`&@*@@鿒`?`&``@ #@`&@*@`?`!&``@6@{ %`?`&``@ %@`&@*@@閒`?`&``@b %@`&@_*@ @ Z `?`&``@N }@`&@K*@`?`&``@ $@`&@*@@d`?`&``@ (@ &@ (*@S`? ~`?`&``@ )@ &@ )*N`?`&``@  @`&@*@ @+ N l㿘 ? `2@骒?`&@ `&*@@ 瀦`㿘"` ?` "@ . :  `"*@@ @i"㿘'H'L'P'T'X3b  H@S$@# @ib㿘!"` @S@# @i"㿘"`۔ ?`"@ " " "*@螒  # \*`: ?, Q ?' v??" e@? q:  "   n/ \  \) t r " Vb?`"@ \`"*@@X b?`]"@^ 2X[  ^*`: b?`"@ \`"*@@1 2 b?`"@  `"*@ @ 2  b?`"@  `"*@ @  b?`"@  `"*@ @  N S"?`"@ " " "*@֒ 㿘" 1 +!    "?`"@ `"*@? "`"*@ @祒  @h"./traceaCan't open %s Tracing started. 0 !?@’a  "b!ha@P0!!(@"@hl"            %d: %s %s: bad trap㿘 `  !. "@U  . 0B`    8'#  a $aa`. ސ.  ". @i.  "@Ha?$aa 2   t  @  㿘  +# )! " J " a $aa@i$$@: a?$aa 2  t   (㿐' . @ 2L    !؀ 6`25?`0!*`@DDDDDDDDDDD$DD0DDD0~J" 2  2 ~J"~J" 2 !N 2L@5   ~J"  ?뀢    ,L `  ```" ' , ,#',@Ng㿈 @N耢?&@  㿘!? @NK ! .㿘@N@c   U!g .c` "c`㿘!g# L   !g` `J@ `*@b*`$b"#`㿘!#Ȁ     $#ȁexitshell(%d) pid=%d @@N+' @Ѐ @ "c\`" J@ ""k @z"c\ @X㿘@ `ā㿘@`ȁ㿘N? &`@@ &@* N 2` Ȁ@@U㿘V ?2  "& &   76  2V !! $!! & & & ?#! ! $!! *`&  &  "&  @&!?$!! 2  t "   @ ?& 㿘@ @ 㿘  V   @0" 6   6  & & 㿘!`"!!!  @g$ $!"!!  t <㿘'L'P'T'X@DL㿘'H'L'P'T'X Ē@7H㿘'H'L'P'T'X! Ȓ@*H ȁ㿀'P'T'X??77@P? '<`'*@ @*?0123456789ABCDEF0@, `:` %  ? & `&*@  ?  N@ - # 2N@`` *2@`*  : * ?Г*`:` `@N@?Ѐ -N@ . l`N@ * `@*  : * ?Г*`:` `@N@?Ѐ -`N@ l2N@ q2@`@?* : ` 7#X*`@H@8H" ''̴:    `        '' / @Sݨ?x @ -@S  '`? ` N@ o@$  %?  ? & -`& ?*@"%@ ? &  & -*%@,M 0 ? &  `&*@M? &  & * M 2 ?,w` ? & `& ?*@g` @V<`4 %? ` ? & Ɛ`& ?*@`"?M "? ? &  & * ?,-` ? & `& ?*@` ? & `&*@ ? &  &@*`@, `R`㿘 5 $@h( $@`@ ܀ ?  &㿘# $@h?c܀ # ,#X #\,# ,#P #@ PS2=> PATH=/bin:/usr/binMAILPATH=MAIL=IFS= HISTSIZE=PS1=PS1=$ PS1=# 㿘!0`!0` 2  @$@"$`$` `2`!P!P @!ؔ?$?"@P !!$  "aP%.*s: bad variable name㿘J"a @ `?"aJ @ 2``= ""Ȓ`  @U@ې?  *? =*`* @@ %.*s: is read only㿘@ O##P#  \ @"  ">   @ ="#ha $aa2 +   2 @d   ?ǐ@$  $    a?$aa  t , f $ $ $$㿘!`"!!  h   !"!!  t 㿘@ "  @ "      @3 =  2  㿘#   @ "  2 @m "  @ "  2 `2     @ =  2  㿘#d  `" ` 2@`2` ** #d `"` "@`"@`2` *"㿘#d,  #   $@   @c   2@@c @ ަ $   ?$ @ 2 *B%s 㿘#d #  "   2`  2  * 㿘@J r  # 0 h" h b#@S = &`@` `@ 2`@`2`*`h`$`h@ ݐ0:#d`@5! @`"+``"#@``? "`ސ  @"@* N = `? "`̐  "*@`2`` @*@ Not in a function㿘# 2#P h" h  1@  h`& h@  㿘a "aa N -N   ݵ x$` ~b@aה x: @    @   2  2 @ = ݧՒ   $`  $`$`  $`  $ @ = "$`ݍ $`c$@"ca?"aa  t 㿘#`'%~@"c` 2 `` @aw x@bc` 0 $ 2 @_ 0 2`@bV `$ ` $ @bPc`2@List assignment not implemented㿘 @ ``  "( vf㿘   !B"  f2  `"  h``" @   򀤠㿘@E "> # @V "2  23 a $aa @ْ =J  `|Ĕ   ?  $  2@a $@aΐa?$aa   t  > 2  㿘*   : *:  ="  @ N  @P^ '* 1#d (8J@ `=   JJ@`J= J`?㿘@m:pinvalid file mode: %s%s㿘@~  @]a`@ט 8 ! '# $)Ő@Sh? m p @c !p @Ӓc@^!@#0* @@ @@ - , -`@@Ԓ ? / *@@@8J@ 4 @@ 4` 6`  @@4  6`Ő!@o@ `@ @Fߐ/%s: %s8Ť#@@~@~ƒL`?,@;k  $#܀  œ.@׺2` Ő!@<?<    /!@  #H@ ? /`, usage: mkdir [-p] [-m mode] dirname ... 㿘!h@E`H@F 㿘@ssethostnamegethostname%s 㾘@}/ #Ɛ@`? ? s @@#0&*  @@5@ " @P@@  @`@̒!   @ҷ` Ɛ@Q . 2*Ɛ @@F- usage: hostname [-s] [name-of-host] 㿘!h@Exb@F 㿘@ update: setitimer㿈@| @4  @Ec  '''' @骔 @"x@E @ @̞㿘@F㿘@aFfh:t:vonly one -t option may be specified.nfs㿘@| @(5Ʈ#- +)# $'@ڔ@?V? 0O*                                              %%b c%"# Ɛ @ߒcP@c$@y#0*` @   @g"  #  @#x   @ @\@ 2 `@ @E5/㿐@; 2 @ѣ  %ǡ,` L@9 Z "@f < " @, L 2 ,`%s%s: not currently mounted%s: not a directory or special device%s: unmount from %s Cannot MNT PRCBad MNT RPCx@~ݒ xǐ"@9z h @Ք0 @Δ)""<    @h"<   ǐ @h ǐ""@ @h hƒcx@9U   @ @ ,@ @,@ :  ,@u :,@% " ǐ"@" 2h @Ԩb hǐ"@ 0Zƒcx@9  2T "Q "@2K , @D*  /7 @@b0  ''?'d'X'\ab X@d@A#( @$ 'x'|'X'\ X#\@ ɔ`!, ǐ@2c   `@   @getmntinfo㿐@  @v": 67 ``.  @"A ` `<@] .  L2 .  L@") 2  `<@\ .  π` 㿘#   "`?#@8c    "@ empty type list㿘  N  n @`h N  o  "b""  @ ,``!`@]* $#2$ @ݒ   @w ,,`*@`$`$㿘 " "@ "/ @[ . "  *"@ 2   " !"@ " @@ . "  *"@   " 㿘'HH@Ք$usage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]㿘!hɒbɔ@BD@B 㿘@=haltlnqd%s???halted by %srebootrebooted by %s~shutdownSIGTSTP init: %sSIGTERM processes: %sWARNING: some process(es) wouldn't die %s%s(can't restart init): 㿘@y`@@z /  @@ cH   "b    +ʨ Đ@~cP?H? 2A* )))))))))))))))))))))))))))))))))))))))))))))))))))    !@@Ӂ  `@ @#X` @y $@|#ܒ@#X)@u @2@J "#`"  ɐ#H @޺ "  chɐ#x @ޱ " ɒc@ݗɐ#ɒc@: @O @A ?2   $@:#ܒ@c# @Ae ?@A ? $@+#ܒ@T#@א @,@А  # $?@Aw ? c܀   $0@޿.  ɐ!h@Ac@x $#ܐ @A^ ? #@ʐ @usage: %s [-nqd] 㿘" "#H#x!h@@`@@A %s: 㿘'H'L'P'T'X" H#Hɔ#x!!h@@ʒ`!h@A!h@@’`@Ab 㿘@///////// /x/p/h/` /X /P/H/@ /8/0/( / ////..... .!....".#.$.%.&)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operand㿘@wl@@cȀ 2??. @@cЀ .  @c&@?`V*`̐ |@00001L_ `JZ`?`J@ !A!J` >``JL@ `J@ !J` /!@4`" (!R  %`@"b2`?`J@ !!J` `@` " !R   ``@"b@ !`$"@`@(`?"@  `$"` @c%s: %s%s㿘 J  @̈b ̒b @̃ 㿘@"!"`$"@` $ "`$"@` 2  ` b?"b㿘@!"`$"@` # "`$"@` @ b?"b㿘 ""@ """@`?argument expectedclosing paren expected㿘  % cȀ %2!"`$"@i`"`$"@a` &P nc0K"3R /b"b  YcȀ   " '""@I#`?"@T@Wz@"@" " " R  @ "@I@ 㿘!" $"@ ""`$"``2 c?* : `y͐",*`@77777776p6666677D7l7@n]`?@hW@ @bR2 @] 4L  0I@@A`?@ސ@ې8@ @Ր@Ґ60  0-@ː@Ȑ4&  0#@@$  0@@&  0@ݒ @@8`  @c 2n a(@3F e `Uΐ d*`@8888899999 99@99(90989999p9     @8`?+ )'%#!0&($$""Ȁ  ̀  @ϖ@Ϛ`?  < `? @ 㿘ˀ !P"" ""T @   "" '%s: out of range%s: bad number㿐! $$#ܐ@ #܀  ΒbH@oJ"ؒ@ ` ؒ `'J`   J  Βb`@Q ؠ @2  @2{8 X@4  ؠ @2l  @2g8 X@&  ؠ @2X @2S8  8@< `?㿘@P%s 㿘@tS!ϐ@y P? ? P@#0 @ @ 2ϐ @ @ % X@=o usage: pwd 㿘!h@<a@=a _HiStOrY_V1_  "    "    "  "    "  "    2  㿘 "@Ge @Gb@VƐ  @Y`@ @W7  "  @1㿘@2` @<@`"``` "` @W!`@W ?& 㿘@V & @j "`  "` "   "`  &   &  㿘  & &@    @㿘@Vp `$ " " " " " " "" &㿘   2& & 㿘@VR $ޒ ϐ!& ϐ!H& ϐ!l& ϐ!& ϐ!& ϐ#& ϐ#D& ϐ"& 㿘 ϐ!@ τ2 ?`6?  㿘` "" ` " ` " ` " ` " ` " ` "  `  @ !ϲ!@~ ϐ!H& & ϐ!l& ϐ!& ϐ!& ϐ#& ϐ#D& ϐ"& ?ϐ!@2`p`& `& ` & `& `& `& `& ` &  r㿐?@zbp @穒ϒa8@0  @眒 @.@€.@ @7w%s㿘 @Mc ?!8@ҙ @ #Аc(@;& @ @㿘   @2 㿘   @2 㿘@Eސ   @0V   @ 㿘@EȐ   @0@   @ 'L'P'T'X `{Lѐ!0.`@FdFPEEEEEEtE|FF<F(FFEEE  €\      @O @0J&AO<n<y72- ''''''''' ?"alalf㿘&" &",&"$"0@T", ,@  0 (   *  ,(  (: ,@" ,㿘 (@  , 8"@ `"`"d@  ( (*@` ,@( @ ,"& ,㿘 (" $ *" `"`"d@ ( " ("*@` ,@( @ ,"& ,*?_-.[]~=㿘"ؐ@   @   ؐ 2   㿘? ?0 "? *㿘   0 "  8㿘'#@@ @2"@`@ "@ "@:b@  "`@*@@(㿘65b@ @ @  @8@@@ @2`@`@ؐ   ز`@  2`2b@@:㿘"@ ""@"\&"`"@&"@"D`, (  " "D& (@n `"@  ` ` ` `&"  &" @8 (&",&"(5 "؄ "    : " :   ؐ  :  " ـ ?㿘@R$& $ @9*$ $& ( $& , $#& 0@R$&"0 @9$&" &"$&"( $&",&"@ $&"D $&"H@RԐ$&"4 @9 $ $&"<"4&"8"\&"`& 4& 8& @ & < ". D&"T?&"L@R (&"P  $" ( $" ,"" ""$""( $"",""@ $""D $""H $""<"\""`" 4" 8" @ " < "* D?""L""㿘@S $& $& 0@S"0&"0@S"4&"4@S "P&"PՐ㿘@C""? , 0 ? N@`& (@*@`N@ 2 ( 㿘` $@ (@  ("& ( $ *& (㿐 /@͒ @] @ O 7    / #"*O # 4  ( $* $& , $& (" ?& (* (& ,.@?@0 .@  (`& (*@ (& ,@/O .@ ( $2 (  $ H " ( :H ("?㿘@ڐ ,* 㿘`"X  , <  0 * <O   4 "$&"$"0 ( *@ "0"$*@[ ?  (`& (*@& 8@H) 4    <&"$"0 ( *@  <&"$"0"$*@9 < < < (`& (*@ <??& <@$ 4 2 @)  㿘 ( $@2 (  $ <rଠ ( "4 @*` (@ &"8 ( "@& ( $*& ( 㿘 ( ,@"p  $@"  (@2 ( ?& ( < ( ,@ *  $@& (  ("4*@` ,*""8 (" , 㿘 ,& ("p 2  & ("@ "  㿘 $& ("p 2 J@"ؒ@ ` " "@ (`& (J`  2 ("@ "  `(`, `$ `("`(`$`(  `(H(`(( 㿘 ( ,@* (  < & ( , 8& ("p 2  "@ " f 㿘 ( $@2 (  $ <& ("p 2  "@ " K 㿘 ( $@(  <"@& ( $ *& ("p 2  "@ " 1 㿐@$8@@$v    㿘"ؐ@  "<  8 " , D 32 < А"@@4-  <*` * ?А& <$   0 * 4  ""$&"$"0 ( *@ "0"$*@Ԓ   (`& (*@& 8@ ؄@"  8 <@(  (Є " <" < " 8 㿘@}@Ӱ        㿘@ ,`& , *@ ,*"p  $&"H 㿘 ( $@   < ( <" & ( $ *& ( 㿘@@ 㿘@@ 㿘  㿘&"  ,*"   " $@$ , $" " &"" < &"@  @@1  㿘&"  ,*" <" &"@ &" 㿘&"@&"  ,*"  ]&"2 "" $@$ , $" " &"" M "" &"    @ @  "  &"   `"@$" " $ , @*e"   , $" L @_ 2`""  &"   " &"@*  㿘&"@&"  ,*" C " ? " &"    "9 @1# % $ , @*"   , $" L @ 2""  &"   `"@݀ 2 &"@" 2&" @א 㿘ʐ (J@ " $@* < $J@ 2 <? & <@ :J@ < #  $@ J@ "`@ :J@` ,@ J@   ` @ *J@& ( 㿘 ( ,@: < ,J@ 2` <? & <`@ *J@ < `  ,@ J@   ` @ *J@& ( 㻘 $* $& , $& (̒  (`& ( *@ (`& ( :*@ (`& ( *@@ ϐ@*| $* $& , $& (@ ?  㿘@N+"! @4c"V`& & @&!h& @U@ @@Ȑ!@@@ @ǐ&  㿘 @@Y@ @@ӐZ@@@ @@Ng@Ne㿘@!}*bindtelltcsettcechotcsetty'L'P'T'X` |Lؐ"@.`@blb|bbbbbbbcc@ 0g@X0c@90_    ?& V  * `"?$*`4ؐ#*`@c0cPcpccؐ!' @*02ؐ!' @y0*ؐ!' @˔0"ؐ!' @0ؐ"' @!0@2@0@N0? $/.editrcrHOME㻐`ٲ )@`8 2@  @")?@T$ْ`(@kP$/@`8"?@ *?@?@ @?㿈' ' @3 @E耢 @c @3 ^D㿘 ( ,@ $@ ْa@ @ 0 @B  f < ( , 8& ( 㿘 ( ,@2 (  , <іଖ (@ "4 @*`@ &"8 (A"  ( , 8& ( 㿘"8"4@"" "8"4"  ,  0 * ( &"< ("8"4" "4, `"8@* @ < "& (  $"4*@` ,*""8 $" , $" ( 㿘"< 2"<)  (  "4 *@"< `&"8 ("  "<"4*@` (* &"8"<" "<& ( "<""<  ( "4*@"< ` ""8"<"4*@` (*""8 `$`(  `(H(`(( 㿘 ( ,@2 (  , <& ("p 2  "@ "  㿘 ( , <ଖ ( :& (Jbؐ@   *`@ `* *J& ( ,8& ( 㿘 ( , <֖ଖ ( :,& (J"ؐ@   `*`@ `* *J :& (Jbؐ@  #*`@ `* *J& ( ,8& ( 㿘 ( , <ଖ ( :& (Jbؐ@  #*`@ `* *J& ( ,8& (  (""<  ("<" (""<  <Є@4  " 8 <(" <  " @  4`?" 4 㿘 ( $@2 (  $ <-ଠ$@ : & ( ,@: & ( *@  `& ( 㿘""@ q  㿘""@ i  㿘&"&"@K$&"&" 㿘@K"&""""" 㿘" 2" $"@!$"""  $ & ,"p 2L ,J $ E "" &"   `9 ""  &"   `"+&" "&" $@$@;b $ $ & , $@("pJ 2 ,& , ,J 2 ,& , , $ *& ,"p 2 , $ & ( %d %s㿘" 2"!?  &"   " !" "@0<""  &"   2" 㿘@Jw$&"&"@ 㿘@J"&"&"*"""""㿘@i"&"㿘"@key_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed 㿘N@  @/`02 " 2" @/ܒ`80 2"@SN@&""@㿘@ "\@"X  "X@ "\ @ @key_delete: Null extended-key not allowed. 㿘J@ 2" @/a`? " @" Unbound extended key "%s" 㿘" 2"N@ " "*@"@   a@/s㿘N@N@2``  @-  . ` `&` 2.``2N@& 㿘NN@@"`   N@ J@ "  ` 2   2 @N@$  `N@ 6 " @}&   "    0     " @I@.&  "0 0& @& @. 2 @pN@&   㿘LN@@    N@J@ " ` 2 $ ``N@ 2 ` $`  ؒ 2  2 ` &$`$ @  㿘 # &    "    0    @IT@.j@IP㿘@HА * " " " " 㿘"2?N@ 2N@=( @  "@  `N` 2?" "* "* "@d `д ?Some extended keys too long for internal print buffer "%s..." 㿘 ""*@"* @.%c ݒcP@. "' `2""?@k@` " "* "* "`@``` ϔ``ɔ %-15s-> %s ""[]no input㻘2 ""t0"!!x `ޔ h@l     20@- ax axޖp@-  ^( ; @؄   ^( . ?,@^\ \( $ ^  \(  ؄H` \( \( :0( :0(  0( J*@`J2  ^* @*JG ^ ? \b؄ " J*J0* ,@^\2J*#  b؄H2* * (80* 00* 0* J J" *J** 㿘@GL!&"X@GI!&"\!&"d#&"h"&"l@G=$8@%&&"t@FÔ$8@G4!h@% &"x@F!h Z&"|@e 㿘@G"X&"X@G"\&"\&"d&"h&"l@G"t&"t@G"x&"x"\  ؄H2*؁㿐"\"X @ /   $ @ $/ @ /   $ @ $ "p   //  @ "  "  /l @   $ @O ,@ 㿘"\"X"l"h &"p"\&"`Y @ , , ``$ @ @  @㿐"\"X"d&"p"\&"`>  " , ,@ ``$  ///# (J @ߒ @ݐemacsvi㿘@ +ch ʐ  @ !cp ? %s -> %s 㻘N N "t @ߖ  20  c@+0_%-15s-> is undefined %-4s to %-7s-> %s 㷈////@ "2"t<e` @+ƒ`01  ) `@ 2  MH @+0 2@@+ !ޠ Pޒ4`@+Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings 㿘 @+ra  "\ @ ?  $"\"\? @+Za  "X @ v?  $"X"Xm? @+Bb!# @+:b8@Œ#؁%s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. 㷘 ?"\   R  h#J -L,  ?* :  8* 444444444444444#"X!   Z s "tcX@*  2   c`@*J , 2J,  5 , ,  @   Cc @ }?L`  @ @ 2 @ޒo  "k-@ ,   @` b[    ", 0ON, @d   c@*WC? :@, @1#@k?  c@*9%? @ L`   3 @  -@ N @-@@) 㿘"|` 2"x$?@Dݓ, &"x, @"t@Dד*`&"t"|"x, "@"t, @*`" "t " "t "  "t, * "@"| &"| history㿐@"> @"l@'@"Z㿘  `:"LL  L :2,@   @     , @@  ,  2, ?J"?J\z^ Ѕ(8F0(                                         LT  t       d   | \ l6 4 2 0 . , * (   JЀ* Ж??؄" JJ? J#㿘'HHJ \ ^ ".HH0 TH?2.  'H . 㿘 "t@ؒ 2   ? 㿘"@  *` @x:`L  "&""&""""""" `2"""""""" `? 㿘"T "!@CW&"T!  㿘` "L  &"L"P* "@@+@㿐@6 " @/ "& @?."` 2"XJ  0"X@(+"X  "\&"` "Ӑ А.@?㿐 @BbL 6 !* @J 2$ *` " .@ *@J " $@ ! $ ` @EL ?2 .@` `#܀ 2.@ ?.@㿐/  @/@w@!  i?A"|;?"x*@€O `). D*`xpX@& <& 8@$?& <& 8@?  , $"@@9@z& <& 8& <& 8@ P@?@z@  `@`2&@   $㿘"ؐ@J  5`  ` @3 &"" ,&" @) " 0!"ؐ@   @ ^` ?`@@ \>` `@`0>` `@ `0``0@" ("(""" H  " (( """""㿐&"&"?''^  $"'"'L  ,* (?2""'"'"&"Ē  ,` @@  @@K H`"@$ " "@@ 4&" @ p@ Β  ,`@1@ = *`" @"&" @ Y@ 㿘@ P" @ʐ @Ȑ @Ґ@`$" @4`@ @ ?"  *?*@ @ @  `  (     *@ @  @  *  *@   *` 2J@㿀''K@   J 2J M   J 2   *J /@K 2  : 'K? 2'? *K?'+M  L 0?JK@8 M 0-* : K@2$  &@JJ@2 &@*J&@" 6  *`#@$     *KL 0-* : J@2$ &JK@2 & *J&" 6 *`"@$   *J'@ %'$%@%& P  %%%@@ P䀊 &%%%@@&䀢 %%'$%@%&@/-" H '@ M$䀥@ :%  H%$@ Ô%%@ ǔ06+ %@ % @  H%@ @ %'@ @ x" 0i&@@ @ @ {%@@ v%@'@ @ Y" 1'%@.+@Ւ$䀥$ @ %  H%$@ H %@ @K@&@ @ %@@"%@@ $  J@*`    *  *㿘"" $ (: H" ( J ' *:  2 * !   2  :   "*    :  J     $ `  `*Π @ܐ@:@ Z㿘@ N  *` &  *   H@ &   & "  &" @ 8 @ 6 㿘 (J  ,@,`00: "ؐ@   ``@ ?ʒ ^, :`,`: "ؐ@J   \,`<  ``0<   0 ``0@ " "  *`(` L@& "" 㿘 P @ƒ  @a@ 5 H " @W 0@T" @ ΐ @ ̐ 㿘@>$&"&"?&"."&" 㿘@>"&"㿈@  @s 2    @p `?@㿘"㿘 D? ""p  "`"X `? (@ $" #&"#&"" "@ $""*@@.R"&"*[]?㿐 ( ̢ "" ,  0 Ϥ"   :*`"&"" .*@ "&"" **@   , & , *   `& , *@ L  ,`& , *@"`"@ : , ,`& , *@ "" * , ,*֒ f  "` @?`'J <*`@4HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH("#("&""*@  ,`& ,P*@ g  d " 4`0O ""  U MQ I@\M , ""  5 ( & ( , ଠ (J@ "& ("#"&"" ( *@  ,& , (`& ( @* (@*J@& ( ,*I ,@"& ("@$L  "*`Аْ`Т  , $@  J@  & ,*@ , $  ,*"?"  ]/"(""L [ ]2? / 8L" }O [z "2!"J ̀ ?#&"&"b \2  $ , (? & ("&"" .*@ "&"" **@ ""*@ ( $@  ,@ "`@ ` 2". D잒   `  2 $ ,& ("`@"?&""*@ ` @v"" & (&" "= & ( ? :*`̐I `  `J ̀ ?2``:" ` * &"" `&"ِ  `  & ([2 ` ` "(" `㻘 ./ */ $* $& , $& (&".  (`& ( *@ (``& ( / ?*@2N  < .*<" 2 " $* $& , $G& (J@ .. *,@"" .*" ** " @"  &""* "`&""* ""*@@ .* @ ** @*|"@&". D $& ,` & (˒  0 , ֐  ΐ ,`& , *@ ,*% 㿘 (  $1 2 & ( $     2& (N 2 0 㿘. D $`& ,`     s 㿘 (" $@ J@"@ 8J@2J@ $@* J@ 2& (2`& ("@ 2 (  & (g 㿘 ("` ,@ J@"`@ *J@2J@ ,@*J@ 2& (2& ("@ 2 (  & (5 㿐? ' $ "cܒ *@@' @   0!@ &  ꤒ  @/ d @  ؀?  ؑ*`  `*` ?*` "*`@ )  @ k  @ N㿐' ' ' ' ' ' ' ' ' @ G@:% $&" ؀? ? "*"@* ?2" @ /  㿘@:"&"㿐' ' ' ' ' ' ' ' ' @  ؀?  #,`@@`"",`?,`" Ԑ @ 㿐' ' ' ' ' ' ' ' ' @ɔ ؀?  ",  " @t , ?2"" Ԑ @ cursor up multipleUPcursor right multipleRIcursor left multipleLEinsert multiple charsICcursor down multipleDOdelete multiple charsDCvisible bellvbend underlineuebegin underlineuscursor up oneupcursor to status linetsbegin standoutsoend standoutsenon destructive spacendend attributesmebegin boldmdsends cursor upkusends cursor rightkrsends cursor leftklsends cursor downkdinsert paddingipstart insert modeiminsert characterichome cursorhocursor from status linefsend insert modeeiend delete modeedstart delete modedmdelete a linedldelete a characterdcclear screenclcursor to horiz poschclear to end of linececlear to bottomcdaudible bellbladd new blank linealMTTab chars destructivextHas meta keykmNumber of columnscoNumber of lineslihas physical tabspt㿘& P! "  ` `@  ` " & P `  P "& P`@& P \ "& PJ 2`& P \  " \J 2 ` \ x "& PJ "& P`& P \ 8  J 2  \ 4 " \J 2   \ " PJ " P  P@& P \ h " \J 2   \ "& PJ "& P & P \`T" PJ " P`p`"  PJ@ "  P@   ?& P \`TJ `\` J@   P@ " & P㿘@7Ő(& T@7(& d@7 @& h& X@7 & \ @ @7 & ` @  "b\@M @1 㿘@8 T& T@8 d& d& X@8 \& \@8 `& `@Out of termcap string space. 㷘 \ &@>`.`@N R$@(  @( 4 X@0@`'3 T  ``"@" @  *8`J  *8` * T@6̔(`'& X @c0  T X $@ǒ X & X㿘@> ` & H@9j & L@㿘 H L @7*   L6 `@@7  , $  `&@`* $& ` @6*  @6 , $  `&@`* $& 㿘 `& @  @7[  @7T `& @  @7J  @7C㿘 @ \ L@X&@ ``  \ |` J@  @+'6A& @]  9&  \` " \J   4  \`h " \J  \  @*@*v8&  \ h "& J   6& %  \ h @*`8 & \& 㿘 @ H @`2 @ {& &@` ` \ ` `J@  @*E`1`$ P \ `"  PJ@  @*2 P `  "  ``@ؐ  `&   * @ @ @:&@ 6&   $ P \ `" PJ@   @*k@)8 &  P  >``@  0  @ &  6 &  @  & 㿘 H  N@@`  & 㿘`R P N H@J \`x " \J `4  \` " \J   \ x@*. \ `"  \J@   @)8 \  " \J  \ !  @)w 8 \ $` J@   @)g8㿘~ P z Hv \` " \J 4  \`4 " \J 2 \ \ @)@)=8m0T \8`/!J@ ", \( "( \J #  @)#8 & N@@`2N@ \ <`"  (J@   @) 8 \ ( @)80" \ 4`" N@J@   @( 8N@@`  &  \ <`" J@   @( 82 \㿘 P   \ ` J@   @(є80 6  @   @& 㿘 \ "  \J   ``@(80" \`0J ` J   ``!@( 8 \ ` `@( 80@W @U 㿘 \ t`" J@    \ ` J@   @(x80@9 TERMdumbCannot read termcap database; No entry for terminal type "%s"; using dumb terminal settings. 㷀'@' @v`'@&#hN@ 2 d#p d @( d@) 40퀢?  @cx   c@ߔ @ےc ` P"` `" " " ``"`  "= ` `@ 2 `@*# `"@@)#H `"`@)#` `"` @)#( `"`@)# `"`@)ߐ# `"`  " `@@)Z`@  `` 4 ` P"` `` 4 ` "` ` & L ` & Hb@@. @ݔ @ 㿐 ` & ` &@ `h@6?  2& 2&@ ` @  @@  㿘 `"` P"` ``"` "`]Gdownleftright h`    ( H    ( h   $ (( ,p 0  4 (8 <㿘 h b`  bh   8bp < (bx ,b b b <b ,"p 1ba bi bq <by ,b b b <b ,㿘 h . @@  @"`"`  . ?㿘 h  . @@  @"  . ?㿘 h N@ , @m@ 2  , @  @ u  $N@㿘 T W h"\ S"p 2"\"X2"d"h= , \* @ "<L 7  `c.L  "  @  `2 , -  , "2E,` , `,  ,㿘@Vb\㿘@/"\ Your terminal has the following characteristics: It has %d columns and %d lines It has %s meta key ano It can%suse tabs not %25s (%s) == %s (empty)㻘 @`p @` ` `@ P @   @` P !!  @a    \!(-+  ` J@  a@@q    @V  yessettc: Bad value `%s'. 㿘"? "? }   @L "    b "$"$ " @0 "   M"$ )@b  "$$:  `*  "@ `  b@+?"$$:  `* "@ݐ `@ۀb$$ :` `*`"  ` & L ` & H2   ` ?%s %d tabsmetabaudrowslinescolsechotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Warning: Extra argument `%s'. echotc: Warning: Missing argument. echotc: Warning: Too many required arguments (%d). 㷐  p' lJ@ -2 J` s v"   "d J _@i`耢 2" P "  @V@K @T` 2 " ` @E` 2  b@:!/ @8a @2a 2  ` b@& @$a  ` b@   $:  \* @    @     @&HL  2? an  +L %c  ?ۑ* :  MU* (((((((` aH @L L  %`"``") ".% J KV  2J . @J 5@$=  a@D J @ J  2$? @)a?@ٳJ  2? ax@ ?@#ɔ@#N8 chars:lflag:cflag:oflag:iflag:timeminstatuslnextdiscardreprintdsuspsuspwerasestopstarteol2eoleofkillerasequitintrextprocaltwerasenokerninfoiextenpendinflushoechokeechoprtechoctltostopnoflshechonlechokechoeechoicanonisigmdmbufcrts_iflowccts_oflowclocalhupclparoddparenbcreadcstopbcignorextabsonlretonoeotonlcropostimaxbelixoffixanyixonicrnligncrinlcristripinpckparmrkignparbrkintignbrk㿘  @.!?"?!&!l!&!p!&!t!&!x!&!|!&!!&!!&!!&!!&!!&!!l&!!p&!!t&!!x&!!|&!!&!!&!!&!!&!!&!!&!@!l&!!p2   &!!t ##`?&! t!l*@&!l p &!l !p*@&!p | &!p !t*@&!t  &!t !x*@&!x  5&!x!Ѐ!$!@r!R  aR " "  a9 2*a9    aR " "  a 2*a   !l@s!   @֔?2 %?!l@g!  !*@&!  &! !*@&!  &! !*@&! Đ &! !*@&! А &!!@H!9 㿘&! ." lb@- ! cX@- K:㿘@K @K *@ *` *` *` *` *` *` *` *` *` *` *` *` *` *` "*` *` !*` @*  `*  `*  `*  `*  `*  `*  ` *  ` *  ` *  ` *  `*  `*  `*  `*  `* " `* `* !㿈!9!//"\"p "X"l"h"d ##?9@/  /*`:`* : @"$ bO , [O"p , PO ,@ IO"p ,@  ?2@㿘! 2  @-8!Ā?"?!̐ ##`?&!K!&!H!l! !lB!! !l@J!@J!!@J!@J!!Ѐ!" !!t@"!&!t *@&!t  &!t!&! Ȑ*@&! Đ &!!!x@"!!@"!&!x *@&!x  &!x!&! Ԑ*@&! А &!!!l@"!!@"!&!l t*@&!l p &!l!&! *@&!  &!!!p@ !@"!p&!p *@&!p | &!p!&! *@&!  &!!p " P&!2  &!!ϒ!R  !R ! @ :  ܑ: 2   R @2*9 :  "*a9$ ܐ !ɒ!9  : 2   R @2*  :  "*a $ !l!   @!? &! ?㿘! 2    @!l?"?&! 㿘! 2!> &!!&!!&!!&!!&!!&!!&!!&!!&!!&!!&! !Đ*@&!  &! !Ȑ*@&!  &!!!̐*@&!! &!!!А*@&!!  &!  @!Ā? &! ?㿘! "    @!? &! ?%s: Unknown switch `%c'. %s%s %*s%c%s %s %s: Invalid argument `%s'. 㿘  *?>`9 J@ -6J` 2J d" q a  x"       a`J? J -J "J? x? ## b !/ߑ*" *   ! * *  @*l ,* @  l,*  p  @ `  t  `+ -`"& @`   H@  a@,`:  a@  a@  2  @av  a@װ?0m"l *" * *" * *" * `^J@ + - @`##   @﹒ "   Α,`:  + - %*` *` *  p @ " p *` * "*` *   p* " p *` *  t @  *   p* " p *` *   t* " t "@"! (""@""D""$""("0 $*"(""( ,* ""  $"", $" , $`" ("\""` ""D""@ 㿘"$ " `2  ( ( ,@`& ( (  (   , @*   㿘ޒ 㿘ג  㿘 ( $@  $ <ְ & ("@   㿘 ( $@  $ <֗ & ("@  ͐ 㿘 ( ,@  , <N & ("p 2  "@ " ֲ 㿘 ( ,@  , <3 & ("p 2  "@ " ֗ 㿘 ( ,$J"ؐ  & (#"ؐ  "  ( (& ( * * & (X  㿘   $" (""H ("", "" "\""` "\""` " 4 ""  ("",""$""( "\""` " 4 ""  ("",""$""( 㿘. <"\&"` 㿘 "\&"` 㿘N "\&"` "\""` (""H ("", ""  "\""` ( , " ( ,8" (   (""H ("", "" "\""` ," ( ,""H ,"", ""  㿘  㿘 ( ,@2 (  ,! <& ("@ 2 (  & (ݐ 㿘 ( ,@2 (  , <& ("@ 2 (  & (Đ 㿘" l"   "  " "s  "  @( ,  ,( ," & , & ( $$p$" $   @ ,@`, & (S ,: @ ,@`,  ,6  ,@` ,  ,(  ,"& , & ($0$ "-  & (# @(6 $$$ 2  & ( ,"@&   @ ,@`, $ ""H""@""D" 8", (, " 2""$""(" 4"X""` ( $" ( 㿘 8  <"@@*`  * ?А& <   $& ("@   㿘"H "  ( <" "H@   ( <" & (  㿘ْaU  㿘 $"4*` (@* @&"8 ( $ǒ"  $& ( 㿘K  㿘D  㿘" "  㿘" 2"     ې 㿐`  &"."O <   㿐J 2 &"."O <Ȗ  В 㿐4 O <  վ 㿐" O <줖  լ 㿘N" 2"  N" <Ɩ  N" <쉖 㿘N" 2"  N" <쯖  N" <r Editline extended commanded-commandMove down one lineed-next-lineMove up one lineed-prev-lineSearch next in history for a line matching the currented-search-next-historySearch previous in history for a line matching the currented-search-prev-historyMove to the next history lineed-next-historyMove to the previous history lineed-prev-historyFirst character in a bound sequenceed-sequence-lead-inErase current line and start from scratched-start-overRedisplay everythinged-redisplayClear screen leaving current line at the toped-clear-screenDelete the character to the left of the cursored-delete-prev-charExecute commanded-newlineTty allow output charactersed-tty-start-outputTty disallow output charactersed-tty-stop-outputTty suspend charactered-tty-sigtstpTty quit charactered-tty-sigquitTty flush output charactersed-tty-flush-outputTty delayed suspend charactered-tty-dsuspTty interrupt charactered-tty-sigintIndicates unbound charactered-unassignedDigit that starts argumented-argument-digitAdds to argument or enters a digited-digitAdd the next character typed verbatimed-quoted-insertMove to the left one charactered-prev-charMove to the beginning of the current worded-prev-wordMove to the right one charactered-next-charExchange the character to the left of the cursor with the one under ited-transpose-charsMove cursor to the beginning of lineed-move-to-begMove cursor to the end of lineed-move-to-endCut to the end of lineed-kill-lineDelete character under cursored-delete-next-charDelete from beginning of current word to cursored-delete-prev-wordAdd character to the lineed-insertIndicate end of fileed-end-of-fileEmacs incremental reverse searchem-inc-search-prevEmacs incremental next searchem-inc-search-nextCopy current word to cursorem-copy-prev-wordSwitch from insert to overwrite mode or vice versaem-toggle-overwriteAdd 8th bit to next character typedem-meta-nextUniversal argument (argument times 4)em-universal-argumentExchange the cursor and markem-exchange-markSet the mark at cursorem-set-markLowercase the characters from cursor to end of current wordem-lower-caseCapitalize the characters from cursor to end of current wordem-capitol-caseUppercase the characters from cursor to end of current wordem-upper-caseMove next to end of current wordem-next-wordExchange the two characters before the cursorem-gosmacs-trasposeCopy area between mark and cursor to cut bufferem-copy-regionCut area between mark and cursor and save in cut bufferem-kill-regionCut the entire line and save in cut bufferem-kill-linePaste cut buffer at cursor positionem-yankCut from cursor to end of current wordem-delete-next-wordDelete character under cursor or list completions if at end of lineem-delete-or-listVi repeat current character search in the opposite search directionvi-repeat-prev-charVi repeat current character search in the same search directionvi-repeat-next-charVi move up to the character specified previousvi-to-prev-charVi move up to the character specified nextvi-to-next-charVi move to the character specified previousvi-prev-charVi move to the character specified nextvi-next-charVi repeat current search in the opposite search directionvi-repeat-search-prevVi repeat current search in the same search directionvi-repeat-search-nextVi search history nextvi-search-nextVi search history previousvi-search-prevVi cut from beginning of line to cursorvi-kill-line-prevVi list choices for completion or indicate end of file if empty linevi-list-or-eofVi move to previous character (backspace)vi-delete-prev-charVi move to the beginning of linevi-zeroVi enter command mode (use alternative key bindings)vi-command-modeVi undo last changevi-undoVi move to the end of the current wordvi-to-end-wordVi move to the end of the current space delimited wordvi-end-wordVi delete prefix commandvi-delete-metaVi enter insert mode at end of linevi-add-at-eolVi enter insert mode after the cursorvi-addVi enter insert modevi-insertVi change to end of linevi-change-to-eolVi substitute entire linevi-substitute-lineVi replace character under the cursor and enter insert modevi-substitute-charVi enter replace modevi-replace-modeVi replace character under the cursor with the next character typedvi-replace-charVi enter insert mode at the beginning of linevi-insert-at-bolVi change prefix commandvi-change-metaVi change case of character under the cursor and advance one charactervi-change-caseVi move to the next wordvi-next-wordVi move to the next space delimited wordvi-next-space-wordVi move to the previous wordvi-prev-wordVi move to the previous space delimited wordvi-prev-space-wordVi paste previous deletion to the left of the cursorvi-paste-prevVi paste previous deletion to the right of the cursorvi-paste-next"#<`(`$2```"`$`"`` (`"`` ( `"`"``$"`$ 㿘@! (!@$$  $ @!ސ ($ "@!ڐ $  $  $  $ $ $$ "  "  " " $" 㿘@"?@"= @"; @"9㿘#  L '  ' \ ""$ $4 $ k P $ ?, $ ? $  ?& $ *  , & & ? & $ `#d*`@Lx&   ?& $ `#*`@ y&  v&   &  *o& e& ?& $ `0 ,*`@T@ $ & $X&  $ & $ `N *`@ $  ?& $p  & &h f d )& ?& $ `)!*`@0X@xL "   `&  \*@&  `&   *@&   &  *3?   *!  " @!m @"  * "  &  &  & @& &     &  @!I*`& /var/log/wtmp"x @ "@ #p А@ɔ ؒ@Ŕ @ @h@# $ $@胐@#/var/run/utmpp#8 @ ) А@#s $ $O؀ @  @̒ @ɒ @0??@#y @#M $ް @#i㿘@3`a@#N ??@ @ @  $ @#L 㿈 ' ' '  @#ߚ ? $l $2 0 $p 0" 0  0" 0 㿘    $*  ? '?,  @ ?"@ $?@ ?"@  2 $ $ " , @ ? `@l*  @ ? 8 $   $, "@, @    `** ` *  *`  @^   @  TERM㿘 "b $"""b@#"؀ P " 2 @i" "@ >  $"  $ $# 4 $# " $@8 $ $ c @ 1  $ ""c $#`0 @"`0 $!$ " $@! $ $ c @  1 $ &!$@@L!$ $@ # ` 0" 0㿘  2@ (@ ,@ $@@ @2@0@2@"@@ 㿘  $*@      5  $, @ * ` * @ ?, J@ J`    $  $@: *@*``@ *J@ ,  $@ $@ :@    ϖ  㿘   J@ `@`@ 㿐//@㿐@/` @ 㿘  #0N@ `  "? $x "  $& &     #  " ږ 2 w n +`@  ?" ?@2 ` 0 "e & & @  $+`@ S  0  "+ J 2V  2V  2 "  "@*"@ @("@+ * ( @ ` + @ ` ?*` ?2  "& & @<  $J#   < 2lN@& &  xxxx|dumb:licoLINESCOLUMNS㿐J@  !@!@P" " !H !H," `* `* `* `* `* `* `* `* `h@ ֔?  `" $"  $ "#@!X $"`@!` $"c@!h ! $ @˰ $ @!p ! $ @˦ $# $# d "@"b $J" ! $ $""#  @ J O $ $*#,$#  *c, $"" " *@""b"@b $"c" $"Ā   $"  $"  $ $#|   $"H 2" $#x 2" $"쀢  $ $#H   $# 2 " $#T 2" "`?ambsdaeohcinmimsncnsosulxbxnxtxsxxALbcbtcdceclcmcrcsdcDLdmdoedeik0k1k2k3k4k5k6k7k8k9hoicimipkdkekhklkrkskullmandnlpcrcscseSFsoSRtatetiucueupusvbvsvealdlsfsrALDLUPDOLERIsgug㿐/  x#h / /@@*@ L `  #% / /@@"@ L ` $J"  $ $"""bl @Ő!( $  $""l @!0  $""@ $bl   $"@ "bl $ $b\""㿘@b㿘 0 2 (   @& @n@  $#2 ? " " * @  $J# "&   `&  :  @*"    $( "  $*`   (8" J  J:|J|   ( 8|" **  J:2* 㿘  $*@' ,  @ ?"@ $ @ ?"@  2 $ $` " , @   `@*  @   ?* $   $, "@, @    `** ` *  *`  @   @C 㿘  $+ @    ?  -   $+ @ * ` * @ ?+  J@ J`  2*@ $ "@: *@*``@ *J@  @S      (#@@ $*` $*R (" `@  2㿘"#$  $@_c f  $ $cc" " " "  " " " " "  $"$ ("(" $*" $2  *c""""`"`"` "`"`"`"`"` "`$"`( >"`  *` *`!1"&"$$$ $$$$` $ $$$(|4&"$ :g$ !̀  |&"? #$ $ "c !̀    @ `?㿘 $ "b""$""c !̀    @ `?㿘 $"""c"$ $ "c !̀    @{ `?㿘 "b# #$ """@!̀    @] `?㿘""# #$ " $ "@!̀    @@ `?㿘b`  "` b`  "`  $``  "`  "b!̀    @ `?㿘b` ?"` b` ?"`  $`` ?"` ""!̀    @ `?㿘bb!"b "bbȐ!"b " $``!"` " $""c!̀    @ `?㿘bb >"b ?"bbȐ >"b ?" $`` >"` ?" $ "c!̀    @ `?㿘@!" 2! $ $ @c*  $"$"!#@bĀ $"$b!b @E $" !@ є  $"< @ ̔ 㿘@! $# " $ 0 "  $ $" @ #`0 ?"`0 $#   @ۘ  $"h !@   $"P @  !@,!!  @ !̀     $@9`?㿘 @|c(`?㿘!̀    @!(`?` @dȀ 6'Đ 'Đ 'Đ @'Đ 'Đ @ @( @a @  $@?c!̀    @D $@# @c 㿘!  @ch$!㿘 @ a㿘 $# 2\ 2^ `? "cX  " 0,` $: @ `  @*`$ `* :   ,` 0 @2 0 $# 0 @2 0#X ' $ 0  $ $# 0 @ $# @ ܔ2#\2#^#X   $# 0 " 0" @" @ n 0 ?& 0 $J#, 2 0  ? " " * @A #X 2 0 $@# 0 (#X %  @  $ ,`:  2``* :  ,`"    & : @$ @F  M #X  ,` $#,` $:`  $  ",`:  $*@ -@ e,` $: @ V  ,` @",` $: @ V  @*",` $: @ @` ?"`* :    $#2  0R#\Rc^ @ A!( $#R\" R^"  "@2\ #*`:``2^ @:& + : & &  :& & & & &      R#\Rc^@ @  $#   "   "@m! 㿈`.` $ ? !T#\# Tc^@v #\ 4#\4c^ $.`@ V  ,  * $0a $.`@ V  Y 6? @'#X " $# @`$* @ * `  $.` ,`@ ' ?"@ $#8 +#X ( $  * ?` J 2 $J 2 $ $.`   (  $J 2 $J   $.`@ "? #X   $#8` $#  Rc^@ R\ @ E $" @ =  R\R^@d 4! $5+ $; $-7􀠠2 @  2 4! $@ܔ  cX  0P\V^@ 3c\ 6^` @黔  hf dc   @2^ &[ L 2W L 2S $.`@* @J@ J cJ " c $.`@ " :` * "@$@ $@d#8*  * @ c ?@# c 0  b @ c`0 ?"`0 $#8 @  6^D --  0:  c 0 2 $"l`b   @ ~c`0  0  b  @ qc`0 ?"`0   ?@2r X 2m  0` hc 0 ` $J# 2  0b @ Lc`0 ?"`0 0 27 cX 2L -  -* : ?`"@  `"*@  ?`"@  `"*@  @  c @     P\@   ?3c\   ?6^   ?@ X 0 8 $X 2L -  -* : ?`"@  `"*@ @Z  ?`"@  `"*@ @D  $"p "  ?`"@  " *@*  $"p @ V^ @& $ 6^* : cc  $J" "   Sc\   V^@   ?6^=! $# 0   $" @ \#`0 ?"`0 㿘! $# 0  $J#   $" @ E#`0 ?"`0@j 㷐  %?# $ $, c $ @2   @* 2   $@ ?"@ * $ ? !%# $ $-  c $ @2%  @绕* 2 % $@ ??"@%/ $  & : 9%3 +@ $-   $,@ @@  @熕* 2@@ %`@$ڦ`%@ Ҁ à?  & : &4   &@ **@@*   * @*`'% $# $,@\"@e $$,  " $ & $  $, @@ ?-"@& `6 4 $ `  `@ * "   `@ٕ*$`  @    $ $*@ "@@T㿘 $# &@`  $"Ā h $" d $"  $ $"쀢   $#  ` $  @Q! $ $#| K $"Ē@  !@   @   $" @Ք    @  $"  @  @Ŕ  $   $; $5c| @ &c| $"Ē @  !@    @՘  $" @ c ! $"  `2 ! $ @  "! $#  @ #@U  @~:' $#T  @  ,'5 $1T @h  T ' $#| ` @ @ 5 $1| @M  |'@'  @m  $"쀢  @   @3' $#H  '5 $1H @#  H'@ݐ  $"Ā f $" b $"H  $ $"쀢   $#  ` $  @O $#x I $"Ē@Ɣ  !@   @  $" @    @   $"H  @  @Ԕ  $@  $5 $3x @ɔ` ,x $"Ē @  !@    @  $" @ t  @ؘ  $"H` $  $ # "  $ @j  @-#T  &5 $1T @  T $#x   5 $1x @m  x@   @  $"쀢  @,  @U $#H  3 $1cH @E  cH@ @h 㿘  $ Ԡ" ` $#" @ 2& 6  &   $.@& *@*` `@.`&㿘  #   @  @`  @&@   @& @= 2 &$&  ( ` @*"@㿘` " 6` `( ,`"@`@ $* @` *  $ $ $ ` @*`$ ` `@*`$㿘@ 4F @,` & $,`"@*  & (@ $ 2+& @@*   & ,@ $@ (@ 0"  ( $, "@@*  , '  '  ' ' '   & & & & & & & 0@ 0" 0   $`" 0 2  $ Ԁ2   2 `" 0   $Ԁ 0" 0㿘  0  $, @  *  @ ?J@ J`  $@ : *@*``@ *J@ ,  $@ $@ :@   * $ unknown  <* K  2  * 㿘@ 㿘"#h"#l"#`"#d@ 㿘' $h#@ !@#l $#l@$h' $`#e @cd"cd@$` $J" E@#!   $#؀  $"  @` $!?`"@ `"*@@  $"Ѐ  @o`!? "!`$!*@ @  $"#` $ Ԗ?#d@ `"@l" "l##d $l Ԁ@G? "lcd@ $ $#؀ ch $J#, ""chl"#h $ Ԁ-+ $# $)! bЀ` c؀   @ cؔ!? "!`$!*@ @ c؀ "#` $ Ԁbl#d@   $J#,  $ $"D ""l $J#,  $# ch@[l $#?c`@ @~@<    @ϔ @/#l"cd#h"c`㿘#t cp?"cp!?` "@ . :  `"*@@1 㿘"#t"cp#`#d $"  $J" #h & : #h` ` ?"@#h#hc`"&#` : : " $J"   #h` ` ?"@#hc`"#`ch"   $J"Ȁ  $#$ #`ch" #dcl,  #l   $"D  $#d@  $ $" @ 0"#d3"c`" / $#l `Ԓ"@   6& $` $"D  $ $" @0"#` $ Ԑ?"cd $"D   $#lcd $? $J" #h` ` ?"@#h & : #h#`ch" $J#  $#؀   $#dclB $J" #dcl:  $#`ch- $J"Ȁ * $#$ % $"  @0 $א  $J"  $"Ѐ  @0ǐ cd "cd"#`#dcl* $!- $+)1 $' $%##d $#dЀ  @gb0#p #p  N# 2$`؀ $`#dcl@#d $"̀ "@#`ch1!' $%##p #`?$#`$  @20p #`ch@#p#dcl $1' $%#!#d?&#dD @0cp #d#l@#d $J" ^#hc`" W'!% $##`@ h d  @b0$#`/ $#`#hc`" 9 $#6 $#$  $ $J"Ȁ + $"d  @Δ0  "#`#h1% $#!#`?&#`$  @b0 #`#h@#`#`chP#!`3#t cp?8$cp $##d$* @#``* J@@ ` `0 @ $!?`"@ `"*@@ #` $"  @g0#` #` $#`cp #h@`#t "#`"#d#p㿘 $#@ @@ n$@ @@"&curses: __tscroll failed㿘 #xN`  Ԁ`%2,@Nۀ K * fg8g8g8g8g8fg8g8fg8g8g8fHf g8g8g8g8g8g8g8g8g8g8fg8g8g8fg8fg8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8g8f g8g8g8g8fg8g8g8g8fg8gE``` `c @ d 0,@`@ d@   0,@`@  0,@`(N@# N @N@ ,@``,@`@ , @{  `` ?&@* &@ N`a ,@1#x1 X㿘@* 㿘     @  &  㿘     @  &   *` $ R  $*`2  $# $  $  *` 8  $*` *  㿘!?` "@ . :  `"*@@ 㿘 o Nbؐ  "ؑ, * N ?а N  , , * N . * N"ؐ@  ?Р N"ؒ@ ` " Nذ N  2 N *2 @   *` ƀ: N   $ * : `2  #*`@* : 2 @: @ 1 $ƀN"? OOPS㿘# 1۰"*#N`ϰ #+ $#`%2,Nۀ M * nk k k k k mtk k mk k k mlk k k k k k k k k k mTk k k n k nHk k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k lk k k k nk k k k lk k k m```` `c @ f d 0,@ d@ \  0,@  0, " IGN@ N@? N@ ``` 2, ' $bD ",! $`"#0bD@(``  ,Ѩ ``,@  , @  `` ?$@* $@N`: @Mc1#TERMCAPTERMPATHHOME.termcap /usr/share/misc/termcapx" @o"L /!@f"@_" @@ /, $ "b" 5"@ $ )*`:   :2 ,  *`:   :2L L  L  $ Ѡ L  $L  /" 't@֐ 6't?'ttx@+tt@H$-#t ?@ ? ?㿐 @ǔ ?㿘 @Δ :@ 㿈/ // @찒&  @@ @ &@   (@ @8(@ @"@"`㿈 2 @ ``*?@ 2   N@ _: N "!@ @   2   ``*@{ 2v N @,`    p@ " ., * @`      p@ " ., * @  @}耢 2D +`@+`@ `?c , ;` `? , ;` `? , ;` @ , +`@+`@ `? , ;` `? , ;` `? , ;` @ , +`@+` `? , ;` `? , ;` @ ,, 1   㿈!#Ԁ @? $#Ԑ-  a??? "a&    ???  &&  *   &  &  x/>/>/>/ϐ#? @,`/ / / / / / / /UUaU  .*" :  ''! Ԗ  ͖ ϰ  !   "##   ! !" "# #  @ ' ` '@;`;`;a;a;b @ '` '@;`;`;a;a;b/ #@   e >Ô . <<<` ;  * ''  ''.@.`.`.`.`.`.`.` P # p * ?$   ,?$,  +   ` `@ & @`$,` `"@`,?$  ` @  -   *?,? `*?$  ` @@\ $ ?,?$ ,  @ @ږ   Ҥ  v 7  ,* ,    ` `4`` `"@`  * $ߠ  ` @  #P 7  `` `"@`?,@   ` @    x#/ , /$  !0 P + +  *`,  @ @<  @<  @<  @<` `4` @,` @ `* @ , $,  <@ *@     O,` @  /<`/<`/<`/ + , ϐ#? @*`"    ( O,` @  /<`/<`/<`/ + , ϐ#? @*`  ?"    㿘 .@ .  ?``.@ (8``.@.(`@& 㿐   *`@  *?;㿐   *``  *? ` ?T    ? ? .:   㿐@?"?{@( w@" c? Bj@3 *0bc? B"? B @ 0N@# Ic? C@  0;@ @  @ @ @ 0 @ 0c B@  @ @Ә 0㿐@?"?@ c? c? B  @㿐@?"?@r @l c? B@{ 㿐@X?"?#@t `? @^ 0`?  @O 0㿐@ ?"?"@ @ `? B? B @  0㿐?&'?> g|`-`6 B(D 1 ? >1: 8: B(, 8.% `3d"&@0$?0 B( ` 4    (* /?&'???@>LC㿐?23?45? ? # !!0h4eP2_P4[PSP" # #: 4"2+@   ":+@  ` " 80$А# 01#a0!10!02 6$#a % D?@p0$%"6 6 !!!ƀ6 &0"&Ӄ'?x́ N # ##  6? ?23   $? ?45!!‘ @#a B!!(‰ D#a0đ B!!8 B#a@ B!!H B…D '"##  !!P B?˥ !?; ?+@ @  "y@  ?? ?45!#8(@…B!! ¥ D? ?45  ; ( ?23!#8(@ Jƅ @ F?? R L!!X B#a`D B!!hD B#apD B!!xD B#aD B?RBB H!!B@ '"#!!…́™ JJ? RBD '"#̝#aH!!F#aBB!#X(@B'F!#H@B@ '"#!#H(@‰ȉ1 6? ?1/  ?23J DDJJ&'?##@ /@ !!!!Bʁ#a? +@ $2#@͐@ !ʁ !!?Bv B# @ : : @ 8  #:(?45?( "`8 J '"##aș Bʉ!!Љ B#a؅ BBD̑F!! B#a腠D B!!D B#aD B!"D BJ#b …HB‰!!ĥ&'?( ;` ?@- ! ?45?F㿐?$%?$%?  ( !? +@ 2   @2  0@ 3`?@i08   A! ?!  <7 !   !+  !$"`0t"h0r!"p0o"x0m    !  ! "0\!"0Y!"@0V"H0T#`H! a6?/H! a?$B%:  <!"X 6 €?6 !" "?@ !    "!!""#??  ?$%"#"!"@"!"@㿐@?"?@, b?  @; 㿈 * H!@   @ ` 0+#@??"Ē@ \  "  0 0 @ B 0 @ 0 @ ; @ ~ * 0㿈 * H!@  @ e0+#@??"Ē@   "   @ F0 @ @ >@ ?ݬgaO?!TD-?s ҁ?!TD-؀ \" T $&#@y ahM $  c'&#&#'" #?"`?"  $1 "@ ؀ ." & $&#@xݒah $  c'&#&#'" #?"`?"  $@؀ "  $&#@xah $  c'&#&#'" #?"`?"  $א "@؀ "  $&#@xah $  c'&#&#'" #?"`?"  $@؀ "  $' @xWah $  c'' ' ('''" @h؀ ' 0@x:ah| $  c'' ' ('" !"?#? B?"'@Ȓ? H#?"`?#? B?" @? H"`?"  $2 "@؀ / $* "  c'' ' ('''"  $ "@؀  $ "  c'' ' ('" ''"`?"  $@Ӑ؀ "  $' H@wah $  c'' ' ('" ''#?"  $@؀ "  $' h@wuah $  c'' ' '" 2""# ?"`" ?%?"  $ "@i؀  $ "  c'' ' '" ''#?" g $@G؀ e" ] $' @wahV $  c'' ' '" ?#?" > $@؀ <" 4 $' @vah- $  c'' '!'#?"  $@؀ "  $'!@vȒah  $  c''!0'!8'#?"  $@ؐ؀ "  $'!@@vah $  c''!X'!`'#?"  $@؀ "  $'!h@vah $  c''!X'!`'"?"  $@؀ "  $'!@v^ah $  c''!'!'"`" ?%?"  $ "@d؀  $} "  c''!'!'ܐ  ?@ ?"  $f "@E؀ c $^ "  c''!'!'''"  $K "@*؀ H"   $!@u!h'!@u!h $6 "  c'&#&#'''"  $# "@؀  "   $!@uВ!h'!@u̒!h $ "  c''!'!'''"  $ "@ڐ؀ "   $!@u!h'!@u!h $ "  c'&#(&#0'''"  $Ӑ "@؀ "   $!@u!h'!@u|!h $ "  c''!'!'''"  $ "@؀ "   $!@uX!h'!@uT!h $ "  c'&#P&#X'''"  $ "@b؀ "   $!@u0!h'!@u,!h $n "  c''!'!'" "?"`?"  $R "@1؀ O $J "  c''!'!'" "?"`?" / $@؀ -" % $'!@tܒah $  c'' ' ('?"? # ?@؀  $ !"c;``./;``./();`` (4 HH#hh2 H(*)HcXBc`DBchDBcpDBcx Bc @D@cBDcB@@#㿐?./?./*+?1 (4 JJ'2J0AЅ B؅D BD B腠D BD BD̄2 B F DLč@ ? ?./ @ȍ… DLānND)'W4b<CAQc޻a$n:BMI. ђ)>5.Dp&_~A99S9_(;/Z mm6~' OF?f_-u'{=9Rk_]V0F{kϼ 6a^e_h@؀Ms'1Vs`{k?!@ !@|@!@jz@"|@%@)!@,F:@/jz@1G\@2|@4k@5@7@9!@:@&& Ѱ !{41NH`hH!px>…> hH!BpxBD>…D>?!4R$%BDB''h Bp  B/". @2.ƕ; >?2  '"`$()x B Dȅƍ…>?2  '"`1() B Dȅƍ…>…?># >A>?? ; {+`# ?./  *` F:?腡’``D? `"B #*@?D3  /@a` >> ;``23;``@  *@`!0ʅ!! B !;``@@:`?*@Wd@ ;``@;``23 B! `?(,! @# Lt#hh!(B!0@j@!8 D!@ĀB_#hh!(B!0@N!HB #hh P?z@JQ !P F!XB F!`B F!h B!pD B!xD B!BHF!@ BLJ @!(BJ @!0DD  !(Bʁ @!0Dāʁ @#㿐?$%?$% !?"#?5 ( .@4 B @0@ Bʁ  ŀ 1 >2 . ;퀧 (  <(@?``2 /` ;퀠`(  <(?.<   ?. 7// ?/@@<   ?/@ 0@@(@(@  &'.7 / A(6`.`?&'. .7 /  ?(!?<   7 .>? .7 1 1( >?$%;``.;``2` *@!A@%/@`?*@H()b @ b(0b0 b0B@((@ ȇ*  # b8 D*BD#hh#hhȅBؕB@ b@BbH= HOD HbPBbXDBb`DBbhDBbpDB   Fbx bH- Fbxƅą…bH<$%;``;``#* ;``./b @$%;``;``+  ;``./$%#;``&';``: '< A2 , * F?*?  2  ;``;``&'*`B !;``;`` **` ;``&7'8  0  ! 2*8 3$ $D??00$%*?8  ;``&'*`@# ?!@>tD-p   -  0};z  * >pBk>@!g>@ * >pB>@!>@h  * >pBF>`!B>`$*@>h>pDD:>p:>h-*@>h>pDD:>p:>h- * >pBhh>@p>` >`>@p>`!>` 㿐?$%? BB > .  "#>  `2|  6 . . ` @ 6.|?.` F .8` F .    3 &F 6``.!    " &?&@ @6``.    " ``@9  7` (`?$%㿐?&?+ 2' +@$]%c0 B$%?+ 2?ϐ Jc8GD  <"a?@)c@?+ * ?&'$,%460#P ? <"a@ c@i["0<cY@c8@ B?+ * ?&'cH@ @㿐?&'?> g|`0`6XB`H   C .@1/< 8<XB`. 6.8.& `3d"'@0%?0 XB` 6/` 4    (* /?&'  +  @ ;``"##$NetBSD: kvm_file.c,v 1.5 1996/03/18 22:33:18 thorpej Exp $can't read fileheadcan't read kfpinconsistant nfilesh(0 ((@=  7(Р?`(("@̀` ( @' ( (?ؒ`(@` (  77@ kvm_getprocskvm_getfiles_filehead_nfiles%s: no such symbolcan't read nfilesX( M '' '   @( ?2((7' 2(0@ &((쀢 @((&(((( &(0 (( @ ?쀢 8 ((7@Vd   'Y W '(7# '7#0''ؠ@9 Ā   2 78@ 7 Ȕ@  7@P)  * @*``'(( 2(0@; &((쀢 @((&(((( &(0 '&(($NetBSD: kvm_proc.c,v 1.16 1996/03/18 22:33:57 thorpej Exp $ ($ 2 ` @( I&($`  $@* 8 8>Ȁ ̀Ѐ Ā@0 &ԴА@W @  @ @ @  ?`? @ܴ( ( "&($ _vm_page_buckets_vm_page_hash_maskp8#'8#''@sЀ 2?ؔ(@@ɖ  2 ?(D@  ? h(@ ڐ 2C?@( @ (D @*`(@@ @  22?( `@ ( (䀢"` (   @- ?2 ( 2( ?   ?($@( ( ? BUG BUG BUG BUG: object %x offset %x pgoffset %x pager %x swpager %x osize %x bsize %x blocks %x nblocks %x sw_blocks[%d]: block %x mask %x X`(@@  2?䀢 2|?@4  2t?`,Đ@둓*` ̀ 9Ȁ.9@!x`,9!& `(@9!@Ƞ Ȁ6O?39, ̐ @  #a@ Ȁ, 9?, ̐ @  2/?Đ@۪*` @K( :@`2(! * (   (  @x ?2(2( ?($@M( ( ? can't read proc at %xnprocs corruptcan't read pgrp at %xcan't read session at %xcan't read tty at %xcan't read tpgrp at &xؠ 6?8@!!:8mHX@  `Xp@w P` ``` h \t:@P?'P8@W  :`8D'TH'N7@E  :x&D` *$`'8@3 :$''`8@    :@?0>H''' @ '2`'`@ X@ 7'7Ѐ`7΀`` 8  8@!P!@!" I@cannot read allproccannot read zombproc㿐(@Ė  :В @  :@)?0.+ +  '@ & kvm_getprocsproc size mismatch (%d total, %d chunks)_nprocs_allproc_zombproc%s: no such symbolcan't read nprocsH( "(@o&(( ; '' '''   @ ?@"䀢 &( ( @ ? ;@[ @"  ;@"M @鑒"E';! ';!(';!8''Ԡ@    2 ;H@' @  ;@` * @*`@*`'@Ð &('&(㿘( @&(out of memory㿘@;@JЁ㿘E?=#8 (4 2 ` & &(8@*` (8 $((*&&(8(4ϕ* "&(4(( 2 (,@h( &((( &(0(,  .@\(  &(,.(4@ݘ"((n (4.@e .@`"a$@(  @(,( ( @ @(, "'4 @ڊ$ @(0 *((&(0q(( &(((((4@ "@"@`@*@  @G@$@`@$@ $ (4@& (42 $@,$@`@*@$@(4"@ " "@ "㾘@!!"0 (@  O% 2 N- " 㿀L - &=@:  2    h  a”  㿘<Ζ㿘<Ŗ invalid address (%x)㿐 %=_   @  8@f& %s: 㿘'P'T'X@P!!h=@βa(!h@Ք @ _!h0 (@y#: %s : %s㿘'P'T'X@P!!h=@Βa(!h@ϵ $@#ܔ!h=@Άa0 (@x@d@($ $@m#ܖ=@͔㿘@蹐 $@\#ܔ/netbsdexec file name too longbad flags arg/dev/mem/dev/drum%s%s: not physical memory device/dev/kmem8&(?&( &(&(&(@&(&( &($&((&(,&(4&(<` &(@@# =h~`="?=]s`="="@Z &( ( @ʒ  =_U`<  <=@b؀  =+A`5= @1  &(=< 2`@"  &(=-#`@ $ @ &(  @  &(=`@  `@ @; 㿘@(H  "T  $@#ܒ@n %s: %s 㿘@ϐ(H 2" " " $@n#ܔ!h>@rb  - 㿘( &(@( &(@( &(@( &(@( "(< @(< "(@1( "($@($ "((@(( "(,@(, "(4@(4 @@ %skvm_%s.db/var/db/VERSION_version@ǒ / 2 ?#$>>@Y   @ N&(>#' '(  2;( 6􀢨3@y>#' '(  2#(` 2( @_ ?#@@z2 (@b< 2( ( @&(?symbol too large㿐(  (@<F?Ԕ??@ /'J@ )$@h @?(  2 ` 2  ` @   @   2$* . . .  > &invalid address (%x)kvm_readshort read㿐( <# $$cܔ (  @靖 ?2(2(c܀   ?hP (@h  ?zB @?R0: m5$@g/$@+% $@Ԁ8$ (   @V ?2 ( 2( ܀ =( @(&?"$@@ڲ@$@kvm_writeshort writekvm_write not implemented for dead kernels㿘( 1! $$#ܖ (  @ ?2(2(#܀   ? (@ߔ @ @ @є@ʔ $NetBSD: kvm_sparc.c,v 1.9 1996/04/01 19:23:03 cgd Exp $_cputypcannot find `cputyp' symbolcannot read `cputyp㿘#? I  "a( @   ( a "a* a! @( $!c @h#  (   @蚖 ?2(  ( c@o   @`?0#   ` 㿘(<` !@ @@(<&(<㿘 ?# @Ɣ@㿘  ?# @@*cannot read segment mapcannot read PMEG table8(<`2 ( Ra B&(<( @ <( !@ؒ@ Ȧ b! $$#( @  ?2 ( 2( #܀  ( @ޔ 6@AUؐ  @a*`a $@ @F(<&(<E?( !@㛒@ Ȧ b@  @a* ?@㊒@В d! $$#( @ ?2 !2!#܀ !!@  @a( @@犕* 6 A{?invalid address (%x)㿘=#@Q(<6`6` ?*`@*`a ` E`@?   @a!#? >`  ?>` * @`' ( ?@?*@ !+   @ ` `@` @ @" &(  & AX _npmemarr_pmemarr_kernel_segmap_storecannot read symbolscannot read pmemarrcannot read npmemarr8(<  ;a &(<c?cЀ BV #  (   @ ?2(  ( !@ A9#  (   @ۖ ?2(  (  @汔! B8#  (   @濖 ?2(  (  @敔  6 BP?cannot read pte㿐=#@\(<6`6` `??*  * !  O#?  >`  >` |@  (   @ ?2(  ( @U   BG(( ` $ ( ?@ +    @ ` `@` @ @" &(  & AX 㿘 $  ̀    㿘 $ ؀     $ ܒ`*` 2`@ C $ ؑ, ?, C@f 㿘 a  "a@(#)setlogin.s 8.1 (Berkeley) 6/4/93 2 +`@ $ `@(#)reboot.s 8.1 (Berkeley) 6/4/93 7 +`@㿐` ``   $  $ ''' "c? `@堔㿘`^@喔 " (" $ " ( " $ " "  g"  ?"  ( $$Id: swab.c,v 1.3 1993/08/26 00:52:03 jtc Exp $2":J  *@ `*@`: DJ  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`$Id: strspn.c,v 1.4 1995/06/15 00:08:37 jtc Exp $  ( + 8: " ( "$Id: strncat.c,v 1.4 1995/06/15 00:08:07 jtc Exp $J H2 @ @(`($Id: strcspn.c,v 1.4 1995/06/15 00:07:51 jtc Exp $   (8J2J "$Id: rindex.c,v 1.4 1994/06/11 16:49:15 jtc Exp $ *`:`J "J $Id: index.c,v 1.4 1994/06/11 16:49:13 jtc Exp $*`:`J   $Id: strsignal.c,v 1.3 1994/10/06 18:16:18 jtc Exp $㿘 @\a$Id: strmode.c,v 1.3 1993/08/26 00:51:54 jtc Exp $< "$ b(" c p ? d ?" l0  - ? s ?*@` r -*@` w -*@@@`@  - @ s  x S*@`  r -*@` w -*@`  - s x S*@` r -*@` w -*@ ` "   - " t  x T*@` *@*`$Id: strcoll.c,v 1.4 1995/06/15 00:07:44 jtc Exp $㿘@V$NetBSD: system.c,v 1.11 1995/12/28 08:52:58 thorpej Exp $sh-c/bin/shxE#('E#0'' '4 @V@[ 'ܰ?  @V$?@V $E#8@X/@ @9  @5 @b> @Vpܐ @* @'??$NetBSD: strtoul.c,v 1.7.4.2 1996/07/20 01:14:24 jtc Exp $㿘" @  ` - +  L@` 0 L@ x XL`` 2? 0  ?@?@9  )/ $"ؐ  " ?А   ?ɐ?8?2  ?? "%ܤ @ @آ`4 `&@$NetBSD: realpath.c,v 1.2 1995/12/28 08:52:47 thorpej Exp $./8!F"@ " ". . @Ô#.#@W /@`F "@(*`J@ /"*`@W ^ $@i  < (  @V$ &G $.<   @Wf : $F"@@d$ / $N / N `?O @@ݐ $ $ ?"c܀`F@~b@{@V  $ #@=0  $#@V@6 $"#ܰ $NetBSD: random.c,v 1.4 1995/12/28 08:52:43 thorpej Exp $㿘# #8"#" #+)q  9%c. ?@"m$@ c# * c " "# #*` *  !@ #*` * random: not enough state (%d bytes); ignored. 㿘## "##" : * @#@" !hGb0@SP  ?"#"#("#   "c "c  "c   "# "c "#  "c ?"c "c 5`&#*  "$Z#  "?##" : * @#@"random: state info corrupted; not changed. 㿘@ @ ## "##" : * @#@"``"#"d,`@""x@" !hH@þ`( "## ,"c!# @c* $# #* c "$㿘# #q@bm `9  * $$  #@ " @2 `" #$@ #" #  ## "c$ #"$NetBSD: getopt.c,v 1.8 1995/12/28 08:52:19 thorpej Exp $%s: illegal option -- %c %s: option requires an argument -- %c 㿘 $   $#4J ) $ $" #0 * @"c4J -H""c4?4J` `"4J` -  $#0`"#0H""4q? $c4"c4J`:"@ 2!J  $ -\?#4J c0 "c0#, N ?N :J@ $!hH/b؀ :  $"##4J 9 $3#4J@  $&"#c0 "c0Hb"#4N :  :#,  @ $!hHb@³ ? $#0* @"cH""c4c0 "c0 $ $NetBSD: bsearch.c,v 1.5 1995/12/28 08:52:10 thorpej Exp $㿘>@@  $>>> $NetBSD: atol.c,v 1.5 1995/12/28 08:52:08 thorpej Exp $㿘 @ $NetBSD: atof.c,v 1.7 1995/12/28 08:52:05 thorpej Exp $㿘@м $NetBSD: atexit.c,v 1.6 1995/12/28 08:52:02 thorpej Exp $㿘 $c2 " $@} 2" ? $c""c "*  "  㿘 @? @Ė㿘  @  x@''J`' ' '' '!@ 耢  ?㿘'L'P'T'X@L㿐@ $@ɐ "4 2V @ٖV 2  6  ? " @٦ @ V   "@  @! $#ܐ?逢   $ @  @! $#܀@"  @  "& @V & & && & &  0` @@"& 0@G & 0& 4 D `@?& D`& H6  $"#  @ @S &6 @Ð6 6 & '!H& $'!& ,'!& ('"\& 㿘`?` &``@ . :  " @ &@* `@X $NetBSD: auth_unix.c,v 1.3 1996/03/29 23:00:47 jtc Exp $authunix_create: out of memory Р@f (J@a!D & & $ $##$` `$``$`` & `& `& $`H@] H''''''0P!@o @ 24@ @0$` $@@+$`P@t@&`& `& @0!hJ@ɒc X@z ?@@R/@R @R@㿘 $ ` 㿀@ ' $``@   "@W$ @ "  & &   '@ $ & &  & @f `$ @2 8  $ ''  @ߖ @(@ '' € @"  $ $ $@1 '@ `@㿘 $@   @@ $  @@auth_none.c - Fatal marshalling problem㿀 $`!@ @/ @* 2 K@j#  @$a  `@`     $ @ @@ʾ@: <  ! ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@ٶ`  @ٰ㿘 +>/;#-$ .@ @@@ % @    ,@  ,@ $ ` , 2  .@ @ɦ@ @"ò`@" @"`@@7@Y@"@@@"@7@0@% "|Z@@@ 5@@ .@ @ܘ" .@ .@  .@  *  &@: :  .@  *  &@: :&㿘  >' % #"3$`@ .@ @"6@@"A`@ ך @L @ Κ @"@ǀ`Ě &@P(@"}` ‘, N: @   ` * `  @  2`` ``: N? 2 @  ` `` ``:{ N 2w @  u`p `2`` `: `N? 2`@  2``(X N?@  2R `_"O `:K N@  H``_E`@ 2`` "``: `N 2`@  2``:( N@  2" `_" `( N?@  ``_` @ .@@  .@  ```2 @ .@> @"\@"f`@>0@"f`0@">@>0@t0ˠ,`, @`?2`` ?" `,    $&8 `,  `   @ 2 @ . @   . 24 2>, /` " `/` >`" , & q 2ef[>,!>3$#%"U 2I@ .@ L@ .@ .@ ",`,  ` &: : + `, &:@,`, ` &: : `,  :  㿘 @ N * @<   ) @ N@@"    2        ,    `    `    0   ` @? ` "ؐ  _ "ؐ  2 _ "ؐ  `_{`  "ؐ  {_  {  @3@  @  @u` &  `㿘 0 @ N * @  ) @ N@    2        ,    `    `    0   ` @V? ` "ؐ  _ "ؐ  2 _ "ؐ  `_{`  "ؐ  {_  {  @3@ 2@ @  @u`㿘  ى(>)' %#!$ . @"~%@"h @"I(@J@N?~@ @V @@@m@ (@^@ꀠ@@   @Z"@p&@(@ v82rm   2kf e b( 2a\ 2]X 4YT (  Q `J G(( 10>; &7(( 0(( *(( (   5>3$ @(@2 ((  ( (( 5) `     $ @ @@ą@: <   ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@O` @I@G`$ 㿘 +>/;#-$ .@ @@@ % @    ,@  ,@ $ ` , 2  .@ @ɦ@ @"ò`@" @"`@@7@Y@"@@@"@V@O@D "|Z@:@3@' 5@@  .@ @" .@ .@  .@  *  &@: :  .@  *  &@: :&㿘  >' % #"3$`@ .@ @"6@@"A`@ ך @L @ Κ @"@ǀ`Ě &@P(@"}` ‘, N: @   ` * `  @  2`` ``: N? 2 @  ` `` ``:{ N 2w @  u`p `2`` `: `N? 2`@  2``(X N?@  2R `_"O `:K N@  H``_E`@ 2`` "``: `N 2`@  2``:( N@  2" `_" `( N?@  ``_` @ .@@  .@  ```2 @ .@> @"\@"f`@>0@"f`0@">@>0@t0ˠ,`, @`?2`` ?" `,    $&8 `,  `   @" 2 @ . @   . 24 2>, /` " `/` >`" , & q 2ef[>,!>3$#%"U 2I@ .@ L@ .@ .@ ",`,  ` &: : + `, &:@,`, ` &: : `,  :  㿘 ( , 0 @ N @ ,@ @k@/ + @ N@@J "    2        ,             0  @?  bؐ  _  bؐ  2 _ bؐ  _{  bؐ  { _  {  @ߚL@ @@Ξ@Ι@Țd`& L@ ` 㿘 ( 4 0 @ N @( ,@ @ + @ N@    2        ,             0  @f?  bؐ  _  bؐ  2 _ bؐ  _{  bؐ  { _  {  @&L@ 2@ @@@@d`㿘 >%' #!$ . @%"r "J) MS?~ʶ „@ b @w@"@"n 造 @  h"~@&(" 82@   2@x w@r  2r@k 2l@e 4f@_ (  \  U@P  @.  @O@@ F/@("C&> @.  @@@3/@O@/ (   5>3$ (  @ @.   ( "@@@/@@@( `㿘<"e@  @4"E@2 `( "`    "   '*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x` >@7 !!  !@ !` @  !"`@ @`Y@%c@ɐ  @0@uI*?0%d㿘!! " @  "  2 Z@~`1Z 0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @Ր@9!S4v *`  $`@.* $` $`` 2$`@ʡf $@$`$`$` *`" `` " H!$ $ $ $ $ $ ($ ,$ 0$ <$ @$ D $ 4 $ 8 P @@!$ H@  `?$ @:  @o @ @  `?$ $@ @ e@ s@ $ L4"E$ D& & <"e& ( @  ` "`@F`㿘  @  @* :  |" :`" @H @:  @ |*  2@ޒ  @&J@ |!` & "@ Ö   @ " @ " "@    @ Ԕ" $@ "㿘 `& @?ܑ* : `X ] *`@vwwwu|wvvwwwwwwwwwwwwwwwwwwwvwwwwwwwwwwwwwwwwwwwwwwwwwwww<wLwvpwwwwwwwwwwwwwwwwwwwwwwwwwwwwwv @ @6   D`" D  D ,  " @  @J@ ) ) ,  " H@ @`&J@ )"`@ [@ڔ  `( "`( `, "`,L @̔  `( "`( `0 ?"`0@ ;@ݒ 6   @- @ (@$ @ @’ `&J@ @: , J@bؐ  @ , :`@ @  @?֐ , :  ? {ѐ` J`bؐ   &@ , :  +"%  ? *"  ) {G"@d @E" "@X  "@N @/"k "@@  @!" @c""@  @Z $@ K@* @J@ ,`&J`bؐ   !@@ @d @ J@ }2 `&@    J@ }`&  @ @ @  @  @?֐ , :  ? {`  J`bؐ  @Ȓ 㿘 @ @  @   `&@J@   㿘   @ J@ ^ `&@x  `( "`( `, "`,  @ @  `  J@J` `@!   ` ?& @I  `( "`( `0 "`0 @] 㿘  &J`\a) @ @L `& @aa)ya)a{`." `[`*`!a("( a{ a}a9a1 ~0`[0|  @dy @ t@Ip@ k D`" D  D ,  " @ܔ @ `  J@ \J` ) \A ) ,  " H@ @ ` J@ \ J` )`)&@ʒ %?Б, `H @` `@`H@ @    "`H@ @ƒ ~ @:"J@ *2`& "@ @m" "@ @a"|  @ r` p`$J@ \l`$J` {h`$`&@k J ,& @Jbؐ   !@R@O !@ @ `  J@ \ J` }2 `.&  @ @  ` : J@ \2J` }"  &   @ @ @  `$   㿘   @! J@"ؒ@ ` ` ؀ . * ?Ж #J `J   `  @Ւ [:<:]][:>:]]㿘@Ր @  `c(@  2& @ `c0@  2 (@  & @: J@ ^2`& @:J@ ]2 `&@ ] ` *] ` ] @:J@ -2 `&@ - ` *- ` -,`  "J ]"     J -J ]"@ @ : J@ ]  @:J@ -2 `&@ - ` *- ` -,` @`&J@ ]" @.   t ` ,`?,"` % @ `@ؐ  "?@* :  @ ` * ` ,`? ` @b/  ?,  @ `@*@* `" ` * ` ?,`   " ` @ ` *@* `?,`` @1@  @@@=0@[@ 㿘 @ J@ - [2  @  @ 0* :  : ="40e &  @ J - ]@ @ @ @y  @  `  J@ :J` ]3`@f 0u &  @] J - ]@S @ @ @I  @ ` J@ = J` ]`G&@3 0B@  J -@ :,`J ]",`& @ J -& -@,`:`, : @@ ,`: , : :` @ ` * `   .`㿘 " J@  `& """ @@ 2` @J "@` @ @ 2`@ 0 @ ` * `.` L   `@@ L 㿘@K = @ `@ * ` .`㿘 @ @  @ ` :&J@ [ `J` .``&`&J@@ . @ ` J@ . J` ]`&@V , > 㿘 @   : J2J ]"  &   @  """  @@ 2`@J "N``@   @ 0L@؄ ؄* : * H㿐 && / ]//&& 㿘  8  "ؐ@   ɐ* : ے0@`    4" 4,㿐 &&  ^/ / ]//&& 㿘     .2``@`d D*`@TTTTT`8TTTTTT,$ " p&  "@c`   @?" @""@6  @x $@- 0K "@?  @ " @b""@  @Y $@ `@   "@ @"0@l0@֔b0@  ""  (""  㿘 ` "`     M & 4 @Ò   2 @,   @ ,  "`   2 @ "` @  "`  ,   @:``  $ ` "  ``%@  @    - @  @r:`  &   %  * . . & &  ` (    (*   *` 㿘`  *` @  (  2    @` @ @ @ @ @   *   &@>    @ `  " * :       @ `  2  㿘``@O&`` @&` @5`&` ` @ 0?@x5``  *?㿘@%@+ "@  `@Ӕ"  " & @ &  @ & 㿘@@ 㿘 "   @  @ N    8 `         ` 8 `          㿘  (`8? @ 2   " `4`&`4   ,@ @ 2  ǔ 2,@  $ @  $ @㿘  @c   * .` @r. & 㿘      `2`@:`*`@E  `&  *`@" 㿘  ' ߐ ,  *`  "` *`H "`H *.   "  @* "    (@> "@㿘   @.` 2& ’ 0& 㿘 &`  @*` &`  &`㿘  v ` >1)'%##$" @ "2 @ )`@"- @ ") @  `@" `@" @*  @  2`( @   @`@$ &`@ @ @2`@ $@  &`<&`@ &`(`<`@`> @  @ *`*   ! `>     4  2 `("`( ?2   2@  *2  ?: : 2@  *: 㿘 ؀  @X5? ``!"`㿘`` >@W"`$NetBSD: rcmd.c,v 1.13.4.1 1996/05/28 02:29:31 mrg Exp $rcmd: socket: All ports in use rcmd: socket: %s connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0''@"@ `2@@yV?%@40  #'' $)@K܀ #!gg!h@c09@gܔ!h@#02 @ / ` /7`@,` @]  ?@܀ 0 =?'2 `4`@Aƥ,  '@!hg@hc$@N ``$``@` '@!hg@Uc0@gHܖ!hh`@L@0?` 'h`@ '@ڐ `'@4  h@@ @k@  @"  $@g#ܔ!hh@`  @ 6 *   * "6`*  `* ? "? $"#܀   @zH  6`* `?:  $#܀ " @f!hh@ޒ`Ho!hh@ؒ`pi@5-@2 6 '@ $@f#ܔ!hh@Ē`W'7ـ  ~* 2 ! !hh@`>@ @@ @@ @ߒ@    $@f#ܖ!hh`@O @͔   @ O @20  @@@͐@2Ԑ?㿈 / /'  @y &?`7@y  ! $#܀ 0 @?"$@@ #$#@?@֐ 2 +?)   h " . @ @Ô    .  "?p . ?p  @< ݰ  ". ?/etc/hosts.equivr/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner8`  j j@f`  @c @Z @ 2U?"l 2 `"M? @CF@sj@e;`(@3@2j@f` @20 @E j! 8<  j PT@G j p` @j  j  $" @Y?'Hx@[!x%'!@f @s 2@ ? & @ `& @ 倢?2 * : : ؐ  *  @.@`@N@   *`N@  2.@`N@ "` "`J@    @N@ @`N@@.@J@  xH @# zx@@d_!N@ +/wN`  @` H% x @#4x` -HN`  @` H?x @#x @O` @JL + -L   @  &  @#x!` L   @"  ? @"x @ @?@`?`"- "*?  `2#   ?㿘'DN@bؐ   @X?D`?@ 2     @5ߔ    D %lx.0.%x%02x㿐   7 7! #8kc@mt@>#8    @` @ @@2 @ k@m\c `k@mUc@1kL 2  @`@mH#@*L@k@m<c@ 1 #8  Mlυ(85@( |||||||||xxxxxxllllll *   J ` H* *`@@c 1/@qL # #@qE .@qA :  *  . : . ' . ` #l#l4``4 `4 `4 `4 ` 4 @I  2`4@ 4` 4` 4` 4` @q   * cj@0  cd@+  #`#`4@`4``4``4``4`` 4` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx  N - #\lch@c#!#\#`lcx@c!!Ք#\#`lc@ct!!lc@ce '''@! @ hm!l 0ӑ* :  KY`*    ,@  ,@L@  @ l#+` lN 0ll#"#Ȫ#N  L@ `" 4 @ǒ  ,?ܐ @b,@?@b!@㿘`    @t, `4  @&@ / /&/㿘`@@   `@a .`n!А  ?*`: &? *`: ? *`: ?N   2    8  % ,  $88P$$$?,@` ".`,@`  ,  ,@` ,@`@*` @$@$@.`.@㿘 #x  @   @ :, @ .# ",   @` ` ` , :` @ ,  @ , @ 뀥 ,1 #x㿘 #`  @`ޒ o А *`: ? *`: ? *`: ?N 2    ,  @L8\pp,@`  ,  ,@` ,@`@* # $@ *# ͔   *` .h *@ `*`8*@`*@` * *@ #%d.%d.%d.%d㿈'#\1   o@ 0  02   "2 2  * ?*@#d?*  @ ?*  ` #dd#`? *@0 @  `?# @No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x N "  $'@#'o#' ' $@ #@$$  o#$ $ ؔ$ : @~UResolver internal errorUnknown resolver error o #̀o#* 㿘 $@6#@6> $ ` $ @z  $# @6㿘 $@5#@6 @z `  @z   0耦`  $ @zÒ  $# @5㿘 $@6j @6 $@z  $  @z   0 $ Ѐ @6]㿘 $@6#@6 $@_ɒ  $  @_   0 $# @6㿘 $@6#@6  $   $# @6㿐 '?c  !$`, @Q$` $  "!P@ %@RO ` @RF `    $ $ !d"!d !P"  `"`"  w  !Pr@QMk@R* 2  @R* 2  @R* 2 `  a쀥 P% @ H% `  @Q  = #aPQaP 24`21  !\@2* $'` ' '`'`   #aP@}  "@ a@  %@`@#%%@"4@ !` s@v31 !P $ "c bf㻐L@"ؐ  4L ./ @Ra 5 !P"!P ad& "ad &  &  ` !"`"c& J@"ؐ  `. J@ 2J@J .  ؀ @N? @RB $ "c= "@ O  qb@]{   J; & f y b  2 @\  @1$  @   ڐ%u.%u.%u.%u.in-addr.arpa㺐c r` ` ` `@g @ ؀  @M?@K"@K O  qb@]   +   ' J: 1 f"% y b # 2! @  @1)$:  & & %`% @$@Δ   ϐ/etc/hostsr㿘!"T  r"r@^lb$"T@C"T""X㿘!"T` "X @|6 $"T# 㿘!"T  r"r@^Fb  $"T !$@^kT2L@W #r@\mc(.r@\fc0 .   a" $ @Q; !P"  "  " N "  "  !P"!P !d"`r@\Ac0 .  !#rN    $ @\)c0.  2N$1 !P㿘h @]    @]   0^  $ "c㿘@ d   @. A  $ "c4  d*  l h"  * 4 @ d* l h *" 㿘 !P"!P `" "  "   ( !d" r@[c02 , !P 2V$@W  $@P]LL "  " s@[nbР"  L " ,  aP  "aP!P@w  !쀤@ $@`   !)rL    @$@`@[:#0,  2L$@$1 !P%u.%u.%u.%uhosts.byaddrx !L!L   @>$ * t`  @d   ' @$# @aLt`Ȕ@*܀  Qന $ "chosts.byname㿐 !L!L  @=    % @M$! @f!Lta@*   $ "cLC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGC㿘! #  t@a" $#t"$# `   . 1" !",`@@i@``$,`N@ 7 !". @:  @5"t@/#. t# !@Zr  u,  "'  !,`@",`@Z^ ``, ^  .  !@ZO R, @h /  !,`@Z? ``, ? L /"L I !$  ,``@Z%,`*`N@ /"`  `/"N@L  N@ 2ސ$` ,` ! !ؐ@hr`  @J @E 2 ``  @ %s/%s/%s/%s/%s㿐 "@hKbİ "") +u#$#D. @uZ@  "#\#` bh @@ `1   . 1 "؁POSIX%s/%s/%s㻘.  !b @u6 . / a t@u*c u@u$c   . 1"@ @g@ 0.  !b. $u( @b  6 @(#)setjmp.s 8.1 (Berkeley) 6/4/93  0 " 5H P """  """㿠   @" &  g @@(#)_setjmp.s 8.1 (Berkeley) 6/4/93" " " @" `&"`@6 0`㿘?@9㿘? @9 ` `؄@2*` `  `  `  *`\ @ \*h` fv*`P8ۀhۘ ۰ \*  np* \*  rj* \*  bd* \*  a^* \*  vX* \*  tR* \*  fL* \*  sF* \*  0*Є= * 8* ` @ \*  `00* 00*  `0!*` \*  M `* ؄@   ^*`  ? *`@* -* * *㿘@*  `@, < :`%`.&㿘 N@`N@8N@N@  *"㿘@?@?  㿈`2@ '`'''@%j  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~* R /var/run/dev.db@.h @ 29 <  x0  0   @w #P @c 7P'T'X '\` X` 2 ```@`d`@1 @@/dev/8x@q!X& @u[2@r `@! @5?@ܒ @@`@@rexph`XPH@80( USR2USR1INFOWINCHPROFVTALRMXFSZXCPUIOTTOUTTINCHLDCONTTSTPSTOPURGTERMALRMPIPESYSSEGVBUSKILLFPEEMTABRTTRAPILLQUITINTHUPSignal 0 I @*`2`Jg" 8o-"M XO+"KL* D`H*  u2D*  !00    ** **  *  +  +  "   *"* 2 㿐M@ O?' @@# ,@#2 8 @  @ 8,`?M@bؐ  / @Z۔ * 2 #` @  А `M@  @ `@O,` $@ , =/@3 0@/ y#l, M@ g"8 o a"   u"M@` +` - =*`:  ="   *`> @?* :  * ,xxxxxxxxxxxxxx<xxxxxxx<xx <x$4$2Ъ`"ͪ` II `@̓,` $@ ,`?>@6` =" + `@,` m$@ ,`? X@d6`  `@,` V$@ ,`?M@>@M6`<=="  `@t,` 4$@ ,`?>@+6` `@\,` $@ ,`? X@6`9`M@  ,! `,@R`g"*`o`= -`X`+`-0=0:`u05*2 -2   +* '2  $2 *2 2* ?2  * 2 +-  =  *   - +  X@2`2 `7 J@+-X   J@-+`8  X`8  `( `** 2   ** 2  "J@** 2 ͐ longjmp botch. 㿘 {`@ 㿐 ' '   @8@?%u㿘 ?*  cȰ  # N  2# # cȀ @   $c@ k2&`1  #̒ {`@}#̐ @@S .  㿘 ?*  cܰ  # N  2# # c܀ @  $c@֐2&`1  # {`@}# @@SĔ .  /bin/shsh-cx'N@ r'䀢 w $K`  $ "cY @ 'R @$ @%?` -K@@@}@; K@ r  "@"/ @m  "@"& @d@a{"{c{@И @ʐ  r2@q@q@G#`#` c#@"c㿐@rː #      2  % $? @+ ?܀ " ` "c$@@{??㿘 @ ?@@?c  @ ??˰?#@є °??@ ?# @! ?E??#@!=?#@?@ ?# @! ?0??#@!(?#@?@ ?# @!  ???#@! ?#@?@?# @?#@ t??c@ ?#@?#@?#@?#@?@?# @?#@! ?#@?@ ?# @  ?j#?#@ b??#@?#@?@ ?# @!  ?G?#@@ ! =?#@? ?c @ ̀@?.?#@@@@ ̀@"?#@? ?c @! @"?#@@@@! @# #? @@ @ @\ #@?#@?@ ?# @!  ?H ?#@@ ! >?#@? ?c @ ̀@?/ ?#@@@@ ̀@#?#@? ?c @! @" ?#@@@@! @2    ?# D?#@ b  $ "cm??#?% #\    @_    , , 4 $    2J@t ? Հ =?3  @A/%)@"" ` 2J@ "@l 2 `$  `, `4  `? ,   2􀤠ۢ` ˀ@oؐ  ؐ     ؐ  ؐ  ؐ  ؐ  ؐJ  ؐ  ؐ  ؐ  ؐ  D (   ? 㷐`"@`"`"`~"` "`"`d    \2 2   \? 2  `  2 *`2@0@㿐 {   }  @\ {@ @ 㷐@@2@`@`    )`[2  ] `" `]` "  {2` }2 ` `܀`[`  @R&@M@ [" { ,#`?` }`9``@ ] `"@`@`]`@ "' &`#``@ ,2@ ` 2@ 2@ `R&``@(@& HOME㿘 ~? (;     /" *@*@ `*@N@  @yz"P@ @" @ߐ   @  *: 2`J@  @2 㷐@ a  [  !  - ?"?`  [ *"?` K I  !" @D ] 2 4@ [4@ !9`7 !`4@` 4@ - ` ] 4@`4@` ]` !&`   ]!&`   ?!&` @    *@"  *4@` 4@@. "@!` 2 #"2` @  `* ` ,@ "@ @g` 㿘@j@㷐 @  8 5  -  @`?`2`@*`2 `  ]@ @ 2 8 ``( `" @*`2` @  ʰ @*@`?㿘 ` *   `@??2@@ .㻘  (7@:` @2` @g0@㻘@* @2$@.;0€㻘@ @2(@0€    *@ `㿘@@@h @offonsecurelocalrtsctssoftcarmdmbufwindow㿘  ܀  ! @u # #   @N ܀ @[6 2N `? "`@k   " •?  bؐ   ذ N  2 N "  #"  *  #"#@ڐ$ N $ $ @ϐ #"`N "`@Ð #" " N  ##a@~   N bؐ   ?|$ a@~p   N bؐ    j$ a@~^   N bؐ    X$ a@~L   N bؐ    F$ a@~:   N bؐ    4$ a@~(   N bؐ    "$ a@~   N bؐ    $ a@~   N  =2  @r$ @)N o J ؀ #" N #   N "  "  #"`N ""`@Z0 2.1 # JA "`6`2 J\2 J ""  *`'# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@Yߒ =   /etc/ttysr㿘  ܀ "@2 0 #@Mc "`܀@ 㿘  ܀ !  @j ܐ8$ ܀@ __YP!㿈! x 2'  "X @k $ x '@Ő''' x  8`?㿈 x 2' @' x  `?㿘%  !8'$t쀢` (J@   ?@  @=t"@  t"``J@   ?@q  `@# t" @h`  t" %t`"`` "` `"`!H"```J@   ?@L  `@t" @D`  t" ``J@   ?@3  `@ t" @*`  t" ` `J@   ?@  ` @̒ t" @`  t"  t`$"`$  ! "a4: 㿐'!@u#&@q#& @m# "J @K& @cc > @K!& & !H& @S#& @O#& @K#& & $ t`"$  !4  `&  !4  t &  t  2&  t  2&  t 2&  passwd.byname` ! @  @`! !$   !,!,   @,  $!$!$ e1  1 ؀ "<!(%  #\#`a,a80@@=!(   &!( "!$܀ "'@1'"a( Q"a0 !,a8 ( 0@ ؀ D 8"!$@̀ @? ``J@ ! @# !,a8И@K؀ "  | "% @! !,a8 |@8ؠ "!$@ |  & |܀ n`@j` a8@@'^"!$ a8* 1  쀢 U`f  !`"! 2/!@ ' '@q R`M  J@ +  J`  @     "a$ "a$  @Ր 0"a$  @ "`|` J@ -&1 J`  @ @`Ԓ@̀  Ѐ`J@  @m`  `1   +p X@u'' 1/!ؒ@# ' '1 !   ! ؟   p ! @ "-  ?  "!1 + # -) 5  !8 2/@ ' '@̐  J + - 0a, @+a,  { J   @a(C a( a,@$a(a,@8Aa( @$a(2 @ ܒ@NԤ@Τ? `a(J@ a(@ސ a,8ؘa(@!0 #a( "$a(@$a(" @$a(  @'ؖa,8ؘa(@!0  a( "Y$a(@U$a(a(8@e!0!0*  G 쀢 % @J ``@2 @ ܒ@Ԁ  ؀`J@  @i   @c  !  !! ! @$!! x " @$ x" tF da( a "a $  !  !! ! @$!! x " @$ x%" t 1/@>ဤ  @' '@А !  `! ! @$!`   %dpasswd.byuid` ! @ "0   ?cX@QY   "a1 + % ) 7  !8 2/@ ' '@  J + -  a, @*Ia,  6 J   @(E ( a,@$(a,#@c`C( @$(2 @̐ ̒@Ħ@? `(J@ (@ a,a8Ș(@!0 $( "$(@j$(" @d$(  @}'Ȗa,a8Ș(@!0  ( "X$(@OT$((8@!0!0* d F 쀢 % ?J ``@2 @p ̒@Ā  Ȁ`J@ i @! a    !  !! ! @$!! x " @$ x" tA c( a "a !  !  !! ! @$!! x " @$ x " t 3/'@ ' '@ !  `! ! @$!`   㿘 "! "! "!$ !( " @ "!(1 x " @& x" t 㿘 㿘 "!! ! "  @$! "!$ !( " @ "!(! x " @$ x" t/etc/pwd.db/etc/spwd.db%s: %m㿘 @"!$ !x!   @e   "a     a@  "` 㿐 !  2l  䀢  ! d"@> 耢 $ \    " ,    " ,    `@   `@   `@ڔ   "!,    "!,    "!,    "! ,    a@  &@ a @    "a  /dev/ttyw+ ` @G `(!hP'Đ 'Đ 'Đ @ST @Ԧ   ?'T @Ĕ@=@,q !8 ! ? $ @d?`$ @? : . .T`0@ Ԑ 'T  @Ȑ @  1 @d1 !8$NetBSD: getnetgrent.c,v 1.9 1996/04/27 18:59:05 christos Exp $*netgroup: %m㿘@ϐ 2&  @b&  & @Ð P & @b㿘   2 & @9*` & @wb  & * "@㿘`  .`@ ` @*@ @㿘  , @`9   * 㿘 @ "ؐ   ` 2`L@  @"؀  J`  @   "J * :  "ؐ   ` 2 L L   L & "``&@% @ b@@*? & 㿘@ 2 @ גb $ ,  ,   )    "@f @`@^ netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀%  / @_ @Ð,@`@J?''  ?0@&@z耢 .& @ rb+ @z!@ #2" 310 0!""@@@F䀢    netgroup: Syntax error `%s'㿘J "g J@ #"b J " @ "ؐ     &J  2 @J (23 &#@ ;?9 L  ` "J@ "`&J`   `ؐ   "" @ &@ @ ߒb@@@*? J@  # netgroup: Cycle in group `%s'㿈i  @h!h@0.. 1 %'5m耢   ?0 0@C0 "` &@N㿘 ` `@^d  `  @^X     @^L   㿈  @!h@TR Ȓ 1 F '耢 8 ?305" 2 "@  "@  @@  ʐ@ @ @~%s.%s㿘@+  @ b N "`N@ "@l(%s,%s,%s)㿘!H !H`!H@k8㿐` @" @z @N   ,㿘ז  Ж  Ɩ   # @>7@"NN? ,2 N`@O0  @ @ 㿘``"" #!` $`@ " @   " @   @@ `$ ! !  @$!/etc/netgroup.db+㿐v' ! !       @a  $! !   `8[ 1 @$0@@ @ b`" n " ""@"  㿐'! !       @`˜ $! !  @#֐``8  1 `@#ʐ@M`  `  3`  2  2 @  㿘! !̀     @*  $! !Ѐ`  !@ "a-   !̑* aЀ@! % # ! Ȁ "!@!̐ * @o$aЀ $a@ $!!̑* aЀ@ !& !́㿘 $ Ā   !@ ے   $ "` !J!؀  x '' 'ܐ ܘ @  ?  @!*`*` ?' F ’`@< 㿘 !耢  @G   @ 1  !㿘@6   @| !  @X  ! 㿘@  @c  !  @?  ! /etc/groupr㿘 !耢 "@'  "!  !$ " @+ "!$  "H@AnbX "a耠@ 㿘@ 㿘  "!  㿘! !耢 @_-$! "!  !$ " @ "!$group.byname: p'ܢ % - + ;9 )  ! 1 / ! ](  @"R( `$ @А   )`Da$(!,#\#`cx@#@a$ %a$#$ %a$#'!,cxa$!,@耢 $ "$ @(cx@$ @  @ ! @[@*H'! $@@!耢 2' @Mi M! !`? "`@]  !" ?! +!L :   @!ݐ  j$ @!֐   $ @ْ@ ]@Ғ  쀦@Zi O @’&`@㈖"D @? &`2܀8 䀢 3  "&` ")" !J@ , 䀢 *@" J    ""*" "  '" BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%d%s-blocks㿐#@h#ؤ`"L \@C- &P" J@ J` 1J M"( k G" K "&!  k m g # 1#! $#$1 @" @ @ @! 1  8@#Т""1 !0 X@gܘ%&@!0.㿘 $ "c@ (~ @z (& `& $`& $@$$@@} fb@@H ]?42 @ -  @+@K $@6@6`2&``@&` $@ 6`4* 2  "6`4 &` &`% `@ ؤ@b@@ &"  2 4 $ "H @oO &  $  & $ "c@@@ @ 㿘`&6`$`@ @|@ O /@`N`A "  @`@@i 6`& &`&``,& 㿘 " ` @ T 2 6 @~  " @  @r@p  $  @    $#ܢ @ @` $ 2  ` $"#? ..㿘 0 $",  8`6 8@̔ !6 4`2( 4 4?* 2   @ 6 4* 2  $  "H @n &  $#&  6 4 6 6 6 4 2W`"  6$ @" , @" 6 "@  " @L$ 6 4 " $! >$$@>$ $ 2%@ i   $#&  6 6 6 "X$  &   2 @   $$" A$  V@V 2 2 8$ @  2$$ 怢 2$ @( 6 4* 2   $  "H @n &  $#&  6 4 6 6 6 6 8 R`2  `$ 2 `J / /  $ /* & @@6H$@b V 2?2 $@\ $"#$*@V 2 2  6$ 2, @ " " 6$  @  ! $#@ $#@   2 $ 2  @ " " $"d$$   6 4$  $   2`8 㿘`a $ D"c $"# $"2>  4  8 26   a@Aa  $!& $ T 2   J / $ @& "H @mW @& @  2 @\  x' $   @U 9  44 $#3$2 $ ` 2 ?` 0 ''܀'2' $  @  26 $#$6 46' $#' '$ " T2  `2$J / $ $  /  . T2`    @Y> $ L` . L` ?`  `@k `  $ `@$ `@  $ @+@|@V< $"  $ " ? ` 4 $$ 4 2 `  6 4 6쀢  4 4$  4 47$ "  $܀" $ `    $  @ $  #4 4 $   @ $  &@ @$ @i  4 4* 2  *`2    $ %n`@U֐ @% $   @8 .䀢%`2* T2   $ `@   ` `@ "  ` 44 $"& $ `2     44 `@~8 $ `<`6   @w' `84 d  $ `@kג 5 $`@ 2 &`&N @ޒ   $#&` @w `A  <  2) &`, &`( 6`0N`@ .2`N`A  ?`@c  2 `! 2``,"&@`R`2 6`( < ( 2     <    㿘  (&  @*` & &  `"    @Q  "`" 㿘 $ D@O  @ @ $ 26 & I ?& <6 & & & 6 6 6 8& & 㿘 @  㿘 a@& @ & `? " @""2  @"""R26㿘 @8   : xxswufsswap ,rwrqro㻘7!5  !L9;+!!  !H$@:H @8a E@ K &LJ #  @ A&  @ = & @TZ!   & @TSa !!&  @ &ᰠ@9&  @ ᰠ|@9& { m& k& i& g& & d`@ a؀ &LJ #  @ a&  @ a&  @ a؀ U& & &  @ aؠ@9&  @ aؠ@9&  @FaX @ Ւaࠒ,!!!@ѐ @S @S @Sݒ @Sؒ @SӒ  @ aࠒ`J  @v OA 㿘 !H @@   # 1  !L㿘@0 1   !L@S !L 㿘@ #  !P  aP@S ? /etc/fstabr㿘 !H "@  0"H@9zbX "aH $@#  㿘! !H @WD$!Hfstab: : p"'А '"H'ؐ '"' '@8-@''#' ' @V] 㿈'L'P'T'XL  * j ?#`L# * #  $ @ ԁ㿀'L'P'T'XL  * j ?#`L# * #  @㿈'L'P'T'XL  * j ?#`L# * # @% 㿘 $@ԁPATH/usr/bin:/bin:.execvp: : path too long sh/bin/sh㻐  @EU /  G'@`!P!X@ '@ah}L@  !p@~]@~Z $ ax@  @ a@ @@ /*| @@,| $@b $#܀ "@ G` / A`   `,`@ 2``* % h@! $h@!l  $!l! !l!"@!l"```@,` $!!l@'`4 $ @ $ $  $hc܀ ` "c܀`@?㿘'L'P'T'X@ƔL㿘'L'P'T'X@ؔLvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunused/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx !p!''Ē@   !p@5!'Đ@ ,J |J@ :`'   *`J@ | :*a@&a@!a@  @Qa 2X    @Qb X $Xb@ : "X $Xb @?"$(b(@$0b0@$,b8@ٔ$4b@@֔ @ c\ 4b@@Ŕ? 4bH@?,@0$8$8bP@?28@4$<$<bX@?.4Hb`@? 4Jbh@? 4Lbp@? 4Nbx@w? $Pb@m? $Tb@c?$b@Y?$""7 `/""7 `/""7 `/""7 `/""7 `/ʢ ` a/////Ē@*?8&&Ē@ ||& Ē@x? x & Ē@t 2 t@+ . . Ē@p? s  . Ē@ @1c.  * :  h ,`: ?4""7 `/\ 0/Ē@הl? l& * :  4  !W$$@İ㿘@5@ "&@`@ Nbؐ   > @50disktab: : 㿘 a@Ӕ  a@Δ  a@ɔ @4{@{j @ a@ /var/run/dev.dbwarning: %s??㿀# b  %   !"H   @S $b"X@ "H $ " 1"h @pӔ '7' ' "  "h//dev/null㿘@? @z @U? !?`@k#X` #` @ea ?" @- @* @'  $ @b $NetBSD: assert.c,v 1.6 1995/02/25 08:50:56 cgd Exp $assertion "%s" failed: file "%s", line %d 㿘!h`p@oژ@ox'''' @#؀ ?  '$Id: sigcompat.c,v 1.6 1994/02/24 06:10:57 cgd Exp $㿈`  @'`'` `'@o &㿐'D D@o 㿐'D D@o 㿘'D@D$Id: killpg.c,v 1.4 1993/11/11 19:04:06 jtc Exp $㿘 @o  $ "cܰ?$Id: getwd.c,v 1.3 1993/08/26 00:43:05 jtc Exp $㿘@V$ 2  $@3;#ܒ@A' $Id: creat.c,v 1.4 1993/11/11 19:04:04 jtc Exp $㿘.`&@d{2$1 +`@$ +`@$ +`@$̈́ +`@$< +`@$$ +`@$9 +`@$ +`@$ +`@$ +`@$i +`@$ +`@$Ä +`@$` +`@$R +`@$ +`@$ +`@$ +`@$8 +`@$ +`@$: +`@$ +`@$ +`@$ +`@$ +`@$ +`@$j +`@$  +`@$ +`@$' +`@$Q +`@$O +`@$/ +`@$ +`@$ +`@$+ +`@${ +`@$| +`@$# +`@$  +`@$; +`@$Z +`@$) +`@$= +`@$ +`@$ +`@$" +`@$  +`@$ +`@$Id: rindex.c,v 1.4 1994/06/11 16:49:15 jtc Exp $ *`:`J "J 㿐@' "      2  2 @ ' @m  " 2$ ""  " @$$  @$ @  $ @ $ @ $ " $ $  @  @    @L7  @ @L $  @$  㿐 "  ) & '$ @'/ " "  2 @L  2 @Z 2 @$  2  yp_match: clnt_call`" L@ " @wȐ @`" N@ " @w @2'{ '@@Ԁ t  $!0@KŒ 2'ؐ '@@  ?'@@@*@U ''? @m* ""'`'` #\@`  p   `@N`hԐ?"`h@谒2#'@@Đ  ' @H@@*  $!0@Ki  @ "  p@E@fԁyp_first: clnt_call` "t N "p @w* @ `"i N@ "e @w @('^ &'@&@Ԁ "'S 'ܠ @l ""'`'` #\@` H!   `@ђbԐ?"`h@nఒ2#&@G  &  @*@'@@7  '  @@@*@!@E@ԁyp_next: clnt_callX\ `N "q @v @ `"j N@ "f @v @($@_ '$'@@r̀ "'T '?ؠ @l- ""'`'` #\@` !   `@Q`̐?"`h@ఒ2#'@@ǐ  '  @K@@*@$@  $@  @@;@*@!@D@í@(#)pipe.s 8.1 (Berkeley) 6/4/93 * :"+`@"@(#)fork.s 8.1 (Berkeley) 6/4/93  +`@"` @(#)Ovfork.s 8.1 (Berkeley) 6/4/93 B +`@"` h`''' ''''' '$'('`'ДȲ```  $   $` ` `@3 "cܰ?$Id: strstr.c,v 1.4 1995/06/15 00:08:43 jtc Exp $㿘N@ `@u, : N   *`: 2N@` 2N?$Id: strsep.c,v 1.4 1995/06/15 00:08:31 jtc Exp $  J H  2* " 2HJ$Id: bcmp.c,v 1.5 1996/04/18 02:30:07 cgd Exp $2J  "  JJ@`  $Id: __strsignal.c,v 1.9 1995/06/15 00:07:11 jtc Exp $libcUnknown signal: %u㿘"@8g  `.  @9& @<$0  ?@9В@7s@9[$Id: strtok.c,v 1.4 1994/06/11 16:49:17 jtc Exp $ 2 J 2J'   "JH?  J   H  2*? #" 2HJ$Id: strdup.c,v 1.6 1995/06/15 00:07:53 jtc Exp $㿘@tƐ @*@0 $NetBSD: setenv.c,v 1.8 1995/12/28 08:52:49 thorpej Exp $㿐N@ ="`@t@V"l @t*6@,`  _  $# ` 2 "  ! $`#@m*` $#H?  ""`@ב* ! $#Ԓ@,`$# $#ԑ,` " '  `=$ L  $@  $ԓ*` "  $cԑ* @L =  = ,   =, @,`   㿐! $@Vm * #Ԗ `"  "㿘`&`` ` 2@@ː 2&?@`" ` @ 2? `?&`@`&@*@``  @͐ 2?㿀'@b''' '@p耢 &@ 㿘 (  $ "c;?@ @2 P (     ?2 2 $? "  : @ c  0 "  < :@ c "  `"   "@: @ C 㿀@s}'''' '@o㿘<"e@' #4"E@&$  " @;  " @5  " <@/ < @)@'㻈@ ?"@ ؀ 2 #\@A2#\ $C"##`$#d  @  $ 2"c@і $ '"c@ 2 ` @ `#*`@ $   $  $  $ "c?㿐' ؀   @  $"#  $"# $ "c N  J@ ." `J@  .@ J ."  ?@ʐt~?"42    @u 4m $#  ؀   @`? ؀"9!! 5; $/ $- @@N 4Fc܀ =>      2     2 `؀""  `@ Ԡ  @ 4 $# $ "#  $ `? $ "c?%.*s.%.*s㽐 ؀  @4` $"#)?`@r?"N .2b @Ŕ *= b!!@4[HOSTALIASESr㻘 @@T(# z@,cv @ /' "$@,1 dO ؐ  2LO   2L"ؠ L   " L C,@+ Ր Lؐ   "ؠ L  2 L )L   ؐ  2*@L     2*@"ؒ`J@   "`*@. @* @I}0@Iz p`d @*, @ 2@4 `*` * $*` `@ ? $*` a > ?$ ?''Ԁ`E```?b?2`?? Z@ R$.2 @ .2 @  `E5  B?@ 8 @ڒ .2 @Ւ  @Ւ  @͒  &5 `  .. 2 @ .2 @  @ /`2 @` @ 5 ?&/etc/servicesr㿘!#|   x@*`$#|@v#| $c"c㿘!#| " $@H$#| $"## ,/㿘!#|   x@*Ȓ`  $#| #$@*|2LY #@(a ."#@(a , L "  " @(֒a(. @* c* 2 "`"`  #"`@(a  .   D#N    $ @(a .  2N$1 #/etc/protocolsr㿘!#  "@*Pc$#@# $`А"`Ё㿘!# " $@H$# $" Ё# 㿘!#  "@**c  $#  H$@*O2LN #@(Qc ." L@(Hc. N "  " @(8c, @)p `L"`  X"`   !N    @$@`@(#.  2N$@1  L/etc/networksr㿘!  耢   !@@)aP$ @D  $c"c㿘!  耢 " $@G$  $"## 㿘!  耢   !@@)aP  $    $@)蠒2LP #@'aఒ ." @'a谒 . N "  " @'a蠒, @ `"`  "` !"`  !!N    @$@`@'!谒.  2N$@1  %s: 㿘@!!hc@d`"!h@e;!h@dc@d%s: : %s 㿘 $#@!!h`@c` !h@e!h@c`@'!h@c`@d㿘'H'L'P'T'X@6H㿘'H'L'P'T'X@DH㿘@ 㿘'L'P'T'X@ Lsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console p< #aHӔ# !d:  $##!`@((p@Pٖ(6'@$@"@ x6?@$!X 2a\ @ "a\!\ @P6?@$!X @c@P6?@$!\   :,@`?  ,@`?$@* $':` % N` m `@'@Prሀ6?&$`,?`@*`:`,@ }6?@!X $@ '%@ &'!' ' @E  !  aX!\`@/ !T@*ǖ !X ! @X @4 > 'А$@&'!'ؐ 'ܐ@D @/dev/log㿘 "!\"!X1"!`1!T?23 ! *  a`@& !X    @9͔ ?&!T @Os 3aT !   a@ؔ ? @aT&aT "a㿘!@!T?$!T "! d d8 2'  ' @b!H'''̐ @b'''''' @ 䀢 <@ @@"@'"@`$''А"@@'"@'"@`''А"@@''' '' @N '*@'! $!@ ! 2 ''''' @8 ' @bI  @b#  @)   @'@А"?@''?/!@'   ᨁ80 p`P@(pX@(User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0/  `  $ "c#@{6#Ѱ  /,@~z&@{0 $ ".#@{ #$' .--  H@V '' $"#ܺ @ "͠? / @{' .,,,@>}@@zY v /,  @B:b $@/ `@B/W $L` .2 `L` ?`   ``@~@  $ $" ``$ @ ` @`j$&.@{ &@}Ҕ`2 `? /, `$ `@}ǒ@?,k c܀ "cܐ "c܀@z@zސ 㿘  ! " @z "! "! @j "a! @zH  $! "! @1ג  $ "cܰ?K:  J (82 J" J  JK JK@:  K:ۀ  2K K@` 㿈#\?@ %s.dbtcX'''Ā \t? ! @  !@yڐ$ O' @1ja  ! `d@yɐ$ >'$      @|Җ 5  @L   @B "@z@,&@j3@y@y@     @T &a 䀤 @|t$4 @ @| ?, L  䀤@($,@L \2 ,@,@`@ ܀$@%d@yܒ  '  $ @|[а?Ţ@,@ `J`"䀢`#"@ 2䀧`@䀢 2    d ?  :aޔ =v  `:! L  ?$#\ܒؔ ܀ ؀? @|@yg0u,?" ?2,??ʲ   `: L  $$L? :"$,$%$@%$$%@yG  ' $ "c@{Ɛ3@@{$@@{@@y?@{$@?̀  @y$@ ' $ "c?@0 @x?0 @ 㿈@i ''  ? "??J@ `'? &@J `? J2 JJ|: ?  ?J:|?  㿘@@㿘1 ! " @@&! "! "! "! r㷈 aĀ ""a! !    !@"Ȓa $! !`   !  "U ! !@ !! "@@! @r aĐ"a   0!@"a  "a0]*? L@"ؐ@  2 `:`# ! J? \   "a "!J? \   "a"! '  `: :J \ , J  ,,  @ xἀ " @@ @הK?0%*?O J |  :*J *#\?_    &㿘  =?@w; d d $ "c?  :!*`:   ^2 N N`: ` x* \2t N`: `}?А   *`?N  ?А *`Z*?* :  2N * htht * * * *  *  * :*?**  "  @w(`dg dN :k*" `? @w" "?&㿘K =3?@v| d d $ "c)? @ : "*@*@`? `"@  @v d dN@ :@*@`"@ ? @vܒ"@ "?&㿘 #2N@2? 0  `N@ x X `  @А *`: ?А *`:  ?@  *`: ?ɀ @t7`& 㿘N@ :2``.`@:.`$ +`@$S +`@$ +`@$  +`@?"*  "&      ??  ?" ?  ??      /var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D  N B "@P ?9 @ ? $#܀ #@x, @x|@[t"܀? $! ""!  `" @ @uʐ2 ` $"! `""&@ $!  D@9    D 2 h@u2 l  @[g l?& \& h  h 2L h$D@H& @P ?"; h@ , $#܀ #('Ȑ '̐'А 'Ԑ@ Ԓ@  H@x& h @[,  . H . I6 J& L J6 X@wl @w" @uU   8d `ؐ @[   /ؐ / 'ܐ?'ab  @~ 2 @ '"Ȁ"w @u.s ""'`' #\@ D 耢 " !hb@ZDD  @?f& h  @ H @Z  . H . I6 J& L6 X & h @, D `? @ ?& \""'`' Hab @/& \ & `@ Ő#0& h \ @F ?@#  $a &"a `2&@ 㿘 ` `@& `?& \㿘 㿘 $!  % $@8ؒ  2 ` `@`$@$ @t0 㿘& $!0J!0   $ @!  $ !0& 㿐 $J!0       $!0& $!0`?$NetBSD: xdryp.c,v 1.11.4.2 1996/06/19 21:17:12 jtc Exp $㿘'HH@4 @㿘'HH@4ܔ!㿘'HH@4Ԕ @㿘@4͔ @㿘@4Ɣ @㿘@4!㿘`@4M$㿘 `  `@ 㿘͒  ͒`@ 㿘@3 㿘  `@3ؔ @ 㿘@3ʒ㿘@3Ē㿘 " @  2  @2\`ђ`㿘  `@ 㿐's `D  @2`L@ 㿘 o`  h`@ x @Y< '$'''@3>܀  ܀ ג 2@  `  㿘  `@3!@ 㿘'HH@3 A㿘   `D H@FL@ 㿘W   ` H@4L@ 㿘E  @1`@ 㿘@  @1ؒ` @1Ӓ`  @2E`@ 㿘@  ` @1`  ` @ 㿘@1  @1`@ @(#)sigsuspend.s 8.1 (Berkeley) 6/4/93 o +`@$Id: strftime.c,v 1.10.4.1 1996/06/01 22:00:41 jtc Exp $㿘@ "! `"!@   !* !&@%m/%d/%y %H:%M%H:%M:%S 㿘 #`%2  N E O2N N`y!*`@ӌӔ \ԤԼHը$tx״ӸDtԌ`|ՈPH`א?` cH`*    `  cH`* @` cH`*   h` cH`*   8`'l@s d @9 0쀢 cH <怢 !6 `  @' 0ڀ `  @! Ԁ ` @ 0΀ `@a "  @ 0À `  @  0 ` @  `@` "  @  ` @ 0 `  @ 0 !cH` ``!  cH ݒ @ @Δ 0 @} !(͒w q!8``" @s  @ 0i ` "  @ 0` ```  $ @r ```  " @`    " 5 @ 0; ```  " @rԒ  @x 0+ ` @r 0% cH u cH o `'l@`M d @] 0 `'l @V 0 `( " @v    a??"a a"a* N G !h' ' ' ' ' ' ' ' ' $' ('@`Ȱ  ! !Ȁ @_  0,?@rb @, 㿘  ! !׀ @_  0,?@rI  !׀  !א ,? @   䀠a (  a"a" @`"7''''@V*@?㿘 @? @$㿘 @5  ?6  $"#܁: x N   $'@`1'"' ' $# @Wa@`#$$  "$ $ ؔ$ : @7a8 $"4 2 (@l ( $M  A $0C> $0@@l @2 P     ?2 2 $? "  : @ d  0 "@ < :@ d@ " @`" @ "@: @ D@       "c  2 @k (ˀ$ '!쀤2 V  & @n 2  <   (6 & L $6 2V  >`@ne >`Ȫ@ B 2$ 0 @"  P    ?2  : @ d  0 " < :@ d 0 "  :@ D 8 "@ @ d  < "@ @ d  @2( L4% L@8 L @ D4%@2 L@%@ @&$ &  0`[ @@"X& 0@n T& 0 L :   @   ?2& $&  & 0` @@"& 0@nܐ & 0 ?ߤ@46 @6l    & "$& @k 2 ?>`   ?2 0"? 0` @@"& 0@n & 0 &&  ?6  $Id: fgetln.c,v 1.2 1995/02/02 02:09:10 jtc Exp $㿘 H* D  @n "?& D& H 㿘  4@6 2F&@ @^ $&@  4  "$ 4$  Β`P 2+&@ D@mj$@@5  @^  @$@ 2&@ D@mM "$ $&@ D $NetBSD: xdr_reference.c,v 1.5 1995/04/14 20:30:18 jtc Exp $xdr_reference: out of memory 㿘@    @m &@!h@S9b  @S @m&@㿐@@ '@-   Ö&@ $NetBSD: clnt_tcp.c,v 1.4 1995/02/25 03:01:41 cgd Exp $clnttcp_create: out of memory `@m? @m: d2 !h@R`8 $a "a $#w" 2@&˖ *` j6  6$`  @* &@)`  @      $a "a $#-"$`$@$` $`$` $` $` $` @* @R`L  ''Đ '''А`0 @* @+1 2 `P` "@o0`L @$`H`P ``L@`L"@` $$@)W$$@m.@m, X'H''\`L`0`  &`&`    2  "$ $&`$?&  `0`H "`$  €H "`$ `€ ğ  `$  &`$@, o`$@(  &`$f 2b      &`$W $/ $ $#!,'`'`'''@ C@*mȀ 2`$ 09@*Ԓ`$`$ 2$? `€Ԁ  &`$  &`(  `$ ؐ &`$؀  $@)ޒ`$?" `$ ` @ 2g$`$ $"@("`,"`㿘  " L L@` ```" "    "  """" "  㿘   " P@n P `@ L@l%@l#XO  @Qڔ 2`* ` *  " ! $ ''''''''   @(| ? 2 & $?#܀ "& $& (?@na 2 6& ( & $? $#& ( & $㿘# $ @n;?$c& (& $? @$NetBSD: clnt_perror.c,v 1.7 1995/04/24 16:34:39 cgd Exp $㿘1 "  @k!!&" "%s: ; errno = %s; low version = %lu, high version = %lu; why = %s(unknown authentication error - %d); s1 = %lu, s2 = %lu 㿈g   €`@Ք@[z@@"r@[r耢`A"$*`@,,,ll,,,,,,,,,,@c@`0& a@j@a0@[A`a@aH@(aap@@['@{a%s 㿘!h@P-cHpXH xX@ RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code) !؄|* 㿘!h@OycH - 㿘( `@! $!!@!  @bP` @bP $@D!@@ޒa㿘ϐ!h@O<cH0`Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK  @*   #` #d #h #l ܀ ?` d܅*`  2 ` ` @ *`#㾐 $@! @?@P* 4 `@K* 2  ` @   ܤ 㾐 ! # !?@! @@* 4 `@* `2 "  P'D'H' ؀ @J?"?' ؀  H"$'''' <  Ā  ) ܀@6Ӭ9 $;,` @'-@ $  DH ̑* d   )4?`     2  @  @%3 % '# @I  #" J@' 'D'H' @0 H` #ܐ 7 @kޠ ސ"7ޑ*  @ @l#܀6-* @d'-@@R* 2 ' 77޲ހ * @j2 ސ"7ޔ*  @ #@<`"&"7ޑ*  ހ"" @jސ"7ޑ*      @   @$ % '`܀ `` `   @  "-@'` DH@( H   /'7 @ '`'# DH @$k H -@  Б*'@i` '؀ $''ܠ @M  2 * -@ @ "   @$Iؠk2'#܆ f'Đ '  @$@Ԁ Z' '@Ҡ ؀$  ؀(2 DH @ 9   ?  -@@k"0 F ؀  " @\'x-@ ؀  ` ؀!@I "  ",DH 2* @H@   )4%?` `܀@5,` Ԁ&' @  $Ā $ ="cܐ <"c"#ܰ?㿘!  @i?$ " " fLOCALDOMAIN /etc/resolv.confrbfdomainlookupsearchnameserversortlist%[0-9./]soptionsconfRES_OPTIONSenv㷈     А ,  ,  54 $  $ !d<*@ $!d$!`!c0@h @9#8C `@_  `@7cH2.!0&??J!0  !, :N   `. " "   N ꀢ *  :  ( . N  ."#P@chz"cp@ 5" А$@ٔ YO ;" #cx@@  'ON "  " N "ސ ې!0 @ !0 @cH2.ɮ c@@Ô  : "@   N   L y b f *@  , `L y b f2  *@` "`Ӱ c@@  R$ON "  " N "s p0@w 0@ 2.0&??N0  !, :N  `. " "  N 퀢 * : " . N  ` ."3 c@@- (&ON "  " N " @ޒ -@ *` *` 52`"`c@@  PON "  " c@ 뀥 @= /2,@@ - ` $!h`@ "- - !h'@$!l ` /,@@UCN "   N "  " c@?  @Cc" ܔВ *`d* "d@- !0J!0 @P  @ے .@ 2a"a"@73#а@ c`` "` ndots:debug㿘 < #*`: N "  " ` @?K  @o  4!d* !d < $!d`(@?7 * : " N N  ` N  0?  ??㿐@!  @J . 6 㿘? @ H  . \ *V?@@:Q?/@`@/ ?,-@@.`\2 /@@:;?/@`/@@`?<@@ ? @ ?(@@ @ &@&@? `/@O@؀2 ?`O@& @㿘@    @ 2` H "?@u A:`?,  ` ` ?"@7* ?@$@`$@  ,  .\ $ "? >**,2$? $      ? * " ?  ؄* P㿘C`3 ` & `?7?, .+ \" ֦ Ҥ< ` "&`." *   @ `Ѥ & ¦? (  ( ( ( 2 *@*`2 *@2 *`2 *`*`㿈 N 0   N x X2  * &':`ؐ   @`?*: ؐ `D` *??  *`:`N .2 N@ $@`  "ؐ  2$@?$@$@ :   **` ?`@  㿐@ ?㿈' N 0   N x X   * *`:`ؐ   @`?`*: ؐ `D` *??  *`ۀN .2 N􀤀97 $   ."ؐ  6 $:` `+Đ"l*`@?#* ?# *`* @  * *` *` `2&@ xph`XPH@80 xph`XH@0 %I:%M:%S %p%H:%M:%S%m/%d/%y%a %b %d %H:%M:%S %YPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSun%s: 㿘@!!hŒa@F !h@G!h@Fa%s: : %s 㿘 $#@!!hŒa@F  !h@G!h@Fya@ m!h@Fqa  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~* R 㿐@D  ?&㿈 ' ''  @cК 8@?㿈 ' ''  @c 8@?$x +`@$ +`@$b +`@GMTJ( ( (  "     D D* ( (  x*     D D (( (  z,& /etc/localtime/usr/share/zoneinfo/?` 2Nư"耦 " ?N :" N /`?`"Ƥ""?@P@P  $@@c@@ђ . 2 `@   2?@:U ??` @bD@bY 2ڰ??  WSO&@K&`G&`C&` @ 2` 8?`!r2  2?`@`2?? $ & `* @`* * @` @@* @@@ o  ` . @"` `  *%ؒ ``@Y `@ , 'L@&@ $` E $``@` @4Z? `.  `  @#L@ *  ` @cL*  @#!L. @&@$` @ * 'L  @L"` ?"`  `.  * 'L` @L"`  ?"` `.  mn ( 8+  (:` Ѐ Ԅ:` " JЀ   +  (Ѕ+`8   JЀ  & "@ 㿐 ܖ $* "@*`@*`N : &@  ˖ ;*`" * @ &@N :   <2@  &@㿘N -   + ’  @ &@㿘N J M&@ `+ 2!N &@ `   "1 N .! ` w "% N . `   ?Ѐ   &@` !m`2N  / u` &`㿘 ` @MX d 2  @MR! 2  "  " *` * "@*`" * |;yTv!*` * "@*`" * n ?ǒc,*  **` * "@*`" *    @M  @_l d@L d. * * ? @_^     < @``: @,`"@ @L &` ,  ǐ#,@*` *@   6+  +  * "@*`" * posixrules`  &8 N8?@M^!N ؒɐ"#2&@N  ^& (?N  , ; 2N?1'N , ;2iN ’ذ"?N , "?N ? &` &` &gL &gP&gT &g`&gd&gh`eؤ ' ȶ $ $$ .$ . .$ .` @L d 2  @L! .  . *` * "@*`" * `gȤ{ 2?   ?gL gL' ` `@ %ؑ* * @gP   @  ` `@ %ؑ* * @gP ݘ  @  + eؑ* * @ S*e\ 2* + X + "@ "@ @ " * * @'L'P     `Ւ@  &gL&gP&gT &g` &gd &gh &`&` &gL&gP&gT &` &` ` "?#L@@@.@ `@.@ 㿘!Ɛ! ! 㿘 !a ?"a ! " "TZ㿘@.@# !!  ! @  5! !@K (  $! ! @L@  b"b" "'L"'T "D@Ԓa0! " L@ :"\  "M㿐' "` "gP`6 gP # `  * * @'P 2* ` * @&@  *@ %ד*@ *`gL@ @ @H & ԕ* #L@@ " &(㿘m 1 !!!㿘 !a 2 "a 8!Ԑ @`  ! &(㿘 1 !!!㿘1 !ؔ!!㿘  L !L!P* @&>@2=  4  * @ &$*  *   @ @2!L * `   *   @ *#T@\a@J'a&@TT! T! ?"T! @\z.&@J .@\s <&@J <&@I  & &'Ȩ  @I d 2  @I! ,  , /@\H!m?&* @*`@*`?@ < ?@\5 d$@\1!,< @\' d$@\#!$$&&, @*`ǐ#@@ &*  $  &* 6& & &$㿘ܐ@{@"&  2` 㿘@ &8@[@[8@W@"@&@`` ` ` `@ 0&' ' ' ' ' ' ' ' ' $' ('В < 2 ?Ԓ  2?ܒ 2?'l 2 ?Ԁ #!nȤ ? ܀  @I  d 2  @I! ,` ,`@`'Ԁ!n#Ȥ  @H d 2  @H! ,` ,`"@'ԐN  Ԁ!n܀  @H͒ d 2  @Hǒ! Ǣ ǐ#,`@*`ؕ*@@ Ԁ"'Ԑ ''ؐ!  ?8 2?ܐ'l'Ȑ?ŀ 2?Ȑ ;'n''Ƞ ' ˤ ̐@Ȓ m? `?',@" ',@ '耢`D A@  "!?,K?,`* 'P耢@2*? %,`* , * P耢@L L" '@ʒȀ 2?耢@?, Б,`?@&  5`@ ''@ &?㿐  &  2U   ː ̀@  "H !?,C?,`* 'P @27? 2,`* , * P @"$?LL"  & `?& y Α, * 'LL"@" & `?& ?֑, Ñ,`?㿘_˒` 㿘?" 㿘" ˒b  㿘" ˒b |  L( `( 㿘&'DDD&㿐'DސDD 'ِ"@D@ 'ΐ"@D@D ??'"@D@D  SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈`  P`* @ϐ @`  P`* @ϐ %@`#\@#``'l#d1 !!ϒ`X` @ `!$Id: strpbrk.c,v 1.4 1995/06/15 00:08:25 jtc Exp $J H ? 2H  J  $Id: strncpy.c,v 1.5 1996/04/18 02:30:18 cgd Exp $ @(`  (02 @$Id: strcat.c,v 1.5 1996/04/18 02:30:12 cgd Exp $H" @ J2  @*` @(#)bzero.s 8.1 (Berkeley) 6/4/93 `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*$Id: strerror.c,v 1.5 1994/10/12 02:35:26 deraadt Exp $㿘 !@ cЁ$Id: strcasecmp.c,v 1.4 1995/06/15 00:07:37 jtc Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ИP   @  `    ИP @  `   "  2  $NetBSD: atoi.c,v 1.6 1995/12/28 08:52:06 thorpej Exp $㿘 @  @'L'P'T'X 7'@FF'''А"x'''@0L㿐 Y? @S* 0`" &  @@"& 0@V & 0& & V @U  3\@R@ `@Uo ?@Ug`2   6 &  C&&  & 2(" 6 &&   &  "& &   & &  $##$"`㿐@& @RX @0.! 66 6  6 & '!H& $'!& ,'!& ('"\&    @V5 㿘`6 "@"&&@T+,(  @ 2,  @Eܒ`"&&@Te@ܤ,$NetBSD: xdr_rec.c,v 1.5 1995/02/25 03:02:08 cgd Exp $xdrrec_create: out of memory 㿘@T D"@$ <@$ @@@T  $ !h@:UbP0&    $  @$ ("<& & $$ $  $ $  $   $  @$ $ $ $ ($ 0$ ,$ 4 $ 8㿐 `4 `,`0"  &@`4?"`4`,  "`,@%   &@ 㿘  &  @ & & @7 2  & @" 㿘    4   8 2 @n 󀦠  @B @ 4"$ 4&㿘"    "@ @WZ   $ @ @ &$ @  2  㿘`   @W  ?@  "  0 ?  "  ," &㿘 ?("  " ,!  "  @  @ $ "  4  0@  (@  $ , 4" $ 4    " 40@"@  ,@0" "4,@", 㿘 @S @S㿘 @ 4 " & 4 8 2  4@ 2 4   4  8 & 8 㿘 @ 4  $ 4 8 2  4@ 2 4  4  8  , 0`?㿘`   2 "  *" @ " ?  "" " 㿘`@? @  " ?"@  "  2  &   &  㿘 ( 0   $ " ?" & ,& 0 㿘$  0 ,@    ,@V ,& ,@&㿐ݔ   2`& 8 *@& 4  㿘`$  0 ,@ @  `    ,@& ,&@  c(/  ?$NetBSD: authunix_prot.c,v 1.2 1995/02/25 03:01:36 cgd Exp $㿘@͒ `@ @j` @e`  ``  @a4   㿘 @R $! +`@$Id: __strerror.c,v 1.7 1996/01/20 01:41:51 jtc Exp $libcUnknown error: %u㿘Ԑ h@ # . ۖP @ @ 0  ?@p@@$NetBSD: strtol.c,v 1.7.4.2 1996/07/20 01:14:19 jtc Exp $㿘" @  ` - +  L@` 0 L@ x XL`` ` 0  `' #@A@T` $ %   3/ $ "bؐ  b ?А  3 ?ɐ?,'`&?2  ?1 %ܤ @O&?  ?#%ܤ @O @Ģ` '     9;@``"ؐ@  `%  4@p 2 "ؐ  "@  ?&  &2   @`xײ`Ր p,`@bWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWVTWWWWVWWWWWVVVVVVVVVVWWWWWWWWWWWW0WW0WWWWVWWWWWWWWWWWW(WWW@WWWWWWWW\WW0W0W0VVWWVWW|W WhVWW8WWWWW(  4@А 耥   ?&  C&h f d @ l2` `] ,* WТ ޶"6   c1  -c"* ( @ @!  @ "  c  2 @ 2""ؐ@     ޶"    @@o  @#` "ؐ  `%  ? &  &@U m ؐ  2 `8@֐ ,`@XYlZ\8_l"    @:$@&@+ "  @ "& & @ -"? ", J>   ` ?&  &  4 @ "` ` J? 2``"b J> " ?& `& @,  4 @Ɛ "ۀ  @J? 2 "հ,*"? &"    !` ?&  &  4@ 2 "ؐ  "`    # ?& `& @,  4@m 2 , bؐ  " ,$߮8!%" Հ M* ט  ^ ^^ ^^]]]]]]]]]]^^^^^^^^ ^ ^ ^ ^ ^ ^^^^^^^^^^^^^^^^^^4^^^^^^^^^ ^ ^ ^ ^ ^ ^^^^^^^^^^^^^^^^^^4`$ "$" < :-`R <-`R`` %! <  ! ?"񀤀!  =, ? &  &@ɐ !2s! (ݰ @>ذ `x`X @2 ,  2  : 2"8!'l׬# Հ :d* `a4``a4``````````a4a4a4a4a4a4a4a4a4a4a4`a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4a4` > "! ?"! = %$ 9!, ? &  &@$ !2!$5 @- `e`E@ @ ,@B  :"$j? ^      *$* !? * -  -]"?0 ]6  -* 㿘 @ 0 2 4@M$$& 0& 4  @,& ,` 0@N @M&& 0& 4 ?㿘?. $"4 2` @J` 2`0 "I?`  @J 2@?` ?6` &`&``  6` `0  ``4@& @ "@(?&@*`! ` ?6` ` "`@@( ` 2`&@`  &`<@&`8`@&`0 &`4.`B`B&@ &`@'L'P'T'X"7''#''@3ؔL*@㿘'H'L'P'T'X!@3ȔH㿘@K 2& @K" &&@Ld&$@@ $@@LS"&@&$NetBSD: xdr_array.c,v 1.4 1995/04/14 20:30:16 jtc Exp $xdr_array: out of memory 㿘@ @  "C  2; @J   "/  ( @L &@!h@2)b  @2 : ` @  @L@&@㿘 :     @ NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @@ H2ڠ P@ ڤ ڦ!p `*`:  :[ %O  ?* :  (F* jjtjDjtjtjtjtjtjtjtjtjtjtjtjtjtjtjtjtjtjtjtjtjjtjtjtjtjtjtjtjtjjtjtjtjtjtjtjtjJ@ :  @*`J@ :  @*`:  * L  *@?2 L 2 L ?0@& ?*@K  "#\@N"?  ̔  @@N?2???#@ @Kx && @[̰?㿘 $ <  5 @4-@08((@ @@@08((Ѐ66׺ո㿘?  $ "c ?" @ @K $NetBSD: errlist.c,v 1.4 1995/02/25 13:40:51 cgd Exp $vvvvvhvPv8v vuuuuuuxu`uPu@u(uttttttpt`tPt8t(ttssssshsHs(srrrrrrhrHrrqqqqqhqHq(qpppppppHp0p poooooopoXo@o(onnnnInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$Id: index.c,v 1.4 1994/06/11 16:49:13 jtc Exp $*`:`J   㿈'XX#\#`#d#h  Ŕ@L$Id: strcpy.c,v 1.6 1996/04/18 02:30:14 cgd Exp $ @(`  @*㿘"   -+  L0 L x XL 0  >??@57 $ ??@5Ѡ    #bؐ  b А  . ɐ' "8?2 @  @  ??? " &ܖ@ٕ> <@ F ɦ ``` '@㿐'" @  ` - +  M@` 0 M@ x XM``  0  %?%  >@ @-O $ %D    97 $ ""ؐ  " ?А  T ?ɐ?M H$4?   @ ?1  1&ܖ@:> = @ f% @?2 @  @  ?1#? &ܖ@> = @ F @`  #㿘  `  `  @2 0#@-   & &@*&&@E @E"   ` 㿘6 ?#6`@@D`;  $ & @*$@&@ @D@D̒2   *  . " 6  "@ .  6 `@ , 4`@`  㿐  `  ` @45`$NetBSD: pmap_getport.c,v 1.2 1995/02/25 03:01:49 cgd Exp $h7֐?' o6 ! ! '`'ܢؐ!#\ab @v!/''''!!'`' #\ l xր   $ "  €`  ր 2  $ "a  @@I$6 ց$NetBSD: pmap_prot.c,v 1.2 1995/02/25 03:01:49 cgd Exp $㿘@H @C`  @>` @9`  $NetBSD: clnt_udp.c,v 1.4 1995/02/25 03:01:42 cgd Exp $clntudp_create: out of memory X\@Eʐ  `!h@+tbf $` `d@E@ ``!h@+dbV $$ X@    K *` Z6 !,$$$  $  $  $  $ $ $ ?$ $$ ($ T@+$ \  ''Đ '''в 8 X@ @ǒ -  < @$ P 6$  '  @T   ' $a "a $#"@  b~@HQ $ @$$  @E @E 㿈''b`#\^'H\ `(? @'P``$'P`('T'X'\`8&`8`< €`P`X@ 2@`< €H   `€ ƀ 2 &`,װ  @@`X `@` $#&`0 &`,ð P  $T \ $##'`'`''' @+ @2`* ` *  "Ь"??/!! $ ''''''''@ ؔ  @`?( 2)'LX` 'X\` @@ '\В"?X 'X\ '\XP@&@ \T@&@ &`,] # @```\ @zL#܀ "'L #܀ #"&`0 &`,A `X``@```@ x@ *@`,`,   `€  &`, &`0  $@ `,$`, ` @ ? `8 &`,`, ,"@0"`4"`㿘  " 8 8@* h(|" $" ( $" ("" "  "  " " " " "   㿘   " <@F < `@ 8@DA@D?$NetBSD: bindresvport.c,v 1.6 1996/03/29 23:00:50 jtc Exp $㿈` `  $ ."c4? @)ߔ  / /! "T Ѐ ?@)@3r!"X4  $ 0"cܠ ' $# ""X܀ 0`А`4`Б* : #6`4`А@  ! ܁$NetBSD: auth_none.c,v 1.3 1995/02/25 03:01:34 cgd Exp $㿀 " ؀ 2  < @(ђ @ "/ "  < * $##& `& `&  & &  & !T&  ( @m @@  @& < `@㿘 " ؀ (` <   $a +`@$ +`@$] +`@$ +`@$t +`@$h +`@$NetBSD: xdr_mem.c,v 1.4 1996/02/08 08:06:05 mycroft Exp $`"l" " " "   "  "@ "     "  @  "   㿐 ?  &  @E &@  &   㿐 ?  & @' @Eϔ   &   㿘 "  &  @E &   㿘 "  &  @E &       @  @4 " "     @  $NetBSD: rpc_prot.c,v 1.3 1995/04/29 05:26:35 cgd Exp $㿘@  ``@ʖ!㿘@ 㿘 @t` " `    `€` @y`  @r`㿘@S " @   @]`  @X`@<` 㿘@K @.` " ` 2  `` @  㿘&` &` 2 @( @ ` @`  @` @`  \* t "@ "@ "@  "@ "@"@ "@"`"`    "@ "@"@ "`"`㿘   "    "&@ @ݒ@&@ &`@ "  " 0 " 0 &` &`&` &`$NetBSD: xdr.c,v 1.8 1995/04/29 05:26:38 cgd Exp $㿀 ' 㿐 "     @'  € € &@  㿐 "     @'  € € &@  㿘            €㿘            €㿐 "     @'  € € &@  㿐 "     @'  € € &@  㿐 "     V@'  € € 6@  㿐 "     @'  € € 6@  㿐 "     V@'  € € 6@  㿐 "     @'  € € 6@  㿐N@'Ȓ .@  㿐@'ڒ .@  㿐 "     @@ '  €€ @ &@  㿘ɒ㿘% "       "  `2     2    a؟ `?xdr_bytes: out of memory 㿘@d "3  2,  "   "    @?0&@  !h@$ؒ`  @?&@㿘$㿘x " @ "  2    €xdr_string: out of memory 㿐 @ 2  "8 @/s' .8, ` ` ` 0!  2@>&@  !h@$ga ,"@?%&@  㿘?$NetBSD: qsort.c,v 1.5 1995/12/28 08:52:36 thorpej Exp $㿘  `@ `< @<@*@0$ )@$&@$6""? $ **? $ղ$͢@6`@B$#"`@ `@@& `?     # @<y%@ $뀤#``@>@ 2 & @  & & && @& 㿘@t ?&& @; @;@>x$ +`@$Id: strcmp.c,v 1.5 1996/04/18 02:30:13 cgd Exp $ (8J@ `   JJ@`  $NetBSD: merge.c,v 1.3 1995/12/28 08:52:28 thorpej Exp $P''쀦 $ "cB?'`?'@90@;   '0?'@*@9Ԑ'' ?Ā   @9'̐` ?'ĀԐ  ?Ԑ' ̶Ā   ?Ԑ'̲@@ ? 䀠2@@N@J  2@ '@ %@(@$@4(&'- @@(#%@@9c2 @8@@4@@%@@@48= "܀" $ $? ,  ,?z܀`" $ $?h ,  ,?Z܀" $  , ܀`" $   ,  ` 'Ā '''Đ ?2Ԁ@ @8@>*'@:V԰ 㿘.@` ?@7@$`&@7@%@  ?@7Ԓ@$ 4  @7Ē@  ` `` "@"@  @, *@`$ S+& 2" &@"@& @, *@`"@ * ې&$& @, *@`"@ * $   &@"@ ?"`? 㿘$@ $ , *$@@8$@㿘@㿘@8  "` "`" " "   " *""?㿘`*` " @  @   2  )  @2   @" :   @;і  & &  $ @ "  @$@@9㿘  @&   25 &        @+  &   @2 "   " $   &  "   2   2  $Ą +`@㿐@Œ @   ``  @ $ "c @5a" 6  `26 !6 6 & '!H& $'!& ,'!& ('"\& $y +`@$I +`@㿘  ɔ@<< 㿘@ " ??& `& @㿘@5㿘 $"4 2& @5`&  2S? 2 0   $ "cG?"  @5i 2@? ?6 & &   6 ` @@"& 0@89 & 0 < &  8&&  2 @4J @8! & $  &  ?Ȑ*@6  `4  `2&    @6  Jrrwa  $   $      & "   J+b  J+    "@㿘V 2  $ "c,?  @4 `" @  &? " 0@7  0` @@"& 0@7 & 0 D "6 @7& D6 & & 㿘!ɀ@8  $n6@t@ n6@@  n6@<$@  $ "cܰ ?\" " " " " " %$sniglet^&8`   $ "c@_!ܢ?$a$a  d  $@Ԓ   $#܀   $c܀ ""cܠ  @ɔ?$a $#a @ ]   @J $ 2$a "$a a@9!?! $l#2j O@!a@2d O`?  a !€ `@ "`U O`(@8͐@$a@ 2U ` * ` * D` :$aa8 @* `"@0@@ $a0  a @ $a4?$a$@6U $2& ! $#@ِ#$# & "&  & "& "`& "&  &   &`@9Ca@6 $"#ܰ 㿘?@ @6 " ? ? $  ܐ?8 $ 8 $ $  $ !$  $ $ @$ 4"$!  D @4  Ē @0 @` @ 8 @ $ $ - " @ $  *@@@$  2$ 4 2$!  2` ဢ@ d" $ "c  $ @@?㿘@7 4  & @ I * *``" D" H&  & $*` `@Cz ?& 0& (.`?& ,! 2  & <  @7 @ $  *@ @4& @㿘  @ !4  $#!؀ !?&!!ؑ* @@5!??&!@5!@F `   $#  !8  @5!, !?@8P@5` $ "#ܰ?㿘` $ "c? "? !4  @   2 ?@  2?&!0 㿘!4 :!a& & ! !€ & @!  @8 ?"$?@7!?! $ O"c&!,? , !8` , Ė @BD  2?  ,  㿘  @@  $ "c#!,?㿘  $ !  $ "c#!,?  @ 㿘  $     @   $ "c",?㿐 @ @ ?K ` -``  @B`   $ 2   @ ?`  `2  ․@@E+(2i `'@Eg*` ē*`2`@ W   `` @@A G `K ?`'` ``207 ` ?-`> ,`   @EQ " ,` & " !&@>m 2 `@@  ` ?@>]  ?0 @q ` ?-`? ` ?-` 㿘    $ "c$!,?!$  $!$ $!($!   ! 2! !$ @% "z?$!  2 $!$ $!( ($!$ (?$!$f  !(*    2*` @ $! $!(     $! !$ $!$"!  "! !*+`     @E  2 0?! +`2* ` &@  ? " &`! +`2 ` & " &`* 2  (+`$! !$ $!$ 2 $!( 㿘 ( & ( 0  4!& (   *!ؒ@2*  ,`&  @ !ؓ,  " "?! &!! &! (@  **`@`D" D&  ,(& 0& ,@=㿘@2 @7. @&@3X$㿘! € ,  ( 0㿘 @=   &! .@@6   ! $#C$#?6 !ؓ* ** " ! &! @% <'`'d'h 'l'p't'x'| ?"@ $l   $t 'lt  |#h'tx |#'x| "'||#h't'd'`'| 'l#'x'p| ဢ@dT $@2K"$U @"$?$a|$a$at$ax$a$b@2: $C$` @q $a"&b  $b && !& "H& #&  &  p& "x& "& `  $  "b    $ $b @  $aaА`  $@X?$ab  $b aВ @ ?`a@1\ `Ȁ 2à rpaВ@4є  ހ  $L!b@b ?@$b  $b '\_/^/]/\/'X[/Z/Y/X/'TW/V/U/T/'PS/R/Q/P/'LO/N/M/L/'HK/J/I/H/L!b@ $  O?"@ $_2| $'pb  $b $a$b `؀!'p"'pp@ 8'p` 2$ab  $b $a$bb  $b p$ad` p? `*  'dp* @d *'ddaز@0 ?@0l?4aܑ* 2   4aܐ aa@+$@b  `@@3?b  $b  b  $b @b  $b  $  $ O"c܀` ` "a@1haЀ?@3@1` 㿐 @Δ ,  $#܀ 2+? $"#@"#?@ 2?$$ $  4 !4  $  @!@?  @: 0?TMPDIR%s/bt.XXXXXX/tmp㻐@q"Ȗ" $@А?' @@? @ @ @#d d$  #㿘  `"" @ & "  $!А "cܰ?㿈  `@ܔ $  $ "c'?@;? 2#\@@Ĕ    @!Ȱ" @"@@@ 0$ P" `2@0'....'....'.. . .  '. . ..7..7..?2   J *  *`2 *2  7* *    '. ***'**** '****'***** 2  ‘*0f  b*` _ *`2 *2  7* *    '. ***'**** `1`'****'****`'****'***** 2  *P" `2@0?2   N *  *`2 *2    '. ***'**** '****'*****2  7* * * 2  *l  2g*` b *`2 *2    '. ***'**** `1`'****'****`'****'*****2  7* * * 2  *'....'....'.. . .  '. . ..7..7..#t w* v*  u*  t*  #p s*  r*  q*  p*  #l o*  n* m* l*  #h k* j* i*  h*  #d g*  f*  e*  d*  #` c*  b*  a*  `* #㿘 ``@@t $`@. ?")?@r@?2`"? "a@.M$` $`a "a@.E$a$aaȀ "a@.=$a$aa@.8@.6@0͐` 㿘  ``@; $ ` $ "c?"   " @? ?@L" ?$" 㿀 @x L!b' '!'!'"'" '@1 @  ?$  +`@$\ +`@$Id: memcmp.c,v 1.4 1995/06/15 00:07:32 jtc Exp $" @`  ?  2  $NetBSD: getenv.c,v 1.6 1995/12/28 08:52:18 thorpej Exp $㿐@㿘   `=  $ `N  $# " ' $@! 2 @L@ =2 Ԑ$: &@   @'P'T'X`"7''''@P*@?㿐@ ?㿘@ ` 8@ԠL 2  ?@  0,@+ ?L X" #<% /L /2?,@ @ : $,8L`*@! &@- , $#܀ $ @|  $#ܰ `? aL  z2,   ސ a  , "cܰ   (  㿘  @*`@?@ 2* @x`  'p= ` *  (( (( (  ` `O ` `J2(8pT * (   * (   * (   * (   * (   * (   * (   * ( Ȑ  `? ` `:2`( ꔅ*  *  *  *  *  *  *  * ؐ  㿘   "   "   ?@ 6@!ؑ* @-  ?  !0    2@$  `?@8-  - $  "` "@!& !&$! "㿘 a a  "@+/ " @+*` & @+ a x?v$a "` "@ 2   "j&  @ *  ?    @8h 2f   " `? `2@aؓ*` a0  ** * " *"  5 $   2/&  2+&  @ *  ?      @8) 2' $ ,  "` "@a $ a$a"  "  2$ & & &.  . a& a&$a " @ :@`! "!  㿘! 2!3 !"/ !   `    @7Ә 2?`"  "@* "` "@@*Ґ!2  "`"` *`@` `@ !"`!"@! ` h `" @” $  $ "(   $ `   $ "c?`܀ 8 (`@ Ԁ?' '@.M ܒ`@.I `` ܀ @ Ԁ?֐' '@.4 @.0 `` ܀ А2 @ Ɣ "?(  @Ш2 @ Ш?  Ѐ @C  Ѐ " "@V?2 @- ?`@ ?  "    #\@ b0l ?* 2 *` " `@-•*  6 -@ "6 2`  `&  $ , @@-``@-(@  2 @2  4䀢 2  2  ?2 ?@2 $ 4쀢 2 2 $4$@   2 @@    $  㿘!@  2& G&!!6 `  ?  "@  @*5&!!䀢    2-&! 2 ?@2&&!@ 2 &&!  6 6!6!  2&! 2&!@  4&!6!쀠 `?& @ X  㿐  `"" @ L $ "  $G " (? $@4> 6  "< @  .' ?2   @.  2)? @; `?2  2  2 @  ?@ `?  $ "c? "  $" 㿐@@  @ W " @@" ,` [@ ۔  !?&! "9@ - "  `?2 ?@2 @   !@"@!2 ! &!2  @`!"!2 ! &!@  @  % ,@  @  " @@2`@@l@ } @ 2k @@"\ ,` V@ g  !?&! "4@  "K   2 @ L ?!@"@2  @`@ < @  ", `?2 ?!"!2 ! &!,@ " @  " @@2`@  @ p &@`?㿐 @n@?   @  u`?@  2[" " `?2  2 @a \ Z?@ Ք U `?2 @  @  א `?2 @"  ?#@`4 ?#@ h @ ?"  "  @`4 `?2  @   @  ?@   ?@ }?㿘?# ,!@&! "s@@ ͔ "? , @  @  ?"g`?2  2@   4`!4` H$` @ 2d?@  Ɛ ,\? `@  @*$ `4`*` `` ?# 2 *   `?2 "?*     *2*  `?4`@  @   @   @  ?@5 2  @   㿘 (@  . @.  .@q 2l?.   @ Z ?"^?`  @` @ O@ ?2`Q?`@@`   @*]$ 6. .  ?#@ 2@` *   ?2 "?*  " ` *2@*  `?6 (@  2   @2  ?6  㿈  ( . ("  `'7  #\  @w 2 `'7@ 2 ` W,`?2 ?'7@ؔ  ` C,`2`"@ s %' ?2 ?7@ 2 `" @  ?2 ?2('`"$'@ P 2'/?7@ 2 ` ,`@ ڔ $@4` @ Д '7` #\  @  ` ,` 㿘``"`@  "?`"`@  ``" @  2`?"`@   $ +`@$ +`@$Id: strncmp.c,v 1.5 1996/04/18 02:30:16 cgd Exp $2J  J@`J 2J x^7@  @ @`"?ޑ* `"@4`2 `"  @ $@ `/@`'@`'@`/@`@(@@(@  ,"  @ ?@  N@/?"Y ,!@&! :@[ "E  7  " " 0< 8 : 06 4 ? ?! ,  2)`` 2 ހ (!` ? ? '` '' '!€ ?:  @ ``"  :`@  @] @`Ԩ  ?ޑ* 2 *`@ " `@(;*` 4`   "  0 > _0*`"4`2* 2 @@(r* `"@ 4`2 *`2`@ $@ '@`'@`  /@` @'  T@ ?"{N ހ * @  @   `@@'@'`ޓ*`@`$4`2`, 4 @@%$@ * @  @   `@ ?2 '@'`ޕ*`"@ 4`2*`2`@ ?2 $@ '`@ "@ 2" @?@?@̔ @Ȕ  ,@” @  @ @ @ @  ?㿐@{^ $@ 4`4``$`@$`` $` ` `?2 @ @&` 4`7&?&@"ؠ2@@u 4 $@$ `$  4 4 ` $ ``@” 2@@#G & @T @Ú@'؀"@#/&&㿐@@ $@$$`@$ $ $` 4 4`!4 4`` $ $` @&&㿘!ڐ?6`6``@ ?2 @$$ `?6`6``@ ?2 @$$  6`` ? &` @  㿘!ڐ?6`6``@&@ $, `  % 4   `" 6`6``@  &@  $ ,  @&s  @< ?  ?  `" 6`6``@ @&Z $ @ 6`` ? &` @  p'' ڐ* 2   `?2 * 2 t *`2 ''ԑ/`2 '- 2 @2` 6  ",  ,0*  ,0$2  @ @2  @ @   ?  ,2  @   2  @@  ? @5- 2 @-2 ܀ :%?- 2 @ *  "@6 2  @%Ҕ* 2 Ԁ    - ,2 䀢  - 2   @6  ( @@-   2,2 @:"""2- 2 8 "7,2`/`2 @N /`2 ,2 `    ",  ,0&  ,0 2  @ @2  @ @    ?,2  @  2  @@  ?@- 2`@"62`@%E, 4   - 2 @/`2 6`6㿘@Ԕ " ?`  "` @i   `0(0 *0(0 @(0 (㿈  `"@@ $ ` "ē*`@ ( (( ( ( @@& $ "c? @@h#\!@<!Ȱ" @@ 0$ 㿐`f#ؓ*`@THTTHT  $  $ "cL?@F @2 ">?`?2  "` 2 &@`@ @ )6`@ &  @ "?`?2  "` 2&@`? ?@ @ @ `?2 ?6` 㿐 (    @WS@ D "# D&@  "  ` *`2`?2 @25&@ @b @ ! %&@ "    , &@ 6``2 @E 2 @ 2??2 ?&@6` 㿐@"}  "Y " q' '@  @ ' ' 7  2&  +@@ @Y 2$@2C? @ =??2 4  ?4 @ "@@є & ?2 @2 @ `2 @ 24 ?$& & 㿘  " (@& &  ( . (& 6  ( . (㿘 ,&!   @ 2& k ?2 *   ,`2 6 @.   "A!&Q,` ,`2   ," 2%&, ,  @Z 21 ,2`?2 @2&  @# 2 &6  ,  2?!"@!2 ! &!, 2   @! 㿐`@z ' 7@Ĕ @   @ & &  & 㿐`@V '  ?2 ?7@ @ߔ   @ٔ & &  & 㿘\@`*   7 `  ` @ 2m?( 2@" @"@@@ @  @@ "R?&@&` @"S@@&&` & "A ` @` @  @` 3?/@ 2`" @#` `@(@@ 2`@ې  @b` 2'@?` '`@` @@ @"``' @' @ @' 㿐    1    *     2   *       ''` !@A!̀ "!?'!€ `8@  "2  ` `` @@    2 ``@㿐@! `@! & :! @6  @ &#?'!ظ?@ 8@!e@ " '@' 㿐!ب? @` @h&?&@&`&`&` 6`6``@!8` @$`@t @&ۢ@g  㿐@! `@! @ 2` ? "!@L  ?`'@ @ "' 㿘"`!"`@&!@+ 㿘!Ԁ` @ "!&@ $!@B8@ & <   $ "c  @$( && * "`"` &$  @&$&$&$"$"$ "$$mpool_new: page allocation overflow. 㿘$?!h @`@@ 2$%  &$"&@ *? *  ""` 2@"`" "@" " 2 &" & 㿘$@  $l @SF? *   2""` 2""@$$ 2"" "2 &  "`  2 &"`$ $ 2 &" &   L,@@$ $@Ζ 2< @29 $@$$@` $ O"c* $ ,? *  $$ 2"" "$ $ 2 &" & $"$$   * 㿘`2` &   "` ` 2`&  "`@͐ 2@ǐ 㿘   @d?2  ? 2 @$` 㿘$$ @*A$"=$  25  @A?"<  ? *   2 " "`  2 ""@ 2  $  "`  2  $ "`2 $@  & $ $$ 㿘$ "$$$``$@` $@ 2?@2?$`@$$ ?` .` ("    2  $_ +`@$NetBSD: calloc.c,v 1.6 1995/12/28 08:52:12 thorpej Exp $㿘@@ @$NetBSD: abort.c,v 1.6 1995/12/28 08:51:57 thorpej Exp $㿐?' ?' @ @p@f  @7  @y @e@[ @ 㿘'L'P'T'X@ L㿘  `  ` @  ` x'' $#? ' $ "c? *@ @ @ ` '@؀ ?؁$. +`@$% +`@$ +`@@(#)sigprocmask.s 8.1 (Berkeley) 6/4/93@2@  0 +`@2"$Id: memset.c,v 1.4 1995/06/15 00:07:35 jtc Exp $($NetBSD: exit.c,v 1.4 1995/12/28 08:52:15 thorpej Exp $㿘 $#` $`?, @,  ?, @`2` $ @ $Id: vfprintf.c,v 1.17 1995/05/02 19:52:41 jtc Exp $㿘` @A&`&`&` @ ?7 7 ' ,'̐''$'''@1@Ր 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.@'D   2  @v " U?   V  H''''L4@! 4 %@@ $$@'  'k L'L `   ?/WN@``X@ "(*`@7? ? 7? ? ? ? ? ? 77? 77? 8L8T8T8T8T8T8T8T8T8T? ? ? ? ? ? ? ? ? ? 89D? 9D? ? ? ? 8? ? ;? ? ? ? ? <? ? <? ? ? ? ? ? ? ? ? ? 889D9D9D88? ? 8? ;L;<8? <0? <? ? ``$! "!``j"q$!$@`" >`i>`` @ 2Z$@"㿘>` @   *  ]  "   * `@ " @* "@`@ 2  " @"`@ ?$H`(`@" ?8 㿘     D       +``* @ ?# @ "@@ : 22"  ` :`33 @  ?# @  : 2`@  :`33   ?? " ;hh?0 $ #`#d:  4?8#` #d #`   ( #d`#㿐  * @?# " &@ " 4 ' ?,  " 2 ?,  "@ 3 @  ' ?+  " 4@'''㿈?\  ?*@' *@2  '' '씒  "@ *  $@2 '$@$`   &  ڐ$@ &    ΐ͐& 5"  &&.`?.`"@&㿀p?l?"@ `" * * '*" '?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doC`@ '  ''' bؐ    "ئ   2L - + '2LL "6L 0  L 0"L (    ``,*   ?4`+  *  ?Т`L/뀢9*: E`=L0ϦL0`π 6e  )`    `,* `4+  *   `,*   ` +  *   LЀ (ӖЀe EG``2 `2"L+ -І LЀ ,0ϦL0"π  *` *  ?ЦL/9$ "@" 2 ` `2 %@`u܀s`q`` ' ?c`B?  - @D?'  c`BD?`1 @ + 2-$@`?`  Г-`@"@$@%@ `Б* D?-` D"?  Г*`@?$@ G  Г*@D??!4$ <  $ ""c"`m? w  ! * D?<  ?, '!*@D? @(8 $$(#'L? I' G   Г*@??9<  $  ! * D?<  ?!*@ FcXH?DFH?'' $ ""c܀ 0B?' '+#;  *  @ a `      쀢 &$@@?d3 6"@ @ 44& $@ $   q  ݒ` W % 8   ' 02  @?  @ ''   ?@@'?' р LfcX B9?0 ch@  /?Ȁ cp?  P@ B < P ?Đ*@4 㿘 !" V   @  ?Đ*@6 V @Ӕ㿘V  @ ?2  2  ?Đ*@6  6 >P㿘@V 㿘! ? T` "??`X2` ?`''#*`@| 0DXl 0@P 'Ȑ '̐ @}Ѐ ? d 'g  'Ȑ w'  'Ȑ p'̐ 'Ȑ k'̐ 'R  'Ȑ b'̐ 'Ȑ ]'̐ 'Ȑ X'̐ 'Ȑ S'̐ 'Ȑ N'̐ 'Ȑ I'̐ 'Ȑ D'̐ '@'̐ 'Ȑ ;'̐ 'Ȑ 6'̐ '  '  '  '  '   '   '  'Ȑ '̐Ȓ Ė @ ? Ā ? $ "c ?Ȓ Ė @ ??ā㿈 $   $ ' ' '  @ ? $? @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  $ +`@$ +`@$6 +`@$„ +`@$ +`@㿐#\  ǔ@  @(#)sbrk.s 8.1 (Berkeley) 6/4/93X   : +`@"X$Id: bcopy.c,v 1.5 1995/06/15 00:07:16 jtc Exp $X@V+  2     " *@ `2" "@ `2 *@ `0* @  "2 2  "? *@2" ?"@? *@/usr/bin:/bin:/usr/sbin:/sbin:/usr/contrib/bin:/usr/old/bin㿘 @lh  a $`2] $   < ; <" *`@m <L    D "?  ?`6*!<*`@#?###    (","  " $ "cܰ?$ʄ +`@$Ƅ +`@$Id: bcopy.c,v 1.5 1995/06/15 00:07:16 jtc Exp $Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*@(#)cerror.s 8.1 (Berkeley) 6/4/93 $ cܐ??8"V? &P?  Ȧ 9, D?–3" ƀ    ?# `$@ 4` ,`  e  .  &?  Ȧ ,͑. "?  h&@㿘@ `r&Ѱ  ? $''''''' ' !ؐ  !    "  "&  & . ``& i& &`G9 $'#ܐ   ?2#` `#܀ 2``2q $  & +1a h&  @"& - -!&  T $  & x M $ ܐ ؐ !& .#& .!8& ,!0& ,#& 9!8& ,!& / &  3 & $`  2  "`   "  )€?? $0 $ "c $ #*` $% $"#ܰ 㿘  `"" ޒ & " ( $" "cܰ?㿘  `"| $ `7,!ԓ*`@0`8@ % $(" ( #  $    ( " "  $?2"I " )2"!€??>?" $ "c7?" " )2 "!€2&" ـ8  ?@[  ( , ($ $@" @"@@  $ 㿘  ` $  $@ 2" $ "c-?" )"!$ €2?@ ?  @" @"@@ǔ $ 㿐!" !Ȁ '  " &!D?"&!!'"'"3"!!`? "`!!" ?2,@?2,@"1@  Φ?آ`*"*"  !&"  㿐"O"!!!`? "`!!" @!'!Ȑ$' (@ n  ,?2,!ʠ$!̒!&!!Ȁ !  %!̀ &!ȑ, 2 !Ƞ , *!Ȁ*"  !&"  㿐!" !Ȁ t  " &!3?!&" / "&!!'"'""@"" :" " !Ȁ *@ `  ބ"@  Ԣ`@ 〤&" 㿐"" "@$" " !&"   ' " * $'@ Ֆ `?@  &" 㿘  `ܐ $ " (" $@`" $"@ @$  $" 2 $ @ $?$ $ "c ? "  @$" 㿘@ 2?@G  B 㿘. @   ђ ?2@E?@  `@  $ `6`.`: ?*  ` ?#@ 2@` *   `? ? @" : ?*  "` ` *2@*  ``?6`"?&" 㿘` `ߔ $ @$ ?"?" $ "."` " ( @! H" 2?C?"?p  `` ۰ $ ` 2" g ~  "" v !2 "!€??"l?"   2d?`2a? $ 'ܐ'" " ؔ  4?"䀢 G ؔ  """?"' ' ؔ ''" ` ' ؔ  "?$ $"  ͖  "?  "  ?" *@$"  ?㿘'L!Ā !     "K?&! &!!Lʔ  &!& "= @`*    `  ` !!̀ 2+?'!" @ @ !̀@!Ȁ 2@U  ܒ` 2&!?@ &!!Ȓ`@@' !' `' 㿘 ,&!  " L $ &@& 6 q  ?* 2 *2   * 2     8!!"!2`! &!  ̒*2   ?*2    "  z  u )#ܠ ,!?&! ` $@” `*    ?*     "  K ! $"#ܰ 㿘,  `$@,`2 @` , 2 6$@,`2  , 2 66, 4 ,  , $@2 2 㿘`.  @G.? . "@ # *  ` *2 @# ` 2. 2`@2`@2.,*  @4 @`@ 24 8?& 8` .` 㿀  ɡ   ɚ 2 x?-.3 @q3`  .   -g .   - '  @   ߧ,@ '% ',%+  ` , 2 @@ -% .``$6 @2`, `@@' " ', ,"6* 2 * @ * %2`* 2   ?.   ?- p* 2       #\@ 2?܀؀  ),`2 @  2#  `" 4* 2 *  * '2* 2 Ֆ Y   @\  ] ,`2   (W,`  ' %@ ' '  " ' `2  @`*  @ @ǒ";?j .  @`*  @ @2?M .`* 2  ,`,`2  *W @ 㿘`  5 *` 8.  & *  @ *     Y *`@ * "R?``2 ( @`*   @8 `@;"6?` @`*   @ Д `@9 2?` .` 8   & 8 (` 4 $  7@ 㿘 4@@ `2  & 4 & 4` .`@r,`2 `Ǻ  &` ` ` *`*@`2`*  ?2`2`2`4`㿐!?N K < Ƽ*  @6  *@  <*@  Ʃ*  @ :@     ?"U??   $ O"cF?2`2   2  6@ ?6` 66` ဢ@1`  :  + *@ '.@ @*`*` *` 7**    * 7* @  *` 㿐!? @ѐ 2q?  ဢ@+!   :  $*@ '.@ @*`*` *`@ *@ 7.@ @ *` < *  @6  *@  <*@  *  @ :@    P ?"?? $  O"cܰ?㿘 !! &!<  ,  L  F"?* $ $.2 đ."!8      (HASH: Out of overflow pages. Increase page size 㿘` -  D?``=@ ?` * ? `$: 2. !8@F2` * ? ` * ?`$  :  ? ?j*`` *` ӑ. - `D$`$`D "`D `@$'$`   $ $`  4au 1 -  @" D @" @ ` * ?2%`` - @ J i - @`D  '""`D  Ր $` -  @" D @" @ : *   ?$ *@ @$ :- C  : *    $  *   $ ` B*` `$?$`$  .  D  .  . @ @$'4 . . 6  㿘` '2 *  @@ $@&& $  :@ * ? @*!8 @b   : *    ?$ *@ * " x㿐?' ݔ!"Ȁ?&!M"! Q  ͔ !8@?㿘,`&4, 2 @`$6, 4 644* `%@2 * 2 㿘!@6 u .`@ "a8.`.`!8Ė  >  .`!8!8  ?*@   *  2@*@ 㿘`e*2 4*  $@,`2 , 4 s%@*44*2`@* $@2`* 2 * 4 x`/*  %4*  "*4* 2 .4 <%@ 4*`@`"2`* 2 * 2?`` .`*  `?F*2 @4*2  "*  $, 2 ,`4`*44*2`@* $2`* 2 * 4 <2`?* 4 ` .`*   ? 㿘 ` ?* 2  (   *    2*  ?` .`ז b@`` 2+  ?  22`$$?$?2+ 2  *` " 2*`@  ?2`  `,2- 8?& 8 㿘`. $* 2 ( . @  ", @ 2 ', 2 &. @`o "?` " * 2 ܰ , 2 2 ?. @ ?㿘@   `*`    2&@*`@ 9 "  &@   㿘`.   .*`@  "w?`  .   2*`@  ``B * @  2 " 0,`G?*  &" 9& 2 &! !$ &!$ .&!(*`@ Ζ (&!  &!(!   2! !$ &!$&! ,`2@?&   $,`! 2!&  "cܰ?㿘`  "@  /`!  D&!2 &!( 2&! !$ (&!$*`@z -&! !   2` !$ &!$&! *`@d $?`   $! ` % "cܰ?㿘 @ ?&!& ?㿘`` " ``?* 2  ! * .&!  "` $?@*`@  И$?`   $!`` ͔ "cܰ?㿈'P\ 2d?@ P4 * 2 ` PҖ $ L?$ ` ` *`"``/`  `*`2 6`*`2 66*`2`@2`* 2 $$ P` ` *` *   6* 2 2 * 2 P ?6P`"$ $ 㿈  `"" ѐ & " ""*" "%8Z $!̀ !Ȁ   s" L&!"&!!*!" "" !'"' 3'9"<.@h (  $! $@2"  @ $"@  $" Z  $ "cU?"<" )2 "!€?"F?" ," ""'" '"'Ҵ""'" (" @( 2#?"`" "@ 2 "& $"  &"   x! 3䀢?/' '''  "@     ""@d?2 К L?`   " ` ,`2 #\ %25 " &"0  ?,`2`* 2 :  *` " `(*  4 ,`2`@ "4 2`  $  * " &""  &" O  %W% (Erasmus) %G%_/@/H/8/H/0/( / +X/+X/+X//..p.p.1X.2.H..`.0.0. . 5. Gx.x Gx.p .h @.X S.H W.@ W.0 \.( \. `. . . . - - - - X- - H- - `- 0- t- - - - -x -p -h 8-` -X ژ-P -H#`-8(-0+-(--;-;,,,,,,,,,@,,X, ,'(,'(,-0,x-0,p<0*P+@?X?H?@?(? ??>>>    e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular fileazb dѰBzшXc$(dzШe0ЈpPf8gzϐhpHHA@0izΰj{ΠxkHlH\m|hXHn"x0o0OpHTPq ͠pXr!{0s!zS!z̰t$̨T̘u"hH0Vw!zx$X˨XATˀ`yPH z{?l (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t 290@(#) Copyright (c) 1980, 1987, 1993 The Regents of the University of California. All rights reserved. $NetBSD: strings.c,v 1.7 1995/02/15 15:49:19 jtc Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $NetBSD: cut.c,v 1.9 1995/09/02 05:59:23 jtc Exp $.@---h-P-H-,,p,@-H+++x/@a/0c/(c/d/d/f.h.l.L.n.N.q.q.r.S.t.T.v.V.1.9.xZ.pbk32222P2 111`1(0000`080/5KKJJJJ5KJL\\[[-H-H-H-H[      pd           #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-@(#) Copyright (c) 1988 The Regents of the University of California. All rights reserved. $Id: chroot.c,v 1.4 1994/01/07 20:34:23 jtc Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: chflags.c,v 1.4 1995/03/26 08:49:20 glass Exp $$NetBSD: stat_flags.c,v 1.5 1995/09/07 06:43:01 jtc Exp $$NetBSD: cchar.c,v 1.10 1996/05/07 18:20:05 jtc Exp $$NetBSD: gfmt.c,v 1.10 1996/05/07 18:20:08 jtc Exp $$NetBSD: key.c,v 1.11 1995/09/07 06:57:11 jtc Exp $PH@80(4tXPt$NetBSD: modes.c,v 1.9 1996/05/07 18:20:09 jtc Exp $$NetBSD: print.c,v 1.11 1996/05/07 18:20:10 jtc Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: stty.c,v 1.11 1995/03/21 09:11:30 cgd Exp $CCFfvVuusCopyright (C) 1989, 1991, 1992, Free Software Foundation. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. -Ro-HxL-M8-I-J<-K--L-x-hNT-X<8\-PO-ll-HP-xm4-@Qo@-8<-0<t-(<- -<X-<  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~??A 00123456789abcdef0123456789ABCDEFAAAAAxΠh ΠX ΠH Π8,( , , ?` ?A$NetBSD: skeleton.c,v 1.10 1996/03/25 00:36:18 mrg Exp $! &  )''  +, #$"%%(*  >i? j] a"5:; )% ek/09#!Uw'&`d834xr(LJc6vzX2MNK7*1+,=.-Cl !uvmno0"p(,).qr:+ q, , ,n , X c; X X X X ,g u\c , , , , , ,S{Wd ,) X F*nq ,nn k )X L  F>>%a$ FXn Xch-)c F FX F X X >>>>>c> .n F > F F F7aan ;> nanaaa67 \9 p&KP/ KGppJ c:; ;`p } p ? z *tFcHILObvFb g`[A[P^<5^'g6gA&PbbggwAg$A$OAbbAADA\]_[\_\^A%&g3[$$@b$'$$4$[\]g'$WXY_U\b@Vx@z@@@@AA@QFEQ@GW\]USTV'X$@$@#@@@'@ ff@RYZRDH#OIX#Qff@O@f@#Q=#[{|^5Sg6Pf gbSSORb@}~DAAAgfAA_\AAAAAAAAAAAAAAAAAAAAA$$$$$[S$$$$$$$$$$$$$$$$$$$$$@@@Q@@QFEG@@@@@@@@@@@@@@@@@@@@@@@@R@@Rf@@f@@@t@@@@tt-ffttttttSZSS /12888>8t 88BR888888y&V58@6$V8V*8LM8t88888888/   8ut/8V8ttuuuu Ns8s8tt!888sss|s||o|%o79;8Ouoo8888888888ss;8s8Oo88|sV**oVVsO EF*O)s,-0OG2OOOOOOOOuOuu;**s*usOsOOO|sOs#||oWssossO*WW**OOOOO*W* .51*364*{W{{{{WW{  {{{{{{{{{{yyyyyyyyyyyyyyy@@@@@@@TTT@@'T'@@k@@@@@k@@@@@@@@@@@@@@@@@@@T@@@@TT@@<<<<<<^< _`abcdefghij  _`abcdefghij <<@@@@@@@@@@@@@@@@@@@@@@'BBBBBBBBBBB<<<<<<<<<<<<<<<<<B<<<<<@@@@@@BB@CCCC@C56CCCCC _`abcdefghijC BBBBBBBBCCBBBBBBB@@@@@@@@@@@@@@@@@@@@@ppppppppppCCCCCCCCCqq qqqpCCCCCCCqqqqqppq56qqLMBBBBBBBBBBNpppppppp}}}B}ppppppp}}}}qqqqqqqq~~~~qqqqqqq~~~~}5 E6'LMJ~BBBBBBBBBBBBBBBBN56KLMJ}}}}}}}}}}}}}}}}~~~~~~~~~5N6~~~~~~~LMJ EF56GHILMJ5N656'LMJLMJ ENF"GHI(+N/P N5 6  EF56GHILM EF56GHI EFN EFGHIGHI  h hhhh h EF5h6GH 6@@@@@@'? hh6hl lhhhllhhl5 6l  lm mmmm m @@@@@m @@@@@  llllnnlllll nnnnmmmmnmmmmmnnnnnnnnn),)$)!,;$,) (,+[-D;D),:;&,!? $;>(:;+-;/!")]),,];]m([]q( q!{)$,](;+]-(/,<,,,!"{;;p%^|]*]{!/($ ,(;;+-/({}([;;;>;;%!"(*+{-!/;$34)((/+^-/{!}$((+-/{{){{,;))>);)^|:;{)}?{(, !$,( ]+-{ ;> | {#$  {!"   !"#$ |   !"#$     !"#$   j !"#$ ,!"#$%&  :;>?346 EFHIJKLM !"ij|5ef@lSTUVWX+,!$l(p+;-t>#<>cks,| :;>?|#, :;>,#D:;)>,|:;    mqr5|@]!&|STUVWX { lp t"'(+/!"#$m efl   ,), 02;>    !$%()*+,-!/&!$:;<(>?+-/!|$%)*+,-/]^:;<>?)!,$0(2+-{|!$%]^()*+,-/?:;<>?{|!$%()*+,-/]:;<,>?:;>? {|!$%]()*+,-/:;<>?{|   |] !"#$   {|!"#$ !"#$     !"#$ !"#$   !$%()*+,-/   !"#$:;<>? #$   !$%]()*+,-/ !"#$:;<>?{|!$%()*+,-/]:;<>?!$%()*+,-/{|]:;<,>?:;>?{|!$%]()*+,-/:;<>?{|   |!$]^()+,- !"#$:;<>?{|   ] !"#$   {| !"#$   !$%()*+,-/  !"#$:;<>? #$   !$]^(+-/ #$;{|,   !;$>()+,- !"#$:;<>?{}!$(+-/];|!$(+-/{|;  !{$}(+-/ #$;{}!"#$ {}   !$(+-/ !"#$;!"#${}!"#$!"#$!$(+-/;!$()+,-:;>?{]!"#$!$(+-/{|;!$%(*+,-/:;>?!$(){,!$^(+-:;<>?|]!"#$  {| !"#$!()+,-:;<>?]!"#$  !$(){|, #$:;<>?  !$(),] !"#$:;<>?!"#${|!$%(]*+-!/$(+-;<>?{|<>  !^$(+,- !"#$:;>?|!(|+,-:;<>?  !$(|, !"#$:;>?  !$|(, !"#$:;>?|  !$(+- !"#$;<>?!"|   !"#$|  !$(+,- !"#$<>?A  !$(+-/ !"#$  !v$|()+- !"#$<>?{  !$(+- !"#$:<>?!|$(+!-$(+-;<>?<>?!| $(+-/ !"#$!$|*| ! $(+-!"#$ {!$(+- !"#$<> !$(+- !"#$:? |  !"#$ !"#$!$ (+-/),!"#$:;?! $(+-/]!"#$! $(!{+$-/(+-!"#$! $(+-/ !"#$!$(!+$-/(+-!/$;(+-/!$(+-/ ),!"#$ :;#$?!$(+-/]!"#${ ),!"#$!"#$:;?]!"#${!"#$!"#$!"#$  !"#$), #$:;?!"#$]  { #$   #$ ?#,?#Đ-?#421?#qXx*p6`6X5P?#  H(@8?#rp0?#u(?$vx ?#w?#P0./?#t3?#?# ?#h?#@?#?#?# $?# ?#?#p?#4?#)(END OF FILE)<nnnpnPn8n nmmmmmmpmHm(m݀ڨp`P<@p0ۤ  @tܨ?@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $NetBSD: mknod.c,v 1.8 1995/08/11 00:08:18 jtc Exp $/dev/ptyXX\^:   }) 0@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $NetBSD: ping.c,v 1.20 1995/08/11 22:37:58 cgd Exp $8. Ad@@@@@@@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: rm.c,v 1.19 1995/09/07 06:48:50 jtc Exp $$NetBSD: cmp.c,v 1.8 1995/03/21 09:06:20 cgd Exp $$NetBSD: stat_flags.c,v 1.5 1995/09/07 06:43:01 jtc Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: ls.c,v 1.16 1996/02/14 05:58:53 jtc Exp $P.{$NetBSD: print.c,v 1.14 1995/09/07 06:43:00 jtc Exp $$NetBSD: util.c,v 1.12 1995/09/07 06:43:02 jtc Exp $$NetBSD: map.c,v 1.4 1994/12/07 05:08:07 jtc Exp $$NetBSD: misc.c,v 1.3 1994/12/07 05:08:09 jtc Exp $$NetBSD: set.c,v 1.6 1994/12/07 05:08:10 jtc Exp $$NetBSD: term.c,v 1.6 1994/12/07 05:08:12 jtc Exp $@(#) Copyright (c) 1980, 1991, 1993 The Regents of the University of California. All rights reserved. $NetBSD: tset.c,v 1.4 1994/12/07 05:08:15 jtc Exp $$NetBSD: wrterm.c,v 1.3 1994/12/07 05:08:16 jtc Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $NetBSD: disklabel.c,v 1.30 1996/03/14 19:49:24 ghudson Exp $ x h ` P H @ 8 0 (   /tmp/EdDk.aXXXXXX $NetBSD: dkcksum.c,v 1.6 1995/03/18 14:54:42 cgd Exp $@(#) Copyright (c) 1988, 1990, 1993 The Regents of the University of California. All rights reserved. $NetBSD: shutdown.c,v 1.9 1995/03/18 15:01:09 cgd Exp $FPFP*0 XXX,,x<<$NetBSD: dkcksum.c,v 1.6 1995/03/18 14:54:42 cgd Exp $$NetBSD: getmntopts.c,v 1.3 1995/03/18 14:56:58 cgd Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: newfs.c,v 1.20 1996/05/16 07:13:03 thorpej Exp $ Ip I` IX IP IH I@ I8 I0 I( I I@ @%s: can't read disk label; disk type must be specified$NetBSD: mkfs.c,v 1.25 1995/06/18 21:35:38 cgd Exp $>......@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: cp.c,v 1.14 1995/09/07 06:14:51 jtc Exp $ $NetBSD: utils.c,v 1.4 1995/08/02 07:17:02 jtc Exp $$NetBSD: acu.c,v 1.3 1994/12/08 09:30:39 jtc Exp $$NetBSD: acutab.c,v 1.3 1994/12/08 09:30:41 jtc Exp $  M8 P P, - / /   < 6 8 8T F4 HT H F4 HT H$NetBSD: cmds.c,v 1.6 1995/10/29 00:49:38 pk Exp $<<  $NetBSD: cmdtab.c,v 1.3 1994/12/08 09:30:46 jtc Exp $! L< |> h ɔt H p 0 |  $ $C c .    h s X ? @ 0# 0 $NetBSD: cu.c,v 1.3 1994/12/08 09:30:48 jtc Exp $$NetBSD: hunt.c,v 1.5 1995/10/29 00:49:40 pk Exp $$NetBSD: log.c,v 1.4 1994/12/24 17:56:28 cgd Exp $$NetBSD: partab.c,v 1.3 1994/12/08 09:30:55 jtc Exp $ !"$'(+-.03569:~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@0000@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $NetBSD: sync.c,v 1.7 1995/03/21 09:11:37 cgd Exp $@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: ln.c,v 1.10 1995/03/21 09:06:10 cgd Exp $$Id: buffer.c,v 1.3 1993/08/02 17:48:38 mycroft Exp $Y$Id: create.c,v 1.6 1994/03/27 09:26:59 cgd Exp $$NetBSD: diffarch.c,v 1.6 1995/04/23 08:36:38 cgd Exp $$NetBSD: extract.c,v 1.6 1995/04/23 08:36:41 cgd Exp $$Id: fnmatch.c,v 1.2 1993/08/02 17:48:44 mycroft Exp $$NetBSD: skeleton.c,v 1.10 1996/03/25 00:36:18 mrg Exp $$Header: /a/cvsroot/src/gnu/usr.bin/tar/getdate.y,v 1.3 1993/12/06 09:38:59 cgd Exp $ %"#  $!(  ,  E "8C-C +)!"0 #$&%-'(./1'&)*''&''''''&&/:,   :    ,    /    .                               $Id: getoldopt.c,v 1.3 1993/08/02 17:48:46 mycroft Exp $$Id: getopt.c,v 1.4 1995/04/29 05:36:24 cgd Exp $?$Id: getopt1.c,v 1.3 1993/08/02 17:48:49 mycroft Exp $$Id: gnu.c,v 1.4 1994/03/27 09:27:25 cgd Exp $$Id: list.c,v 1.4 1996/03/26 00:48:49 cgd Exp $$Id: mangle.c,v 1.3 1993/08/02 17:48:53 mycroft Exp $$Id: names.c,v 1.4 1993/08/02 17:48:53 mycroft Exp $$Id: port.c,v 1.4 1993/08/02 17:48:56 mycroft Exp $/dev/tty$NetBSD: regex.c,v 1.4 1995/04/23 08:36:44 cgd Exp $ ިސx`P8 ݸݘ݀$Id: rtapelib.c,v 1.4 1994/10/18 06:04:08 andrew Exp $$Id: tar.c,v 1.7 1996/03/21 18:35:51 jtc Exp $T(cT rTxTxTtTuSASASdSdSS SSCS#$STSVSpXShS`fSPbSH S@vS8#4S #SKS#R#HRkR#R#R#`R Rx#Rh#RX#RPNR@NR0 R GRgQ#QFQFQ#Q#Q#Q#\Q#,Qx#QhoQXoQHZQ8ZQ(#Q zQzQR#P#PLP#P#P#P#LPPx#Ph#PX#PP#t$Id: update.c,v 1.4 1994/03/27 09:27:38 cgd Exp $$Id: version.c,v 1.3 1993/08/02 17:49:09 mycroft Exp $GNU tar version 1.11.2@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount.c,v 1.24 1995/11/18 03:34:29 cgd Exp $@ xh@P@ 88($NetBSD: getmntopts.c,v 1.3 1995/03/18 14:56:58 cgd Exp $$NetBSD: skeleton.c,v 1.10 1996/03/25 00:36:18 mrg Exp $!!!!}mu=IUa!/   !"#$%&'()*+,-./012                                                                                     $NetBSD: arith.y,v 1.6 1995/05/11 21:28:45 christos Exp $$NetBSD: arith_lex.l,v 1.5 1995/05/11 21:28:46 christos Exp $$NetBSD: alias.c,v 1.6 1995/05/11 21:28:40 christos Exp $$NetBSD: cd.c,v 1.15 1996/03/01 01:58:58 jtc Exp $$NetBSD: error.c,v 1.14 1995/05/11 21:28:51 christos Exp $$NetBSD: eval.c,v 1.29.4.1 1996/06/10 19:36:36 jtc Exp $$NetBSD: exec.c,v 1.17 1995/06/09 01:53:50 christos Exp $$NetBSD: expand.c,v 1.20 1996/02/12 15:11:41 christos Exp $$NetBSD: histedit.c,v 1.8 1995/05/11 21:29:12 christos Exp $$NetBSD: input.c,v 1.19 1995/10/19 04:14:37 christos Exp $#ň$NetBSD: jobs.c,v 1.17 1995/07/04 16:26:45 pk Exp $$NetBSD: mail.c,v 1.9 1995/05/11 21:29:22 christos Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.23 1995/11/19 23:27:42 christos Exp $$NetBSD: memalloc.c,v 1.17 1996/05/20 14:49:32 cgd Exp $##$NetBSD: miscbltin.c,v 1.15 1995/06/12 19:44:16 jtc Exp $$NetBSD: mystring.c,v 1.10 1995/05/11 21:29:41 christos Exp $$NetBSD: options.c,v 1.14 1995/05/11 21:29:46 christos Exp $efIimnsxvVExCha`bXu$NetBSD: parser.c,v 1.29 1996/05/09 19:40:08 christos Exp $$NetBSD: redir.c,v 1.12 1995/05/11 21:30:10 christos Exp $$NetBSD: show.c,v 1.11 1995/05/11 21:30:24 christos Exp $$NetBSD: trap.c,v 1.15 1995/06/07 04:16:57 christos Exp $$NetBSD: output.c,v 1.15 1995/09/14 16:19:06 jtc Exp $d$NetBSD: var.c,v 1.13 1995/05/11 21:30:39 christos Exp $@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $NetBSD: mkdir.c,v 1.14 1995/06/25 21:59:21 mycroft Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $NetBSD: hostname.c,v 1.10 1995/09/07 06:28:40 jtc Exp $@(#) Copyright (c) 1987, 1990 The Regents of the University of California. All rights reserved. $Id: update.c,v 1.2 1993/08/01 17:54:51 mycroft Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $NetBSD: umount.c,v 1.16 1996/05/11 14:13:55 mycroft Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $NetBSD: reboot.c,v 1.8 1995/10/05 05:36:22 mycroft Exp $$NetBSD: test.c,v 1.15 1995/03/21 07:04:06 cgd Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: pwd.c,v 1.7 1995/03/21 09:08:18 cgd Exp $@(#)history.c 8.1 (Berkeley) 6/4/93DxP1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RYK"""Q"7I: UH""@""NG"PTW""D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""aanaHaҰb? fwdbck: x`XH@( xh`H@( phPH80 phPH0h`PH0(POAOBOCOD( ʀ(@  a(  =,A"'B" """"@80(  @ ݸݰݨݠݘݐ ݈@݀p`XPH@80( @@  ܸܰܨܠܘܐ ܈@܀xph `@XPH@80FGx`I0 JDEx80 9@O`PP8 S  T  : p `? H @6  7  <  > h XU 0 (X  ;  Y  = P @B  A  R  xQ ` HM  N  C  pH @ 0V WKhPL'&h`58(,-%pX)(04#P@.1(3`P/(2$*hP+(pP@ (  `P 0 pH0"pP@(!  pX(h@0h0 XY_SYS WpQQTTTTYPUZ_VZ@^VDWZ\[Z8Z$UdY Y(YY0Y8YHY@Xj(l0h\f$ekhllgXgkli,klkif\,L84HDTHxt,hh@(#)tokenizer.c 8.1 (Berkeley) 6/4/93$NetBSD: logwtmp.c,v 1.5 1996/05/15 21:42:29 jtc Exp $$NetBSD: logout.c,v 1.5 1996/05/15 21:42:28 jtc Exp $$NetBSD: login_tty.c,v 1.5 1996/05/15 21:42:27 jtc Exp $$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $@(#)standout.c 8.3 (Berkeley) 8/10/94@(#)insertln.c 8.2 (Berkeley) 5/4/94@(#)initscr.c 8.2 (Berkeley) 5/4/94@(#)idlok.c 8.2 (Berkeley) 5/4/94@(#)delwin.c 8.2 (Berkeley) 5/4/94@(#)clrtobot.c 8.2 (Berkeley) 5/4/94@(#)addnstr.c 8.2 (Berkeley) 5/4/94@(#)addch.c 8.2 (Berkeley) 5/4/94@(#)addbytes.c 8.4 (Berkeley) 5/4/94 @(#)setterm.c 8.7 (Berkeley) 7/27/94$$$$$$$$$$$$|$L$8$t$$`$$$$$0$8$$ $$$$$$($$<$`$d$P$\$p$t$h$l$D$L$$$$4$$$$$$ $@$$$$#θ$$x$$$l$H$d$P$$p$\$D$@$X$<$h$H$T$|$x$T$$$$0$(@(#)scroll.c 8.3 (Berkeley) 5/4/94@(#)move.c 8.2 (Berkeley) 5/4/94@(#)longname.c 8.1 (Berkeley) 6/4/93@(#)deleteln.c 8.2 (Berkeley) 5/4/94@(#)clrtoeol.c 8.2 (Berkeley) 5/4/94@(#)id_subwins.c 8.2 (Berkeley) 5/4/94@(#)tty.c 8.5 (Berkeley) 8/13/94@(#)tstp.c 8.3 (Berkeley) 5/4/94@(#)refresh.c 8.7 (Berkeley) 8/13/94 @(#)newwin.c 8.3 (Berkeley) 7/27/94@(#)erase.c 8.2 (Berkeley) 5/4/94@(#)curses.c 8.3 (Berkeley) 5/4/94Uh@(#)cur_hash.c 8.1 (Berkeley) 6/4/93@(#)cr_put.c 8.3 (Berkeley) 5/4/94@(#)tscroll.c 8.4 (Berkeley) 7/27/94@(#)touchwin.c 8.2 (Berkeley) 5/4/94@(#)putchar.c 8.2 (Berkeley) 5/4/94$NetBSD: tputs.c,v 1.5 1995/06/06 08:14:37 pk Exp $5MS7) $NetBSD: tgoto.c,v 1.5 1995/06/05 19:45:54 pk Exp $$NetBSD: termcap.c,v 1.8 1996/03/22 23:25:30 jtc Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'    91)! :2*" ;3+# <4,$?7/'>6.&=5-%     #& +6 )4%/7(3-!0,1'8"5.*2$                                                                                                                                     !"#$1234%&'(5678)*+,9:;<-./0=>?@./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz@.B9I-0Q@.B9I-0Q~7<u~7<u?@C@~7<unY?33333?mo?UUQ&M?t`A?͆Je?~(JEN?UUUUU>fl?Vj%,Ak>f7ir?.B9?.C \a l9<Ge+? :? >/[?Ge+?G`>T ]D???UUUUUU??G`>T ]D?Ge+C@?~(JEN?͆Je?t`A?UUQ&M?mo?33333@? >/[? :~7<u<Ge+nY?.C?.B9 \a l9>f7irоAk?Vj%,fl?UUUUU>@nY?!TD-?!TD-@ !TD-<&3\@ !TD- !TD-!TD-?!TD-?!TD-!TD-@|3!|3!<&3\?~7<u~7<u?@?G???UUUUUI?*a>W}Z+=:Z|=:Z|Z+>W}*a?UUUUUI???UUUUULVlQw>~OR>!Ľ龈8?龈8>!ľ~OR>VlQw?UUUUUL???Ap?_0mȃ?!T@=дabc1=дa`;.ps;.9{% I?!T@=дabc1=дa`;.ps?_0mȃ?;.9{% IAp?.B=95yRDCP??.B=95yRD?Fd?I$"Y?UUUUU???~7<up@.B9I-0Q?.B.B=95yfl?Vj%,Ak>f7ir@.B9I-0Q?Ge+~7<u?>f7irоAk?Vj%,fl?UUUUU>@pC00?Ap>p>pAp?@ ???nY?CP<~7<unYCPnY~7<u<~7<u~7<uݐ$NetBSD: kvm.c,v 1.2 1996/05/13 02:30:22 thorpej Exp $ ` $$NetBSD: tcflush.c,v 1.2 1995/06/26 23:05:50 jtc Exp $$NetBSD: tcdrain.c,v 1.2 1995/06/26 23:05:10 jtc Exp $$NetBSD: cfsetspeed.c,v 1.1 1995/04/25 00:04:35 jtc Exp $$NetBSD: cfsetospeed.c,v 1.1 1995/04/25 00:04:33 jtc Exp $$NetBSD: cfsetispeed.c,v 1.1 1995/04/25 00:04:31 jtc Exp $$NetBSD: cfmakeraw.c,v 1.2 1995/06/26 23:04:45 jtc Exp $$NetBSD: cfgetospeed.c,v 1.1 1995/04/25 00:04:27 jtc Exp $$NetBSD: cfgetispeed.c,v 1.1 1995/04/25 00:04:25 jtc Exp $0XHHH?192$f1]B; oH@tIk۰\YeT.h=y-Ckg.*ʈis]O5oQank6A?"˜*{" 'G&&&' ""%&P&&$NetBSD: setbuffer.c,v 1.4 1995/02/02 02:10:32 jtc Exp $$NetBSD: puts.c,v 1.5 1996/03/29 23:29:16 jtc Exp $$NetBSD: fscanf.c,v 1.5 1996/03/29 23:29:08 jtc Exp $$NetBSD: freopen.c,v 1.5 1996/05/04 19:25:19 mycroft Exp $$NetBSD: fputc.c,v 1.5 1996/03/29 23:29:06 jtc Exp $+X---.`/h$NetBSD: regexec.c,v 1.6 1995/02/27 13:29:48 cgd Exp $$NetBSD: regerror.c,v 1.4 1995/02/27 13:29:20 cgd Exp $gggggg`gPg8g(ggfffff fpfX fHf( ff ee eeeeepeHe8eed$NetBSD: regcomp.c,v 1.6 1995/02/27 13:29:01 cgd Exp $kkkkxk@kk8k0kk(kkjjkjjkjxjXkjPikiikiikiikiihkkp(p ppppoooooo o o o o o o o ox oh o`oXoPoHo@o8o0o(o oooonnnnnnnnni n!n"n#np$n`%nP&n@'n((n)n*m+m,m-m-m.m.m/m/m0m1m2m3m4mx5mp6mh7m`8mX9mP:m@;m0<m =m>l?l@l[l\l\l]l^lp^l`_lP_l@`l0{l{l|k}k}k~k$NetBSD: lshrdi3.c,v 1.2 1995/02/27 17:30:28 cgd Exp $$NetBSD: ashrdi3.c,v 1.2 1995/02/27 17:29:45 cgd Exp $$NetBSD: sethostent.c,v 1.5 1996/02/02 15:22:39 mrg Exp $h$NetBSD: ns_ntoa.c,v 1.4 1995/02/25 06:20:51 cgd Exp $$NetBSD: ns_addr.c,v 1.5 1995/02/25 06:20:51 cgd Exp $$NetBSD: linkaddr.c,v 1.5 1995/02/25 06:20:49 cgd Exp $0123456789abcdef$NetBSD: iso_addr.c,v 1.4 1995/02/25 06:20:47 cgd Exp $0123456789abcdef$NetBSD: inet_ntoa.c,v 1.4 1995/02/25 06:20:46 cgd Exp $$NetBSD: inet_netof.c,v 1.4 1995/02/25 06:20:43 cgd Exp $$NetBSD: inet_makeaddr.c,v 1.4 1995/02/25 06:20:42 cgd Exp $$NetBSD: inet_lnaof.c,v 1.4 1995/02/25 06:20:42 cgd Exp $$NetBSD: herror.c,v 1.6 1996/02/02 15:22:22 mrg Exp $x$NetBSD: getservbyport.c,v 1.4 1995/02/25 06:20:37 cgd Exp $$NetBSD: getservbyname.c,v 1.4 1995/02/25 06:20:36 cgd Exp $$NetBSD: getprotoname.c,v 1.4 1995/02/25 06:20:36 cgd Exp $$NetBSD: getnetbyname.c,v 1.5 1996/02/02 15:22:20 mrg Exp $$NetBSD: getnetbyaddr.c,v 1.5 1996/02/02 15:22:19 mrg Exp $$NetBSD: gethostnamadr.c,v 1.13 1995/05/21 16:21:14 mycroft Exp $@(#)setlocale.c 8.1 (Berkeley) 7/4/93ҸҨҘҐҀCCCCCCC$NetBSD: wait3.c,v 1.4 1995/02/25 15:40:14 cgd Exp $$NetBSD: wait.c,v 1.4 1995/02/25 15:40:11 cgd Exp $$NetBSD: vis.c,v 1.6 1995/02/25 15:40:09 cgd Exp $$NetBSD: valloc.c,v 1.5 1995/02/25 15:40:04 cgd Exp $$NetBSD: utime.c,v 1.5 1995/02/25 15:39:58 cgd Exp $$NetBSD: ttyname.c,v 1.9 1995/05/02 01:45:33 mycroft Exp $/dev/$NetBSD: signame.c,v 1.6 1995/03/04 01:56:05 cgd Exp $$NetBSD: setmode.c,v 1.13 1996/04/03 19:49:01 jtc Exp $$NetBSD: setjmperr.c,v 1.5 1995/03/04 01:55:55 cgd Exp $$NetBSD: sethostname.c,v 1.4 1995/06/16 07:36:21 jtc Exp $$NetBSD: pwcache.c,v 1.5 1995/05/13 06:58:23 jtc Exp $$NetBSD: popen.c,v 1.11 1995/06/16 07:05:33 jtc Exp $$NetBSD: nlist.c,v 1.7 1996/05/16 20:49:20 cgd Exp $$NetBSD: isctype.c,v 1.13 1995/02/27 04:34:43 cgd Exp $$NetBSD: glob.c,v 1.5 1995/02/27 04:13:35 cgd Exp $$NetBSD: getttyent.c,v 1.9 1995/06/16 07:05:31 jtc Exp $$NetBSD: getpwent.c,v 1.14 1995/07/28 05:43:01 phil Exp $$NetBSD: getpass.c,v 1.9 1996/05/20 06:13:07 jtc Exp $)$NetBSD: getmntinfo.c,v 1.5 1995/02/27 04:12:53 cgd Exp $$NetBSD: getlogin.c,v 1.6 1995/02/27 04:12:47 cgd Exp $$NetBSD: getloadavg.c,v 1.5 1995/02/25 08:51:15 cgd Exp $A$NetBSD: getgrent.c,v 1.13 1995/07/28 05:43:57 phil Exp $$NetBSD: getbsize.c,v 1.8 1996/01/22 16:34:08 mycroft Exp $$NetBSD: fts.c,v 1.12 1995/02/27 03:43:30 cgd Exp $$NetBSD: fstab.c,v 1.8 1996/04/03 19:48:56 jtc Exp $$NetBSD: exec.c,v 1.7 1995/12/14 16:51:27 jtc Exp $$NetBSD: errx.c,v 1.1 1996/04/15 23:45:32 jtc Exp $$NetBSD: err.c,v 1.13 1996/04/15 23:45:29 jtc Exp $$NetBSD: disklabel.c,v 1.11 1995/06/07 13:14:09 cgd Exp $e(e eeeedddddddeeeeeeexepehe`e(eXePeHe@e8e0$NetBSD: devname.c,v 1.4 1995/02/25 08:51:08 cgd Exp $$NetBSD: daemon.c,v 1.4 1995/02/25 13:41:16 cgd Exp $p8$NetBSD: alarm.c,v 1.4 1995/02/25 15:39:04 cgd Exp $q(rHrs0y$NetBSD: yp_match.c,v 1.2 1996/05/18 19:01:27 jtc Exp $$NetBSD: yp_first.c,v 1.2 1996/05/20 15:17:32 cgd Exp $$NetBSD: tcsetattr.c,v 1.2 1995/06/26 23:06:06 jtc Exp $xph$NetBSD: wbuf.c,v 1.5 1996/03/29 23:29:34 jtc Exp $$NetBSD: fwrite.c,v 1.5 1995/02/02 02:09:51 jtc Exp $$NetBSD: ftell.c,v 1.6 1995/03/22 18:19:51 jtc Exp $$NetBSD: fputs.c,v 1.5 1996/03/29 23:29:07 jtc Exp $$NetBSD: regfree.c,v 1.4 1995/02/27 13:29:56 cgd Exp $$NetBSD: res_query.c,v 1.10 1996/02/02 15:22:34 mrg Exp $$NetBSD: res_mkquery.c,v 1.6 1996/02/02 15:22:32 mrg Exp $$NetBSD: getservent.c,v 1.4 1995/02/25 06:20:38 cgd Exp $$NetBSD: getprotoent.c,v 1.4 1995/02/25 06:20:35 cgd Exp $$NetBSD: getnetent.c,v 1.7 1996/02/16 00:53:00 mrg Exp $$NetBSD: verrx.c,v 1.1 1996/04/15 23:45:36 jtc Exp $$NetBSD: verr.c,v 1.1 1996/04/15 23:45:35 jtc Exp $$NetBSD: warnx.c,v 1.1 1996/04/15 23:45:44 jtc Exp $$NetBSD: warn.c,v 1.1 1996/04/15 23:45:42 jtc Exp $$NetBSD: waitpid.c,v 1.4 1995/02/25 15:40:17 cgd Exp $$NetBSD: syslog.c,v 1.10 1995/08/31 16:28:01 mycroft Exp $$NetBSD: sleep.c,v 1.14.4.1 1996/08/05 20:58:39 jtc Exp $$NetBSD: siglist.c,v 1.8 1995/03/04 01:56:02 cgd Exp $$NetBSD: getcwd.c,v 1.5 1995/06/16 07:05:30 jtc Exp $$NetBSD: getcap.c,v 1.10 1995/08/24 05:26:35 mycroft Exp $$NetBSD: ypprot_err.c,v 1.1 1996/05/18 19:06:47 jtc Exp $$NetBSD: yplib.c,v 1.22.4.1 1996/05/26 06:13:58 jtc Exp $ h$NetBSD: vsnprintf.c,v 1.6 1996/03/29 23:29:31 jtc Exp $$NetBSD: setbuf.c,v 1.4 1995/02/02 02:10:30 jtc Exp $$NetBSD: rewind.c,v 1.4 1995/02/02 02:10:25 jtc Exp $$NetBSD: perror.c,v 1.8 1995/02/02 02:10:11 jtc Exp $$NetBSD: fseek.c,v 1.8 1995/03/05 06:56:09 jtc Exp $t$NetBSD: res_send.c,v 1.5 1996/02/02 15:22:36 mrg Exp $$NetBSD: res_init.c,v 1.9 1996/02/02 15:22:30 mrg Exp $$NetBSD: res_comp.c,v 1.7 1996/02/02 15:22:26 mrg Exp $$NetBSD: inet_network.c,v 1.5 1996/02/17 15:35:41 hpeyerl Exp $$NetBSD: inet_addr.c,v 1.6 1996/02/02 15:22:23 mrg Exp $$NetBSD: vwarnx.c,v 1.1 1996/04/15 23:45:40 jtc Exp $$NetBSD: vwarn.c,v 1.1 1996/04/15 23:45:38 jtc Exp $p$NetBSD: time.c,v 1.4 1995/02/27 05:53:56 cgd Exp $$NetBSD: gethostname.c,v 1.3 1995/06/16 07:36:13 jtc Exp $$NetBSD: getdomainname.c,v 1.3 1995/06/16 07:36:03 jtc Exp $@(#)localtime.c 7.53@(#)private.h 7.39@(#)tzfile.h 7.7WILDABBRHH@(#)asctime.c 7.6@(#)private.h 7.39@(#)tzfile.h 7.7=(=>H?@B $NetBSD: sscanf.c,v 1.7 1996/03/29 23:29:25 jtc Exp $$NetBSD: setvbuf.c,v 1.8 1996/03/29 23:29:22 jtc Exp $$NetBSD: fopen.c,v 1.4 1995/02/02 02:09:23 jtc Exp $$NetBSD: fgets.c,v 1.5 1995/03/25 02:50:04 jtc Exp $FGtGH`HIJJKPO$NetBSD: send.c,v 1.6 1995/02/25 06:21:02 cgd Exp $P0Q$NetBSD: vfscanf.c,v 1.15 1996/03/29 23:29:28 jtc Exp $  $NetBSD: ungetc.c,v 1.5 1996/03/29 23:29:27 jtc Exp $$NetBSD: sprintf.c,v 1.5 1995/02/02 02:10:37 jtc Exp $$NetBSD: printf.c,v 1.5 1995/02/02 02:10:13 jtc Exp $$NetBSD: fread.c,v 1.6 1995/02/02 02:09:34 jtc Exp $fpmPv$NetBSD: mmap.c,v 1.4 1995/02/27 11:23:07 cgd Exp $w@(#)strtouq.c 5.1 (Berkeley) 6/26/92@(#)strtoq.c 5.1 (Berkeley) 6/26/92$NetBSD: muldi3.c,v 1.2 1995/02/27 17:30:39 cgd Exp $$NetBSD: moddi3.c,v 1.2 1995/02/27 17:30:35 cgd Exp $<08@X ` XX0 X$$NetBSD: opendir.c,v 1.10 1995/06/18 10:58:32 cgd Exp $$NetBSD: closedir.c,v 1.4 1995/06/16 07:05:27 jtc Exp $$NetBSD: seekdir.c,v 1.4 1995/02/25 08:51:44 cgd Exp $$NetBSD: telldir.c,v 1.4 1995/02/25 08:51:51 cgd Exp $$NetBSD: readdir.c,v 1.5 1995/02/25 08:51:35 cgd Exp $$NetBSD: fdopen.c,v 1.5 1995/02/02 02:09:05 jtc Exp $$NetBSD: ftruncate.c,v 1.3 1995/02/27 11:23:01 cgd Exp $$NetBSD: rget.c,v 1.5 1996/03/29 23:29:20 jtc Exp $$NetBSD: refill.c,v 1.5 1996/03/29 23:29:18 jtc Exp $$NetBSD: flags.c,v 1.5 1995/02/02 02:09:19 jtc Exp $$NetBSD: fclose.c,v 1.5 1995/02/02 02:09:04 jtc Exp $$NetBSD: db.c,v 1.7 1995/02/27 13:21:27 cgd Exp $$NetBSD: hash.c,v 1.9 1996/05/03 21:43:47 cgd Exp $$NetBSD: bt_open.c,v 1.8 1996/05/03 21:50:46 cgd Exp $$NetBSD: bt_get.c,v 1.7 1996/05/03 21:50:45 cgd Exp $$NetBSD: bt_conv.c,v 1.6 1996/05/03 21:50:39 cgd Exp $$NetBSD: bt_close.c,v 1.7 1996/05/03 21:50:38 cgd Exp $x$NetBSD: snprintf.c,v 1.5 1996/03/29 23:29:24 jtc Exp $$NetBSD: mktemp.c,v 1.5 1995/02/02 02:10:09 jtc Exp $$NetBSD: hash_log2.c,v 1.6 1996/05/03 21:43:54 cgd Exp $$NetBSD: hash_func.c,v 1.6 1996/05/03 21:43:52 cgd Exp $($NetBSD: hash_buf.c,v 1.6 1996/05/03 21:43:51 cgd Exp $$NetBSD: bt_put.c,v 1.8 1996/05/03 21:50:51 cgd Exp $$NetBSD: bt_delete.c,v 1.7 1996/05/03 21:50:44 cgd Exp $$NetBSD: bt_split.c,v 1.6 1996/05/03 21:50:56 cgd Exp $$NetBSD: bt_seq.c,v 1.7 1996/05/03 21:50:54 cgd Exp $$NetBSD: bt_search.c,v 1.8 1996/05/03 21:50:52 cgd Exp $$NetBSD: bt_utils.c,v 1.7 1996/05/03 21:50:58 cgd Exp $$NetBSD: bt_overflow.c,v 1.6 1996/05/03 21:50:48 cgd Exp $$NetBSD: bt_page.c,v 1.6 1996/05/03 21:50:49 cgd Exp $$NetBSD: mpool.c,v 1.6 1996/05/03 21:29:48 cgd Exp $./h$NetBSD: fprintf.c,v 1.5 1995/02/02 02:09:26 jtc Exp $$NetBSD: divdi3.c,v 1.2 1995/02/27 17:29:52 cgd Exp $$NetBSD: signal.c,v 1.7 1995/03/04 01:56:04 cgd Exp $22p30 0000000000000000$NetBSD: fvwrite.c,v 1.5 1996/03/29 23:29:09 jtc Exp $$NetBSD: umoddi3.c,v 1.2 1995/02/27 17:31:13 cgd Exp $$NetBSD: udivdi3.c,v 1.2 1995/02/27 17:31:09 cgd Exp $$NetBSD: qdivrem.c,v 1.4 1995/02/27 17:30:53 cgd Exp $@(#)isnan.c 8.1 (Berkeley) 6/4/93@(#)isinf.c 8.1 (Berkeley) 6/4/93[\P}A@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?h$NetBSD: wsetup.c,v 1.5 1996/03/29 23:29:35 jtc Exp $$NetBSD: makebuf.c,v 1.5 1995/02/02 02:10:08 jtc Exp $$NetBSD: findfp.c,v 1.6 1995/02/02 02:09:17 jtc Exp $$ X\HY\H Yh\HXX$NetBSD: fflush.c,v 1.7 1995/02/02 02:09:08 jtc Exp $Hh$Id: infinity.c,v 1.1 1993/10/19 08:17:20 deraadt Exp $$NetBSD: isatty.c,v 1.4 1995/02/27 04:34:33 cgd Exp $$NetBSD: ctype_.c,v 1.12 1995/02/25 15:39:28 cgd Exp $8@X$NetBSD: tcgetattr.c,v 1.2 1995/06/26 23:05:55 jtc Exp $ $NetBSD: stdio.c,v 1.5 1996/03/29 23:29:25 jtc Exp $$NetBSD: fwalk.c,v 1.5 1996/03/29 23:29:12 jtc Exp $$NetBSD: sysconf.c,v 1.3 1995/03/04 01:56:09 cgd Exp $$NetBSD: getpagesize.c,v 1.5 1995/02/25 08:51:21 cgd Exp $$NetBSD: lseek.c,v 1.3 1995/02/27 11:23:04 cgd Exp $$`$NetBSD: sysctl.c,v 1.4 1995/05/13 06:58:24 jtc Exp $P$NetBSD: scandir.c,v 1.6 1995/02/25 08:51:42 cgd Exp $$NetBSD: rec_open.c,v 1.7 1996/05/03 21:38:49 cgd Exp $$NetBSD: rec_seq.c,v 1.7 1996/05/03 21:38:53 cgd Exp $$NetBSD: rec_get.c,v 1.8 1996/05/03 21:38:48 cgd Exp $$NetBSD: rec_delete.c,v 1.8 1996/05/03 21:38:46 cgd Exp $$NetBSD: rec_close.c,v 1.7 1996/05/03 21:38:45 cgd Exp $$NetBSD: rec_utils.c,v 1.7 1996/05/03 21:38:54 cgd Exp $$NetBSD: rec_search.c,v 1.7 1996/05/03 21:38:52 cgd Exp $$NetBSD: hash_page.c,v 1.8 1996/05/03 21:43:55 cgd Exp $_hashXXXXXX$NetBSD: ashldi3.c,v 1.2 1995/02/27 17:29:42 cgd Exp $$NetBSD: hash_bigkey.c,v 1.6 1996/05/03 21:43:49 cgd Exp $$NetBSD: rec_put.c,v 1.8 1996/05/03 21:38:50 cgd Exp $######## TERMINAL TYPE DESCRIPTIONS SOURCE FILE # # Version 9.12.3 # termcap syntax # # Eric S. Raymond (current maintainer) # John Kunze, Berkeley # Craig Leres, Berkeley # # Please e-mail changes to terminfo@ccil.org. The old termcap@berkeley.edu # address is no longer valid. # # PURPOSE OF THIS FILE: # # This file describes the capabilities of various character-cell terminals, # as needed by software such as screen-oriented editors. # # Other terminfo and termcap files exist, supported by various OS vendors # or as relics of various older versions of UNIX. This one is the longest # and most comprehensive one in existence. It subsumes not only the entirety # of the historical 4.4BSD, GNU, System V and SCO termcap files, but also large # numbers of vendor-maintained termcap and terminfo entries more complete # and carefully tested than those in historical termcap/terminfo versions. # # Pointers to related resources (including the ncurses distribution) may # be found at . # # INTERNATIONALIZATION: # # This file assumes a US-ASCII character set. If you need to fix this, start # by global-replacing \E(B and \E)B with the appropriate ISO 6429 enablers # for your character set. \E(A and \E)A enables the British character set # with the pound sign at position 2/3. # # FILE FORMAT: # # The version you are looking at may be in any of three formats: master # (terminfo with OT capabilities), stock terminfo, or termcap. You can tell # which by the format given in the header above. # # The master format is accepted and generated by the terminfo tools in the # ncurses suite; it differs from stock (System V-compatible) terminfo only # in that it admits a group of capabilities (prefixed `OT') equivalent to # various obsolete termcap capabilities. You can, thus, convert from master # to stock terminfo simply by filtering with `sed "/OT[^,]*,/s///"'; but if # you have ncurses `tic -I' is nicer. # # The termcap version is generated automatically from the master version # using tic -C. This filtering leaves in the OT capabilities under their # original termcap names. All translated entries fit within the # 1023-byte string-table limit of archaic termcap libraries except where # explicitly noted below. # # For details on these formats, see terminfo(5) in the ncurses distribution, # and termcap(5) in the 4.4BSD Unix Programmer's Manual. Be aware that 4.4BSD # curses has been declared obsolete by the caretakers of the 4.4BSD sources # as of June 1995; they are encouraging everyone to migrate to ncurses. # # Note: unlike some other distributed terminfo files (Novell Unix & SCO's), # no entry in this file has embedded comments. This is so source translation # to termcap only has to carry over leading comments. Also, no name field # contains embedded whitespace (such whitespace confuses rdist). # # Further note: older versions of this file were often installed with an editor # script (reorder) that moved the most common terminal types to the front of # the file. This should no longer be necessary, as the file is now ordered # roughly by type frequency with ANSI/VT100 and other common types up front. # # Some information has been merged in from terminfo files distributed by # USL and SCO (see COPYRIGHTS AND OTHER DELUSIONS below). Much information # comes from vendors who maintain official terminfos for their hardware # (notably DEC and Wyse). # # A detailed change history is included at the end of this file. # # FILE ORGANIZATION: # # Comments in this file begin with # - they cannot appear in the middle # of a terminfo/termcap entry. Individual capabilities are commented out by # placing a period between the colon and the capability name. # # The file is divided up into major sections (headed by lines beginning with # the string "########") and minor sections (beginning with "####"); do # # grep "^####" | more # # to see a listing of section headings. The intent of the divisions is # (a) to make it easier to find things, and (b) to order the database so # that important and frequently-encountered terminal types are near the # front (so that you'll get reasonable search efficiency even if you don't # use reorder). Minor sections usually correspond to manufacturers or # standard terminal classes. Parenthesized words following manufacturer # names are type prefixes or product line names used by that manufacturers. # # Finally, because this file is released in both terminfo and termcap formats, # most references to termcap names in comments are bracketed with colons (the # termcap separator) so they can be distinguished from terminfo capability # names. # # HOW TO READ THE ENTRIES: # # The first name in an entry is the canonical name for the model or # type, last entry is a verbose description. Others are mnemonic synonyms for # the terminal. # # Terminal names look like - # The part to the left of the dash, if a dash is present, describes the # particular hardware of the terminal. The part to the right may be used # for flags indicating special ROMs, extra memory, particular terminal modes, # or user preferences. # # All names should be in lower case, for consistency in typing. # # The following are conventionally used suffixes: # -2p Has two pages of memory. Likewise 4p, 8p, etc. # -am Enable auto-margin. # -m Monochrome. Suppress color support # -mc Magic-cookie. Some terminals (notably older Wyses) can # only support one attribute without magic-cookie lossage. # Their base entry is usually paired with another that # uses magic cookies to support multiple attributes. # -na No arrow keys - termcap ignores arrow keys which are # actually there on the terminal, so the user can use # the arrow keys locally. # -nam No auto-margin - suppress capability # -nl No labels - suppress soft labels # -ns No status line - suppress status line # -rv Terminal in reverse video mode (black on white) # -s Enable status line. # -vb Use visible bell () rather than . # -w Wide - in 132 column mode. # If a name has multiple suffixes and one is a line height, that one should # go first. Thus `aaa-30-s-rv' is recommended over `aaa-s-rv'. # # Entries with embedded plus signs are designed to be included through use/tc # capabilities, not used as standalone entries. # # To avoid search clashes, some older all-numeric names for terminals have # been removed (i.e., "33" for the Model 33 Teletype, "2621" for the HP2621). # All primary names of terminals now have alphanumeric prefixes. # # Comments marked "esr" are mostly results of applying the termcap-compiler # code packaged with ncurses and contemplating the resulting error messages. # In many cases, these indicated obvious fixes to syntax garbled by the # composers. In a few cases, I was able to deduce corrected forms for garbled # capabilities by looking at context. All the information in the original # entries is preserved in the comments. # # In the comments, terminfo capability names are bracketed with <> (angle # brackets). Termcap capability names are bracketed with :: (colons). # # INTERPRETATION OF USER CAPABILITIES # # The System V Release 4 and XPG4 terminfo format defines ten string # capabilities for use by applications, .... In this file, we use # certain of these capabilities to describe functions which are not covered # by terminfo. The mapping is as follows: # # u9 terminal enquire string (equiv. to ANSI/ECMA-48 DA) # u8 terminal answerback description # u7 cursor position request (equiv. to VT100/ANSI/ECMA-48 DSR 6) # u6 cursor position report (equiv. to ANSI/ECMA-48 CPR) # # The terminal enquire string should elicit an answerback response # from the terminal. Common values for will be ^E (on older ASCII # terminals) or \E[c (on newer VT100/ANSI/ECMA-48-compatible terminals). # # The cursor position request () string should elicit a cursor position # report. A typical value (for VT100 terminals) is \E[6n. # # The terminal answerback description (u8) must consist of an expected # answerback string. The string may contain the following scanf(3)-like # escape ...MAKEDEV MAKEDEV.localconsole ttykmemx mem nulls zeroy eeprom openprom drum[klogrstdinW@stdout@stderr fdttyattyb} fbmouse kbdsd0cj$rsd0csd0atI@sd0b!sd0d@sd0eUsd0fx@sd0goVsd0h rsd0a@!rsd0b"rsd0d#rsd0e$rsd0f%rsd0g&rsd0h@'sd1c(rsd1c)sd1aL*sd1bwU@+sd1d,sd1eˀ-sd1fx.sd1g|!@/sd1h0rsd1a~1rsd1bf2rsd1dT3rsd1eM@4rsd1f`5rsd1gU6rsd1h7sd2c|8rsd2cL9sd2a@:sd2b;sd2d@<sd2ep=sd2fqw>sd2gD?sd2hx@rsd2aR@Arsd2bBrsd2d@Crsd2e@Drsd2faErsd2gFrsd2hGsd3ce0Hrsd3cMIsd3ayJsd3bKsd3dpZLsd3esMsd3f|#Nsd3g1Osd3hnPrsd3aQrsd3bRrsd3dPSrsd3eTrsd3fUrsd3g$Vrsd3hWsd4cr@Xrsd4c$@Ysd4amZsd4br@[sd4dzT\sd4e%@]sd4fo^sd4gM_sd4hx@`rsd4a]@arsd4bЀbrsd4dWcrsd4edrsd4fMersd4gfrsd4ho@gxd0cRhrxd0cixd0at@jxd0bxkxd0d|lxd0en@mxd0fyonxd0gpQoxd0h}prxd0a@qrxd0brrxd0dsrxd0e\trxd0fBurxd0gvrxd0hwxd1cxrxd1cyxd1a0zxd1b{xd1d|xd1e{ۀ}xd1f4~xd1gxd1hrrxd1arxd1b%@rxd1dZrxd1erxd1f$rxd1g)@rxd1hxd2crDrxd2cXxd2alAxd2bxd2dxd2eqvxd2ftHxd2g|xd2hurxd2aPrxd2brxd2drxd2e$rxd2frxd2grxd2hxd3curxd3cOxd3axd3b€xd3dsxd3eyxd3fۀxd3gq}xd3h.@rxd3a@rxd3brxd3dQrxd3erxd3f6@rxd3g@rxd3hxy0c}rxy0cxy0axy0bkxy0duxy0eЀxy0fkxy0g|@xy0h^rxy0arxy0brxy0dbrxy0erxy0f@rxy0grxy0h xy1c<rxy1c xy1axy1bz[xy1dAxy1ekxy1fxy1gzYxy1hrxy1arxy1brxy1d[rxy1eUrxy1fVrxy1grxy1hsxy2c]rxy2cIxy2a@xy2bxy2dwT@xy2e{xy2fzRxy2gya@xy2hCrxy2an@rxy2b@rxy2drxy2e@rxy2frxy2gp@rxy2h<xy3csrxy3cxy3auxy3b,xy3dRxy3e{xy3f@xy3gt@xy3h@rxy3a#@rxy3b!rxy3drxy3erxy3f$rxy3g@rxy3hAcd0coSrcd0ccd0a|,cd0bcd0dym@cd0eycd0fcd0gH@cd0hˀrcd0aH@rcd0b.rcd0d!@rcd0ercd0fZrcd0g@rcd0h^ st0nst0est0 enst0rst08@nrst0erst0enrst0@ st1 nst1 est1@ enst1$ rst1i@nrst1O@erst1enrst1fd0c}rfd0c$fd0afd0b{Ӏfd0dfd0ezXfd0f|fd0g@fd0hxrfd0arfd0b@rfd0drfd0erfd0f̀rfd0g rfd0h@!ttyp0"ptyp0#ttyp1@$ptyp1X%ttyp2;@&ptyp2$'ttyp3@(ptyp3)ttyp4*ptyp42@+ttyp5,ptyp5V-ttyp6@.ptyp6@/ttyp7 0ptyp71ttyp8A2ptyp8l3ttyp94ptyp9@5ttypa@6ptypa7ttypb"@8ptypb$9ttypc:ptypc[;ttypdT<ptypd=ttype$>ptype@?ttypfV@@ptypfAvnd0cR@Brvnd0cCvnd0a$Dvnd0bEvnd0d@Fvnd0eGvnd0f Hvnd0gIvnd0hJrvnd0aKrvnd0b@Lrvnd0dMrvnd0eNrvnd0f@Orvnd0gPrvnd0hQvnd1cRrvnd1cSvnd1a,@Tvnd1bUvnd1d@Vvnd1eJ@Wvnd1fXvnd1gYvnd1hZrvnd1a[rvnd1b@\rvnd1d]rvnd1e^rvnd1f@_rvnd1g`rvnd1havnd2c$brvnd2c@cvnd2advnd2b%evnd2dfvnd2e@gvnd2f)hvnd2givnd2hjrvnd2akrvnd2blrvnd2d@mrvnd2enrvnd2f@orvnd2gprvnd2hqvnd3crrvnd3csvnd3a8@tvnd3b @uvnd3d\vvnd3ewvnd3fxvnd3gyvnd3h@zrvnd3a@{rvnd3b|rvnd3d@}rvnd3e~rvnd3f@rvnd3grvnd3haudiotun0s@tun1tun2zUtun3@ccd0cLrccd0cccd0accd0b$ccd0dYccd0eccd0fLccd0g ccd0hSrccd0arccd0brccd0drccd0erccd0f@rccd0g@rccd0hccd1crccd1cccd1accd1bn@ccd1dccd1eJccd1fccd1g@ccd1hrccd1arccd1brccd1drccd1erccd1f@rccd1grccd1h@ccd2crccd2cccd2a,ccd2bccd2dy@ccd2e+@ccd2f$ccd2g$ccd2hsrccd2arccd2brccd2drccd2erccd2frccd2grccd2h@ccd3c]rccd3cccd3accd3b+ccd3dC@ccd3e9ccd3f.ccd3gccd3h;@rccd3arccd3brccd3drccd3erccd3frccd3grccd3hbpf0tbpf1rD@bpf2/bpf3Rbwtwo0@cgthree0cgfour0cgsix0@cgeight0lkm  ` P ` xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`HLMTASTADT|D_$OZ60/<0Y@;@@˾Ű̷@60@Ӽ d0Ѧ F0T@[j6@ =!J@"h#)@$H% @&10&@(0()0*+0,-0.r/00Rb1y2;@3Y4a@59h5C@7J7%@8,9@:I0;@<+0=> 0?c@0ACBa0C#DA0EF*ϰFoH Ȟ@IꓰJn@KuLP@MWNl2@Ot0PL@QsV0R50SS80TU30UW0WX0YZ[\ܰ]}@^_]@`{a={@b[c]@d;dd?@f$0f[hc0h=iE0jk'0lm 0neo%pEqmr.@sLt@u,˰u@w wΈ@x쏰yj@zլ0{L@|0}wh~p0WJ SMTADTASTESTEDTFSTT . ..ULondon0VBelfastWDublinXTiraneYAndorraZVienna[Minsk\Brussels ]Sarajevo ^Sofia_Zagreb`Praguea Copenhagen bTallinncHelsinki dPariseBerlinf Gibraltar gAthenshBudapestUiRomejRigakVaduzlVilniusm Luxembourg nSkopjeoMaltapChisinau qMonacor Amsterdam sOslotWarsawuLisbonv Bucharest wMoscowx Kuybyshev y Ljubljana zMadrid{ Stockholm |ZurichaIstanbul}Kiev~ Simferopol Belgrade iVaticani San_Marino` Bratislava & 0à ve {ȠN? %` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ &ʗYw;ͱ`Xϐn^r2i c)I !BN . p  ޴߮ ̠rHkt R*T2 = ) T q S  g} aI_ Jf _A ! ?#  Ѡ {p)X P  : 0  l N  0  qޠ.Qy1X#8Ɛ͐㯐Ñk lr!M"LT#a/$,6%JK& '*-'4) )*+,Ӑ-ڐ./t00$1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y BSTGMTDST & 0à ve {ȠN? %` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ &ʗYw;ͱ`Xϐn^r2i c)I !BN . p  ޴߮ ̠rHkt R*T2 = ) T q S  g} aI_ Jf _A ! ?#  Ѡ {p )X P  : 0  l N  0  qޠ.Qy1X#8Ɛ͐㯐Ñk lr!M"LT#a/$,6%JK& '*-'4) )*+,Ӑ-ڐ./t00$1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    DMTDSTGMTBST & 0à ve {ȠN? %` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ I!N,( . p  ޴߮ ̠rHkt R*T2 = ) T q S  g} aI_ Jf _A ! ?#  Ѡ {p )X P  : 0  l N  0  qޠ.Qy1X#8Ɛ͐㯐Ñk lr!M"LT#a/$,6%JK& '*-'4) )*+,Ӑ-ڐ./t00$1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    DMTDSTGMTBST4hmpKͩ͸(9>` x q Op H` k*`pt `pS`pp;`Hp`1p_`̯`|s ld!\U"LF#<7$,(%& '5'&()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq  LMTMETMET DSTkA| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y WETMETMET DST `ٮD[ qKͩ΢Cϒ4Ђ%rҡOcI9), #ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   MET DSTMET  .>* 9||l<@m=2h=EP`'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq 1t#d? 8@*0FP "*08@*0& "LST DSTLSTLST DDSTMSDMSKMSDDEETEET DST Ź `ٮ``~pTNpzL5^#p%5'*}4p_PAɧ#Opkp"prP.IZ 02vXԠ֋  x h Xy ?/8[ : X֠p qKͩ΢Cϒ4Ђ%rN@ӑ@K# cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y       WETMET DSTMETWET DSTw 5Kͩ΢Cϒ4Ђ%ѡN@s㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   METMET DST|Kͩ΢Cϒ4Ђ%r$ cPU?M 5!,p 㡀ӒÃ|s ld!\U"LF#<7$,(%& '5'&()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq  *0 *0EETMETMET DSTEET DSTw 5Kͩ΢Cϒ4Ђ%ѡN@s㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   METMET DST `ٮ qKͩ΢Cϒ4ҡOӀIL8), pxdpd'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   MET DSTMET `վCWpKͩ΢Cϒ4Ђ%r$y^Gɐ׿ΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   MET DSTMET ~ $Y-̞+psoLȰƗPKͩ΢Cϒ4t'@PC@̓s|d lU!\F"L7#<($,%& '5'&()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq     4  *0 8@*08@*0 LSTMETMET DSTEETMSKMSDEET DSTusoQ`̿#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yp *0 *0 HMTEET DSTEET `ٮ qKͩ΢Cϒ4Ђ%rѶXҡOcI9gըs), xΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  *0 *0  MET DSTMETMET DDST %`POGx𜼑pppp`~p.zL5^#p%5'X&p}4p_PAɧ#Opkp"prpPpI//p2Lpppp`ȷ𽸨_pxlh]XN?p80:Xp jpKͩ΢Cϒ4OЉrN@ G 8 cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   1     PMTWET DSTWETMET DSTMETWET DDST& 0à ve {ȠN? %` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ &ʗYw;ͱ`Xϐn^r2i c)I !BN . p  ޴߮ ̠rHkt R*T2 = ) T͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    BSTGMTDSTMETMET DST !x|ƯcPKͪL΢ϓip`߷ P ^` ` ͮ U]7jd{RF`3P#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                         D *0  *0 *0 AMTEET DSTEETMET DSTMET `ٮ) dyp( ZA?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   MET DSTMET 7𝵼pp`~p\7pL(pl5Kͩ΢Cϒ4_`nBprL>1Ip)뀐 3pp`Ųb`ZpBwpv+np gE:I .Wp 9 9p  ptppSpΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   MET DSTMET~, F˃ ȯd`bePKͩ΢Cϒ49x`'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq    $$ *0  8@ *08@ *0$ LSTLST DSTEETMSKMET DSTMETMSDEET DSTr #ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y METMET DST } $OPJ0fx`ȬpY*Kͩ΢Cϒ40='@PC@̓s|d lU!\F"L7#<($,% & ''p'p()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq  *0   8@*0 8@*0 LSTMETEETMSKMET DSTMSDEET DST`pp`~堢.zi5^?%5'*4pnآpPɧ2Opkp0rpP.IZ 02vXԠ֋  x h Xy ?/8[ : X֠B>0Kͩ΢Cϒ4orN@ӑ@K# cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                                                LMTMET DSTMETWETWET DSTw 5Kͩ΢Cϒ4Ђ%ѡN@s㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   METMET DST 7𝵼pp`~p\7pL(pl5Kͩ΢Cϒ4Ђ%rL>1Ip)뀐 3pp`Ųb`ZpBwpv+3p $pp4p  ؐрavAE[*#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   MET DSTMETt`'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq *08@ *08@ *0 LMTEETMSKMSDEET DST '{`NKͩ΢Cϒ4Ђ%rb L=.xhXG7'/ҐΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   MET DSTMET %`POGx𜼑pppp`~p.zL5^#p%5'X&p}4p_PAɧ#Opkp"prpPpI//p2Lpppp`ȷ𽸨_pxlh]XN?p80:Xp [bˬpKͩ!ϒ4ЉrN@ G 8 cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y 1    PMTWET DSTWETWET DDSTMETMET DST  KRٸ%Avp#VP6%['^㐩Z煐'gfIΙ+pHRP*s0 T@xq쐼ΐؐ]x§ː]`Xtpp8Vp`!rDKͩ΢Cϒ4Ђ%rѱ^ cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                                NSTAMTMET DSTMET *Л `ٮevKͩ΢Cϒ4Ѐ`ѕpҊ`bp#l`^)+ kT᥀і캳Zzw<ZY:;}: U 7t(dT M63#݀΀㡀ӒÃ|s ld!\U"LF#<7$,(%& '5'&()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq     *0 WMTMET DSTMETEETEET DST %,KmpǀpɃprp_TppApnop# Opɧ#Opkp"prpPp2Lppppȷ𽸨_pxlh]XN?p80:Xpp/p pb˵R̀Kܢ͕4K`rſpuϬgRХpTьI2f҅pYI9 )  ܹY ݲޢuߒfWrHb9R*B2 !)    z j cSC3#sdUF *  7t(dTC3#ܐ͐㽠ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                  T     LMTWET DSTWETWET DDSTMETMET DST >``ߍ`~`ȩླྀྨ࿘|mx^hOX@H18"(`SPM 3`#݀΀㡀ӒÃ|s ld!\U"LF#<7$,(%& '5'&()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq` *0 *0 BMTEET DSTEET .>* 9||l<@m=2h=EP`'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()x)p*p+p,p-p.p/tp0dp1]2M3=4-56 q6b7S8D95:&;Rp%p?vp@fpAUpBEpC5pD%pEpFpFGH޺IΫJKL~MoN~`OnQPg}pQWnpRG_pS7PpT'ApU2pV#pVpWpXpYpZp[\]^_o`_aOb?c/d|emfpfpg{phlpi]pjNpk?pl0pm!pnxpohppa.qQrAs1t uvvwxЧyz{p|p}p~ypiyp 1t#d? 8@*0FP "*08@*0& "LST DSTLSTLST DDSTMSDMSKMSDDEETEET DSTu  P'0@50̅te|V lG!\8"L)#<$, %& '`' `( p)xp)`*`+`,`-`.`/t`0d`1]2M3=4-5r6 c6T7E869':;D`<5`=&`>`?v`@e`AU`BE`C5`D%`E`F`FGHެIΝJKLpMaN~ROnCPgo`QW``RGQ`S7B`T'3`U$`V`V`W`X`Y`Z`[\]^_o`_aOb?c/}dne_f`f|`gm`h^`iO`j@`k1`l"`m`nx`og`pa qQrAs0t uvvwxЙyz{{`|`}`~yz`ik`/*08@FP8@FP8@*0LMTKSKKSDw 5Kͩ΢Cϒ4Ђ%ѡN@s㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   METMET DST!pp*p^pp_ɧ#Opkp"prpPp¨pXN9p80:!Mp`̖`K`΢ϣ-`Ѝ`у``pb`AF p ` tp   9`ltpd'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    WET DSTWETWET DDSTMETMET DSTw `ΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  METMET DSTx $r`&``#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  MET DSTMET )>X*؞@HHsȡ<ؤ{X>ȥvH=Xh`'@PC@̓s|d lU!\F"L7#<($,% & &'5'&()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq *8  *08@*08@*0! *0!LST DSTLSTLST DDSTEETMSKMSDEET DST  )>*p>r``t=`'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()*+,ۀ-̀.p/tp0dp1]2M3=4-56 q6b7S8D95:&;Rp%p?vp@fpAUpBEpC5pD%pEpFpFGH޺IΫJKL~MoN~`OnQPg}pQWnpRG_pS7PpT'ApU2pV#pVpWpXpYpZp[\]^_o`_aOb?c/d|emfpfpg{phlpi]pjNpk?pl0pm!pnxpohppa.qQrAs1t uvvwxЧyz{p|p}p~ypiyp   ,:   *08@*08@*0! LST DSTLSTLST DDSTEETMSKMSDEET DSTw 5Kͩ΢Cϒ4Ђ%ѡN@s㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   METMET DST . ..^Riyadh87_Riyadh88`Riyadh89 . ..group[0 master.passwdpasswd0 protocols[,pwd.db0services[, spwd.dbdisktab.shadow disktab fstab resolv.conf hosts . .. binmdeciǀsbiniǀshareǀ . .. AustraliaBrazilCanada@Chile@DMexico@$SystemV USAfrica@HAtlantic\2Indian@Asia@OPacificTEurope WET MET EET=Americat EtcFactory CETEST5EDTCST6CDTMST7MDTPST8PDT EST MST HSTOCuba)EgyptWEireU GBu GMTc NZuGMT+0uGMT-0uGMT0u Greenwich,HongkongLIceland4Iran6IsraelXJamaica7Japan\ Kwajalein5LibyaNavajodNZ-CHAT' PRCtPolanduPortugal+ ROC< ROKJ SingaporeaTurkeyu UCTu UTCu UniversalwW-SUuZuluMideastL posixruleswheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: games:*:13: staff:*:20:root guest:*:31:root nobody:*:39: utmp:*:45: ingres:*:74:ingres dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/csh toor:*:0:0::0:0:Bourne-again Superuser:/root: daemon:*:1:31::0:0:The devil himself:/root: operator:*:2:20::0:0:System &:/usr/guest/operator:/bin/csh bin:*:3:7::0:0:Binaries Commands and Source,,,:/:/dev/null games:*:7:13::0:0:Games pseudo-user:/usr/games: uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico nobody:*:32767:9999::0:0:Unprivileged user:/nonexistent:/dev/null ingres:*:267:74::0:0:& Group:/usr/ingres:/bin/csh falken:*:32766:31::0:0:Prof. Stephen &:/usr/games:/usr/games/wargames root:*:0:0:Charlie &:/root:/bin/csh toor:*:0:0:Bourne-again Superuser:/root: daemon:*:1:31:The devil himself:/root: operator:*:2:20:System &:/usr/guest/operator:/bin/csh bin:*:3:7:Binaries Commands and Source,,,:/:/dev/null games:*:7:13:Games pseudo-user:/usr/games: uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico nobody:*:32767:9999:Unprivileged user:/nonexistent:/dev/null ingres:*:267:74:& Group:/usr/ingres:/bin/csh falken:*:32766:31:Prof. Stephen &:/usr/games:/usr/games/wargames # $NetBSD: protocols,v 1.3 1995/12/17 02:01:12 thorpej Exp $ # # Internet (IP) protocols # # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # Updated for NetBSD based on RFC 1340, Assigned Numbers (July 1992). # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol egp 8 EGP # exterior gateway protocol pup 12 PUP # PARC universal packet protocol udp 17 UDP # user datagram protocol hmp 20 HMP # host monitoring protocol xns-idp 22 XNS-IDP # Xerox NS IDP rdp 27 RDP # "reliable datagram" protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 xtp 36 XTP # Xpress Tranfer Protocol idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport vmtp 81 VMTP # Versatile Message Transport ospf 89 OSPFIGP # Open Shortest Path First IGP ipip 94 IPIP # Yet Another IP encapsulation encap 98 ENCAP # Yet Another IP encapsulation a  n}n`nfalken*Prof. Stephen &/usr/games/usr/games/wargames3games* Games pseudo-user/usr/games2RKingres* J& Group/usr/ingres/bin/csh1ingresnobody*'Unprivileged user/nonexistent/dev/null3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2up)"falken*Prof. Stephen &/usr/games/usr/games/wargames1falkennobody*'Unprivileged user/nonexistent/dev/null2games* Games pseudo-user/usr/games3bin*Binaries Commands and Source,,,//dev/null1binL:Lingres* J& Group/usr/ingres/bin/csh2 root*Charlie &/root/bin/csh3root*Charlie &/root/bin/csh2~72falken*Prof. Stephen &/usr/games/usr/games/wargames2 nobody*'Unprivileged user/nonexistent/dev/null1nobodydaemon*The devil himself/root3toor*Bourne-again Superuser/root2 @2SC <  @@p\X<@`bT U2S 'p(pA2SDp2S2S 2SJA2SD22SEI2SE" 2STAm2Szs2Ok2S U 2S`2SL$s2SL92SL9 2S42SM1-2SM2SM 2S2SMX;2SM 2SM 2SF2SM沀2SMz92SMz9 2S2SMW2SM4΀2SM4΀ P2S2SM"2SM% 2SM% 2S2SM)'2SM1xˀ2SM1xˀ  P2Sa2Sh7n2Sh7n2Sik 2S>a2Si1-2Si1-2Sik 2S@a2Si]J2Si]J2Sik 2SB!2Si h2Si h2Sik 2SD!2Si 2Si 2Sik 2SF!2SiI 2SiI 2Sik 2SH!2Siu*2Siu*2Sik 2SJa2Si#F2Si#F2Skw2SL!2Si'c2Si'c2Sk'62SNa2Si+2Si+2Skw2SPa2Si/2Si/2Skw2SRa2Si4s2Si4s2Skw2STa2Si8ـ2Si8ـ2Skw2SVa2Sj2Sj2Skw2SXa2SjĴ2SjĴ2Skw2SZa2Sjр2Sjр2Skw2S\!2Sj X2Sj X2Sk'62S^!2Sjv2Sjv2Sk'62S`!2Sj+2Sj+2Sk'62Sb!2Sj/2Sj/2Sk'62Sd!2Sj3%2Sj3%2Sk'62Sf!2Sj7n2Sj7n2Sk'62Sh!2Sk2Sk2Sk'62Sj!2Sk92Sk92Sk92Sl!2Sk4΀2Sk4΀2Sk4΀2Sn!2Sk U2Sk U2Sk U2Sp!2Sk#F2Sk#F2Sk#F2Sr!2Sk&62Sk&62Sk&62St!2Sk*Q2Sk*Q2Sk*Q2Sv!2Sk-L2Sk-L2Sk-L2Sx!2Sk0G2Sk0G2Sk0G2Sz!2Sk3%2Sk3%2Sk3%2S|!2Sk62Sk62Sk62S~!2Sk;32Sk;32Sk;32S!2SlbZ2SlbZ2SlbZ2S!2Sl]J2Sl]J2Sl]J2S!2Slр2Slр2Slр2S!2Sl 2Sl 2Sl 2S!2Sl沀2Sl沀2Sl沀2S!2Slz92Slz92Slz92S!2Slu*2Slu*2Slu*2S!2Slp2Slp2Slp 2S!2Sl2Sl2Sl 2S!2Sl2Sl2Sl 2S!2Sl!2Sl!2Sl! 2S!2Sl% 2Sl% 2Sl%  2S!2Sl(2Sl(2Sl( 2S!2Sl+2Sl+2Sl+ 2S!2Sl/q2Sl/q2Sl/q 2S!2Sl2b2Sl2b2Sl2b 2S!2Sl5 R2Sl5 R2Sl5 R 2S!2Sl8ـ2Sl8ـ2Sl8ـ2S!2Sm2Sm2Sm2S!2Sm2Sm2Sm2S!2Sm'2Sm'2Sm'2Sa2Smv2Smv2Snp2S!2Smܓ2Smܓ2Snpn2Sa2Smp2Smp2Snp2Sa2Sm82Sm82Snp2Sa2Sm U2Sm U2Snp2Sa2Sm$[܀2Sm$[܀2Snp2Sa2Sm(2Sm(2Snp2Sa2Sm,2Sm,2Snp2Sa2Sm0G2Sm0G2Snp2S!2Sm4s2Sm4s2Snpn2S!2Sm98p2Sm98p2Snpn2S!2SnÀ2SnÀ2Snpn2S!2Sn]J2Sn]J2Snpn2S!2Sn h2Sn h2Snpn2S!2Sn 2Sn 2Snpn2S!2SnI 2SnI 2Snpn2Sa2Sn U2Sn U2So'V 2S!2Sn$[܀2Sn$[܀2So'Vn 2Sa2Sn(2Sn(2So'V2Sa2Sn,2Sn,2So'V 2Sa2Sn0G2Sn0G2So'V 2Sa2Sn4s2Sn4s2So'V 2Sa2Sn8ـ2Sn8ـ2So'V 2Sa2So2So2So'V2Sa2SoĴ2SoĴ2So'V2S!2Soр2Soр2So'Vn2S!2So X2So X2So'Vn 2S!2Sov2Sov2So'Vn 2S!2Soܓ2Soܓ2So'Vn 2S!2Sop2Sop2So'Vn 2S!2So82So82So'Vn2S!2So U2So U2So'Vn2Sa2So/2So/2Sp7n2S!2So3%2So3%2Sp7nn2Sa2So7n2So7n2Sp7n2Sa2Sp2Sp2Sp7n2Sa2Sp,2Sp,2Sp7n2Sa2Sp2Sp2Sp7n2Sa2Sp 2Sp 2Sp7n2Sa2Sp߀2Sp߀2Sp7n2Sa2Spf2Spf2Sp7n2S!2Spׄ2Spׄ2Sp7nn2S!2Sp82Sp82Sp7nn2S!2Sp U2Sp U2Sp7nn2S!2Sp$[܀2Sp$[܀2Sp7nn2S!2Sp(2Sp(2Sp7nn2S!2Sp,2Sp,2Sp7nn2S!2Sp0G2Sp0G2Sp7nn2S a2Sq,2Sq,2Sr 2S !2Sq2Sq2Sr n2Sa2Sq 2Sq 2Sr 2Sa2Sq߀2Sq߀2Sr 2Sa2Sqf2Sqf2Sr 2Sa2Sqׄ2Sqׄ2Sr 2Sa2Sq2Sq2Sr 2Sa2Sq(2Sq(2Sr 2Sa2Sq#F2Sq#F2Sr 2S!2Sq'c2Sq'c2Sr n2S!2Sq+2Sq+2Sr n2S !2Sq/2Sq/2Sr n2S"!2Sq5 R2Sq5 R2Sr n2S$!2Sq92Sq92Sr n2S&!2SrbZ2SrbZ2Sr n2S(!2Sr'2Sr'2Sr n2S*!2Sr2Sr2SrCE2S,!2Sr92Sr92Srk o2S.!2Sr+2Sr+2Sr,o2S0!2Sr8ـ2Sr8ـ2Sr9o2S2!2Ss h2Ss h2Ss o2S4a2Ssk 2Ssk 2St#* 2S6!2Ss(2Ss(2St#F2S8a2Ss#F2Ss#F2St#* 2S:a2Ss'V2Ss'V2St#* 2S<a2Ss+2Ss+2St#F 2S>a2Ss0G2Ss0G2St#F 2S@a2Ss4s2Ss4s2St#F 2SBa2Ss8ـ2Ss8ـ2St#F 2SDa2St2St2St#F 2SF!2StĴ2StĴ2St#F2SH!2Stр2Stр2St#F2SJ!2St X2St X2St#F2SL!2Stv2Stv2St#F2SN!2Stܓ2Stܓ2St#F2SP!2Stp2Stp2St#F2SR!2St82St82St#F2STa2St+2St+2Su2 2SV!2St/2St/2Su2 2SXa2St3B2St3B2Su2 2SZa2St7n2St7n2Su2 2S\a2Su2Su2Su2 2S^a2Su2Su2Su2 2S`a2Su2Su2Su2 2Sba2Su 2Su 2Su2 2Sda2SuI2SuI2Su2 2Sf!2Suf2Suf2Su22Sh!2Suׄ2Suׄ2Su2 2Sj!2Suk 2Suk 2Su2 2Sl!2Su(2Su(2Su2 2Sn!2Su#F2Su#F2Su2 2Sp!2Su'V2Su'V2Su22Sr!2Su+2Su+2Su22Sta2Su:i2Su:i2Sww 2Sv!2Sv2Sv2Sww2Sxa2Sv'2Sv'2Sww 2Sza2Sv 2Sv 2Sww 2S|a2Sv沀2Sv沀2Sww 2S~a2Svf2Svf2Sww 2Sa2Svׄ2Svׄ2Sww 2Sa2Svk 2Svk 2Sww 2Sa2Sv(2Sv(2Sww 2S!2Sv#F2Sv#F2Sww2S!2Sv'V2Sv'V2Sww2S!2Sv+2Sv+2Sw'2S!2Sv/2Sv/2Sw'2S!2Sv3B2Sv3B2Sw'2S!2Sv7n2Sv7n2Sw'2S!2Sw2Sw2Sw'2Sa2Sw沀2Sw沀2Sxk 2S!2Sw2Sw2Sxk 2Sa2SwW2SwW2Sxk 2Sa2Swt2Swt2Sxk 2Sa2Sw2Sw2Sxk 2Sa2Sw"2Sw"2Sxk 2Sa2Sw&62Sw&62Sxk 2Sa2Sw*T2Sw*T2Sxk 2Sa2Sw.}2Sw.}2Sxk 2S!2Sw22Sw22Sxk 2S!2Sw8C2Sw8C2Sxk 2S!2Sx1-2Sx1-2Sxk 2S!2Sx2Sx2Sxk 2S!2Sx 2Sx 2Sxk 2S!2SxI2SxI2Sxk 2S!2SxC2SxC2Sxk 2S!2Sx&62Sx&62Sx'ci2S!2Sx4s2Sx4s2Sx5i2S!2Sy]J2Sy]J2Sywi2S!2Sy2Sy2SyCi2S!2Sy2Sy2Sy /2S!2Sy&62Sy&62Sy'c72S!2Sy-D2Sy-D2Sy/q'2S!2Sy5 R2Sy5 R2Sy6=C2S!2SzĴ2SzĴ2Sz@2S!2SzI 2SzI 2Sz>p2S$2Sz2OQ2S 2S$2Sz2OQ2S߀ 2S $2Sz2OQ2St 2S $e2Sz2O`2SN 2SB2S#*2S'V2S'V "2S2S0G2S2b2S2b/tmp/disktab.shadow2S2S4s2S5 R2S5 R/tmp/fstab.shadow2S2S7n2S8C2S8C/tmp/resolv.conf.shadow2S 2S:i2S2S/tmp/hosts2SID sn uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/usr/guest/operator/bin/csh3operator*System &/usr/guest/operator/bin/csh1operatordaemon*The devil himself/root2daemon*The devil himself/root1daemontoor*Bourne-again Superuser/root1toorroot*Charlie &/root/bin/csh1rootic(#uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpgames* Games pseudo-user/usr/games1gamesbin*Binaries Commands and Source,,,//dev/null3operator*System &/usr/guest/operator/bin/csh2tftingres* J& Group/usr/ingres/bin/csh3 bin*Binaries Commands and Source,,,//dev/null2# $NetBSD: services,v 1.18 1996/03/26 00:07:58 mrg Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 5.8 (Berkeley) 5/9/91 # tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp ssh 22/tcp ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink kerberos 88/tcp krb5 # Kerberos v5 kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp sunrpc 111/udp auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap2 143/tcp # Interim Mail Access Proto v2 imap2 143/udp snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # webster 765/tcp # Network dictionary webster 765/udp # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. # klogin 543/tcp # Kerberos `rlogin' kshell 544/tcp krcmd # Kerberos `rsh' kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos4 750/udp kdc # Kerberos (server) udp kerberos4 750/tcp kdc # Kerberos (server) tcp kerberos-master 751/udp # Kerberos admin server udp kerberos-master 751/tcp # Kerberos admin server tcp krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' eklogin 2105/tcp # Kerberos encrypted `rlogin' # # Unofficial but necessary (for NetBSD) services # supfilesrv 871/tcp # SUP server supfiledbg 1127/tcp # SUP debugging z cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yWET DSTWET `ٮ qKͩ΢Cϒ4Ђ% cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  MET DSTMETa  n}n`nD sn uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/usr/guest/operator/bin/csh3operator*System &/usr/guest/operator/bin/csh1operatordaemon*The devil himself/root2daemon*The devil himsefalken*Prof. Stephen &/usr/games/usr/games/wargames3games* Games pseudo-user/usr/games2RKuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uingres* J& Group/usr/ingres/bin/csh1ingresnobody*'Unprivileged user/nonexistent/dev/null3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2up)"falken*Prof. Stephen &/usr/games/usr/games/wargames1falkennobody*'Unprivileged user/nonexistent/dev/null2games* Games pseudo-user/usr/games3bin*Binaries Commands and Source,,,//dev/null1binN<Nfalken*Prof. Stephen &/usr/games/usr/games/wargames2 nobody*'Uingres* J& Group/usr/ingres/bin/csh2 rootCharlie &/root/bin/csh3rootCharlie &/root/bin/csh2~72falken*falken*Prof. Stephen &/usr/games/usr/games/wargames2 nobody*'Unprivileged user/nonexistent/dev/null1nobodydaemon*The devil himself/root3toor*Bourne-again Superuser/root2JEto uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/usr/guest/operator/bin/csh3operator*System &/usr/guest/operator/bin/csh1operatordaemon*The devil himself/root2daemon*The devil himself/root1daemontoor*Bourne-again Superuser/root1toorrootCharlie &/root/bin/csh1rootic(#uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpgames* Games pseudo-user/usr/games1gamesbin*Binaries Commands and Source,,,//dev/null3operator*System &/usr/guest/operator/bin/csh2tftingres* J& Group/usr/ingres/bin/csh1ingresnobody*'Unprivilegedingres* J& Group/usr/ingres/bin/csh3 bin*Binaries Commands and Source,,,//dev/null2z cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y*0 EET DSTEET1Local time zone must be set--see zic manual pagester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163:  @  ` (  2 "" 2     * " @@ @   `@ @ "`" ?* ?*  @(`  (02 @  "J@J`2J@  J " @(` @ *  J@   J@J`  H" @ J2  @*`  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J@  "  J@J`   8  *  8  *  4  &  4  & @'Ā  "@  /-? 耦 Ā 2;  0ؘ'7477477477ܑ477`A ڸ? 28```@@`*  @@ `*  @@`*  @Ā  @Ĕ ;--`2 @- ,`ˑ2 @ ĺ` `"` '``? '8  . ?2 ? '`" * #@'.`@ '  @`@?  ``'7@, @7@@͒,  ( ?#   . ?@, @@ "@"@4@6`#?# "6` 5 . * @? @ @ 4@6`5`5 @  Ā '   " . ? * :@ @2. 4@đ*  *`@;Α*  Г*`@ +     ( 8 2+ ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@44 44 444 l44 44444444   4&`4)4*44*4*4+l444h4 $4 ,4 4@` 4y0123456789abcdef/s: # # %c Accept any character # %[...] Accept any number of characters in the given set # # The cursor position report () string must contain two scanf(3)-style # %d format elements. The first of these must correspond to the Y coordinate # and the second to the %d. If the string contains the sequence %i, it is # taken as an instruction to decrement each value after reading it (this is # the inverse sense from the cup string). The typical CPR value is # \E[%i%d;%dR (on VT100/ANSI/ECMA-48-compatible terminals). # # These capabilities are used by tac(1m), the terminfo action checker soon # to be distributed with ncurses. # # REQUEST FOR CONTACT INFORMATION AND HISTORICAL MATERIAL: # # As the ANSI/ECMA-48 standard and variants take firmer hold, and as # character-cell terminals are increasingly replaced by X displays, much of # this file is becoming a historical document (this is part of the reason for # the new organization, which puts ANSI types, xterm, and vt100 up front in # confidence that this will catch 95% of new hardware). # # For the terminal types still alive, I'd like to have manufacturer's # contact data (Internet address and/or snail-mail + phone). # # I'm also interested in enriching the comments so that the latter portions of # the file do in fact become a potted history of VDT technology as seen by # UNIX hackers. Ideally, I'd like the headers for each manufacturer to # include its live/dead/out-of-the-business status, and for as many # terminal types as possible to be tagged with information like years # of heaviest use, popularity, and interesting features. # # I'm especially interested in identifying the obscure entries listed under # `Manufacturer unknown' and `Utter unknowns', before the tribal wisdom # about them gets lost. # # If you have been around long enough to contribute, please read the file # with this in mind and send me your annotations. # # COPYRIGHTS AND OTHER DELUSIONS # # The BSD ancestor of this file had a standard Regents of the University of # California copyright with dates from 1980 to 1993. # # Some information has been merged in from a terminfo file SCO distributes. # It has an obnoxious boilerplate copyright which I'm ignoring because they # took so much of the content from the ancestral BSD versions of this file # and didn't attribute it, thereby violating the BSD Regents' copyright. # # Not that anyone should care. However many valid functions copyrights may # serve, putting one on a termcap/terminfo file with hundreds of anonymous # contributors makes about as much sense as copyrighting a wall-full of # graffiti -- it's legally dubious, ethically bogus, and patently ridiculous. # # This file deliberately has no copyright. It belongs to no one and everyone. # If you claim you own it, you will merely succeed in looking like a fool. # Use it as you like. Use it at your own risk. Copy and redistribute freely. # There are no guarantees anywhere. Svaha! ######## STANDARD AND SPECIAL TYPES # # This section describes terminal classes and maker brands that are still # quite common. # #### Specials # # Special "terminals". These are used to label tty lines when you don't # know what kind of terminal is on it. The characteristics of an unknown # terminal are the lowest common denominator - they look about like a ti 700. # dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: lpr|printer|line printer:\ :hc:os:\ :co#132:li#66:\ :bl=^G:cr=^M:do=^J:ff=^L:le=^H:sf=^J: #### ANSI.SYS/ISO 6429/ECMA-48 Capabilities # # See the end-of-file comment for more on these. # # The IBM PC alternate character set. Plug this into any Intel console entry. # We use \E[11m for rmacs rather than \E[12m so the string can use the # ROM graphics for control characters such as the diamond, up- and down-arrow. # This works with the System V, Linux, and BSDI consoles. It's a safe bet this # will work with any Intel console, they all seem to have inherited \E[11m # from the ANSI.SYS de-facto standard. klone+acs|alternate character set for ansi.sys displays:\ :ac=`\004a\261f\370g\361h\260j\331k\277l\332m\300n\305o~q\304r\362s_t\303u\264v\301w\302x\263y\371z\372{\373|\374}\375~\376.\031-\030\054\021+^P0\333p\304r\304y\363z\362{\343|\330}\234:\ :ae=\E[10m:as=\E[11m: # Highlight controls corresponding to the ANSI.SYS standard. Most # console drivers for Intel boxes obey these. Makes the same assumption # about \E[11m as klone+acs. True ANSI/ECMA-48 would have rmso=\E[27m, # rmul=\E[24m, but this isn't a documented feature of ANSI.SYS. klone+sgr|attribute control for ansi.sys displays:\ :S2=\E[11m:S3=\E[10m:ae=\E[10m:as=\E[11m:mb=\E[5m:\ :md=\E[1m:me=\E[0;10m:mk=\E[8m:mr=\E[7m:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m:\ :se=\E[m:so=\E[7m:ue=\E[m:us=\E[4m: # Highlight controls corresponding to the ANSI.SYS standard. *All* # console drivers for Intel boxes obey these. Does not assume \E[11m will # work; uses \E[12m instead, which is pretty bulletproof but loses you the ACS # diamond and arrow characters under curses. klone+sgr-dumb|attribute control for ansi.sys displays (no ESC [ 11 m):\ :ae=\E[10m:as=\E[12m:mb=\E[5m:md=\E[1m:me=\E[0;10m:\ :mk=\E[8m:mr=\E[7m:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;12%;m:\ :se=\E[m:so=\E[7m:ue=\E[m:us=\E[4m: # ANSI.SYS color control. The setb/setf caps depend on the coincidence # between SVr4/XPG4's color numbers and ANSI.SYS attributes. Here are longer # but equivalent strings that don't rely on that coincidence: # setb=\E[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m, # setf=\E[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m, # The DOS 5 manual asserts that these sequences meet the ISO 6429 standard. klone+color|color control for ansi.sys and ISO6429-compatible displays:\ :Co#8:NC#3:pa#64:\ :AB=\E[4%p1%dm:AF=\E[3%p1%dm:Sb=\E[%+(m:Sf=\E[%+^^m:\ :op=\E[37;40m: # For comparison, here are all the capabilities implied by the Intel # Binary Compatibility Standard (level 2) that fit within terminfo. # For more detail on this rather pathetic standard, see the comments # near the end of this file. ibcs2|Intel Binary Compatibility Standard prescriptions:\ :AL=\E[%dL:DC=\E[%dP:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:\ :RA=\E[?7l:RI=\E[%dC:S1=\E=%p1%dg:SA=\E[?7h:\ :SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:bt=\E[Z:ch=\E[%i%dG:\ :cl=\Ec:cm=\E[%i%d;%dH:ct=\E[g:cv=\E[%i%dd:ec=\E[%dX:\ :ei=:im=:rc=\E7:sc=\E7:st=\EH: #### ANSI/ECMA-48 terminals and terminal emulators # # See near the end of this file for details on ANSI conformance. # Don't mess with these entries! Lots of other entries depend on them! # # This section lists entries in a least-capable to most-capable order. # if you're in doubt about what `ANSI' matches yours, try them in that # order and back off from the first that breaks. ansi-mini|any ansi terminal with pessimistic assumptions:\ :am:bs:\ :co#80:it#8:li#24:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:do=\E[B:ho=\E[H:\ :le=\E[D:nd=\E[C:ta=^I:up=\E[A: # Procomm and some other ANSI emulations don't recognize all of the ANSI- # standard capabilities. This entry deletes , , , , and # / capabilities, forcing curses to use repetitions of , # , cud1 and cub1. Also deleted and , as QModem up to 5.03 # doesn't recognize these. Finally, we delete and , which seem to # confuse many emulators. On the other hand, we can count on these programs # doing //. # Older versions of this entry featured # =\E[9m, but =\E[8m now seems to be more common under # ANSI.SYS influence. # From: Eric S. Raymond Oct 30 1995 pcansi-m|pcansi-mono|ibm-pc terminal programs claiming to be ansi (mono mode):\ :am:bs:mi:ms:\ :co#80:it#8:li#24:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:ct=\E[2g:dc=\E[P:dl=\E[M:\ :do=\E[B:ho=\E[H:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:nd=\E[C:sf=^J:st=\EH:ta=^I:\ :up=\E[A:tc=klone+sgr-dumb: pcansi-25-m|pcansi25m|ibm-pc terminal programs with 25 lines (mono mode):\ :li#25:tc=pcansi-m: pcansi-33-m|pcansi33m|ibm-pc terminal programs with 33 lines (mono mode):\ :li#33:tc=pcansi-m: pcansi-43-m|ansi43m|ibm-pc terminal programs with 43 lines (mono mode):\ :li#43:tc=pcansi-m: # The color versions. All PC emulators do color... pcansi|ibm-pc terminal programs claiming to be ansi:\ :tc=klone+color:tc=pcansi-m: pcansi-25|pcansi25|ibm-pc terminal programs with 25 lines:\ :li#25:tc=pcansi: pcansi-33|pcansi33|ibm-pc terminal programs with 33 lines:\ :li#33:tc=pcansi: pcansi-43|pcansi43|ibm-pc terminal programs with 43 lines:\ :li#43:tc=pcansi: # ansi-m -- full ANSI X3.64 with ANSI.SYS-compatible attributes, no color. # If you want pound signs rather than dollars, replace `B' with `A' # in the , , , and capabilities. # From: Eric S. Raymond Nov 6 1995 ansi-m|ansi-mono|ANSI X3.64-1979 terminal with ANSI.SYS compatible attributes:\ :5i:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :cb=\E[1K:ch=\E[%i%dG:ct=\E[2g:cv=\E[%i%dd:ec=\E[%dX:\ :ei=:im=:kB=\E[Z:kI=\E[L:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:nw=\r\E[S:pf=\E[4i:po=\E[5i:\ :..rp=%p1%c\E[%p2%{1}%-%db:s0=\E(B:s1=\E)B:s2=\E*B:\ :s3=\E+B:ta=\E[I:tc=pcansi-m: # ansi -- this terminfo expresses the largest subset of X3.64 that will fit in # standard terminfo. Assumes ANSI.SYS-compatible attributes and color # From: Eric S. Raymond Nov 6 1995 ansi|ansi/pc-term compatible with color:\ :u6=\E[%i%d;%dR:u7=\E[6n:..u8=\E[?%[;0123456789]c:\ :u9=\E[c:tc=klone+color:tc=klone+acs:tc=klone+sgr:tc=ansi-m: # # ANSI.SYS entries # # This completely describes the sequences specified in the DOS 2.1 ANSI.SYS # documentation (except for the keyboard key reassignment feature, which # doen't fit the model well). The klone+acs sequences were valid # though undocumented. The capability is untested but should work for # keys F1-F10 (%p1 values outside this range will yield unpredictable results). # From: Eric S. Raymond Nov 7 1995 ansi.sys-old|ANSI.SYS under PC-DOS 2.1:\ :am:mi:ms:xo:\ :co#80:li#25:\ :RA=\E[?7l:SA=\E[?7h:ce=\E[k:cl=\E[2J:cm=\E[%i%d;%dH:\ :do=\E[B:ho=\E[H:is=\E[m\E[?7h:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=\E[C:pk=\E[0;%+:;"%s":rc=\E[u:\ :sc=\E[s:u6=\E[%i%d;%dR:u7=\E[6n:up=\E[A:tc=klone+color:tc=klone+acs:tc=klone+sgr: ansi.sys|ANSI.SYS 3.1 and later versions:\ :ce=\E[K:tc=ansi.sys-old: # # Define IBM PC keypad keys for vi as per MS-Kermit while using ANSI.SYS. # This should only be used when the terminal emulator cannot redefine the keys. # Since redefining keys with ansi.sys also affects PC-DOS programs, the key # definitions must be restored. If the terminal emulator is quit while in vi # or others using /, the keypad will not be defined as per PC-DOS. # The PgUp and PgDn are prefixed with ESC so that tn3270 can be used on Unix # (^U and ^D are already defined for tn3270). The ESC is safe for vi but it # does "beep". ESC ESC i is used for Ins to avoid tn3270 ESC i for coltab. # Note that is always BS, because PC-dos can tolerate this change. # Caution: vi is limited to 256 string bytes, longer crashes or weirds out vi. # Consequently the End keypad key could not be set (it is relatively safe and # actually useful because it sends ^@ O, which beeps and opens a line above). ansi.sysk|ansisysk|PC-DOS 3.1 ANSI.SYS with keypad redefined for vi:\ :is=U2 PC-DOS 3.1 ANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:\ :ke=\E[;71;0;71p\E[;72;0;72p\E[;73;0;73p\E[;77;0;77p\E[;80;0;80p\E[;81;0;81p\E[;82;0;82p\E[;83;0;83p:\ :ks=\E[;71;30p\E[;72;11p\E[;73;27;21p\E[;77;12p\E[;80;10p\E[;81;27;4p\E[;82;27;27;105p\E[;83;127p:tc=ansi.sys: # # Adds ins/del line/character, hence vi reverse scrolls/inserts/deletes nicer. nansi.sys|nansisys|PC-DOS Public Domain NANSI.SYS:\ :al=\E[1L:dc=\E[1P:dl=\E[1M:ei=:ic=\E[1@:im=:\ :is=U3 PC-DOS Public Domain NANSI.SYS 9-23-86\n:tc=ansi.sys: # # See ansi.sysk and nansi.sys above. nansi.sysk|nansisysk|PC-DOS Public Domain NANSI.SYS with keypad redefined for vi:\ :al=\E[1L:dc=\E[1P:dl=\E[1M:ei=:ic=\E[1@:im=:\ :is=U4 PC-DOS Public Domain NANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:tc=ansi.sysk: #### ANSI console types # # This entry is good for the 1.1.47 version of the Linux console driver. # # Note: there are numerous broken linux entries out there, which didn't screw # up BSD termcap but hose ncurses's smarter cursor-movement optimization. # One common pathology is an incorrect tab length of 4. # # *************************************************************************** # * * # * WARNING: * # * Linuxes come with a default keyboard mapping kcbt=^I. This entry, in * # * response to user requests, assumes kcbt=\E[Z, the ANSI/ECMA reverse-tab * # * character. Here are the keymap replacement lines that will set this up: * # * * # keycode 15 = Tab Tab # alt keycode 15 = Meta_Tab # shift keycode 15 = F26 # string F26 ="\033[Z" # * * # * This has to use a key slot which is unfortunate (any unused one will * # # do, F26 is the higher-numbered one). The change ought to be built * # * into the kernel tables. * # * * # *************************************************************************** # # From: Eric S. Raymond 9 Nov 1995 linux|linux console:\ :am:eo:mi:ms:ut:xn:xo:\ :co#80:it#8:li#25:\ :&7=^Z:@7=\E[4~:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :IC=\E[%d@:K2=\E[G:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:\ :ch=\E[%i%dG:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:cv=\E[%i%dd:dc=\E[P:dl=\E[M:\ :do=^J:ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:k1=\E[[A:\ :k2=\E[[B:k3=\E[[C:k4=\E[[D:k5=\E[[E:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kB=\E[Z:\ :kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:kd=\E[B:\ :kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mr=\E[7m:\ :nd=\E[C:nw=^M^J:r1=\Ec:rc=\E8:sc=\E7:sf=^J:sr=\EM:\ :st=\EH:ta=^I:u6=\E[%i%d;%dR:u7=\E[6n:u8=\E[?6c:\ :u9=\E[c:up=\E[A:vb=200\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l:tc=klone+sgr:tc=klone+color:tc=klone+acs: linux-m|Linux console no color:\ :Co@:pa@:\ :AB@:AF@:Sb@:Sf@:tc=linux: # See the note on ICH/ICH1 VERSUS RMIR/SMIR near the end of file linux-nic|linux with ich/ich1 suppressed for non-curses programs:\ :IC@:ei=:ic@:im=:tc=linux: # SCO console and SOS-Syscons console for 386bsd # (scoansi: had unknown capabilities # :Gc=N:Gd=K:Gh=M:Gl=L:Gu=J:Gv=\072:\ # :GC=E:GD=B:GH=D:GL=\64:GU=A:GV=\63:GR=C: # :G1=?:G2=Z:G3=@:G4=Y:G5=;:G6=I:G7=H:G8=<:\ # :CW=\E[M:NU=\E[N:RF=\E[O:RC=\E[P:\ # :WL=\E[S:WR=\E[T:CL=\E[U:CR=\E[V:\ # I renamed GS/GE/HM/EN/PU/PD/RT -- esr) scoansi|SCO Extended ANSI standard crt:\ :am:bs:eo:xo:\ :co#80:it#8:li#25:\ :@7=\E[F:ae=\E[10m:al=\E[L:as=\E[12m:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:k1=\E[M:k2=\E[N:\ :k3=\E[O:k4=\E[P:k5=\E[Q:k6=\E[R:k7=\E[S:k8=\E[T:\ :k9=\E[U:k;=\E[V:kN=\E[G:kP=\E[I:kb=^H:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:\ :md=\E[1m:me=\E[m:nd=\E[C:se=\E[m:sf=\E[S:so=\E[7m:\ :sr=\E[T:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # This actually describes the generic SVr4 display driver for Intel boxes. # The =\E[2m isn't documented and therefore may not be reliable. # From: Eric Raymond Mon Nov 27 19:00:53 EST 1995 att6386|at386|386at|AT&T WGS 6386 console:\ :am:bw:eo:xo:\ :co#80:it#8:li#25:\ :@7=\E[Y:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:\ :F1=\EOZ:F2=\EOA:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:\ :SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :ac=``a1fxgqh0jYk?lZm@nEooppqDrrsstCu4vAwBx3yyzz{{||}}~~:\ :ae=\E[10m:al=\E[1L:as=\E[12m:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:ch=\E[%i%dG:cl=\E[2J\E[H:cm=\E[%i%d;%dH:\ :cr=^M:ct=\E[2g:cv=\E[%i%dd:dc=\E[P:dl=\E[1M:do=\E[B:\ :ec=\E[%dX:ei=:ho=\E[H:ic=\E[1@:im=:is=\E[0;10;39m:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOT:k6=\EOU:\ :k7=\EOV:k8=\EOW:k9=\EOX:k;=\EOY:kB=^]:kD=\E[P:\ :kI=\E[@:kM=\E0:kN=\E[U:kP=\E[V:kb=^H:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:\ :md=\E[1m:me=\E[0;10m:mh=\E[2m:mk=\E[9m:mr=\E[7m:\ :nd=\E[C:nw=\r\E[S:rc=\E8:\ :..sa=\E[10m\E[0%?%p1%p3%|%t;7%;%?%p2%t;4%;%?%p4%t;5%;%?%p5%t;2%;?%p6%t;1%;%?%p9%t;12%e;10%;%?%p7%t;9%;m:\ :sc=\E7:se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:st=\EH:\ :ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[=1C:vi=\E[=C:tc=klone+color: # (pc6300plus: removed ":KM=/usr/lib/ua/kmap.s5:"; renamed BO/EE/CI/CV -- esr) pc6300plus|AT&T 6300 plus:\ :am:xo:\ :co#80:li#24:\ :al=\E[1L:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[2J\E[H:\ :cm=\E[%i%2;%2H:cr=^M:ct=\E[3g:dc=\E[1P:dl=\E[1M:\ :do=\E[B:ei=:ho=\E[H:ic=\E[1@:im=:k1=\EOc:k2=\EOd:\ :k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:\ :k9=\EOk:k;=\EOu:kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mh=\E[2m:\ :mk=\E[9m:mr=\E[7m:nd=\E[C:nw=^M^J:se=\E[m:sf=^J:\ :so=\E[7m:st=\EH:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[=1C:\ :vi=\E[=C: # # Terminfo entry for the AT&T Unix PC 7300 # from escape(7) in Unix PC 7300 Manual. # Somewhat similar to a vt100-am (but different enough # to redo this from scratch.) # # /*************************************************************** # * # * FONT LOADING PROGRAM FOR THE UNIX PC # * # * This routine loads a font defined in the file ALTFONT # * into font memory slot #1. Once the font has been loaded, # * it can be used as an alternative character set. # * # * The call to ioctl with the argument WIOCLFONT is the key # * to this routine. For more information, see window(7) in # * the PC 7300 documentation. # ***************************************************************/ # #include /* needed for strcpy call */ # #include /* needed for ioctl call */ # #define FNSIZE 60 /* font name size */ # #define ALTFONT "/usr/lib/wfont/special.8.ft" /* font file */ # /* # * The file /usr/lib/wfont/special.8.ft comes with the # * standard PC software. It defines a graphics character set # * similar to that of the Teletype 5425 terminal. To view # * this or other fonts in /usr/lib/wfont, use the command # * cfont . For further information on fonts see # * cfont(1) in the PC 7300 documentation. # */ # # struct altfdata /* structure for alt font data */ # { # short altf_slot; /* memory slot number */ # char altf_name[FNSIZE]; /* font name (file name) */ # }; # ldfont() # { # int wd; /* window in which altfont will be */ # struct altfdata altf; # altf.altf_slot=1; # strcpy(altf.altf_name,ALTFONT); # for (wd =1; wd < 12; wd++) { # ioctl(wd, WIOCLFONT,&altf); # } # } # # (att7300: added /// from the BSDI entry, # they're confirmed by the man page for the System V display---esr) # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att7300|unixpc|pc7300|3b1|s4|AT&T UNIX PC Model 7300:\ :am:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:bt=\E^I:\ :cd=\E[0J:ce=\E[0K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:i1=^O:ic=\E[@:\ :im=:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E5:k6=\E6:\ :k7=\E7:k8=\E8:kD=\Edc:kI=\Eim:kN=\Epg:kP=\EPG:kb=^H:\ :kd=\E[B:kh=\Ehm:kl=\E[D:kr=\E[C:ku=\E[A:md=\E[7m:\ :me=\E[0;10m:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:\ :se=\E[m:sf=^J:so=\E[7m:sr=\EM:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\E[=1C:vi=\E[=C: # From: davis@unidata.ucar.edu # (iris-ansi: added rmam/smam based on init string -- esr) iris-ansi|iris-ansi-net|IRIS emulating ANSI terminal:\ :am:\ :co#80:it#8:li#40:\ :!2=\E[218q:#2=\E[143q:#4=\E[158q:%9=\E[209q:\ :%f=\E[210q:%i=\E[167q:&7=\E[217q:*4=\E[P:*7=\E[147q:\ :@7=\E[146q:@8=^M:AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:\ :F1=\EOR:F2=\EOS:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:al=\E[L:bl=^G:cb=\E[1K:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:\ :dl=\E[M:do=^J:ho=\E[H:\ :is=\E[?1l\E>\E[?7h\E[100g\E[0m\E7\E[r\E8:k1=\E[001q:\ :k2=\E[002q:k3=\E[003q:k4=\E[004q:k5=\E[005q:\ :k6=\E[006q:k7=\E[007q:k8=\E[008q:k9=\EOP:k;=\EOQ:\ :kB=\E[Z:kD=\177:kI=\E[139q:kM=\E[146q:kN=\E[154q:\ :kP=\E[150q:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=\E[D:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pk=\EP101;%d.y%s\E\\:rc=\E8:sc=\E7:se=\E[m:\ :sf=\ED:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m:ve=\E[9/y\E[12/y\E[=6l:\ :vs=\E[10/y\E[=1h\E[=2l\E[=6h: # The following is a version of the ibm-pc entry distributed with PC/IX, # (Interactive Systems' System 3 for the Big Blue), modified by Richard # McIntosh at UCB/CSM. The :pt: and :uc: have been removed from the original, # (the former is untrue, and the latter failed under UCB/man); standout and # underline modes have been added. Note: this entry describes the "native" # capabilities of the PC monochrome display, without ANY emulation; most # communications packages (but NOT PC/IX connect) do some kind of emulation. pcix|PC/IX console:\ :am:bw:eo:\ :co#80:li#24:\ :cd=\E[J:ce=\E[K:cl=\Ec:cm=\E[%i%2;%2H:do=\E[B:\ :ho=\E[H:le=^H:nd=\E[C:se=\E[m:so=\E[7m:ue=\E[m:\ :up=\E[A:us=\E[4m: # (ibmpcx: this entry used to be known as ibmx. # It formerly included the following extension capabilities: # :GC=b:GL=v:GR=t:RT=^J:\ # :GH=\E[196g:GV=\E[179g:\ # :GU=\E[193g:GD=\E[194g:\ # :G1=\E[191g:G2=\E[218g:G3=\E[192g:G4=\E[217g:\ # :CW=\E[E:NU=\E[F:RF=\E[G:RC=\E[H:\ # :WL=\E[K:WR=\E[L:CL=\E[M:CR=\E[N:\ # I renamed GS/GE/WL/WR/CL/CR/PU/PD/HM/EN; also, removed a duplicate # ":kh=\E[Y:". Added IBM-PC forms characters and highlights, they match # what was there before. -- esr) ibmpcx|xenix|ibmx|IBM PC xenix console display:\ :am:ms:\ :co#80:li#25:\ :@7=\E[d:al=\E[L:cd=\E[J:ce=\E[K:cl=^L:cm=\E[%d;%dH:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:\ :k1=\E[K:k2=\E[L:k3=\E[M:k4=\E[N:kN=\E[e:kP=\E[Z:\ :kb=^H:kd=\E[B:kh=\E[Y:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :nd=\E[C:up=\E[A:tc=klone+acs:tc=klone+sgr: # QNX 4.0 Console # Michael's original version of this entry had @, =\Ei, # =\Eh\ER; this was so terminfo applications could write the lower # right corner without triggering a scroll. The ncurses terminfo library can # handle this case with the capability, and prefers am for optimization. # From: Michael Hunter 25 Aug 1995 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) qnx|qnx4|qnx console:\ :am:km:mi:ms:xt:\ :co#80:it#4:li#25:\ :al=\EE:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:dc=\Ef:dl=\EF:do=^J:ei=:ho=\EH:ic=\Ee:im=:\ :k1=\377\201:k2=\377\202:k3=\377\203:k4=\377\204:\ :k5=\377\205:k6=\377\206:k7=\377\207:k8=\377\210:\ :k9=\377\211:kD=\377\254:kI=\377\253:kN=\377\252:\ :kP=\377\242:kd=\377\251:kh=\377\240:kl=\377\244:\ :kr=\377\246:ku=\377\241:le=^H:mb=\E{:md=\E<:\ :me=\E}\E]\E>\E):mr=\E(:nd=\EC:rp=\Eg%r%+ %.:se=\E):\ :sf=^J:so=\E(:sr=\EI:ta=^I:te=\ER:ue=\E]:up=\EA:\ :us=\E[:ve=\Ey1:vi=\Ey0:vs=\Ey2: #### FreeBSD and NetBSD consoles # # pcvt termcap database entries (corresponding to release 3.31) # Author's last edit-date: [Fri Sep 15 20:29:10 1995] # # (For the terminfo master file, I translated these into terminfo syntax. # Then I dropped all the pseudo-HP entries. we don't want and can't use # the :Xs: flag. Then I split :is: into a size-independent and a # size-dependent . Finally, I added / -- esr) # NOTE: because the 386BSD "vi"/"elvis" seems to have a bug if # both and are specified (an original VT220 # shows the same buggy behaviour!), has been taken # out of this entry. for reference, it should be =\E[@. pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=llmmkkjjuuttvvwwqqxxnnoosspprr``aaffgg~~..--++\054\054hhII00yyzz:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:kD=\E[3~:kH=\E[4~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:\ :ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:\ :us=\E[4m: # NetBSD/FreeBSD vt220 terminal emulator console (pc keyboard & monitor) # termcap entries for pure VT220-Emulation and 25, 28, 35, 40, 43 and # 50 lines entries; 80 columns pcvt25|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: # NetBSD/FreeBSD vt220 terminal emulator console (pc keyboard & monitor) # termcap entries for pure VT220-Emulation and 25, 28, 35, 40, 43 and # 50 lines entries; 132 columns pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: #### 386BSD and BSD/OS Consoles # # This was the original 386BSD console entry (I think). # Some places it's named oldpc3|oldibmpc3. # From: Alex R.N. Wetmore origpc3|origibmpc3|IBM PC 386BSD Console:\ :am:bw:eo:xo:\ :co#80:li#25:\ :ac=l\332q\304k\277x\263j\331m\300w\302u\264v\301t\303n\305:\ :cd=\E[J:ce=\E[K:cl=\Ec:cm=\E[%i%2;%2H:do=\E[B:\ :ho=\E[H:kd=\E[B:kh=\E[Y:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:md=\E[7m:me=\E[m\E[1;0x\E[2;7x:nd=\E[C:\ :se=\E[1;0x\E[2;7x:sf=\E[S:so=\E[1;7x\E[2;0x:sr=\E[T:\ :ue=\E[1;0x\E[2;7x:up=\E[A:us=\E[1;7x\E[2;0x: # description of BSD/386 console emulator in version 1.0 (supplied by BSDI) oldpc3|oldibmpc3|old IBM PC BSD/386 Console:\ :km:\ :li#25:\ :al=\E[L:bl=^G:cr=^M:dl=\E[M:do=^J:kH=\E[F:kI=\E[L:\ :kN=\E[G:kP=\E[I:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:md=\E[=15F:me=\E[=R:mh=\E[=8F:\ :nw=^M^J:sf=^J:ta=^I: # Description of BSD/OS console emulator in version 1.1, 2.0, 2.1 # Note, the emulator supports many of the additional console features # listed in the iBCS2 (e.g. color and character-set selection) though # not all are described here. This entry really ought to be upgraded. # Also note, the console will also work with fewer lines after doing # "stty rows NN", e.g. to use 24 lines. bsdos|BSD/OS console:\ :am:bw:eo:km:xo:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\Ec:\ :cm=\E[%i%d;%dH:cr=^M:dl=\E[M:do=^J:ho=\E[H:kH=\E[F:\ :kI=\E[L:kN=\E[G:kP=\E[I:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[0m:mh=\E[=8F:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:\ :sc=\E7:se=\E[0m:sf=^J:so=\E[7m:ta=^I:up=\E[A: bsdos-bold|IBM PC BSD/386 Console with bold instead of underline:\ :ue=\E[0m:us=\E[1m:tc=bsdos: # If you are BSDI, you want the following entries, for the moment. # In release 2.0 they will probably phase out the pc3 and ibmpc3 names pc3|IBM PC BSD/386 Console:\ :tc=bsdos: ibmpc3|pc3-bold|IBM PC BSD/386 Console with bold instead of underline:\ :us=\E[1m:tc=bsdos-bold: #### DEC VT100 and compatibles # # DEC terminals from the vt100 forward (and the vt52, way obsolete but still # the basis of some emulations) are collected here. Older DEC terminals and # micro consoles can be found in the `obsolete' section. More details on # the relationship between the VT100 and ANSI X3.64/ISO 6429/ECMA-48 may be # found near the end of this file. # # Except where noted, these entries are DEC's official terminfos. # Contact Bill Hedberg of Terminal Support # Engineering for more information. Updated terminfos and termcaps # are kept available at ftp://gatekeeper.dec.com/pub/DEC/termcaps. # vt52|dec vt52:\ :co#80:it#8:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:\ :do=\EB:ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\ED:nd=\EC:nw=^M^J:sf=^J:sr=\EI:ta=^I:up=\EA: # NOTE: Any VT100 emulation, whether in hardware or software, almost # certainly includes what DEC called the `Level 1 editing extension' codes; # only the very oldest VT100s lacked these and there probably aren't any of # those left alive. To capture these, use one of the VT102 entries. # # Note that the glitch in vt100 is not quite the same as on the Concept, # since the cursor is left in a different position while in the # weird state (concept at beginning of next line, vt100 at end # of this line) so all versions of vi before 3.7 don't handle # right on vt100. The correct way to handle is when # you output the char in column 80, immediately output CR LF # and then assume you are in column 1 of the next line. If # is on, am should be on too. # # I assume you have smooth scroll off or are at a slow enough baud # rate that it doesn't matter (1200? or less). Also this assumes # that you set auto-nl to "on", if you set it off use vt100-nam # below. # # The padding requirements listed here are guesses. It is strongly # recommended that xon/xoff be enabled, as this is assumed here. # # The vt100 uses and rather than // because the # tab settings are in non-volatile memory and don't need to be # reset upon login. Also setting the number of columns glitches # the screen annoyingly. You can type "reset" to get them set. # # This is how the keypad gets assigned in Application Keypad mode. # PF1 = kf1 PF2 = kf2 PF3 = kf3 PF4 = kf4 # 7 = kf9 8 = kf10 9 = kf0 - # 4 = kf5 5 = kf6 6 = kf7 , = kf8 # 1 = ka1 2 = kb2 3 = ka3 # 0 = kc1 . = kc3 ENTER = kent # # And here, for those of you with orphaned VT100s lacking documentation, is # a description of the soft switches invoked when you do `Set Up'. # # Scroll 0-Jump Shifted 3 0-# # | 1-Smooth | 1-British pound sign # | Autorepeat 0-Off | Wrap Around 0-Off # | | 1-On | | 1-On # | | Screen 0-Dark Bkg | | New Line 0-Off # | | | 1-Light Bkg | | | 1-On # | | | Cursor 0-Underline | | | Interlace 0-Off # | | | | 1-Block | | | | 1-On # | | | | | | | | # 1 1 0 1 1 1 1 1 0 1 0 0 0 0 1 0 <--Standard Settings # | | | | | | | | # | | | Auto XON/XOFF 0-Off | | | Power 0-60 Hz # | | | 1-On | | | 1-50 Hz # | | Ansi/VT52 0-VT52 | | Bits Per Char. 0-7 Bits # | | 1-ANSI | | 1-8 Bits # | Keyclick 0-Off | Parity 0-Off # | 1-On | 1-On # Margin Bell 0-Off Parity Sense 0-Odd # 1-On 1-Even # # The following SET-UP modes are assumed for normal operation: # ANSI_MODE AUTO_XON/XOFF_ON NEWLINE_OFF 80_COLUMNS # WRAP_AROUND_ON JUMP_SCROLL_OFF # Other SET-UP modes may be set for operator convenience or communication # requirements; I recommend # AUTOREPEAT_ON BLOCK_CURSOR MARGIN_BELL_OFF SHIFTED_3_# # Unless you have a graphics add-on such as Digital Engineering's VT640 # (and even then, whenever it can be arranged!) you should set # INTERLACE_OFF # # (I added / based on the init string -- esr) vt100|vt100-am|dec vt100 (w/advanced video):\ :am:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:\ :K5=\EOn:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:do=^J:eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:\ :k8=\EOl:k9=\EOw:k;=\EOx:kb=^H:kd=\EOB:ke=\E[?1l\E>:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m\017:mr=\E[7m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 no automargins:\ :am@:xn@:tc=vt100-am: # Ordinary vt100 in 132 column ("wide") mode. vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video no automargin):\ :co#132:li#14:vt@:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: # vt100 with no advanced video. vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:tc=vt100-nav: # vt100 with one of the 24 lines used as a status line. # We put the status line on the top. vt100-s|vt100-s-top|vt100-top-s|vt100 for use with top sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:\ :is=\E7\E[2;24r\E8:ts=\E7\E[1;%p1%dH\E[1K:tc=vt100-am: # Status line at bottom. # Clearing the screen will clobber status line. vt100-s-bot|vt100-bot-s|vt100 for use with bottom sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%p1%dH\E[1K:tc=vt100-am: # Most of the `vt100' emulators out there actually emulate a vt102 # This entry (or vt102-nsgr) is probably the right thing to use for # these. vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: vt102-w|dec vt102 in wide mode:\ :li#132:\ :r3=\E[?3h:tc=vt102: # Many brain-dead PC comm programs that pretend to be `vt100-compatible' # fail to interpret the ^O and ^N escapes properly. Symptom: the # string in the canonical vt100 entry above leaves the screen littered # with little snowflake or star characters (IBM PC ROM character \017 = ^O) # after highlight turnoffs. This entry should fix that, and even leave # ACS support working, at the cost of making multiple-highlight changes # slightly more expensive. # From: Eric S. Raymond July 22 1995 vt102-nsgr|vt102 no sgr (use if you see snowflakes after highlight changes):\ :me=\E[m:sa@:tc=vt102: # VT125 Graphics CRT. Clear screen also erases graphics vt125|vt125 graphics terminal:\ :cl=\E[H\E[2J\EPpS(E)\E\\:tc=vt100: # This isn't a DEC entry, it came from University of Wisconsin. # (vt131: I added / based on the init string -- esr) vt131|dec vt131:\ :am:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[?7h:bl=^G:cd=50\E[J:ce=3\E[K:cl=50\E[;H\E[2J:\ :cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:do=^J:ho=\E[H:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:sc=\E7:\ :se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: # vt132 - like vt100 but slower and has ins/del line and such. # I'm told that / are backwards in the terminal from the # manual and from the ANSI standard, this describes the actual # terminal. I've never actually used a vt132 myself, so this # is untested. # vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:tc=vt100: # vt220: # This vt220 description maps F5--F9 to the second block of function keys # at the top of the keyboard. The "DO" key is used as F10 to avoid conflict # with the key marked (ESC) on the vt220. See vt220d for an alternate mapping. # PF1--PF4 are used as F1--F4. # vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=kkllmmjjnnwwqquuttvvxx:ae=\E(B:al=\E[L:as=\E(0:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/lib/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt220-w|vt200-w|DEC vt220 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt220: # # vt220d: # This vt220 description regards F6--F10 as the second block of function keys # at the top of the keyboard. This mapping follows the description given # in the VT220 Programmer Reference Manual and agrees with the labeling # on some terminals that emulate the vt220. There is no support for an F5. # See vt220 for an alternate mapping. # vt220d|DEC VT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k5@:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:tc=vt220: vt220-nam|v200-nam|VT220 in vt100 mode with no auto margins:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt220-8|dec vt220 8 bit terminal:\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ec=\E[%dX:ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:\ :im=\E[4h:is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :rc=\E8:sc=\E7:se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l: # This was DEC's vt320. Use the purpose-built one below instead #vt320|DEC VT320 in vt100 emulation mode, # use=vt220, # # Use v320n for SCO's LYRIX. Otherwise, use Adam Thompson's vt320-nam. # vt320nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: # These entries are not DEC's official ones, they were purpose-built for the # VT320. Here are the designer's notes: # is end on a PC kbd. Actually 'select' on a VT. Mapped to # 'Erase to End of Field'... since nothing seems to use 'end' anyways... # khome is Home on a PC kbd. Actually 'FIND' on a VT. # Things that use usually use tab anyways... and things that don't use # tab usually use instead... # kprv is same as tab - Backtab is useless... # I left out because of its RIDICULOUS complexity, # and the resulting fact that it causes the termcap translation of the entry # to SMASH the 1k-barrier... # From: Adam Thompson Sept 10 1995 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt320|vt300|dec vt320 7 bit terminal:\ :am:es:hs:mi:ms:xn:\ :co#80:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ec=\E[%dX:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\E[H\E[K:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[?25h:vi=\E[?25l: vt320-nam|vt300-nam|dec vt320 7 bit terminal with no am to make SAS happy:\ :am@:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:tc=vt320: # We have to init 132-col mode, not 80-col mode. vt320-w|vt300-w|dec vt320 wide 7 bit terminal:\ :co#132:ws#132:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:tc=vt320: vt320-w-nam|vt300-w-nam|dec vt320 wide 7 bit terminal with no am:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:tc=vt320-w: # VT330 and VT340 -- These are ReGIS and SIXEL graphics terminals # which are pretty much a superset of the VT320. They have the # host writable status line, yet another different DRCS matrix size, # and such, but they add the DEC Technical character set, Multiple text # pages, selectable length pages, and the like. The difference between # the vt330 and vt340 is that the latter has only 2 planes and a monochrome # monitor, the former has 4 planes and a color monitor. These terminals # support VT131 and ANSI block mode, but as with much of these things, # termcap/terminfo doesn't deal with these features. # # Note that this entry is are set up in what was the standard way for GNU # Emacs v18 terminal modes to deal with the cursor keys in that the arrow # keys were switched into application mode at the same time the numeric pad # is switched into application mode. This changes the definitions of the # arrow keys. Emacs v19 is smarter and mines its keys directly out of # your termcap entry, # # From: Daniel Glasser , 13 Oct 1993 # (vt340: string capability "sb=\E[M" corrected to "sr"; # also, added / based on the init string -- esr) vt340|dec-vt340|vt330|dec-vt330|dec vt340 graphics terminal with 24 line page:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:\ :ei=\E[4l:fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:\ :l3=pf3:l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=^M\ED:r1=\E[?3l:rc=\E8:\ :rf=/usr/lib/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # DEC doesn't supply a vt400 description, so we add Daniel Glasser's # (originally written with vt420 as its primary name, and usable for it). # # VT400/420 -- This terminal is a superset of the vt320. It adds the multiple # text pages and long text pages with selectable length of the vt340, along # with left and right margins, rectangular area text copy, fill, and erase # operations, selected region character attribute change operations, # page memory and rectangle checksums, insert/delete column, reception # macros, and other features too numerous to remember right now. TERMCAP # can only take advantage of a few of these added features. # # Note that this entry is are set up in what was the standard way for GNU # Emacs v18 terminal modes to deal with the cursor keys in that the arrow # keys were switched into application mode at the same time the numeric pad # is switched into application mode. This changes the definitions of the # arrow keys. Emacs v19 is smarter and mines its keys directly out of # your termcap entry, # # From: Daniel Glasser , 13 Oct 1993 # (vt400: string capability ":sb=\E[M:" corrected to ":sr=\E[M:"; # also, added / based on the init string -- esr) vt400|vt400-24|dec-vt400|dec vt400 24x80 column autowrap:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ae=^O:al=\E[L:as=^N:cd=10\E[J:ce=4\E[K:\ :cl=10\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:fs=\E[$}:\ :ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:\ :l3=pf3:l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=^M\ED:r1=\E<\E[?3l\E[!p\E[?7h:\ :rc=\E8:rf=/usr/lib/tabset/vt100:sc=\E7:se=\E[27m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # (I removed , it collided with ; # I also added / based on the init string -- esr) vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt100:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:\ :k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:ke=\E>:kl=\E[D:\ :kr=\E[C:ks=\E=:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:r3=\E[?67h\E[64;1"p:rc=\E8:\ :rf=/usr/lib/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: # # DECUDK # if (key < 16) then value = key; # else if (key < 21) then value = key + 1; # else if (key < 25) then value = key + 2; # else if (key < 27) then value = key + 3; # else if (key < 30) then value = key + 4; # else value = key + 5; # vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:\ :F4=\E[12;2~:F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:\ :F8=\E[17;2~:F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:\ :FC=\E[21;2~:FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:\ :FG=\E[24~:FH=\E[25~:FI=\E[26~:FJ=\E[28~:FK=\E[29~:\ :FL=\E[31~:FM=\E[32~:FN=\E[33~:FO=\E[34~:FP=\E[35~:\ :FQ=\E[36~:FR=\E[23;2~:FS=\E[24;2~:FT=\E[25;2~:\ :FU=\E[26;2~:FV=\E[28;2~:FW=\E[29;2~:FX=\E[31;2~:\ :FY=\E[32;2~:FZ=\E[33;2~:Fa=\E[34;2~:Fb=\E[35;2~:\ :Fc=\E[36;2~:S6=USR_TERM\072vt420pcdos\072:k1=\E[11~:\ :k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\177:\ :kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p2%{19}%=%t\E\023\021%e%p2%{32}%<%t\E%p2%c%e%p2%{127}%=%t\E\177%e%p2%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[m:sa@:tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=\177:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:tc=vt420: vt510|DEC VT510:\ :tc=vt420: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: # VT520/VT525 # # The VT520 is a monochrome text terminal capable of managing up to # four independent sessions in the terminal. It has multiple ANSI # emulations (VT520, VT420, VT320, VT220, VT100, VT PCTerm, SCO Console) # and ASCII emulations (WY160/60, PCTerm, 50/50+, 150/120, TVI 950, # 925 910+, ADDS A2). This terminfo data is for the ANSI emulations only. # # Terminal Set-Up is entered by pressing [F3], [Caps Lock]/[F3] or # [Alt]/[Print Screen] depending upon which keyboard and which # terminal mode is being used. If Set-Up has been disabled or # assigned to an unknown key, Set-Up may be entered by pressing # [F3] as the first key after power up, regardless of keyboard type. # (I added / based on the init string -- esr) vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt100:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:\ :k7=\E[19~:k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/lib/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: # (I added / based on the init string -- esr) vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt100:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:\ :k7=\E[19~:k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/lib/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: #### VT100 emulations # # John Hawkinson tells us that the EWAN telnet for Windows # (the best Windows telnet as of September 1995) presents the name `dec-vt100' # to telnetd. We'll guess that it's vt102-like but doesn't grok ^N/^O. dec-vt100|EWAN telnet's vt100 emulation:\ :tc=vt102-nsgr: # Zstem340 is an (IMHO) excellent VT emulator for PC's. I recommend it to # anyone who needs PC VT340 emulation. (or anything below that level, for # that matter -- DEC's ALL-in-1 seems happy with it, as does INFOPLUS's # RDBM systems, it includes ReGIS and SiXel support! I'm impressed... # I can send the address if requested. # (z340: changed garbled \E[5?l to \E[?5l, DEC smooth scroll off -- esr) # From: Adam Thompson Sept 10 1995 z340|zstem vt340 terminal emulator 132col 42line:\ :li#42:\ :is=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h\E[1;42r\E[42;1H:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h\E[1;42r\E[42;1H:tc=vt320-w: z340-nam|zstem vt340 terminal emulator 132col 42line:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[?5l\E[?7l\E[?8h\E[1;42r\E[42;1H:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?7l\E[?8h\E[1;42r\E[42;1H:tc=z340: #### X terminal emulators # # X10/6.6 11/7/86, minus alternate screen, plus (csr) # (xterm: ":MT:" changed to ":km:"; added / based on init string; # removed (hs, eslok, tsl=\E[?E\E[?%i%dT, fsl=\E[?F, dsl=\E[?E) # as these seem not to work -- esr) x10term|vs100-x10|xterm terminal emulator (X10 window system):\ :am:km:mi:ms:xn:xo:\ :co#80:it#8:li#65:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:RA=\E[?7l:SA=\E[?7h:\ :al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:\ :ho=\E[H:im=\E[4h:is=\E\E[m\E[?7h\E[?1;4l:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:\ :rs=\E[r\E<\E[m\E[H\E[2J\E[?7h\E[?1;3;4;6l:se=\E[m:\ :sf=^J:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m: # X11R6 xterm. This is known good for the XFree86 version under Linux. # It is *way* more featureful than the stock X consortium entry. # The kmous key is actually the \E[M prefix returned by xterm's internal # mouse-tracking facility. ncurses will interpret the following three bytes # of mouse status information. # From: Eric S. Raymond 9 Nov 1995 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) xterm|vs100|xterm terminal emulator (X11R6 Window System):\ :am:km:mi:ms:xn:xo:\ :co#80:it#8:li#65:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3k:dc=\E[P:dl=\E[M:do=^J:\ :ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E[r\E[m\E[2J\E[H\E[?7h\E[?1;3;4;6l\E[4l:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:ke=\E[?1l\E>:\ :kh=\E[@:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:\ :se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :te=\E[2J\E[?47l\E8:ti=\E7\E[?47h:ue=\E[m:up=\E[A:\ :us=\E[4m: xterm-bold|xterm terminal emulator (X11R6 Window System) standout w/bold:\ :so=\E[1m:tc=xterm: xterms|vs100s|xterm terminal emulator (small screen 24x80):\ :co#80:li#24:tc=xterm: # (kterm: this had extension capabilities ":KJ:TY=ascii:" -- esr) kterm|kterm kanji terminal emulator (X window system):\ :es:hs:\ :cs=\E[%i%d;%dr:ds=\E[?H:fs=\E[?F:rc=\E8:sc=\E7:\ :ts=\E[?E\E[?%i%dT:tc=xterm: # See the note on ICH/ICH1 VERSUS RMIR/SMIR near the end of file xterm-nic|xterm with ich/ich1 suppressed for non-curses programs:\ :IC@:ei=:ic@:im=:tc=xterm: # From: Eric S. Raymond May 4 1995 # Should work with the color xterm on the X11R6 contrib tape. xterm-color|xterm with color support:\ :tc=xterm:tc=klone+color: # From: David J. MacKenzie 20 Apr 1995 # Here's a termcap entry I've been using for xterm_color, which comes # with BSD/OS 2.0, and the X11R6 contrib tape too I think. Besides the # color stuff, I also have a status line defined as the window manager # title bar. [I have translated it to terminfo -- ESR] xterm-pcolor|xterm with color used for highlights and status line:\ :hs:\ :ws#40:\ :ds=\E]0;\007:fs=^G:md=\E[1m\E[43m:mr=\E[7m\E[34m:\ :so=\E[7m\E[31m:ts=\E]0;:us=\E[4m\E[42m:tc=xterm: # HP ships this, except for the pb#9600 which was merged in from BSD termcap. hpterm|X-hpterm|hp X11 terminal emulator:\ :am:da:db:mi:xs:\ :Nl#8:co#80:lh#2:li#24:lm#0:lw#8:pb#9600:sg#0:\ :LF=\E&j@:LO=\E&jB:ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:\ :cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\E&a0y0C\EJ:\ :cm=\E&a%dy%dC:cr=^M:ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:\ :do=\EB:ei=\ER:im=\EQ:k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:\ :k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:kA=\EL:kC=\EJ:kD=\EP:\ :kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:kM=\ER:kN=\EU:\ :kP=\EV:kR=\ET:kS=\EJ:kT=\E1:ka=\E3:kb=^H:kd=\EB:\ :ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:\ :ku=\EA:le=^H:md=\E&dB:me=\E&d@:mh=\E&dH:ml=\El:\ :mr=\E&dB:mu=\Em:nd=\EC:..pk=\E&f%p1%dk%p2%l%dL%p2%s:\ :..pl=\E&f1a%p1%dk%p2%l%dL%p2%s:\ :..pn=\E&f%p1%dk%p2%l%dd0L%p2%s:\ :..px=\E&f2a%p1%dk%p2%l%dL%p2%s:\ :..sa=\E&d%?%p7%t%'s'%c%;%p1%p3%|%p6%|%{2}%*%p2%{4}%*%+%p4%+%p5%{8}%*%+%'@'%+%c%?%p9%t%'\016'%c%e%'\017'%c%;:\ :se=\E&d@:sf=^J:so=\E&dJ:sr=\ET:st=\E1:ta=^I:\ :ue=\E&d@:up=\EA:us=\E&dD: # This is for the extensible terminal emulator on the X11R6 contrib tape. emu|emu native mode:\ :mi:ms:xo:\ :Co#15:co#80:it#8:li#24:pa#64:vt#200:\ :*6=\Esel:@0=\Efind:@8=^M:\ :AB=\Es%i%p1%d; setaf=\Er%i%p1%d;:AL=\EQ%d;:\ :DC=\EI%d;:DL=\ER%d;:DO=\Ep%d;:F1=\EF11:F2=\EF12:\ :F3=\EF13:F4=\EF14:F5=\EF15:F6=\EF16:F7=\EF17:\ :F8=\EF18:F9=\EF19:FA=\EF20:LE=\Eq-%d;:RI=\Eq%d;:\ :UP=\Ep-%d;:\ :ac=a\202f\260g261j\213k\214l\215m\216n\217o\220q\222s\224t\225u\226v\227w\230x\231~\244:\ :ae=\200:al=\EQ1;:as=\200:bl=^G:cb=\EL:ce=\EK:\ :cl=\EP\EE0;0;:cm=\EE%d;%d;:cr=^M:cs=\Ek%d;%d;:\ :ct=\Ej:dc=\EI1;:dl=\ER1;:do=\EB:eA=\200:\ :ec=\Ej%d;\ned=\EN:ei=\EX:ho=\EE0;0;:if=\200:im=\EY:\ :is=\ES\Er0;\Es0;:k0=\EF00:k1=\EF01:k2=\EF02:\ :k3=\EF03:k4=\EF04:k5=\EF05:k6=\EF06:k7=\EF07:\ :k8=\EF08:k9=\EF09:k;=\EF10:kD=\177:kI=\Eins:\ :kN=\Enext:kP=\Eprior:kb=^H:kd=\EB:kl=\EC:kr=\ED:\ :ku=\EA:le=^H:mb=\ES\EW:md=\ES\EU:me=\ES:mr=\ES\ET:\ :nd=\ED:oc=\Es0;\Er0;:r2=\ES\Es0;\Er0;:se=\ES:sf=\EG:\ :so=\ES\ET:sr=\EF:st=\Eh:ta=^I:ue=\ES:up=\EA:\ :us=\ES\EV:ve=\Ea:vi=\EZ:vs=\Ea: ######## UNIX VIRTUAL TERMINALS AND VIRTUAL CONSOLES # # Columbus UNIX virtual terminal. This terminal also appears in # UNIX 4.0 and successors as line discipline 1 (?), but is # undocumented and does not really work quite right. cbunix|cb unix virtual terminal:\ :am:da:db:\ :co#80:li#24:lm#0:\ :al=\EP:bl=^G:cd=\EL:ce=\EK:cl=\EL:cm=\EG%r%.%.:\ :cr=^M:dc=\EM:dl=\EN:do=^J:ei=:ic=\EO:im=:kd=\EB:\ :kh=\EE:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\Eb^D:\ :sf=^J:so=\Ea^D:ue=\Eb^A:up=\EA:us=\Ea^A: # (vremote: removed obsolete ":nl@:" -- esr) vremote|virtual remote terminal:\ :am@:\ :co#79:tc=cbunix: pty|4bsd pseudo teletype:\ :cm=\EG%+ %+ :se=\Eb$:so=\Ea$:ue=\Eb!:us=\Ea!:tc=cbunix: # Entries for use by the FSF's `screen' program. The screen and # screen-w came with version 3.6.2. The screen2 and screen3 entries # come from University of Wisconsin and may be older. screen|VT 100/ANSI X3.64 virtual terminal:\ :am:km:mi:ms:xn:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:\ :F2=\E[24~:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~..--++\054\054hhII00:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :im=\E[4h:is=\E)0:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[15~:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kH=\E[4~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:r2=\Ec:\ :rc=\E8:sc=\E7:se=\E[23m:sf=^J:so=\E[3m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\EM:us=\E[4m: screen-w|VT 100/ANSI X3.64 virtual terminal with 132 cols:\ :co#132:tc=screen: screen2|VT 100/ANSI X3.64 virtual terminal:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ic=:\ :im=\E[4h:k0=\E~:k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:\ :k6=\EP:k7=\EQ:k8=\ER:k9=\E0I:kb=^H:kd=\EB:kh=\EH:\ :kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\E[C:nw=^M^J:r1=\Ec:\ :rc=\E8:sc=\E7:se=\E[23m:sf=^J:so=\E[3m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: # (screen3: removed unknown ":xv:LP:G0:" -- esr) screen3|VT 100/ANSI X3.64 virtual terminal:\ :km:mi:ms:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ei=\E[4l:ho=\E[H:im=\E[4h:is=\E)0:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E>:kl=\EOD:\ :kr=\EOC:ks=\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:r1=\Ec:rc=\E8:\ :sc=\E7:se=\E[23m:sf=^J:so=\E[3m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[24m:up=\EM:us=\E[4m: ######## WORKSTATION CONSOLES # #### Sun consoles # # :is1: resets scrolling region in case a previous user had used "tset vt100" oldsun|Sun Microsystems Workstation console:\ :am:km:mi:ms:\ :co#80:it#8:li#34:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:al=\E[L:\ :bl=^G:cd=\E[J:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:cr=^M:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:i1=\E[1r:ic=\E[@:im=:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:nd=\E[C:se=\E[m:sf=^J:\ :so=\E[7m:ta=^I:up=\E[A: # From: Alexander Lukyanov , 14 Nov 1995 sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :am:km:ms:\ :co#80:li#35:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:\ :IC=\E[%d@:K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:\ :cl=^L:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:\ :ei=:ic=\E[@:im=:k1=\E[224z:k2=\E[225z:k3=\E[226z:\ :k4=\E[227z:k5=\E[228z:k6=\E[229z:k7=\E[230z:\ :k8=\E[231z:k9=\E[232z:k;=\E[233z:kD=\177:kN=\E[222z:\ :kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r2=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m: # From: Tue Sep 24 13:14:44 1985 # (sun-s: I added lines#34 because the Lukyanov entry for sun has 35 -- esr) sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :li#34:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :te=\E[>4h:ti=\E[>4l:tc=sun: #### Iris consoles # # (wsiris: this had extension capabilities # :HS=\E7F2:HE=\E7F7:\ # :CT#2:CZ=*Bblack,red,green,yellow,blue,magenta,cyan,*Fwhite: # (wsiris: removed suboptimal =\EH\EJ:" -- esr) wsiris|iris40|iris emulating a 40 line visual 50 (approximately):\ :am:\ :co#80:it#8:li#40:\ :al=\EL:cd=\EJ:ce=\EK:cl=\Ev:cm=\EY%+ %+ :dl=\EM:\ :ho=\EH:is=\E7B0\E7F7\E7C2\E7R3:k0=\E0:k1=\E1:k2=\E2:\ :k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:k8=\E8:k9=\E9:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\E0@:\ :so=\E9P:sr=\EI:ta=^I:ue=\E7R3\E0@:up=\EA:\ :us=\E7R2\E9P:ve=\E>:vs=\E;: #### NeWS consoles # # Console terminal windows under the NeWS (Sun's Display Postscript windowing # environment). Note: these have nothing to do with Sony's News workstation # line. # # Entry for NeWS's psterm from Eric Messick & Hugh Daniel # (psterm: unknown ":sl=\EOl:el=\ENl:" removed -- esr) psterm|psterm-basic|NeWS psterm-80x34:\ :am:bs:hs:km:ul:\ :co#80:it#8:li#34:\ :al=\EA:cd=\EB:ce=\EC:cl=^L:cm=\E%d;%d;:cs=\EE%d;%d;:\ :dc=\EF:dl=\EK:do=\EP:ei=\ENi:fs=\ENl:ho=\ER:i1=\EN*:\ :im=\EOi:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=\ET:\ :ll=\EU:mb=\EOb:md=\EOd:me=\EN*:mr=\EOr:nd=\EV:rc=^\:\ :sc=^]:se=\ENo:sf=\EW:so=\EOo:sr=\EX:ta=^I:te=\ENt:\ :ti=\EOt:ts=\EOl:ue=\ENu:up=\EY:us=\EOu:vb=\EZ: psterm-96x48|NeWS psterm 96x48:\ :co#96:li#48:tc=psterm: psterm-90x28|NeWS psterm 90x28:\ :co#90:li#28:tc=psterm: psterm-80x24|NeWS psterm 80x24:\ :co#80:li#24:tc=psterm: # This is a faster termcap for psterm. Warning: if you use this termcap, # some control characters you type will do strange things to the screen. # (psterm-fast: unknown ":sl=^Ol:el=^Nl:" -- esr) psterm-fast|NeWS psterm fast version (flaky ctrl chars):\ :am:bs:hs:km:ul:\ :co#80:it#8:li#34:\ :al=^A:cd=^B:ce=^C:cl=^L:cm=\004%d;%d;:cs=\005%d;%d;:\ :dc=^F:dl=^K:do=^P:ei=^Ni:fs=^Nl:ho=^R:i1=^N*:im=^Oi:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^T:ll=^U:mb=^Ob:\ :md=^Od:me=^N*:mr=^Or:nd=^V:rc=^\:sc=^]:se=^No:sf=^W:\ :so=^Oo:sr=^X:ta=^I:te=^Nt:ti=^Ot:ts=^Ol:ue=^Nu:\ :up=^Y:us=^Ou:vb=^Z: #### Apollo consoles # # Apollo got bought by Hewlett-Packard. The Apollo workstations are # labeled HP700s now. # # From: Gary Darland apollo|apollo console:\ :am:mi:\ :co#88:li#53:\ :al=\EI:cd=\EJ:ce=\EK:ch=\EN%d:cl=^L:cm=\EM%+ %d):\ :cv=\EO+ :dc=\EP:dl=\EL:do=\EB:ei=\ER:im=\EQ:le=^H:\ :nd=\EC:se=\ET:sf=\EE:so=\ES:sr=\ED:te=\EX:ti=\EW:\ :ue=\EV:up=\EA:us=\EU: # We don't know whether or not the apollo guys replicated DEC's firmware bug # in the VT132 that reversed /. To be on the safe side, disable # both these capabilities. apollo_15P|apollo 15 inch display:\ :ei@:im@:tc=vt132: apollo_19L|apollo 19 inch display:\ :ei@:im@:tc=vt132: apollo_color|apollo color display:\ :ei@:im@:tc=vt132: #### Fortune Systems consoles # # From: Robert Nathanson via tut Wed Oct 5, 1983 # (This had extension capabilities # :rv=\EH:re=\EI:rg=0:GG=0:\ # :CO=\E\\:WL=^Aa\r:WR=^Ab\r:CL=^Ac\r:CR=^Ad\r:DL=^Ae\r:RF=^Af\r:\ # :RC=^Ag\r:CW=^Ah\r:NU=^Aj\r:EN=^Ak\r:HM=^Al:PL=^Am\r:\ # :PU=^An\r:PD=^Ao\r:PR=^Ap\r:HP=^A@\r:RT=^Aq\r:TB=\r:CN=\177:MP=\E+F: # It had both ":bs:" and ":bs=^H:"; I removed the latter. Also, it had # ":sg=0:" and ":ug=0:"; evidently the composer was trying (unnecessarily) # to force both magic cookie glitches off. Once upon a time, I # used a Fortune myself, so I know the capabilities of the form ^A[a-z]\r are # function keys; thus the "Al" value for HM was certainly an error. I renamed # EN/PD/PU/CO/CF/RT according to the XENIX/TC mappings, but not HM/DL/RF/RC. # I think :rv: and :re: are start/end reverse video and :rg: is a nonexistent # "reverse-video-glitch" capability; I have put :rv: and :re: in with standard # names below. I've removed obsolete ":nl=5^J:" as there is a :do: -- esr) fos|fortune|Fortune system:\ :am:bw:\ :co#80:li#25:\ :@7=^Ak\r:@8=^Aq:ac=l m"k(j*v%w#q&x-:ae=^O:al=\034E:\ :as=\Eo:bl=^G:cd=\034Y:ce=^\Z:cl=\014:cm=\034C%+ %+ :\ :cr=^M:dc=\034W:dl=\034R:do=\n:ei=:ho=\036:ic=\034Q:\ :im=:is=^_..:k1=^Aa\r:k2=^Ab\r:k3=^Ac\r:k4=^Ad\r:\ :k5=^Ae\r:k6=^Af\r:k7=^Ag\r:k8=^Ah\r:kN=^Ao\r:\ :kP=^An\r:kb=^H:kd=^Ay\r:kh=^A?\r:kl=^Aw\r:kr=^Az\r:\ :ku=^Ax\r:le=^H:mb=\EN:me=\EI:mr=\EH:nw=^M^J:se=^\I`:\ :sf=^J:so=^\H`:ta=^Z:ue=^\IP:up=\013:us=^\HP:ve=\E\\:\ :vi=\E]:vs=\E\072: ######## COMMON TERMINAL TYPES # # This section describes terminal classes and maker brands that are still # quite common, but have proprietary command sets not blessed by ANSI. #### Altos # # Altos descriptions from Ted Mittelstaedt 4 Sep 1993 # His comments suggest they were shipped with the system. # # (altos2: had extension capabilities # :c0=^A`\r:c1=^Aa\r:c2=^Ab\r:c3=^Ac\r:\ # :c4=^Ad\r:c5=^Ae\r:c6=^Af\r:c7=^Ag\r:\ # :c8=^Ah\r:c9=^Ai\r:cA=^Aj\r:cB=^Ak\r:\ # :cC=^Al\r:cD=^Am\r:cE=^An\r:cF=^Ao\r: # :XU=^Aq\r:XD=^Ar\r:XR=^As\r:XL=^At\r:\ # :YU=^AQ\r:YD=^AR\r:YR=^AS\r:YL=^AT\r:\ # :HL=^AP\r:SP=\E[i:\ # :IS=\E[@:DE=\E[P:IL=\E[L:NS=\E[S:PS=\E[T:\ # :LO=\E[0q:LC=\E[5q:LL=\E[6q:\ # Comparison with the k* capabilities makes it obvious that the c* things are # shift keys. I have renamed them to keys 32 and up accordingly. Also, # :sr: was given as a boolean-- esr) altos2|alt2|altos-2|altos II:\ :co#80:it#8:li#24:sg#0:\ :*5=^Am\r:*8=^An\r:DL=\E[M:FM=^A`\r:FN=^Aa\r:\ :FO=^Ab\r:FP=^Ac\r:FQ=^Ad\r:FR=^Ae\r:FS=^Af\r:\ :FT=^Ag\r:FU=^Ah\r:FV=^Ai\r:FW=^Aj\r:FX=^Ak\r:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:do=\E[1B:\ :ei=:ho=\E[H:ic=\E[@:if=/usr/share/tabset/vt100:\ :im=:is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:k0=^AI\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=^AJ\r:\ :kB=^AK\r:kC=^AL\r:kD=^AM\r:kE=^AN\r:kF=^AO\r:kb=^H:\ :kd=\E[B:kh=\E[f:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :nd=\E[1C:nw=^M^J:se=\E[m:sf=^J:so=\E[7m:ta=^I:\ :ue=\E[m:up=\E[1A:us=\E[4m: # (altos3: had extension capabilities # :c0=^A`\r:c1=^Aa\r:c2=^Ab\r:c3=^Ac\r:\ # :c4=^Ad\r:c5=^Ae\r:c6=^Af\r:c7=^Ag\r:\ # :c8=^Ah\r:c9=^Ai\r:cA=^Aj\r:cB=^Ak\r:\ # :cC=^Al\r:cD=^Am\r:cE=^An\r:cF=^Ao\r: # :XU=^Aq\r:XD=^Ar\r:XR=^As\r:XL=^At\r:\ # :HL=^AP\r:SP=\E[i:\ # :IS=\E[@:DE=\E[P:IL=\E[L:NS=\E[S:PS=\E[T:\ altos3|altos5|alt3|alt5|altos-3|altos-5|altos III or V:\ :mb=\E[5p:me=\E[p:sr=\EM:tc=altos2: altos4|alt4|altos-4|altos IV:\ :tc=wy50: # (altos7: had extension capabilities: # :GG#0:GI=\EH8:GF=\EH7:\ # :c0=^A`\r:c1=^Aa\r:c2=^Ab\r:c3=^Ac\r:\ # :c4=^Ad\r:c5=^Ae\r:c6=^Af\r:c7=^Ag\r:\ # :c8=^Ah\r:c9=^Ai\r:cA=^Aj\r:cB=^Ak\r:\ # :cC=^Al\r:cD=^Am\r:cE=^An\r:cF=^Ao\r: # Comparison with the k* capabilities makes it obvious that the c* things are # shift keys. I have renamed them to keys 32 and up accordingly -- esr) altos7|alt7|altos VII:\ :am:mi:\ :co#80:li#24:sg#0:\ :*5=^Am\r:*8=^An\r:DL=\ER:FM=^A`\r:FN=^Aa\r:FO=^Ab\r:\ :FP=^Ac\r:FQ=^Ad\r:FR=^Ae\r:FS=^Af\r:FT=^Ag\r:\ :FU=^Ah\r:FV=^Ai\r:FW=^Aj\r:FX=^Ak\r:\ :ac=l2m1k3j5t4u9v=w0q\072x6n8\nblink=\EG2:al=\EE:\ :cd=\EY:ce=\ET:cl=\E+^^:cm=\E=%+ %+ :cr=^M:dc=\EW:\ :do=^J:ei=\Er:ho=^^:im=\Eq:\ :is=\E`\072\Ee(\EO\Ee6\Ec41\E~4\Ec21\Eu\E~2:k0=^AI\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=^AJ\r:\ :kB=^AK\r:kC=^AL\r:kD=^AM\r:kE=^AN\r:kF=^AO\r:kN=\EK:\ :kP=\EJ:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:\ :md=\EGt:me=\EG0:mh=\EGp:mk=\EG1:mr=\EG4:nd=^L:\ :nw=^M^J:pf=\EJ:po=\Ed#:se=\EG0:sf=^J:so=\EG4:sr=\Ej:\ :ta=^I:ue=\EG0:up=^K:us=\EG8: altos7pc|alt7pc|altos PC VII:\ :@7=\ET:tc=altos7: #### Hewlett-Packard (hp) # # Hewlett-Packard # 8000 Foothills Blvd # Roseville, CA 95747 # Vox: 1-(916)-785-4363 (Technical response line for VDTs) # 1-(800)-633-3600 (General customer support) # # Generic HP terminal - this should (hopefully) work on any HP terminal. hpgeneric|hp|hewlett-packard generic terminal:\ :am:da:db:mi:xs:\ :co#80:li#24:lm#0:vt#6:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:\ :cm=\E&a%r%dc%dY:cr=^M:ct=\E3:cv=\E&a%dY:dc=\EP:\ :dl=\EM:do=^J:ei=\ER:im=\EQ:kB=\Ei:kb=^H:le=^H:\ :nd=\EC:se=\E&d@:sf=^J:so=\E&dJ:st=\E1:ta=^I:\ :ue=\E&d@:up=\EA:us=\E&dD: hp110|hewlett-packard model 110 portable:\ :li#16:tc=hpgeneric: hp+pfk+cr|hp function keys with CR:\ :k1=\Ep\r:k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:\ :k6=\Eu\r:k7=\Ev\r:k8=\Ew\r: hp+pfk-cr|hp function keys w/o CR:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:\ :k8=\Ew: # The 2621s use the same keys for the arrows and function keys, # but not separate escape sequences. These definitions allow the # user to use those keys as arrow keys rather than as function # keys. hp+pfk+arrows|hp alternate arrow definitions:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:kF=\Er\r:kH=\Eq\r:\ :kR=\Es\r:kd=\Ew\r:kh=\Ep\r:kl=\Eu\r:kr=\Ev\r:\ :ku=\Et\r: hp+arrows|hp arrow definitions:\ :kF=\ES:kH=\EF:kR=\ET:kd=\EB:kh=\Eh:kl=\ED:kr=\EC:\ :ku=\EA: # Generic stuff from the HP 262x series # hp262x|HP 262x terminals:\ :xs:\ :cd=\EJ:dc=\EP:ip=:kA=\EL:kD=\EP:kE=\EK:kF=\ES:\ :kI=\EQ:kL=\EM:kM=\ER:kN=\EU:kP=\EV:kR=\ET:kS=\EJ:\ :kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:\ :ku=\EA:mb=\E&dA:me=\E&d@:mk=\E&dS:mr=\E&dB:\ :..sa=\E&d%'@'%?%p1%t%'B'%|%;%?%p2%t%'D'%|%;%?%p3%t%'B'%|%;%?%p4%t%'A'%|%;%c:\ :se=\E&d@:sf=\ES:so=\E&dB:ta=\011:ue=\E&d@:us=\E&dD: # Note: no on HP's since that homes to top of memory, not screen. # Due to severe 2621 braindamage, the only way to get the arrow keys to # transmit anything at all is to turn on the function key labels # with , and even then the user has to hold down shift! # The default 2621 turns off the labels except when it has to to # enable the function keys. If your installation prefers labels # on all the time, or off all the time (at the "expense" of the # function keys) move the # 2621-nl or 2621-wl labels to the # front using reorder. # Note: there are newer ROMs for 2621's that allow you to set # strap A so the regular arrow keys xmit \EA, etc, as with the # 2645. However, even with this strap set, the terminal stops # xmitting if you reset it, until you unset and reset the strap! # Since there is no way to set/unset the strap with an escape # sequence, we don't use it in the default. # If you like, you can use 2621-ba (brain-damaged arrow keys). hp2621-ba|2621-ba|2621 w/new rom and strap A set:\ :ke@:ks@:tc=hp+arrows:tc=hp2621: # hp2621 with function labels. Most of the time they are off, # but inside vi, the function key labels appear. You have to # hold down shift to get them to xmit. hp2621|hp2621a|hp2621A|2621|2621a|2621A|hp2621-wl|2621-wl|hp 2621 w/labels:\ :is=\E&jA\r:ke=\E&jA:tc=hp2621-fl: hp2621-fl|2621-fl|hp 2621:\ :xo:xs@:\ :pb#19200:\ :bt=\Ei:cm=\E&a%r%dc%dY:dc=\EP:ip=:is=\E&j@\r:\ :ke=\E&j@:ks=\E&jB:me=\E&d@:se=\E&d@:so=\E&dD:\ :ta=\011:ue=\E&d@:us=\E&dD:tc=hp+pfk+cr:tc=hpgeneric: # To use 2621p printer, setenv TERM=2621p, PRINTER=2612p hp2621p|2621p|2621P|hp 2621 with printer:\ :pf=\E&p13C:po=\E&p11C:tc=hp2621: hp2621p-a|2621p-a|hp2621p with fn as arrows:\ :tc=hp+pfk+arrows:tc=hp2621p: # hp2621 with k45 keyboard hp2621-k45|hp2621k45|2621k45|k45|hp 2621 with 45 keyboard:\ :kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:\ :ks=\E&s1A:ku=\EA:tc=hp2621: # 2621 using all 48 lines of memory, only 24 visible at any time. hp2621-48|48 line 2621:\ :li#48:\ :cm=\E&a%r%dc%dR:cv=\E&a%dR:ho=\EH:tc=hp2621: # 2621 with no labels ever. Also prevents vi delays on escape. hp2621-nl|hp 2621 with no labels:\ :kd@:ke@:kh@:kl@:kr@:ks@:ku@:tc=hp2621-fl: # Needed for UCB ARPAVAX console, since lsi-11 expands tabs # (wrong). # hp2621-nt|hp 2621 w/no tabs:\ :ta@:tc=hp2621: # Hp 2624 B with 4 or 10 pages of memory. # # Some assumptions are made with this entry. These settings are # NOT set up by the initialization strings. # # Port Configuration # RecvPace=Xon/Xoff # XmitPace=Xon/Xoff # StripNulDel=Yes # # Terminal Configuration # InhHndShk=Yes # InhDC2=Yes # XmitFnctn(A)=No # InhEolWrp=No # # Note: the 2624 DOES have a true , believe it or not! # # The 2624 has an "error line" to which messages can be sent. # This is CLOSE to what is expected for a "status line". However, # after a message is sent to the "error line", the next carriage # return is EATEN and the "error line" is turned back off again! # So I guess we can't define , , , , , . # # This entry supports emacs (and any other program that uses raw # mode) at 4800 baud and less. I couldn't get the padding right # for 9.6. # # (hp2624: replaced NUL sequences in flash with mandatory pauses -- esr) hp2624|hp2624a|hp2624b|hp2624b-4p|2624-4p|2624|2624a|2624b|Hewlett Packard 2624 B:\ :da:db:\ :lm#96:\ :vb=\E&w13F\E&w12F\E&w13F\E&w12F:tc=hp+labels:tc=scrhp: # This hp2626 entry does not use any of the fancy windowing stuff # of the 2626. # # Indeed, terminfo does not yet handle such stuff. Since changing # any window clears memory, it is probably not possible to use # this for screen opt. # # ed is incredibly slow most of the time - I am guessing at the # exact padding. Since the terminal uses xoff/xon this is intended # only for cost computation, so that the terminal will prefer el # or even dl1 which is probably faster! # # \ED\EJ\EC hack for ed from Ed Bradford - apparently ed is only # extra slow on the last line of the window. # # The padding probably should be changed. # hp2626|hp2626a|hp2626p|2626|2626a|2626p|2626A|2626P|hp 2626:\ :da:db:\ :lm#0:pb#19200:\ :SF=\E&r%dD:SR=\E&r%dU:cd=\ED\EJ\EC:ip=:is=\E&j@\r:tc=hp+pfk+cr:tc=hp+labels:tc=scrhp: # This entry is for sysline. It allocates a 23 line window with # a 115 line workspace for regular use, and a 1 line window for # the status line. # # This assumes port 2 is being used. # Turn off horizontal line, Create ws #1 with 115 lines, # Create ws #2 with 1 line, Create window #1 lines 1-23, # Create window #2 lines 24-24, Attach cursor to workspace #1. # Note that this clears the tabs so it must be done by tset before # it sets the tabs. # hp2626-s|2626-s|hp 2626 using only 23 lines:\ :es:hs:\ :li#23:\ :fs=\E&d@\E&w7f2p1I\E&w4f1I:\ :i1=\E&q3t0{0H \E&w0f115n1I \E&w0f1n2I\n\E&w2f1i0d0u22l0S \E&w2f2i0d23u23l0S \E&w7f2p1I \r:\ :ts=\E&w7f2p2I\E&w4f2I\r\EK\E&a%p1%dC:tc=hp2626: # Force terminal back to 24 lines after being 23. hp2626-ns|2626-ns|hp 2626 using all 24 lines:\ :i1=\E&q3t0{0H \E&w0f118n1I \E&w0f1n2I\n\E&w2f1i0d0u23l0S \E&w3f2I \E&w7f2p1I \r:tc=hp2626: # Various entries useful for small windows on 2626. hp2626-12|2626-12|hewlett-packard 2626 12 lines:\ :li#12:tc=hp2626: hp2626-12x40|2626-12x40|hewlett-packard 2626 12 lines 40 columns:\ :co#40:li#12:tc=hp2626: hp2626-x40|2626-x40|hewlett-packard 2626 40 columns:\ :co#40:tc=hp2626: hp2626-12-s|2626-12-s|hewlett-packard 2626 11 lines plus status:\ :li#11:tc=hp2626-s: # # hp2627 color tubes from University of Wisconsin # hp2627a-rev|hp 2627 with reverse video colors:\ :cr=^M:do=^J:\ :is=\E&v0m1a0b0c1x1y1z1i0a0b1c1x1y1z0i0S\E&j@\r\E3\r:\ :kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:\ :ue=\E&v0S\E&d@:us=\E&dD\E&v1S:tc=hp2621-nl: hp2627a|2627|hp 2627 color terminal with no labels:\ :cr=^M:do=^J:\ :is=\E&v0m1a1b0c1i0a1b1c2i1a0b0c0i0S\E&j@\r\E3\r:\ :kb=^H:kd=^J:kl=^H:nw=^M^J:se=\E&v0S:sf=^J:so=\E&v2S:\ :ta=^I:ue=\E&v0S\E&d@:us=\E&dD\E&v1S:tc=hp2621-nl: hp2627c|hp 2627 color (cyan) terminal with no labels:\ :cr=^M:do=^J:\ :is=\E&v0m1a0b0c2i1a1b0c1i0a1b1c0i0S\E&j@\r\E3\r:\ :kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=hp2627a: # 2640a doesn't have the Y cursor addressing feature, and C is # memory relative instead of screen relative, as we need. # hp2640a|2640a|hp 2640a:\ :cm@:ke@:ks@:tc=hp2645: hp2640b|hp2644a|hp 264x series:\ :ke@:ks@:tc=hp2645: # This terminal should be used at 4800 baud or less. It needs padding for # plain characters at 9600, I guessed at an appropriate cr delay. It really # wants ^E/^F handshaking, but that doesn't work well even if you write # software to support it. hp2645|hp45|HP 2645 series:\ :pb#9600:\ :cr=\r:kA=\EL:kD=\EP:kE=\EK:kF=\ES:kI=\EQ:kL=\EM:\ :kM=\ER:kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kT=\E1:kd=\EB:\ :ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:\ :ku=\EA:mb=\E&dA:me=\E&d@:mh=\E&dH:mr=\E&dB:\ :..sa=\E&d%'@'%?%p1%t%'B'%|%;%?%p2%t%'D'%|%;%?%p3%t%'B'%|%;%?%p4%t%'A'%|%;%?%p5%t%'H'%|%;%?%p6%t%'B'%|%;%c:\ :us=\E&dD:tc=hpgeneric: # You should use this terminal at 4800 baud or less. hp2648|hp2648a|2648a|2648A|2648|HP 2648a graphics terminal:\ :cl=\EH\EJ:cm=\E&a%r%dc%dY:dc=\EP:ip=:tc=hp2645: # The HP 150 terminal is a fairly vanilla HP terminal, with the # clreol standout problem. It also has graphics capabilities and # a touch screen, which we don't describe here. hp150|hewlett packard Model 150:\ :tc=hp2622: # Hp 2382a terminals, "the little ones." They don't have any # alternate character set support and sending out ^N/^O will # leave the screen blank. hp2382a|hp2382|hewlett packard 2382a:\ :da:db:\ :lh#1:lm#48:\ :ac@:ae@:as@:me=\E&d@:\ :..pn=\E&f0a%p1%dk%p2%l%Pa%?%ga%t%ga%d%e1%;d0L%?%ga%!%t %;%p2%s:\ :..sa=\E&d%{0}%Pa%?%p4%t%{1}%ga%+%Pa%;%?%p1%p3%|%p6%|%t%{2}%ga%+%Pa%;%?%p2%p6%|%t%{4}%ga%+%Pa%;%?%p1%p5%|%t%{8}%ga%+%Pa%;%?%p7%t%?%ga%ts%ga%'@'%+%e%'S'%;%e%?%ga%t%ga%'@'%+%e%'@'%;%;%c:tc=hp+labels:tc=scrhp: hp2621-a|hp2621a-a|2621-a|hp2621 with fn as arrows:\ :tc=hp+pfk+arrows:tc=hp2621-fl: # newer hewlett packard terminals newhpkeyboard|generic entry for HP extended keyboard:\ :kA=\EL:kB=\Ei:kC=\EJ:kD=\EP:kE=\EK:kF=\ET:kH=\EF:\ :kI=\EQ:kL=\EM:kM=\ER:kN=\EU:kP=\EV:kR=\ES:kS=\EJ:\ :kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:\ :ks=\E&s1A:ku=\EA:tc=hp+pfk-cr: newhp|generic entry for new hewlett packard terminals:\ :am:bw:mi:xo:xs:\ :co#80:li#24:pb#4800:\ :ac=T1R!U2S"W3O#V4P$t5u6w7v8\072'9(LQKWlRkT5I3@2[MAJSmFjGdHQ;Y+Z*X\0724>q\\\054x.n/:\ :ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:cr=^M:\ :ct=\E3:dc=\EP:dl=\EM:do=^J:ei=\ER:i1=\E&jB:im=\EQ:\ :ip=:le=^H:mb=\E&dA:md=\E&dF:me=\E&d@\017:mh=\E&dH:\ :mk=\E&dS:mr=\E&dB:nd=\EC:nw=^M^J:\ :..pk=\E&f0a%p1%dk0d%p2%l%dL%p2%s:\ :..pl=\E&f1a%p1%dk0d%p2%l%dL%p2%s:\ :..px=\E&f2a%p1%dk0d%p2%l%dL%p2%s:r1=\Eg:\ :..sa=\E&d%{0}%Pa%?%p4%t%{1}%ga%+%Pa%;%?%p1%p3%|%p6%|%t%{2}%ga%+%Pa%;%?%p2%p6%|%t%{4}%ga%+%Pa%;%?%p1%p5%|%t%{8}%ga%+%Pa%;%?%p7%t%?%ga%ts%ga%'@'%+%e%'S'%;%e%?%ga%t%ga%'@'%+%e%'@'%;%;%c%?%p9%t\016%e\017%;:\ :se=\E&d@:sf=^J:so=\E&dJ:sr=\ET:st=\E1:ta=\011:\ :ue=\E&d@:up=\EA:us=\E&dD:tc=newhpkeyboard: memhp|memory relative addressing for new HP ttys:\ :vt#6:\ :CM=\E&a%p1%dr%p2%dC:DO=\E&a+%dR:LE=\E&a-%dC:\ :RI=\E&a+%dC:UP=\E&a-%dR:ch=\E&a%dC:cl=\EH\EJ:\ :cm=\E&a%dr%dC:cv=\E&a%dR:ho=\EH:ll=\E&a23R\r:tc=newhp: scrhp|screen relative addressing for new HP ttys:\ :CM=\E&a%p1%dr%p2%dC:DO=\E&a+%dR:LE=\E&a-%dC:\ :RI=\E&a+%dC:UP=\E&a-%dR:ch=\E&a%dC:cl=\E&a0c0Y\EJ:\ :cm=\E&a%dy%dC:cv=\E&a%dY:ho=\E&a0y0C:ll=\E&a0y0C\EA:tc=newhp: hp+labels|"standard" label info for new HP ttys:\ :Nl#8:lh#2:lw#8:\ :LO=\E&jB:\ :..pn=\E&f2a%p1%dk%p2%l%Pa%?%ga%t%ga%d%e1%;d0L%?%ga%!%t %;%p2%s: hp+printer|"standard" printer info for HP ttys:\ :ff=\E&p4u0C:pf=\E&p13C:po=\E&p11C:ps=\EH\E&p4dF: # The new hp2621b is kind of a cross between the old 2621 and the # new 262x series of machines. It has dip-switched options. # The firmware has a bug in it such that if you give it a null # length label, the following character is eaten! hp2621b|2621b|hp 2621b with old style keyboard:\ :Nl#8:lh#1:lm#48:lw#8:\ :LO=\E&jB:kF=\ET:kH=\EF:kR=\ES:kd=\EB:kh=\Eh:kl=\ED:\ :kr=\EC:ku=\EA:\ :..pn=\E&f0a%p1%dk%p2%l%Pa%?%ga%t%ga%d%e1%;d3L%?%ga%!%t%{32}%c%;%p2%s\E%'o'%p1%+%c\r:tc=hp2621: hp2621b-p|2621b-p|hp 2621b with printer:\ :tc=hp+printer:tc=hp2621b: # hp2621b - new 2621b with new extended keyboard # these are closer to the new 26xx series than the other 2621b hp2621b-kx|2621b-kx|hp 2621b with extended keyboard:\ :tc=newhpkeyboard:tc=hp2621b: hp2621b-kx-p|2621b-kx-p|hp 2621b with new keyboard & printer:\ :tc=hp+printer:tc=hp2621b-kx: # Some assumptions are made in the following entries. # These settings are NOT set up by the initialization strings. # # Port Configuration # RecvPace=Xon/Xoff XmitPace=Xon/Xoff StripNulDel=Yes # # Terminal Configuration # InhHndShk(G)=Yes InhDC2(H)=Yes # XmitFnctn(A)=No InhEolWrp=No # # # Hp 2622a & hp2623a display and graphics terminals # hp2622|hp2622a|2622|2622a|hp 2622:\ :da:db:\ :lm#0:pb#19200:\ :is=\E&dj@\r:tc=hp+pfk+cr:tc=hp+labels:tc=scrhp: # The 2623 is a 2622 with extra graphics hardware. hp2623|hp2623a|2623|2623a|hp 2623:\ :tc=hp2622: hp2624b-p|hp2624b-4p-p|hewlett packard 2624 B with printer:\ :tc=hp+printer:tc=hp2624: # The hewlett packard B can have an optional extra 6 pages of memory. hp2624-10p|hp2624a-10p|hp2624b-10p|2624-10p|2624a-10p|2624b-10p|hewlett packard 2624 B w/ 10 pages of memory:\ :lm#240:tc=hp2624: hp2624b-10p-p|hewlett packard 2624 B w/ extra memory & printer:\ :lm#240:tc=hp2624b-p: # Color manipulations for HP terminals hp+color|hp with colors:\ :cc:\ :Co#16:NC#17:pa#7:\ :..Ip=\E&v%?%p2%{1000}%=%t1%e.%p2%d%;a\n%?%p3%{1000}%=%t1%e.%p3%d%;b\n%?%p4%{1000}%=%t1%e.%p4%d%;c\n%?%p5%{1000}%=%t1%e.%p5%d%;x\n%?%p6%{1000}%=%t1%e.%p6%d%;y\n%?%p7%{1000}%=%t1%e.%p7%d%;z\n%p1%dI:\ :oc=\E&v0m1a1b1c0I\E&v1a1I\E&v1b2I\E&v1a1b3I\E&v1c4I\E&v1a1c5I\E&v1b1c6I\E&v1x1y7I:\ :op=\E&v0S:sp=\E&v%dS: # sets the screen to be 80 columns wide hp2397a|2397a|hp2397|2397|hewlett packard 2397A color terminal:\ :is=\E&w6f80X:tc=memhp:tc=hp+labels:tc=hp+color: # HP 700/44 Setup parameters: # Terminal Mode HP-PCterm # Inhibit Auto Wrap NO # Status Line Host Writable # PC Character Set YES # Twenty-Five Line Mode YES # XON/XOFF @128 or 64 (sc) # Keycode Mode NO or YES (sc) # Backspace Key BS or BS/DEL # # sets pcterm; autowrap; 25 lines; pc char set; prog DEL key; # \E\\? does not turn off keycode mode # sets alternate start/stop; keycode on hpansi|hp700|hewlett packard 700/44 in HP-PCterm mode:\ :am:eo:xn:xo:\ :co#80:li#25:\ :@7=\E[4~:RA=\E[?7l:S4=\E[>11h\EPO**x0/65;1/67\E\\:\ :S5=\E[>11l\EP1**x0/11;1/13\E[m\E\\:SA=\E[?7h:XF=g:\ :XN=e:\ :ac=k\277l\332m\300j\331n\305w\302q\304u\264t\303v\301x\263:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=:\ :ho=\E[H:ic=\E[@:im=:\ :is=\E[44"p\E[?7h\E[>10h\E[>12h\EP1;1|3/7F\E\\:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:k9=\E[26~:k;=\E[28~:\ :kB=\E[Z:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[1~:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:nd=\E[C:se=\E[m:\ :sf=^J:so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[?25h:vi=\E[?25l: # hp2392|2392|2393|239x series:\ :co#80:\ :bt=\Ei:cm=\E&a%dy%dC:cv=\E&a%dY:im=\EQ:k1=\Ep\r:\ :k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:\ :k7=\Ev\r:k8=\Ew\r:kF=\EU:kN=\Eu:kP=\Ev:kR=\EV:\ :kh=\Eh:ue=\E&d@:us=\E&dD:tc=hpsub: hpsub|hp terminals -- capability subset:\ :am:da:db:mi:xo:xs:\ :li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:\ :cr=^M:dc=\EP:dl=\EM:do=\EB:ei=\ER:\ :if=/usr/share/tabset/stdcrt:is=\E&s1A\E<\E&k0\\:kb=^H:\ :kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:\ :ku=\EA:le=^H:nd=\EC:se=\E&d@:sf=^J:so=\E&dB:ta=^I:\ :up=\EA: # hpex: # May be used for most 24 x 80 hp terminals, # but has no padding added, so may allow runover in some terminals at high # baud rates. Will not work for 2640a or 2640b terminals, 98x6 and 98x5 # terminal emulators or 98x6 consoles. # Adds xy-cursor addressing, vertical cursor addressing, home, # last line, and underline capabilities. # # (hpex: removed memory-lock capabilities ":ml=\El:mu=\Em:" -- esr) hpex|hp extended capabilites:\ :cm=\E&a%dy%dC:cr=^M:cv=\E&a%dY:do=^J:im=\EQ:kb=^H:\ :kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:ue=\E&d@:us=\E&dD:tc=hpsub: # HP 236 console # From: hp236|hp236 internal terminal emulator:\ :am:\ :co#80:li#24:\ :al=\EG:ce=\EK:cl=\EF:cm=\EE%+ %+ :dc=\EJ:dl=\EH:ei=:\ :ic=\EI:im=:le=^H:se=\ECI:so=\EBI:up=^K:ve=\EDE:\ :vs=\EDB: # This works on a hp300 console running Utah 4.3 BSD # From: Craig Leres hp300h|HP Catseye console:\ :am:da:db:mi:xs:\ :co#128:li#51:lm#0:sg#0:\ :al=\EL:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:ch=\E&a%dC:\ :cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:cr=^M:ct=\E3:\ :cv=\E&a%dY:dc=\EP:dl=\EM:do=\EB:ei=\ER:\ :if=/usr/share/tabset/stdcrt:im=\EQ:kb=^H:kd=\EB:\ :ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:ku=\EA:\ :le=^H:me=\E&d@:nd=\EC:se=\E&d@:sf=^J:so=\E&dB:ta=^I:\ :ue=\E&d@:up=\EA:us=\E&dD: # From: Greg Couch hp9837|hp98720|hp98721|HP 9000/300 workstations:\ :am:da:db:mi:xs:\ :co#128:it#8:li#46:lm#0:\ :al=\EL:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:ch=\E&a%dC:\ :cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:ct=\E3:cv=\E&a%dY:\ :dc=\EP:dl=\EM:do=\EB:ei=\ER:im=\EQ:is=\E&v0m1b0i&j@:\ :kA=\EL:kD=\EP:kE=\EK:kI=\E    ( 0 8 @ H P X ` h p x Q:kL=\EM:kN=\EU:kP=\EV:\ :kS=\EJ:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:\ :ks=\E&s1A:ku=\EA:le=^H:me=\E&d@:nd=\EC:se=\E&v0S:\ :sf=^J:so=\E&v5S:st=\E1:ta=^I:ue=\E&d@:up=\EA:\ :us=\E&dD: # From: Charles A. Finnell of MITRE , developed 07SEP90 hp98550|hp98550a|HP 9000 Series 300 color console:\ :am:da:db:mi:xs:\ :co#128:it#8:li#49:lm#0:\ :ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:\ :ch=\E&a%dC:cl=\EH\EJ:cm=\E&a%dy%dC:cr=^M:ct=\E3:\ :cv=\E&a%dY:dc=\EP:dl=\EM:do=^J:ei=\ER:\ :if=/usr/share/tabset/9837:im=\EQ:k1=\Ep:k2=\Eq:\ :k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:kA=\EL:\ :kC=\EJ:kD=\EP:kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:\ :kM=\ER:kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kT=\E1:ka=\E3:\ :kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:\ :ks=\E&s1A:kt=\E2:ku=\EA:le=^H:mb=\E&dA:md=\E&dJ:\ :me=\E&d@:mh=\E&dH:mk=\E&ds:mr=\E&dJ:nd=\EC:se=\E&d@:\ :sf=^J:so=\E&dJ:st=\E1:ta=^I:ue=\E&d@:up=\EA:\ :us=\E&dD:ve=\E*dQ:vi=\E*dR: # From: Victor Duchovni # (hp700-wy: removed obsolete ":nl=^J:" -- esr) hp700-wy|HP700/41 emulating wyse30:\ :am:bw:mi:ms:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=0.7*\EE:bt=\EI:cd=\EY:ce=10\ET:cl=^Z:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:cv=\E[%+ :dc=\EW:dl=\ER:\ :do=^V:ei=\Er:ho=^^:i1=\E~"\EC\Er\E(\EG0\003\E`9\E`1:\ :if=/usr/share/tabset/hp700-wy:im=\Eq:kB=\EI:kC=^Z:\ :kE=\ET:kI=\Eq:kM=\Er:kS=\EY:kT=\EI:kb=\177:kd=^V:\ :kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:nd=^L:\ :se=10\EG0:so=10\EG4:sr=\Ej:ta=\011\nhts=\E1:\ :ue=10\EG0:up=^K:us=10\EG8: hp70092|70092a|70092A|hp70092a|hp70092A|HP 700/92:\ :am:da:db:xs:\ :Nl#8:co#80:lh#2:li#24:lm#0:lw#8:\ :LF=\E&j@:LO=\E&jB:ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:\ :ce=\EK:ch=\E&a%dC:cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:\ :cr=^M:ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:do=\EB:ei=\ER:\ :im=\EQ:k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:\ :k7=\Ev:k8=\Ew:kA=\EL:kC=\EJ:kD=\EP:kE=\EK:kF=\ES:\ :kH=\EF:kI=\EQ:kL=\EM:kM=\ER:kN=\EU:kP=\EV:kR=\ET:\ :kS=\EJ:kT=\E1:ka=\E3:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:\ :kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:ku=\EA:le=^H:\ :mb=\E&dA:md=\E&dB:me=\E&d@:mh=\E&dH:mr=\E&dB:nd=\EC:\ :se=\E&d@:so=\E&dJ:sr=\ET:st=\E1:ta=^I:ue=\E&d@:\ :up=\EA:us=\E&dD: bobcat|sbobcat|HP 9000 model 300 console:\ :am:da:db:mi:xs:\ :co#128:it#8:li#47:sg#0:\ :al=10*\EL:bt=\Ei:cd=\EJ:ce=\EK:ch=6\E&a%dC:\ :cl=\EH\EJ:cm=6\E&a%dy%dC:cr=^M:cv=6\E&a%dY:dc=\EP:\ :dl=10*\EM:do=\EB:ei=\ER:im=\EQ:kb=^H:kd=\EB:\ :ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:ku=\EA:\ :le=^H:nd=\EC:nw=^M^J:se=\E&d@:sf=^J:so=\E&dB:ta=^I:\ :ue=\E&d@:up=\EA:us=\E&dD: gator-t|HP 9000 model 237 emulating extra-tall AAA:\ :li#94:tc=gator: gator|HP 9000 model 237 emulating AAA:\ :bw:km:mi:ul:\ :co#128:it#8:li#47:\ :AL=1*\E[%dL:DC=4\E[%dP:DL=1*\E[%dM:IC=4\E[%d@:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%i%d`:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=^J:ei=:ho=\E[H:ic=\E[@:im=:kb=^H:kd=^J:kl=^H:\ :le=^H:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:\ :rp=1*%.\E[%db:se=\E[m:so=\E[7m:ta=^I:ue=\E[m:up=\EM:\ :us=\E[4m: gator-52|HP 9000 model 237 emulating VT52:\ :co#128:li#47:tc=vt52: gator-52t|HP 9000 model 237 emulating extra-tall VT52:\ :li#94:tc=gator-52: #### Honeywell-Bull # # From: Michael Haardt 11 Jan 93 # # Honeywell Bull terminal. Its cursor and function keys send single # control characters and it has standout/underline glitch. Most programs # do not like these features/bugs. Visual bell is realized by flashing the # "keyboard locked" LED. dku7003-dumb|Honeywell Bull DKU 7003 dumb mode:\ :co#80:li#25:\ :cd=^_:ce=\E[K:cl=^]^_:cm=\E[%i%d;%dH:cr=^M:do=^K:\ :ho=^]:kb=^H:kd=^K:kh=^]:kl=^Y:kr=^X:ku=^Z:le=^Y:\ :nd=^X:nw=^M^J:sf=^J:ta=^I:up=^Z:vb=\E[2h\E[2l: dku7003|Honeywell Bull DKU 7003 all features described:\ :ms:\ :sg#1:ug#1:\ :mb=\E[5m:md=\E[7m:me=\E[m:mh=\E[2m:mr=\E[7m:se=\E[m:\ :so=\E[7m:ue=\E[m:us=\E[4m:tc=dku7003-dumb: #### Lear-Siegler (adm) # # These guys are long since out of the terminals business, but # in 1995 many current terminals still have an adm type as one of their # emulations (usually their stupidest, and usually labeled adm3, though # these `adm3' emulations normally have adm3a+ capabilities). # # WARNING: Some early ADM terminals (including the ADM3 and ADM5) are # reputed to have had the weird `feature' that sending them a ^G would trigger # a diagnostic dump to screen if one of the more obscure RS-232 pins # (variously reported as 22 or as `Ring Indicator') was being held high during # receipt of the ^G. If you have a real ADM and think you've run into this, # check it out with a breakout box and tell us if this rumor is correct! # A quick fix might be to drop back to a cheesy 4-wire cable. # adm1a|adm1|lsi adm1a:\ :am:\ :co#80:li#24:\ :bl=^G:cl=\E;:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:le=^H:\ :nd=^L:sf=^J:up=^K: adm2|lsi adm2:\ :am:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E;:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:\ :kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:sf=^J:\ :up=^K: # (adm3: removed obsolete ":ma=^K^P:" -- esr) adm3|lsi adm3:\ :am:\ :co#80:li#24:\ :bl=^G:cl=^Z:cr=^M:do=^J:le=^H:sf=^J: # The following ADM-3A switch settings are assumed for normal operation: # SPACE U/L_DISP CLR_SCRN 24_LINE # CUR_CTL LC_EN AUTO_NL FDX # Other switches may be set for operator convenience or communication # requirements. I recommend # DISABLE_KB_LOCK LOCAL_OFF 103 202_OFF # ETX_OFF EOT_OFF # Most of these terminals required an option ROM to support lower case display. # Open the case and look at the motherboard; if you see an open 24-pin DIP # socket, you may be out of luck. # # (adm3a: removed obsolete ":ma=^K^P:" -- esr) adm3a|lsi adm3a:\ :am:\ :co#80:li#24:\ :bl=^G:cl=\032:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:le=^H:\ :nd=^L:sf=^J:up=^K: adm3a+|adm3a plus:\ :kd=^J:kl=^H:kr=^L:ku=^K:tc=adm3a: # (adm5: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" & duplicate ":do=^J:" -- esr) adm5|lsi adm5:\ :sg#1:\ :bl=^G:cd=\EY:ce=\ET:cr=^M:do=^J:kb=^H:kh=^^:se=\EG:\ :so=\EG:tc=adm3a+: # From: # (adm11: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" -- esr) adm11|lsi adm11:\ :am:hs:\ :co#80:li#24:\ :bl=^G:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:do=^J:\ :ds=\Eh:fs=\E(\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:\ :le=^H:nd=^L:se=\E(:so=\E):ts=\EF\E):up=^K: # From: Andrew Scott Beals # Corrected by Olaf Siebert , 11 May 1995 # (adm12: removed obsolete ":kn:ma=j^Jk^P^K^Pl ^R^L^L :" -- esr) adm12|lsi adm12:\ :am:mi:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:is=\Eq:\ :k0=^A0\r:k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:\ :k5=^A5\r:k6=^A6\r:k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^J:\ :kl=^H:kr=^L:ku=^K:le=^H:mk=\EG1:nd=^L:se=\EG0:\ :so=\EG4:ue=\EG0:up=^K:us=\EG8: # (adm20: removed obsolete ":kn#7:" -- esr) adm20|lear siegler adm20:\ :am:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:\ :cm=\E=%i%r%+^_%+^_:cr=^M:dc=\EW:dl=\ER:ei=:ho=^^:\ :ic=\EQ:im=:k1=^A:k2=^B:k3=^W:k4=^D:k5=^E:k6=^X:\ :k7=^Z:le=^H:nd=^L:se=\E(:so=\E):ta=^I:up=^K: adm21|lear siegler adm21:\ :sg#1:ug#1:\ :al=30*\EE:bl=^G:cd=\EY:ce=\ET:cr=^M:dc=\EW:\ :dl=30*\ER:do=^J:ei=:ic=\EQ:im=:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:se=\EG0:sf=^J:so=\EG4:ue=\EG0:\ :us=\EG8:tc=adm3a: # (adm22: ":em=:" was an obvious typo for ":ei=:"; also, # removed obsolete ":kn#7:ma=j^Jk^P^K^Pl ^R^L^L :"; # removed bogus-looking \200 from before . -- esr) adm22|lsi adm22:\ :am:\ :co#80:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=:ho=^^:\ :ic=\EQ:im=:\ :is=\E%\014\014\014\016\003\200\003\002\003\002\200\200\200\200\200\200\200\200\200\200\200:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:\ :ku=^K:l1=F1:l2=F2:l3=F3:l4=F4:l5=F5:l6=F6:l7=F7:\ :le=^H:nd=^L:se=\E(:so=\E):ta=\Ei:up=^K: # ADM 31 DIP Switches # # This information comes from two versions of the manual for the # Lear-Siegler ADM 31. # # Main board: # rear of case # +-||||-------------------------------------+ # + S1S2 ||S + # + ||3 + # + + # + ||S + # + ||4 + # + + # + + # + + # + + # + + # +-+ +-+ # + + # + S5 S6 S7 + # + == == == + # +----------------------------------------------+ # front of case (keyboard) # # S1 - Data Rate - Modem # S2 - Data Rate - Printer # ------------------------ # Data Rate Setting # ------------------- # 50 0 0 0 0 # 75 1 0 0 0 # 110 0 1 0 0 # 134.5 1 1 0 0 # 150 0 0 1 0 # 300 1 0 1 0 # 600 0 1 1 0 # 1200 1 1 1 0 # 1800 0 0 0 1 # 2000 1 0 0 1 # 2400 0 1 0 1 # 3600 1 1 0 1 # 4800 0 0 1 1 # 7200 1 0 1 1 # 9600 0 1 1 1 # x 1 1 1 1 # # S3 - Interface/Printer/Attributes # --------------------------------- # Printer Busy Control # sw1 sw2 sw3 # --------------- # off off off Busy not active, CD disabled # off off on Busy not active, CD enabled # off on off Busy active on J5-20, CD disabled # on off off Busy active on J5-19, CD disabled - Factory Set. # on off on Busy active on J5-19, CD enabled # # sw4 Used in conjuction with S4 for comm interface control - Fact 0 # # sw5 Secondary Channel Control (Hardware implementation only) - Fact 0 # # sw6 ON enables printer BUSY active LOW - Factory Setting # OFF enables printer BUSY active HIGH - If set to this, ADM31 senses # # sw7 ON - steady cursor - Factory Setting # OFF - blinking cursor # # sw8 ON causes selected attribute character to be displayed # OFF causes SPACE to be displayed instead - Factory Setting # # S4 - Interface # -------------- # Modem Interface # S3 S4 S4 S4 S4 # sw4 sw1 sw2 sw3 sw4 # --------------------------- # OFF ON OFF ON OFF Enable RS-232C interface, Direct Connect and # Current Loop disabled - Factory Setting # ON ON OFF ON OFF Enable Current Loop interface, Direct Connect # disabled # OFF OFF ON OFF ON Enable Direct Connect interface, RS-232C and # Current Loop Disabled # # sw5 ON disables dot stretching mode - Factory Setting # OFF enables dot stretching mode # sw6 ON enables blanking function # OFF enables underline function - Factory Setting # sw7 ON causes NULLS to be displayed as NULLS # OFF causes NULLS to be displayed as SPACES - Factory Setting # # S5 - Word Structure # ------------------- # sw1 ON enables BREAK key - Factory Setting # OFF disables BREAK key # sw2 ON selects 50Hz monitor refresh rate # OFF selects 60Hz monitor refresh rate - Factory Setting # # Modem Port Selection # sw3 sw4 sw5 # --------------- # ON ON ON Selects 7 DATA bits, even parity, 2 STOP bits # OFF ON ON Selects 7 DATA bits, odd parity, 2 STOP bits # ON OFF ON Selects 7 DATA bits, even parity, 1 STOP bit - Factory Set. # OFF OFF ON Selects 7 DATA bits, odd parity, 1 STOP bit # ON ON OFF Selects 8 DATA bits, no parity, 2 STOP bits # OFF ON OFF Selects 8 DATA bits, no parity, 1 STOP bit # ON OFF OFF Selects 8 DATA bits, even parity, 1 STOP bit # OFF OFF OFF Selects 8 DATA bits, odd parity, 1 STOP bit # # sw6 ON sends bit 8 a 1 (mark) # OFF sends bit 8 as 0 (space) - Factory Setting # sw7 ON selects Block Mode # OFF selects Conversation Mode - Factory Setting # sw8 ON selects Full Duplex operation # OFF selects Half Duplex operation - Factory Setting # # S6 - Printer # ------------ # sw1, sw2, sw6, sw7 Reserved - Factory 0 # # Printer Port Selection # same as Modem above, bit 8 (when 8 DATA bits) is always = 0 # # sw8 ON enables Printer Port # OFF disables Printer Port - Factory Setting # # S7 - Polling Address # -------------------- # sw1-7 Establish ASCII character which designates terminal polling address # ON = logic 0 # OFF = logic 1 - Factory Setting # sw8 ON enables Polling Option # OFF disables Polling Option - Factory Setting # # # On some older ADM 31s, S4 does not exist, and S5-sw6 is not defined. # # If the adm31 gives you trouble with standout mode, check the DIP switch in # position 6, bank @c11, 25% from back end of the circuit board. Should be # OFF. If there is no such switch, you have an old adm31 and must use oadm31. # (adm31: removed obsolete ":ma=j^Jk^P^K^Pl ^R^L^L :" -- esr) adm31|lsi adm31:\ :am:mi:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:\ :is=\Eu\E0:k0=^A0\r:k1=^A1\r:k2=^A2\r:k3=^A3\r:\ :k4=^A4\r:k5=^A5\r:k6=^A6\r:k7=^A7\r:k8=^A8\r:\ :k9=^A9\r:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:\ :se=\EG0:sf=^J:so=\EG1:ue=\EG0:up=^K:us=\EG1: adm31-old|o31|old adm31:\ :so=\EG4:ue@:us@:tc=adm31: # ADM36 in native mode (not VT52 emulation mode) # Hmmm...this looks a lot like an incomplete and slightly botched description # of a vt100 emulator. Might be worth trying vt100 on this type and seeing # if it flies. Assuming there are any of these left alive... # (adm36: I added / based on the initialization string -- esr) adm36|lsi adm36:\ :am:mi:\ :co#80:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[1L:cd=\E[0J:ce=\E[0K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:dl=\E[1M:ei=\E[4l:\ :im=\E[4h:is=\E[6;?7h\E[4;20;?1;?3;?6;?4l\E(B\E)B\E>:\ :kd=\EB:kl=\ED:kr=\EC:ku=\E[A:le=^H:nd=\E[D:up=\E[A: # (adm42: removed obsolete ":ma=^K^P:" -- esr) adm42|lsi adm42:\ :am:\ :co#80:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E;:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=\Er:\ :im=\Eq:ip=:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:\ :nd=^L:pc=\177:se=\EG0:sf=^J:so=\EG4:ta=^I:up=^K:\ :vs=\EC\E3 \E3(: # The following termcap for the Lear Siegler ADM-42 leaves the # "system line" at the bottom of the screen blank (for those who # find it distracting otherwise) adm42-ns|lsi adm-42 with no system line:\ :al=\EE\EF \011:bt=\EI\EF \011:cd=\EY\EF \011:\ :ce=\ET\EF \011:cl=\E;\EF \011:cm=\E=%+ %+ \EF \011:\ :dc=\EW\EF \011:dl=\ER\EF \011:ei=\Er\EF \011:\ :im=\Eq\EF \011:tc=adm42: #### Prime # # Yes, Prime makes terminals. These entries were posted by Kevin J. Cummings # on 14 Dec 1992 and lightly edited by esr. pt100|pt200|wren|fenix|prime pt100/pt200:\ :am:bw:mi:ms:\ :co#80:it#8:li#24:\ :DC=\E[%dP:DL=\E[M:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:al=\E[L\E[t:bt=\E[Z:cd=\E[J\E[r:\ :ce=\E[K\E[t:cl=\E?:cm=\E0%+!%+!:cr=^M:dc=\E[P:\ :do=\ED:ei=\E[4l:ho=\E$B:im=\E[4h:kb=^H:kd=\E[B:\ :ke=\E[>13l:kh=\E$A:kl=\E[D:kr=\E[C:ks=\E[>13h:\ :ku=\E[A:le=^H:nd=\E[C:nw=^M^J:se=\E[m:sf=^J:\ :so=\E[2;7m:ta=^I:\ :ti=\E[>1l\E[>2l\E[>16l\E[4l\E[>9l\E[20l\E[>3l\E[>7h\E[>12l\E[1Q:\ :ue=\E[m:up=\EM:us=\E[4m:vb=\E$\E$P: pt100w|pt200w|wrenw|fenixw|prime pt100/pt200 in 132-column mode:\ :co#132:\ :cm=\E[%i%d;%dH:tc=pt100: pt250|Prime PT250:\ :so@:tc=pt100: pt250w|Prime PT250 in 132-column mode:\ :so@:tc=pt100w: #### Qume (qvt) # # Qume, Inc. # 3475-A North 1st Street # San Jose CA 95134 # Vox: (800)-457-4447 # Fax: (408)-473-1510 # Net: josed@techsupp.wyse.com (Jose D'Oliveira) # # Qume was bought by Wyse, but still (as of early 1995) has its own support # group and production division. # # Discontinued Qume models: # # The qvt101 and qvt102 listed here are long obsolete; so is the qvt101+ # built to replace them, and a qvt119+ which was a 101+ with available wide # mode (132 columns). There was a qvt103 which added vt100/vt131 emulations # and an ANSI-compatible qvt203 that replaced it. Qume started producing # ANSI-compatible terminals with the qvt323 and qvt61. # # Current Qume models (as of February 1995): # # All current Qume terminals have ANSI-compatible operation modes. # Qume is still producing the qvt62, which features emulations for other # popular lines such as ADDS, and dual-host capabilities. The qvt82 is # designed for use as a SCO ANSI terminal. The qvt70 is a color terminal # with many emulations including Wyse370, Wyse 325, etc. Their newest # model is the qvt520, which is vt420-compatible. # # There are some ancient printing Qume terminals under `Daisy Wheel Printers' qvt101|qvt108|qume qvt 101 and QVT 108:\ :sg#1:\ :se=\EG0:so=\EG4:tc=qvt101+: # This used to have =\E.2 but no or . The BSD termcap # file had =\EM4 \200\200\200. I've done the safe thing and yanked # both. The is from BSD, which also claimed bold=\E( and dim=\E). # What seems to be going on here is that this entry was designed so that # the normal highlight is bold and standout is dim plus something else # (reverse-video maybe? But then, are there two sequences?) qvt101+|qvt101p|qume qvt 101 PLUS product:\ :am:bw:hs:ul:\ :co#80:li#24:sg#0:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:\ :cm=\E=%+ %+ :cr=^M:ct=\E3:dc=\EW:dl=\ER:do=^J:\ :ds=\Eg\Ef\r:ei=:fs=^M:ho=^^:ic=\EQ:im=:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:kA=\EE:kB=\EI:\ :kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:mr=\EG4:nd=^L:pf=\EA:po=\E@:\ :se=\E(:sf=^J:so=\E0P\E):st=\E1:ta=^I:ts=\Eg\Ef:\ :ue=\EG0:up=^K:us=\EG8:vb=\Eb\Ed:ve=\E.4: qvt102|qume qvt 102:\ :ve=\E.:tc=qvt101: # (qvt103: added / based on init string -- esr) qvt103|qume qvt 103:\ :am:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :DO=\E[%dB:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:\ :kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: qvt103-w|qume qvt103 132 cols:\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=qvt103: qvt119+|qvt119p|qvt119|qume qvt 119 and 119PLUS terminals:\ :am:hs:mi:ms:\ :co#80:li#24:sg#0:\ :al=\EE:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E*1:\ :cm=\E=%+ %+ :cr=^M:ct=\E3:dc=\EW:dl=\ER:do=^J:\ :ds=\Eg\Ef\r:ei=\Er:fs=^M:ho=^^:im=\Eq:\ :is=\EDF\EC\EG0\Er\E(\E%EX:k0=^AI\r:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=^L:pf=\EA:po=\E@:se=\EG0:sf=^J:\ :so=\EG4:sr=\EJ:st=\E1:ta=^I:ts=\Eg\Ef:ue=\EG0:up=^K:\ :us=\EG8:vb=\En0\En1:ve=\E.4:vs=\E.2: qvt119+-25|qvt119p-25|QVT 119 PLUS with 25 data lines:\ :li#25:tc=qvt119+: qvt119+-w|qvt119p-w|qvt119-w|QVT 119 and 119 PLUS in 132 column mode:\ :co#132:\ :is=\EDF\EC\EG0\Er\E(\E%\EX\En4:tc=qvt119+: qvt119+-25-w|qvt119p-25-w|qvt119-25-w|QVT 119 and 119 PLUS 132 by 25:\ :li#25:tc=qvt119+: qvt203|qvt203+|qume qvt 203 Plus:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:ip=:\ :k0=\E[29~:k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:\ :k5=\E[21~:k6=\E[23~:k7=\E[24~:k8=\E[25~:k9=\E[28~:\ :sf=\n:tc=qvt103: qvt203-w|qvt203-w-am|qume qvt 203 PLUS in 132 cols (w/advanced video):\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=qvt203: # # Since a command is present for enabling 25 data lines, # a specific terminfo entry may be generated for the 203. # If one is desired for the QVT 119 PLUS then 25 lines must # be selected in the status line (setup line 9). # qvt203-25|QVT 203 PLUS with 25 by 80 column mode:\ :co#80:li#25:\ :is=\E[=40h\E[?3l:tc=qvt203: qvt203-25-w|QVT 203 PLUS with 25 by 132 columns:\ :co#132:li#25:\ :r2=\E[?3h\E[=40h:tc=qvt203: #### Televideo (tvi) # # TeleVideo # 550 East Brokaw Road # PO Box 49048 95161 # San Jose CA 95112 # Vox: (408)-954-8333 # Fax: (408)-954-0623 # # # There are some tvi terminals that require incredible amounts of padding and # some that don't. I'm assuming 912 and 920 are the old slow ones, # and 912b, 912c, 920b, 920c are the new ones that don't need padding. # # All of these terminals (912 to 970 and the tvipt) are discontinued. Newer # Televideo terminals are ANSI and PC-ANSI compatible. tvi803|televideo 803:\ :cl=\E*:tc=tvi950: # Vanilla tvi910 -- W. Gish 10/29/86 # Switch settings are: # # S1 1 2 3 4 # D D D D 9600 # D D D U 50 # D D U D 75 # D D U U 110 # D U D D 135 # D U D U 150 # D U U D 300 # D U U U 600 # U D D D 1200 # U D D U 1800 # U D U D 2400 # U D U U 3600 # U U D D 4800 # U U D U 7200 # U U U D 9600 # U U U U 19200 # # S1 5 6 7 8 # U D X D 7N1 (data bits, parity, stop bits) (X means ignored) # U D X U 7N2 # U U D D 7O1 # U U D U 7O2 # U U U D 7E1 # U U U U 7E2 # D D X D 8N1 # D D X U 8N2 # D U D D 8O1 # D U U U 8E2 # # S1 9 Autowrap # U on # D off # # S1 10 CR/LF # U do CR/LF when CR received # D do CR when CR received # # S2 1 Mode # U block # D conversational # # S2 2 Duplex # U half # D full # # S2 3 Hertz # U 50 # D 60 # # S2 4 Edit mode # U local # D duplex # # S2 5 Cursor type # U underline # D block # # S2 6 Cursor down key # U send ^J # D send ^V # # S2 7 Screen colour # U green on black # D black on green # # S2 8 DSR status (pin 6) # U disconnected # D connected # # S2 9 DCD status (pin 8) # U disconnected # D duplex # # S2 10 DTR status (pin 20) # U disconnected # D duplex # (tvi910: removed obsolete ":ma=^Kk^Ll^R^L:"; added , , , # , , , , from SCO entry -- esr) tvi910|televideo model 910:\ :am:ms:\ :co#80:it#8:li#24:sg#1:ug#1:\ :bl=^G:bt=\EI:cd=\EY:ce=\ET:ch=\E]%+ :cl=^Z:\ :cm=\E=%+ %+ :cr=^M:cv=\E[%+ :do=^J:ho=\E=\001\001:\ :if=/usr/share/tabset/stdcrt:k0=^AI\r:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=^L:se=\EG0:sf=^J:so=\EG4:ta=^I:\ :ue=\EG0:up=^K:us=\EG8: # From: Alan R. Rogers # as subsequently hacked over by someone at SCO # (tvi910+: removed obsolete ":ma=^K^P^L :" -- esr) # # Here are the 910+'s DIP switches (U = up, D = down, X = don't care): # # S1 1 2 3 4: # D D D D 9600 D D D U 50 D D U D 75 D D U U 110 # D U D D 135 D U D U 150 D U U D 300 D U U U 600 # U D D D 1200 U D D U 1800 U D U D 2400 U D U U 3600 # U U D D 4800 U U D U 7200 U U U D 9600 U U U U 19200 # # S1 5 6 7 8: # U D X D 7N1 U D X U 7N2 U U D D 7O1 U U D U 7O2 # U U U D 7E1 U U U U 7E2 D D X D 8N1 D D X U 8N2 # D U D D 8O1 D U U U 8E2 # # S1 9 Autowrap (U = on, D = off) # S1 10 CR/LF (U = CR/LF on CR received, D = CR on CR received) # S2 1 Mode (U = block, D = conversational) # S2 2 Duplex (U = half, D = full) # S2 3 Hertz (U = 50, D = 60) # S2 4 Edit mode (U = local, D = duplex) # S2 5 Cursor type (U = underline, D = block) # S2 6 Cursor down key (U = send ^J, D = send ^V) # S2 7 Screen colour (U = green on black, D = black on green) # S2 8 DSR status (pin 6) (U = disconnected, D = connected) # S2 9 DCD status (pin 8) (U = disconnected, D = connected) # S2 10 DTR status (pin 20) (U = disconnected, D = connected) # tvi910+|910+|televideo 910+:\ :al=\EE:dc=\EW:dl=\ER:ei=:ho=^^:ic=\EQ:im=:k0=^A@\r:\ :k1=^AA\r:k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:\ :k6=^AF\r:k7=^AG\r:k8=^AH\r:k9=^AI\r:ll=\E=7 :tc=tvi910: # (tvi912: removed obsolete ":ma=^K^P^L :" -- esr) tvi912|tvi914|tvi920|old televideo 912/914/920:\ :am:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EE:bl=^G:cd=\Ey:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:\ :ct=\E3:dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:k0=^AI\r:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:kd=^J:kl=^H:kr=^L:\ :ku=^K:le=^H:nd=^L:se=\Ek:sf=^J:so=\Ej:st=\E1:ta=^I:\ :ue=\Em:up=^K:us=\El: # the 912 has a key that's like shift: 8 xmits "^A8\r". # The 920 has this plus real function keys that xmit different things. # Terminfo makes you use the funct key on the 912 but the real keys on the 920. tvi912c|tvi912b|912c|912b|tvi|new televideo 912:\ :al=\EE:dl=\ER:tc=tvi912: # set to page 1 when entering curses application (\E-17 ) # reset to page 0 when exiting curses application (\E-07 ) tvi912-2p|tvi920-2p|912-2p|920-2p|tvi-2p|televideo w/2 pages:\ :te=\E-07 :ti=\E-17 :tc=tvi912: # We got some new tvi912c terminals that act really weird on the regular # termcap, so one of our gurus worked this up. Seems that cursor # addressing is broken. tvi912cc|tvi912 at cowell college:\ :cm@:tc=tvi912c: # Here are the switch settings for the TVI 920c: # # S1 (Line), and S3 (Printer) baud rates -- put one, and only one, switch down: # 2: 9600 3: 4800 4: 2400 5: 1200 # 6: 600 7: 300 8: 150 9: 75 # 10: 110 # # S2 UART/Terminal options: # Up Down # 1: Not used Not allowed # 2: Alternate character set Standard character set # 3: Full duplex Half duplex # 4: 50 Hz refresh 60 Hz refresh # 5: No parity Send parity # 6: 2 stop bits 1 stop bit # 7: 8 data bits 7 data bits # 8: Not used Not allowed on Rev E or lower # 9: Even parity Odd parity # 10: Steady cursor Blinking cursor # (On Rev E or lower, use W25 instead of switch 10.) # # S5 UART/Terminal options: # Open Closed # 1: P3-6 Not connected DSR received on P3-6 # 2: P3-8 Not connected DCD received on P3-8 # # 3 Open, 4 Open: P3-20 Not connected # 3 Open, 4 Closed: DTR on when terminal is on # 3 Closed, 4 Open: DTR is connected to RTS # 3 Closed, 4 Closed: Not allowed # # 5 Closed: HDX printer (hardware control) Rev. K with extension port off, # all data transmitted out of the modem port (P3) will also be # transmitted out of the printer port (P4). # # 6 Open, 7 Open: Not allowed # 6 Open, 7 Closed: 20ma current loop input # 6 Closed, 7 Open: RS232 input # 6 Closed, 7 Closed: Not allowed # # Jumper options: # If the jumper is installed, the effect will occur (the next time the terminal # is switched on). # # S4/W31: Enables automatic LF upon receipt of CR from # remote or keyboard. # S4/W32: Enables transmission of EOT at the end of Send. If not # installed, a carriage return is sent. # S4/W33: Disables automatic carriage return in column 80. # S4/W34: Selects Page Print Mode as initial condition. If not # installed, Extension Mode is selected. # tvi920b|tvi920c|new televideo 920:\ :al=\EE:dl=\ER:k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:\ :k9=^AH\r:tc=tvi912: # Televideo 921 and variants # From: Tim Theisen 22 Sept 1995 # (tvi921: removed :ko=bt: before translation, I see no backtab cap -- esr) tvi921|televideo model 921 with sysline same as page & real vi function:\ :am:hs:xn:xs:\ :co#80:li#24:sg#0:\ :ae=\E%:al=\EE:as=\E$:cd=\EY:ce=\ET:cl=^Z:\ :cm=3\E=%+ %+ :cr=^M:dc=\EW:dl=1*\ER:do=^V:\ :ds=\Ef\r\Eg:ei=:fs=\Eg:ho=^^:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:\ :is=\El\E"\EF1\E.3\017\EA\E<:kA=\EE:kC=^Z:kD=\EW:\ :kE=\ET:kI=\EQ:kL=1*\ER:kS=\EY:kb=^H:kd=^V:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=^L:nw=^M^J:se=\EG0:sf=^J:\ :so=\EG4:ta=^I:ts=\Ef\EG0:ue=\EG0:up=^K:us=\EG8:\ :ve=\E.3:vs=\E.2: # without the beeper # (tvi92B: removed :ko=bt: before translation, I see no backtab cap -- esr) tvi92B|televideo model 921 with sysline same as page & real vi function:\ :am:hs:xn:xs:\ :co#80:li#24:sg#0:\ :ae=\E%:al=\EE:as=\E$:cd=\EY:ce=\ET:cl=^Z:\ :cm=3\E=%+ %+ :cr=^M:dc=\EW:dl=1*\ER:do=^V:\ :ds=\Ef\r\Eg:ei=:fs=\Eg:ho=^^:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:\ :is=\El\E"\EF1\E.3\017\EA\E<:kA=\EE:kC=^Z:kD=\EW:\ :kE=\ET:kI=\EQ:kL=1*\ER:kS=\EY:kb=^H:kd=^V:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=^L:nw=^M^J:se=\EG0:sf=^J:\ :so=\EG4:ta=^I:ts=\Ef\EG0:ue=\EG0:up=^K:us=\EG8:\ :vb=\Eb\Ed:ve=\E.3:vs=\E.2: # (tvi92D: removed :ko=bt: before translation, I see no backtab cap -- esr) tvi92D|tvi92B with DTR instead of XON/XOFF & better padding:\ :al=2*\EE:dl=2*\ER:is=\El\E"\EF1\E.3\016\EA\E<:\ :kA=2*\EE:kL=2*\ER:tc=tvi92B: # (tvi924: This used to have =\Es0, =\031. I put the new strings # in from a BSD termcap file because it looks like they do something the # old ones skip -- esr) tvi924|televideo tvi924:\ :am:bw:hs:in:mi:ms:xn:xo:\ :co#80:it#8:li#24:sg#0:ws#80:\ :F1=^AK\r:F2=^AL\r:F3=^AM\r:F4=^AN\r:F5=^AO\r:al=\EE:\ :bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E*0:cm=\E=%+ %+ :\ :cr=^M:cs=\E_%+ %+ :ct=\E3:dc=\EW:dl=\ER:do=^V:\ :ds=\Es0\Ef\031:ei=:fs=\031\Es1:ho=^^:\ :i1=\017\E%\E'\E(\EDF\EC\EG0\EN0\Es0\Ev0:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:k0=^A@\r:k1=^AA\r:\ :k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:k6=^AF\r:\ :k7=^AG\r:k8=^AH\r:k9=^AI\r:k;=^AJ\r:kA=\EE:kC=\E*0:\ :kD=\EW:kE=\Et:kI=\EQ:kL=\ER:kS=\Ey:kb=^H:kd=^V:\ :kh=^^:kl=^H:kr=^L:ku=^K:l0=F1:l1=F2:l2=F3:l3=F4:\ :l4=F5:l5=F6:l6=F7:l7=F8:l8=F9:l9=F10:la=F11:le=^H:\ :mb=\EG2:me=\EG0:mk=\EG1:nd=^L:pk=\E|%+1%s\031:\ :se=\EG0:sf=^J:so=\EG4:sr=\Ej:st=\E1:ta=^I:ts=\Ef:\ :ue=\EG0:up=^K:us=\EG8:vb=\Eb\Ed:ve=\E.3:vi=\E.0:\ :vs=\E.1: # TVI925 DIP switches. In each of these, D = Down and U = Up, # # Here are the settings for the external (baud) switches (S1): # # Position Baud # 7 8 9 10 [Printer] # 1 2 3 4 [Main RS232] # ----------------------------------------------------- # D D D D 9600 # D D D U 50 # D D U D 75 # D D U U 110 # D U D D 135 # D U D U 150 # D U U D 300 # D U U U 600 # U D D D 1200 # U D D U 1800 # U D U D 2400 # U D U U 3600 # U U D D 4800 # U U D U 7200 # U U U D 9600 # U U U U 19200 # # # Settings for word length and stop-bits (S1) # # Position Description # 5 6 # --------------------------- # U - 7-bit word # D - 8-bit word # - U 2 stop bits # - D 1 stop bit # # # S2 (external) settings # # Position Up Dn Description # -------------------------------------------- # 1 X Local edit # X Duplex edit (transmit editing keys) # -------------------------------------------- # 2 X 912/920 emulation # X 925 # -------------------------------------------- # 3 X # 4 X No parity # 5 X # -------------------------------------------- # 3 X # 4 X Odd parity # 5 X # -------------------------------------------- # 3 X # 4 X Even parity # 5 X # -------------------------------------------- # 3 X # 4 X Mark parity # 5 X # -------------------------------------------- # 3 X # 4 X Space parity # 5 X # -------------------------------------------- # 6 X White on black display # X Black on white display # -------------------------------------------- # 7 X Half Duplex # 8 X # -------------------------------------------- # 7 X Full Duplex # 8 X # -------------------------------------------- # 7 X Block mode # 8 X # -------------------------------------------- # 9 X 50 Hz # X 60 Hz # -------------------------------------------- # 10 X CR/LF (Auto LF) # X CR only # # S3 (internal switch) settings: # # Position Up Dn Description # -------------------------------------------- # 1 X Keyclick off # X Keyclick on # -------------------------------------------- # 2 X English # 3 X # -------------------------------------------- # 2 X German # 3 X # -------------------------------------------- # 2 X French # 3 X # -------------------------------------------- # 2 X Spanish # 3 X # -------------------------------------------- # 4 X Blinking block cursor # 5 X # -------------------------------------------- # 4 X Blinking underline cursor # 5 X # -------------------------------------------- # 4 X Steady block cursor # 5 X # -------------------------------------------- # 4 X Steady underline cursor # 5 X # -------------------------------------------- # 6 X Screen blanking timer (ON) # X Screen blanking timer (OFF) # -------------------------------------------- # 7 X Page attributes # X Line attributes # -------------------------------------------- # 8 X DCD disconnected # X DCD connected # -------------------------------------------- # 9 X DSR disconnected # X DSR connected # -------------------------------------------- # 10 X DTR Disconnected # X DTR connected # -------------------------------------------- # # (tvi925: BSD has =\E*. I got and from there -- esr) tvi925|925|televideo 925:\ :am:bw:hs:ul:\ :co#80:li#24:sg#1:ug#1:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:\ :cm=\E=%+ %+ :cr=^M:ct=\E3:dc=\EW:dl=\ER:do=^V:\ :ds=\Eh:ei=:fs=^M\Eg:ho=^^:ic=\EQ:im=:\ :is=\El\E"\nkclr=\032:k0=^AI\r:k1=^A@\r:k2=^AA\r:\ :k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:k9=^AH\r:kA=\EE:kD=\EW:kE=\ET:kI=\EQ:\ :kL=\ER:kS=\EY:kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:\ :le=^H:nd=^L:se=\EG0:sf=^J:so=\EG4:sr=\Ej:st=\E1:\ :ta=^I:ts=\Eh\Ef:ue=\EG0:up=^K:us=\EG8:vb=\Eb\Ed:\ :ve=\E.4:vs=\E.2: # From: Todd Litwin 28 May 1993 # Originally Tim Curry, Univ. of Central Fla., 5/21/82 # for additional capabilities, # The following tvi descriptions from B:pjphar and virus!mike # is for all 950s. It sets the following attributes: # full duplex (\EDF) write protect off (\E() # conversation mode (\EC) graphics mode off (\E%) # white on black (\Ed) auto page flip off (\Ew) # turn off status line (\Eg) clear status line (\Ef\r) # normal video (\E0) monitor mode off (\EX or \Eu) # edit mode (\Er) load blank char to space (\Ee\040) # line edit mode (\EO) enable buffer control (^O) # protect mode off (\E\047) duplex edit keys (\El) # program unshifted send key to send line all (\E016) # program shifted send key to send line unprotected (\E004) # set the following to nulls: # field delimiter (\Ex0\200\200) # line delimiter (\Ex1\200\200) # start-protected field delimiter (\Ex2\200\200) # end-protected field delimiter (\Ex3\200\200) # set end of text delimiter to carriage return/null (\Ex4\r\200) # # TVI 950 Switch Setting Reference Charts # # TABLE 1: # # S1 1 2 3 4 5 6 7 8 9 10 # +-----------------------+-----+-----+-----------------------+ # | Computer Baud Rate |Data |Stop | Printer Baud Rate | # | |Bits |Bits | | # +------+-----------------------+-----+-----+-----------------------+ # | Up | See | 7 | 2 | See | # +------+-----------------------+-----+-----+-----------------------+ # | Down | TABLE 2 | 8 | 1 | TABLE 2 | # +------+-----------------------+-----+-----+-----------------------+ # # # S2 1 2 3 4 5 6 7 8 9 10 # +-----+-----+-----------------+-----+-----------+-----+-----+ # |Edit |Cursr| Parity |Video|Transmiss'n| Hz |Click| # +------+-----+-----+-----------------+-----+-----------+-----+-----+ # | Up | Dplx|Blink| See |GonBk| See | 60 | Off | # +------+-----+-----+-----------------+-----+-----------+-----+-----+ # | Down |Local|St'dy| TABLE 3 |BkonG| CHART | 50 | On | # +------+-----+-----+-----------------+-----+-----------+-----+-----+ # # TABLE 2: # # +-----------+-----+-----+-----+-----+-----------+ # | Display | 1 | 2 | 3 | 4 | Baud | # +-----------+-----+-----+-----+-----+ | # | Printer | 7 | 8 | 9 | 10 | Rate | # +-----------+-----+-----+-----+-----+-----------+ # | D | D | D | D | 9600 | # | U | D | D | D | 50 | # | D | U | D | D | 75 | # | U | U | D | D | 110 | # | D | D | U | D | 135 | # | U | D | U | D | 150 | # | D | U | U | D | 300 | # | U | U | U | D | 600 | # | D | D | D | U | 1200 | # | U | D | D | U | 1800 | # | D | U | D | U | 2400 | # | U | U | D | U | 3600 | # | D | D | U | U | 4800 | # | U | D | U | U | 7200 | # | D | U | U | U | 9600 | # | U | U | U | U | 19200 | # +-----+-----+-----+-----+-----------+ # # TABLE 3: # +-----+-----+-----+-----------+ # | 3 | 4 | 5 | Parity | # +-----+-----+-----+-----------+ # | X | X | D | None | # | D | D | U | Odd | # | D | U | U | Even | # | U | D | U | Mark | # | U | U | U | Space | # +-----+-----+-----+-----------+ # X = don't care # # CHART: # +-----+-----+-----------------+ # | 7 | 8 | Communication | # +-----+-----+-----------------+ # | D | D | Half Duplex | # | D | U | Full Duplex | # | U | D | Block | # | U | U | Local | # +-----+-----+-----------------+ # # (tvi950: early versions had obsolete ":ma=^Vj^Kk^Hh^Ll^^H:". # I also inserted and ; the :ko: string indicated that # should be present and all tvi native modes use the same string for this. # Finally, note that BSD has cud1=^V. -- esr) tvi950|950|televideo 950:\ :am:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:sg#1:ug#1:\ :ac=d\rc\014e\nb\011i\013:ae=^X:al=\EE:as=^U:bl=^G:\ :bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :cr=^M:\ :ct=\E3:dc=\EW:dl=\ER:do=^J:ds=\Eg\Ef\r:ei=\Er:fs=^M:\ :ho=^^:ic=\EQ:im=\Eq:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\Ef\r:\ :k0=^A0\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=\EE:\ :kB=\EI:kC=\E*:kD=\EW:kE=\Et:kI=\EQ:kL=\ER:kS=\Ey:\ :kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:\ :pf=\Ea:po=\E`:se=\EG0:sf=^J:so=\EG4:sr=\Ej:st=\E1:\ :ta=^I:ts=\Eg\Ef:ue=\EG0:up=^K:us=\EG8:vb=\Eb\Ed: # # is for 950 with two pages adds the following: # set 48 line page (\E\\2) # place cursor at page 0, line 24, column 1 (\E-07 ) # set local (no send) edit keys (\Ek) # # two page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 48 line page (\E\\2) # place cursor at 0,24,1 (\E-07 ) # set duplex (send) edit keys (\El) when entering vi # set local (no send) edit keys (\Ek) when exiting vi # tvi950-2p|950-2p|televideo950 w/2 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\\2\E-07 \011:\ :ke=\Ek:ks=\El:te=\E\\2\E-07 :ti=\E\\1\E-07 :tc=tvi950: # # is for 950 with four pages adds the following: # set 96 line page (\E\\3) # place cursor at page 0, line 24, column 1 (\E-07 ) # # four page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 96 line page (\E\\3) # place cursor at 0,24,1 (\E-07 ) # tvi950-4p|950-4p|televideo950 w/4 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\\3\E-07 \011:\ :ke=\Ek:ks=\El:te=\E\\3\E-07 :ti=\E\\1\E-07 :tc=tvi950: # # for reverse video 950 changes the following: # set reverse video (\Ed) # # set vb accordingly (\Ed ...delay... \Eb) # tvi950-rv|950-rv|televideo950 rev video:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200:\ :vb=\Ed\Eb:tc=tvi950: # tvi950-rv-2p uses the appropriate entries from 950-2p and 950-rv tvi950-rv-2p|950-rv-2p|televideo950 rev video w/2 pages:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\\2\E-07 :\ :ke=\Ek:ks=\El:te=\E\\2\E-07 :ti=\E\\1\E-07 :\ :vb=\Ed\Eb:tc=tvi950: # tvi950-rv uses the appropriate entries from 950-4p and 950-rv tvi950-rv-4p|950-rv-4p|televideo950 rev video w/4 pages:\ :is=\EDF\EC\Eb\EG0\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\\3\E-07 :\ :ke=\Ek:ks=\El:te=\E\\3\E-07 :ti=\E\\1\E-07 :\ :vb=\Ed\Eb:tc=tvi950: # From: Andreas Stolcke # (tvi955: removed obsolete ":ma:=^Vj^Kk^Hh^Ll^^H"; # removed incorrect (and overridden) ":do=^J:"; fixed broken continuations in # the :rs: string, inserted the implied by the termcap :ko: string. Note # the :ko: string had :cl: in it, which means that one of the original # =\E*, =\EY had to be wrong; set =\E* because that's what # the 950 has. Finally, corrected the string to match the 950 and what # ko implies -- esr) # If the BSD termcap file was right, =\E=%p1%{32}%+%c%p2%{32}%+%c would # also work. tvi955|televideo 955:\ :5i:ms@:\ :it#8:sg@:\ :RA=\E[=7l:RX=^N:SA=\E[=7h:SX=^O:\ :ac=0_`RjHkGlFmEnIoPqKsQtMuLvOwNxJ:ae=\E%:as=\E$:\ :cm=\E[%i%d;%dH:do=^V:\ :is=\E[=3l\EF1\Ed\EG0\E[=5l\E%\El:kM=\EQ:kN=\EK:\ :kP=\EJ:kT=\E1:ka=\E3:kt=\E2:mb=\EG2:me=\EG0\E[=5l:\ :mh=\E[=5h:mk=\EG1:mr=\EG4:ps=\EP:\ :r1=\EDF\EC\Eg\Er\EO\E'\E(\Ew\EX\Ee \017\E0P\E6\200\E0p\E4\200\Ef\r:\ :sf@:ve=\E.2:vi=\E.0:vs=\E.1:tc=tvi950: tvi955-w|955-w|televideo955 w/132 cols:\ :co#132:\ :is=\E[=3h\EF1\Ed\EG0\E[=5l\E%\El:tc=tvi955: # use half-intensity as normal mode, full intensity as tvi955-hb|955-hb|televideo955 half-bright:\ :is=\E[=3l\EF1\Ed\EG0\E[=5h\E%\El:md=\E[=5l:\ :me=\EG0\E[=5h:mh@:tc=tvi955: # From: Humberto Appleton , 880521 UT Austin # (tvi970: removed ":sg#0:" -- esr) tvi970|televideo 970:\ :da:db:mi:ms:\ :co#80:it#8:li#24:\ :ae=\E(B:al=\E[L:as=\E(B:bt=\E[Z:cd=\E[0J:ce=\E[0K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%df:dc=\E[P:dl=\E[M:do=\ED:\ :ds=\Eg\Ef\r:ei=\E[4l:im=\E[4h:\ :is=\E<\E[?21l\E[19h\E[1Q\E[10l\E[7l\E[H\E[2J:\ :k1=\E?a:k2=\E?b:k3=\E?c:k4=\E?d:k5=\E?e:k6=\E?f:\ :k7=\E?g:k8=\E?h:k9=\E?i:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:nd=\E[C:se=\E[m:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\EM:us=\E[4m:\ :vb=\E[5;m\E[0;m:vs=\E[1Q: # Works with vi and rogue. NOTE: Esc v sets autowrap on, Esc u sets 80 chars # per line (rather than 40), Esc K chooses the normal character set. Not sure # padding is needed, but adapted from the tvi920c termcap. The :so: and :us: # strings are klutzy, but at least use no screen space. # (tvipt: removed obsolete ":ma=^Kk^Ll^R^L:". I wish we knew . -- esr) # From: Gene Rochlin 9/19/84. tvipt|televideo personal terminal:\ :am:\ :co#80:li#24:\ :SA=\Ev:al=\EE:bt=\EI:ce=\ET:cl=^Z:cm=\E=%+ %+ :\ :dl=\ER:ho=^^:if=/usr/share/tabset/stdcrt:\ :is=\Ev\Eu\EK:kb=^H:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:\ :nd=^L:se=\EF:so=\EG1@A\EH:ue=\EF:up=^K:us=\EG1B@\EH: #### Visual (vi) # # vi50 is from University of Wisconsin # This is a provisional vi50 termcap entry. It was copied from vi500 # entry. Note especially the function. - are really l4-l6 in # disguise; - are really l1-l3. No highlighting enabled at present. vi50|visual 50:\ :am:ms:\ :co#80:it#8:li#24:\ :al=\EL:bt=4\Ez:cd=\Ek:ce=16\EK:cl=\Ev:cm=\EY%+ %+ :\ :cr=^M:dl=3*\EM:do=\EB:ho=\EH:k1=\EP:k2=\EQ:k3=\ER:\ :k4=\EV:k5=\EE:k6=\E]:k7=\EL:k8=\Ev:k9=\EM:kb=^H:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :nw=^M^J:sf=^J:ta=^I:up=\EA: # this one was BSD & SCO's vi50 vi50adm|visual 50 in adm3a mode:\ :am:ms:\ :co#80:it#8:li#24:\ :al=\EL:bl=^G:cd=\Ek:ce=\EK:cl=^Z:cm=\E=%+ %+ :cr=^M:\ :dl=\EM:do=^J:ho=\EH:kb=^H:kd=\EB:kh=\EH:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:nd=^L:se=\ET:sf=^J:so=\EU:ta=^I:\ :up=^K: # From: Jeff Siegal vi55|Visual 55:\ :am:mi:ms:\ :co#80:it#8:li#24:\ :al=\EL:cd=\EJ:ce=\EK:cl=\Ev:cm=\EY%+ %+ :\ :cs=\E_%+A%+A:dc=\Ew:dl=\EM:do=^J:ei=\Eb:ho=\EH:\ :im=\Ea:is=\Ev\E_AX\Eb\EW\E9P\ET:kb=^H:kd=\EB:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:nd=\EC:se=\ET:so=\EU:sr=\EI:\ :ta=^I:up=\EA: # The Visual 200 beeps when you type a character in insert mode. # This is a horribly obnoxious misfeature, and some of the entries # below try to get around the problem by ignoring the feature or # turning it off when inputting a character. They are said not to # work well at 300 baud. (You could always cut the wire to the bell!) # (vi200: this used to use ich1=\Ei\s\010\Ej but it's more effective to # use / directly -- esr) # From: Mon Nov 14 08:34:29 1983 vi200|vis200|visual 200 with function keys:\ :am:\ :co#80:it#8:li#24:\ :al=\EL:bl=^G:cd=\Ey:ce=\Ex:cl=\Ev:cm=\EY%+ %+ :\ :cr=^M:dc=\EO:dl=\EM:do=^J:ei=\Ej:ho=\EH:im=\Ei:\ :is=\E3\Eb\Ej\E\\\El\EG\Ec\Ek:k0=\EP:k1=\EQ:k2=\ER:\ :k3=\E :k4=\E!:k5=\E":k6=\E#:k7=\E$:k8=\E%:k9=\E&:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :se=\E3:sf=^J:so=\E4:sr=\EI:ta=^I:up=\EA:ve=\Ec:\ :vs=\Ed: # The older Visuals didn't come with function keys. This entry uses # and so that the keypad keys can be used as function keys. # If your version of vi doesn't support function keys you may want # to use vi200-f. vi200-f|visual|visual 200 no function keys:\ :is=\E3\Eb\Ej\E\\\El\EG\Ed\Ek:k0=\E?p:k1=\E?q:\ :k2=\E?r:k3=\E?s:k4=\E?t:k5=\E?u:k6=\E?v:k7=\E?w:\ :k8=\E?x:k9=\E?y:ke=\E>:ks=\E=:se@:so@:tc=vi200: vi200-rv|visual 200 reverse video:\ :se=\E3:so=\E4:sr@:ve@:vs@:tc=vi200: # the function keys are programmable but we don't reprogram them to their # default values with because programming them is very verbose. maybe # an initialization file should be made for the 300 and they could be stuck # in it. # (vi300: added / based on init string -- esr) vi300|visual 300 ansi x3.64:\ :am:bw:mi:xn:\ :co#80:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[7s\E[2;3;4;20;?5;?6l\E[12;?7h\E[1Q\E[0;1(D\E[8s:\ :k1=\E_A\E\\:k2=\E_B\E\\:k3=\E_C\E\\:k4=\E_D\E\\:\ :k5=\E_E\E\\:k6=\E_F\E\\:k7=\E_G\E\\:k8=\E_H\E\\:\ :k9=\E_I\E\\:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:nd=\E[C:se=\E[m:sf=^J:so=\E[1m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # some of the vi300s have older firmware that has the command # sequence for setting editing extent reversed. vi300-old|visual 300 with old firmware (set edit extent reversed):\ :is=\E[7s\E[2;3;4;20;?5;?6l\E[12;?7h\E[2Q\E[0;1(D\E[8s:tc=vi300: # Visual 500 prototype entry from University of Wisconsin. # The best place to look for the escape sequences is page A1-1 of the # Visual 500 manual. The initialization sequence given here may be # overkill, but it does leave out some of the initializations which can # be done with the menus in set-up mode. # The :xp: line below is so that emacs can understand the padding requirements # of this slow terminal. :xp: is 10 time the padding factor. # (vi500: removed unknown :xp#4: termcap -- esr) vi500|visual 500:\ :am:mi:ms:\ :co#80:it#8:li#33:\ :ae=^O:al=3*\EL\Ex:as=^N:bt=4\Ez:cd=3*\Ey:ce=16\Ex:\ :cl=6*\Ev:cm=\EY%+ %+ :cr=^M:cs=\E(%+ %+ :dc=3*\EO:\ :dl=3*\EM:do=\EB:ei=\Ej:ho=\EH:im=\Ei:\ :is=\E3\E\001\E\007\E\003\Ek\EG\Ed\EX\El\E>\Eb\E\\:\ :kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:\ :nd=\EC:nw=^M^J:se=\E^G:sf=^J:so=\E^H:ta=8\011:\ :ue=\E^C:up=\EA:us=\E^D: # The visual 550 is a visual 300 with tektronix graphics, # and with 33 lines. clear screen is modified here to # also clear the graphics. vi550|visual 550 ansi x3.64:\ :li#33:\ :cl=\030\E[H\E[2J:tc=vi300: vi603|visual603|visual 603:\ :hs:mi:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:\ :ds=\EP2;1~\E\\:ei=\E[4l:fs=\E\\:\ :i1=\E>\E[?3l\E[?4l\E[?7h\E[?8h\E[1;24r:im=\E[4h:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:ts=\EP2~:ue=\E[24m:\ :up=\E[A:us=\E[4m:tc=vt100: #### Wyse (wy) # # Wyse Technology # 3471 North First Street # San Jose, CA 95134 # Vox: (408)-473-1200 # Fax: (408) 473-1222 # # Wyse sales can be reached by phone at 1-800-GET-WYSE. Tech support is at # (800)-800-WYSE (option 5 gets you a human). # # All the following entries until (but not including) wy100q are direct from # Wyse technical support and represent their best knowledge as of January 1995. # I canceled the bel capacities in the vb entries. # I made two trivial syntax fixes in the wyse30 entry. # # Note: The wyse75, wyse85, and wyse99 have been discontinued. # Although the Wyse 30 can support more than one attribute # it requires magic cookies to do so. Many applications do not # function well with magic cookies. The following terminfo uses # the protect mode to support one attribute (dim) without cookies. # If more than one attribute is needed then the wy30-mc terminfo # should be used. # wy30|wyse30|Wyse 30:\ :5i:am:bw:hs:mi:ms:xo:\ :Nl#8:co#80:lh#1:li#24:lw#8:ma#1:ws#45:\ :#2=\E{:&3=\Er:@8=\E7:LF=\EA11:LO=\EA10:\ :ac=0wa_h[jukslrmqnxqzttuyv]wpxv:ae=\EH^C:al=\EE:\ :as=\EH^B:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:\ :ds=\EF\r:ei=\Er:fs=^M:ho=^^:im=\Eq:ip=:\ :is=\E'\E(\E^3\E`9\016\024:k1=^A@\r:k2=^AA\r:\ :k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:kA=\EE:kB=\EI:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:\ :kN=\EK:kP=\EJ:kS=\EY:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:\ :ku=^K:le=^H:ll=^^^K:me=\E(\EH\003:mh=\E`7\E):\ :mp=\E`7\E):nd=^L:nw=^M^J:pf=^T:pn=\Ez%+/%s\r:po=^X:\ :ps=\EP:px=\Ez%+?%s\177:\ :..sa=%?%p1%p5%p8%|%|%t\E`7\E)%e\E(%;%?%p9%t\EH\002%e\EH\003%;:\ :se=\E(:sf=\n:so=\E`7\E):sr=\Ej:st=\E1:ta=\011:\ :ts=\EF:up=^K:vb=\E`8\E`9:ve=\E`1:vi=\E`0: # # This terminal description uses the non-hidden attribute mode # (with magic cookie). # wy30-mc|wyse30-mc|wyse 30 with magic cookies:\ :ms@:\ :ma@:sg#1:ug#1:\ :ae=\EG0\EH\003:as=\EG0\EH\002:mb=\EG2:\ :me=\EG0\E(\EH\003:mh=\EGp:mk=\EG1:mp=\EG0\E):\ :mr=\EG4:\ :..sa=\EG%'0'%?%p2%p6%|%t%{8}%|%;%?%p1%p3%|%p6%|%t%{4}%|%;%?%p4%t%{2}%|%;%?%p1%p5%|%t%{64}%|%;%?%p7%t%{1}%|%;%c%?%p8%t\E)%e\E(%;%?%p9%t\EH\002%e\EH\003%;:\ :se=\EG0:so=\EG4:te=\EG0:ue=\EG0:us=\EG8:tc=wy30: # The mandatory pause used by does not work with # older versions of terminfo. If you see this effect then # unset xon and delete the / from the delay. # i.e. change $<100/> to $<100> wy30-vb|wyse30-vb|wyse 30 visible bell:\ :bl@:tc=wy30: # # The Wyse 50 can support one attribute (e.g. Dim, Inverse, # Normal) without magic cookies by using the protect mode. # The following description uses this feature, but when more # than one attribute is put on the screen at once, all attributes # will be changed to be the same as the last attribute given. # The Wyse 50 can support more attributes when used with magic # cookies. The wy50-mc terminal description uses magic cookies # to correctly handle multiple attributes on a screen. # wy50|wyse50|Wyse 50:\ :5i:am:bw:hs:mi:ms:xo:\ :Nl#8:co#80:lh#1:li#24:lw#8:ma#1:ws#45:\ :#2=\E{:%9=\EP:&3=\Er:@8=\E7:F1=^AJ\r:F2=^AK\r:\ :F3=^AL\r:F4=^AM\r:F5=^AN\r:F6=^AO\r:LF=\EA11:\ :LO=\EA10:ac=0wa_h[jukslrmqnxqzttuyv]wpxv:ae=\EH^C:\ :al=\EE:as=\EH^B:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:\ :ds=\EF\r:ei=\Er:fs=^M:ho=^^:i1=\E`\072\E`9:im=\Eq:\ :ip=:is=\016\024\E'\E(:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:\ :k9=^AH\r:k;=^AI\r:kA=\EE:kB=\EI:kD=\EW:kE=\ET:\ :kI=\EQ:kL=\ER:kN=\EK:kP=\EJ:kS=\EY:kb=^H:kd=^J:\ :kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:me=\E(\EH\003:\ :mh=\E`7\E):mp=\E`7\E):mr=\E`6\E):nd=^L:nw=^M^J:\ :pf=^T:pn=\Ez%+/%s\r:po=^X:ps=\EP:px=\Ez%+?%s\177:\ :..sa=%?%p1%p3%|%t\E`6\E)\n%e%p5%p8%|%t\E`7\E)%e\E(%;\n%?%p9%t\EH\002%e\EH\003%;:\ :se=\E(:sf=\n:so=\E`6\E):sr=\Ej:st=\E1:ta=^I:ts=\EF:\ :up=^K:vb=\E`8\E`9:ve=\E`1:vi=\E`0: # # This terminal description uses the non-hidden attribute mode # (with magic cookie). # # The mandatory pause used by flash does not work with some # older versions of terminfo. If you see this effect then # unset and delete the / from the delay. # i.e. change $<100/> to $<100> wy50-mc|wyse50-mc|wyse 50 with magic cookies:\ :ms@:\ :ma@:sg#1:ug#1:\ :ae=\EG0\EH\003:as=\EG0\EH\002:mb=\EG2:\ :me=\EG0\E(\EH\003:mh=\EGp:mk=\EG1:mp=\EG0\E):\ :mr=\EG4:\ :..sa=\EG%'0'%?%p2%p6%|%t%{8}%|%;%?%p1%p3%|%p6%|%t%{4}%|%;%?%p4%t%{2}%|%;%?%p1%p5%|%t%{64}%|%;%?%p7%t%{1}%|%;%c%?%p8%t\E)%e\E(%;%?%p9%t\EH\002%e\EH\003%;:\ :se=\EG0:so=\EGt:te=\EG0:ue=\EG0:us=\EG8:tc=wy50: wy50-vb|wyse50-vb|wyse 50 visible bell:\ :bl@:tc=wy50: wy50-w|wyse50-w|wyse 50 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:i1=\E`;\E`9:tc=wy50: wy50-wvb|wyse50-wvb|wyse 50 132-column visible bell:\ :bl@:tc=wy50-w: # # The Wyse 350 is a Wyse 50 with color. # Unfortunately this means that it has magic cookies. # The color attributes are designed to overlap the reverse, dim and # underline attributes. This is nice for monochrome applications # because you can make underline stuff green (or any other color) # but for true color applications it's not so hot because you cannot # mix color with reverse, dim or underline. # To further complicate things one of the attributes must be # black (either the foreground or the background). In reverse video # the background changes color with black letters. In normal video # the foreground changes colors on a black background. # This terminfo uses some of the more advanced features of curses # to display both color and blink. In the final analysis I am not # sure that the wy350 runs better with this terminfo than it does # with the wy50 terminfo (with user adjusted colors). # # The mandatory pause used by flash does not work with # older versions of terminfo. If you see this effect then # unset xon and delete the / from the delay. # i.e. change $<100/> to $<100> # # (untranslatable capabilities removed to fit entry within 1023 bytes) wy350|wyse350|Wyse 350:\ :5i:am:bw:hs:mi:xo:\ :Co#8:NC#55:Nl#8:co#80:lh#1:li#24:lw#8:pa#8:sg#1:\ :ug#1:ws#45:\ :#2=\E{:%9=\EP:&3=\Er:@8=\E7:F1=^AJ\r:F2=^AK\r:\ :F3=^AL\r:F4=^AM\r:F5=^AN\r:F6=^AO\r:LF=\EA11:\ :LO=\EA10:Sb= :ac=0wa_h[jukslrmqnxqzttuyv]wpxv:\ :ae=\EG0\EH\003:al=\EE:as=\EG0\EH\002:bl=^G:bt=\EI:\ :cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :cr=^M:ct=\E0:\ :dc=\EW:dl=\ER:do=^J:ds=\EF\r:ei=\Er:fs=^M:ho=^^:\ :i1=\E`\072\E`9:i2=\E%?:im=\Eq:ip=:is=\016\024\E'\E(:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:kA=\EE:\ :kB=\EI:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kN=\EK:kP=\EJ:\ :kS=\EY:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:\ :ll=^^^K:mb=\EG2:me=\EG0\E(\EH\003%{0}%PA%{0}%PC:\ :mh=\EGp:mk=\EG1:mp=\EG0\E):mr=\EG4:nd=^L:nw=^M^J:\ :oc=\E%?:op=\EG0:pf=^T:pn=\Ez%+/%s\r:po=^X:ps=\EP:\ :px=\Ez%+?%s\177:se=\EG0:sf=\n:so=\EG4:sr=\Ej:st=\E1:\ :ta=^I:ts=\EF:ue=\EG0:up=^K:us=\EG8:vb=\E`8\E`9:\ :ve=\E`1:vi=\E`0: wy350-vb|wyse350-vb|wyse 350 visible bell:\ :bl@:tc=wy350: wy350-w|wyse350-w|wyse 350 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:i1=\E`;\E`9:tc=wy350: wy350-wvb|wyse350-wvb|wyse 350 132-column visible bell:\ :bl@:tc=wy350-w: # # This terminfo description is untested. # wy100|wyse 100:\ :hs:mi:\ :co#80:li#24:sg#1:ug#1:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E;:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ds=\EA31:ei=\Er:fs=^M:\ :im=\Eq:is=\Eu\E0:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:kb=^H:\ :kd=^J:kh=\E{:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\EG0:\ :sf=^J:so=\EG4:ts=\EF:ue=\EG0:up=^K:us=\EG8: # # The Wyse 120/150 has most of the features of the Wyse 60. # This terminal does not need padding up to 9600 baud! # should be set but the clear screen fails when in # alt-charset mode. Try \EcE\s\s\E+\s if the screen is really clear # then set . # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy120|wyse120|wy150|wyse150|Wyse 120/150:\ :am:bw:hs:km:mi:ms:xo:\ :co#80:it#8:li#24:pb#9601:ws#45:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :cl=\E+:cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=^J:\ :ds=\EF\r:ei=\Er:fs=^M:ho=^^:i1=\EcB0\EcC1:\ :i2=\EwJ\Ew1:im=\Eq:ip=:\ :is=\Ed$\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:\ :kN=\EK:kP=\EJ:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:\ :le=^H:ll=^^^K:mb=\EG2:me=\E(\EH\003\EG0\EcD:mh=\EGp:\ :mr=\EG4:nd=^L:nw=\r\n:se=\EG0:sf=\n:so=\EGt:sr=\Ej:\ :st=\E1:ta=\011:te=\Ew1:ti=\Ew0:ts=\EF:ue=\EG0:up=^K:\ :us=\EG8:vb=\E`8\E`9:ve=\E`1:vi=\E`0: # wy120-w|wyse120-w|wy150-w|wyse150-w|wyse 120/150 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\E`;:tc=wy120: # wy120-25|wyse120-25|wy150-25|wyse150-25|wyse 120/150 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy120: # wy120-25-w|wyse120-25-w|wy150-25-w|wyse150-25-w|wyse 120/150 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy120-w: # wy120-vb|wyse120-vb|wy150-vb|wyse150-vb|Wyse 120/150 visible bell:\ :bl@:tc=wy120: # wy120-w-vb|wy120-wvb|wyse120-wvb|wy150-w-vb|wyse150-w-vb|Wyse 120/150 132-column visible bell:\ :bl@:tc=wy120-w: # # The Wyse 60 is like the Wyse 50 but with more padding. # The reset strings are slow and the pad times very depending # on other parameters such as font loading. I have tried # to follow the following outline: # # -> set personality # -> set number of columns # -> set number of lines # -> select the proper font # -> do the initialization # -> set up display memory (2 pages) # # The Wyse 60's that have vt100 emulation are slower than the # older Wyse 60's. This change happened mid-1987. # The capabilities effected are # # The meta key is only half right. This terminal will return the # high order bit set when you hit CTRL-function_key # # It may be useful to assign two function keys with the # values \E=(\s look at old data in page 1 # \E=W, look at bottom of page 1 # where \s is a space ( ). # # Note: # The Wyse 60 runs faster when the XON/XOFF # handshake is turned off. # # (wy60: we use \E{ rather than ^^ for home (both are documented) to avoid # a bug reported by Robert Dunn, -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy60|wyse60|Wyse 60:\ :am:bw:hs:km:mi:ms:\ :co#80:li#24:ws#45:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :cl=\E+:cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:\ :do=^J:ds=\EF\r:ei=\Er:fs=^M:ho=\E{:i1=\EcB0\EcC1:\ :i2=\EwJ\Ew1:im=\Eq:ip=:\ :is=\Ed$\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:\ :kN=\EK:kP=\EJ:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:\ :le=^H:ll=\E{^K:mb=\EG2:me=\E(\EH\003\EG0\EcD:\ :mh=\EGp:mr=\EG4:nd=^L:nw=\r\n:se=\EG0:sf=\n:so=\EGt:\ :sr=\Ej:st=\E1:ta=\011:te=\Ew1:ti=\Ew0:ts=\EF:\ :ue=\EG0:up=^K:us=\EG8:vb=\E`8\E`9:ve=\E`1:vi=\E`0: # wy60-w|wyse60-w|wyse 60 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\EeF\E`;:tc=wy60: # wy60-25|wyse60-25|wyse 60 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy60: wy60-25-w|wyse60-25-w|wyse 60 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy60-w: # wy60-42|wyse60-42|wyse 60 80-column 42-lines:\ :li#42:\ :al=\EE:cd=\Ey:cl=\E+:cm=\E=%+ %+ :dc=\EW:dl=\ER:\ :i1=\EcB2\EcC3:ip=:nw=\r\n:r3=\Ee*:sf=\n:sr=\Ej:tc=wy60: wy60-42-w|wyse60-42-w|wyse 60 132-column 42-lines:\ :Nl#16:co#132:lw#7:ws#97:\ :cd=\Ey:cl=\E+:cm=\Ea%i%dR%dC:dc=\EW:ho=\036:ip=:\ :nw=\r\n:r2=\EeF\E`;:tc=wy60-42: # wy60-43|wyse60-43|wyse 60 80-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy60-42: wy60-43-w|wyse60-43-w|wyse 60 132-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy60-42-w: # wy60-vb|wyse60-vb|Wyse 60 visible bell:\ :bl@:tc=wy60: wy60-w-vb|wy60-wvb|wyse60-wvb|Wyse 60 132-column visible bell:\ :bl@:tc=wy60-w: # The Wyse-99GT looks at lot like the Wyse 60 except that it # does not have the 42/43 line mode. In the Wyse-60 the "lines" # setup parameter controls the number of lines on the screen. # For the Wyse 99GT the "lines" setup parameter controls the # number of lines in a page. The screen can display 25 lines max. # The Wyse-99GT also has personalities for the VT220 and # Tektronix 4014. But this has no bearing on the native mode. # # (msgr) should be set but the clear screen fails when in # alt-charset mode. Try \EcE\s\s\E+\s if the screen is really clear # then set msgr, else use msgr@. # # u0 -> enter Tektronix mode # u1 -> exit Tektronix mode # wy99gt|wyse99gt|Wyse 99gt:\ :ms@:\ :al=\EE:cd=\Ey:ce=\Et:cl=\E+:dc=\EW:dl=\ER:i2=\Ew0:\ :ip=:nw@:r2=\E`\072:sf=\n:sr=\Ej:ta=\011:te=\Ew0:\ :ti=\Ew1:u0=\E~>\E8:u1=\E[42h:vb=\E`8\E`9:tc=wy60: # wy99gt-w|wyse99gt-w|wyse 99gt 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cd=\Ey:cl=\E+:cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\E`;:tc=wy99gt: # wy99gt-25|wyse99gt-25|wyse 99gt 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r2=\E`\072:r3=\EwG\Ee):tc=wy99gt: # wy99gt-25-w|wyse99gt-25-w|wyse 99gt 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r2=\E`;:tc=wy99gt-w: # wy99gt-vb|wyse99gt-vb|Wyse 99gt visible bell:\ :bl@:tc=wy99gt: # wy99gt-w-vb|wy99gt-wvb|wyse99gt-wvb|Wyse 99gt 132-column visible bell:\ :bl@:tc=wy99gt-w: # # The Wyse 160 is combination of the WY-60 and the WY-99gt. # The reset strings are slow and the pad times very depending # on other parameters such as font loading. I have tried # to follow the following outline: # # -> set personality # -> set number of columns # -> set number of lines # -> select the proper font # -> do the initialization # -> set up display memory (2 pages) # # The display memory may be used for either text or graphics. # When "Display Memory = Shared" the terminal will have more pages # but garbage may be left on the screen when you switch from # graphics to text. If "Display Memory = Unshared" then the # text area will be only one page long. # # (wy160: we use \E{ rather than ^^ for home (both are documented) to avoid # a bug reported by Robert Dunn, -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy160|wyse160|Wyse 160:\ :am:bw:hs:km:mi:ms:\ :co#80:li#24:ws#38:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :cl=\E+:cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:\ :do=^J:ds=\EF\r:ei=\Er:fs=^M:ho=\E{:i1=\EcB0\EcC1:\ :i2=\Ew0:im=\Eq:ip=:\ :is=\Ed$\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:\ :kN=\EK:kP=\EJ:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:\ :le=^H:ll=\E{^K:mb=\EG2:me=\E(\EH\003\EG0\EcD:\ :mh=\EGp:mr=\EG4:nd=^L:nw=\r\n:se=\EG0:sf=\n:so=\EGt:\ :sr=\Ej:st=\E1:ta=^I:te=\Ew0:ti=\Ew1:ts=\EF:ue=\EG0:\ :up=^K:us=\EG8:vb=\E`8\E`9:ve=\E`1:vi=\E`0: # wy160-w|wyse160-w|wyse 160 132-column:\ :Nl#16:co#132:lw#7:ws#90:\ :cm=\Ea%i%dR%dC:dc=\EW:r2=\EeF\E`;:tc=wy160: # wy160-25|wyse160-25|wyse 160 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy160: wy160-25-w|wyse160-25-w|wyse 160 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy160-w: # wy160-42|wyse160-42|wyse 160 80-column 42-lines:\ :li#42:\ :al=\EE:cd=\Ey:cl=\E+:dl=\ER:i1=\EcB2\EcC3:nw=\r\n:\ :r3=\Ee*:sf=\n:sr=\Ej:tc=wy160: wy160-42-w|wyse160-42-w|wyse 160 132-column 42-lines:\ :Nl#16:co#132:lw#7:ws#90:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\EeF\E`;:tc=wy160-42: # wy160-43|wyse160-43|wyse 160 80-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy160-42: wy160-43-w|wyse160-43-w|wyse 160 132-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy160-42-w: # wy160-vb|wyse160-vb|Wyse 160 visible bell:\ :bl@:tc=wy160: wy160-w-vb|wy160-wvb|wyse160-wvb|Wyse 160 132-column visible bell:\ :bl@:tc=wy160-w: # # The Wyse 75 is a vt100 lookalike without advanced video. # # The Wyse 75 can support one attribute (e.g. Dim, Inverse, # Underline) without magic cookies. The following description # uses this capability, but when more than one attribute is # put on the screen at once, all attributes will be changed # to be the same as the last attribute given. # The Wyse 75 can support more attributes when used with magic # cookies. The wy75-mc terminal description uses magic cookies # to correctly handle multiple attributes on a screen. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy75|wyse75|wyse 75:\ :am:hs:mi:ms:xn:xo:\ :co#80:li#24:ma#1:pb#1201:ws#78:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[>\\\054\001\001\E[>-\001\001:ec=\E[%dX:\ :ei=\E[4l:fs=^A:ho=\E[H:\ :i1=\E[2;4;20;30l\E[?1;10l\E[12h\E[?7;8;25h:i2=\E[m:\ :im=\E[4h:ip=:is=\E>\E(B\E)0\017:k1=\E[?5i:k2=\E[?3i:\ :k3=\E[2i:k4=\E[@:k5=\E[M:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kI=\E[@:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:ke=\E>:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[?1l\E[?7h\E=:ku=\E[A:le=^H:me=\E[m\017:\ :mh=\E[0t\E[2m:mr=\E[1t\E[7m:nd=\E[C:rc=\E8:sc=\E7:\ :se=\E[m:sf=\n:so=\E[1t\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[>\\\054\001:ue=\E[m:up=\E[A:us=\E[2t\E[4m:\ :vb=\E[30h\E\\\054\E[30l:ve=\E[?25h:vi=\E[?25l: # # This terminal description uses the non-hidden attribute mode # (with magic cookie). # wy75-mc|wyse75-mc|wyse 75 with magic cookies:\ :ms@:\ :ma@:sg#1:ug#1:\ :ae=\E[0p\017:as=\E[0p\016:i2=\E[m\E[p:mb=\E[2p:\ :me=\E[0p\017:mh=\E[1p:mk=\E[4p:mr=\E[16p:\ :..sa=\E[%{0}%?%p2%p6%|%t%{8}%|%;%?%p1%p3%|%p6%|%t%{16}%|%;%?%p4%t%{2}%|%;%?%p1%p5%|%t%{1}%|%;%?%p7%t%{4}%|%;%dp%?%p9%t\016%e\017%;:\ :se=\E[0p:so=\E[17p:ue=\E[0p:us=\E[8p:tc=wy75: wy75-vb|wyse75-vb|wyse 75 with visible bell:\ :pb@:\ :bl@:tc=wy75: wy75-w|wyse75-w|wyse 75 in 132 column mode:\ :co#132:ws#130:\ :r2=\E[35h\E[?3h:tc=wy75: wy75-wvb|wyse75-wvb|wyse 75 with visible bell 132 columns:\ :pb@:\ :bl@:tc=wy75-w: # # Wyse 85 emulating a vt220 7 bit mode. # 24 line screen with status line. # # The vt220 mode permits more function keys but it wipes out # the escape key. I strongly recommend that be set to # escape (esc). # The terminal may have to be set for 8 data bits and 2 stop # bits for the arrow keys to work. # The Wyse 85 runs faster with XON/XOFF enabled. Also the # and work best when XON/XOFF is set. and # leave trash on the screen when used without XON/XOFF. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy85|wyse85|wyse 85:\ :am:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[40l:ec=\E[%dX:ei=\E[4l:fs=\E[1;24r\E8:ho=\E[H:\ :i1=\E[62;1"p\E[?5W:i2=\E>\E(B\E)0\017\E[m:im=\E[4h:\ :ip=:is=\E[2;4;20;30l\E[?1;4;10;16l\E[12h\E[?7;8;25h:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\E[B:ke=\E>:kh=\E[26~:kl=\E[D:\ :kr=\E[C:ks=\E[?1l\E=:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :rc=\E8:sc=\E7:se=\E[m:sf=\n:so=\E[7m:sr=\EM:st=\EH:\ :ta=\011:ts=\E[40h\E7\E[25;%i%p1%dH:ue=\E[m:up=\E[A:\ :us=\E[4m:vb=\E[30h\E\\\054\E[30l:ve=\E[?25h:\ :vi=\E[?25l: # # Wyse 85 with visual bell. wy85-vb|wyse85-vb|wyse 85 with visible bell:\ :bl@:vb=\E[30h\E\\\054\E[30l:tc=wy85: # # Wyse 85 in 132-column mode. wy85-w|wyse85-w|wyse 85 in 132-column mode:\ :co#132:ws#132:\ :r2=\E[35h\E[?3h:tc=wy85: # # Wyse 85 in 132-column mode with visual bell. wy85-wvb|wyse85-wvb|wyse 85 with visible bell 132-columns:\ :bl@:tc=wy85-w: # # Wyse 185 emulating a vt320 7 bit mode. # # This terminal always displays 25 lines. These lines may be used # as 24 data lines and a terminal status line (top or bottom) or # 25 data lines. The 48 and 50 line modes change the page size # and not the number of lines on the screen. # # The Compose Character key can be used as a meta key if changed # by set-up. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy185|wyse185|wyse 185:\ :am:hs:km:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E7\E[99;0H\E[K\E8:ec=\E[%dX:ei=\E[4l:\ :fs=\E[1;24r\E8:ho=\E[H:i1=\E[?5W:\ :i2=\E>\E(B\E)0\017\E[m:im=\E[4h:ip=:\ :is=\E[2;4;20;30l\E[?1;4;10;16l\E[12h\E[?7;8;25h:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\E[B:ke=\E>:kh=\E[26~:kl=\E[D:\ :kr=\E[C:ks=\E[?1l\E=:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :rc=\E8:sc=\E7:se=\E[27m:sf=\n:so=\E[7m:sr=\EM:\ :st=\EH:ta=^I:te=\E[ R:ti=\E[ Q:ts=\E7\E[99;%i%p1%dH:\ :ue=\E[24m:up=\E[A:us=\E[4m:vb=\E[30h\E\\\054\E[30l:\ :ve=\E[34h\E[?25h:vi=\E[?25l:vs=\E[?25h\E[34l: # # Wyse 185 with 24 data lines and top status (terminal status) wy185-24|wyse185-24|wyse 185 with 24 data lines:\ :hs@:\ :ds@:fs@:r3=\E[?5l\E[47h\E[40l\E[1;24r:ts@:tc=wy185: # # Wyse 185 with visual bell. wy185-vb|wyse185-vb|wyse 185+flash:\ :bl@:tc=wy185: # # Wyse 185 in 132-column mode. wy185-w|wyse185-w|wyse 185 in 132-column mode:\ :co#132:ws#132:\ :DC=\E[%dP:IC=\E[%d@:dc=\E[P:ei=:im=:ip=:\ :r2=\E[35h\E[?3h:tc=wy185: # # Wyse 185 in 132-column mode with visual bell. wy185-wvb|wyse185-wvb|wyse 185+flash+132 cols:\ :bl@:tc=wy185-w: # wy325 terminfo entries # Done by Joe H. Davis 3-9-92 # lines 25 columns 80 # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy325|wyse325|Wyse epc:\ :am:bw:hs:mi:\ :co#80:li#24:pb#9601:ws#45:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :cl=\E+:cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:\ :do=^J:ds=\EF\r:ei=\Er:fs=^M:ho=^^:i1=\EcB0\EcC1:\ :i2=\Ew0:im=\Eq:ip=:\ :is=\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\Eq:\ :kN=\EK:kP=\EJ:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:\ :le=^H:ll=^^^K:mb=\EG2:me=\E(\EH\003\EG0\EcD:mh=\EGp:\ :mr=\EG4:nd=^L:se=\EG0:sf=\n:so=\EGt:sr=\Ej:st=\E1:\ :ta=^I:te=\Ew0:ti=\Ew1:ts=\EF:ue=\EG0:up=^K:us=\EG8:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0: # # lines 24 columns 80 vb # wy325-vb|wyse325-vb|wyse-325 with visual bell:\ :bl@:tc=wy325: # # lines 24 columns 132 # wy325-w|wyse325-w|wy325w-24|wyse-325 in wide mode:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\E`;:tc=wy325: # # lines 25 columns 80 # wy325-25|wyse325-25|wy325-80|wyse-325|wyse-325 25 lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325: # # lines 25 columns 132 # wy325-25w|wyse325-25w|wy325 132 columns:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325-w: # # lines 25 columns 132 vb # wy325-w-vb|wy325-wvb|wyse325-wvb|wyse-325 wide mode reverse video:\ :bl@:tc=wy325-w: # # lines 42 columns 80 # wy325-42|wyse325-42|wyse-325 42 lines:\ :Nl@:lh@:li#42:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325: # # lines 42 columns 132 # wy325-42w|wyse325-42w|wyse-325 42 lines wide mode:\ :Nl@:lh@:li#42:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325-w: # # lines 42 columns 132 vb # wy325-42w-vb|wy325-42wvb|wyse-325 42 lines wide mode visual bell:\ :bl@:tc=wy325-w: # # lines 43 columns 80 # wy325-43|wyse325-43|wyse-325 43 lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:tc=wy325: # # lines 43 columns 132 # wy325-43w|wyse325-43w|wyse-325 43 lines wide mode:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325-w: # # lines 43 columns 132 vb # wy325-43w-vb|wy325-43wvb|wyse-325 43 lines wide mode visual bell:\ :bl@:tc=wy325-w: # Wyse 370 -- 24 line screen with status line. # # The terminal may have to be set for 8 data bits and 2 stop # bits for the arrow keys to work. # # If you change keyboards the terminal will send different # escape sequences. # The following definition is for the basic terminal without # function keys. # # -> enter Tektronix 4010/4014 mode # -> exit Tektronix 4010/4014 mode # -> enter ASCII mode (from any ANSI mode) # -> exit ASCII mode (goto native ANSI mode) # -> enter Tek 4207 ANSI mode (from any ANSI mode) # -> exit Tek 4207 mode (goto native ANSI mode) # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy370-nk|wyse 370 without function keys:\ :am:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:\ :bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=^J:ds=\E[40l:ec=\E[%dX:ei=\E[4l:\ :fs=\E[1;24r\E8:ho=\E[H:i1=\E[90;1"p\E[?5W:\ :i2=\E>\017\E)0\E(B\E[63;0w\E[m:im=\E[4h:ip=:\ :is=\E[2;4;20;30;40l\E[?1;10;16l\E[12h\E[?7;8;25h:\ :ke=\E>:ks=\E[?1l\E=:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\n:so=\E[7m:sr=\EM:st=\EH:ta=\011:\ :te=\E[ R:ti=\E[ Q:ts=\E[40l\E[40h\E7\E[99;%i%p1%dH:\ :ue=\E[24m:up=\E[A:us=\E[4m:vb=\E[30h\E\\\054\E[30l:\ :ve=\E[34h\E[?25h:vi=\E[?25l:vs=\E[?25h\E[34l: # # Function key set for the ASCII (wy-50 compatible) keyboard # This is the default 370. # wy370|wyse370|wy370-101k|Wyse 370 with 101 key keyboard:\ :@8=\EOM:F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:\ :F5=\E[28~:F6=\E[29~:k1=\E[?4i:k2=\E[?3i:k3=\E[2i:\ :k4=\E[@:k5=\E[M:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:k;=\E[21~:kA=\EOP:kB=\E[Z:kD=\EOQ:kI=\EOP:\ :kL=\EOQ:kN=\E[U:kP=\E[V:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:tc=wy370-nk: # # Function key set for the VT-320 (and wy85) compatible keyboard # wy370-105k|Wyse 370 with 105 key keyboard:\ :%1=\E[28~:*6=\E[4~:@0=\E[1~:@8=\EOM:F1=\E[23~:\ :F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:F6=\E[29~:\ :F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:K1=\EOw:\ :K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\E[B:kh=\E[26~:kl=\E[D:kr=\E[C:\ :ku=\E[A:l1=PF1:l2=PF2:l3=PF3:l4=PF4:tc=wy370-nk: # # Function key set for the PC compatible keyboard # wy370-EPC|Wyse 370 with 102 key keyboard:\ :@7=\E[1~:@8=\EOM:F1=\E[23~:F2=\E[24~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[M:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kB=\E[Z:kI=\E[2~:\ :kN=\E[U:kP=\E[V:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:tc=wy370-nk: # # Wyse 370 with visual bell. wy370-vb|Wyse 370 with visible bell:\ :bl@:tc=wy370: # # Wyse 370 in 132-column mode. wy370-w|Wyse 370 in 132-column mode:\ :co#132:ws#132:\ :r2=\E[35h\E[?3h:tc=wy370: # # Wyse 370 in 132-column mode with visual bell. wy370-wvb|Wyse 370 with visible bell 132-columns:\ :vb=\E[30h\E\\\054\E[30l:tc=wy370-w: wy370-rv|Wyse 370 reverse video:\ :r3=\E[32h\E[?5h:tc=wy370: # # Wyse 99gt Tektronix 4010/4014 emulator, # wy99gt-tek|Wyse 99gt Tektronix 4010/4014 emulator:\ :am:os:\ :co#74:li#35:\ :bl=^G:cl=\E^L:\ :..cm=\035%{3040}%{89}%p1%*%-%Py\n%p2%{55}%*%Px\n%gy%{128}%/%{31}%&%{32}%+%c\n%gy%{3}%&%{4}%*%gx%{3}%&%+%{96}%+%c\n%gy%{004}%/%{31}%&%{96}%+%c\n%gx%{128}%/%{31}%&%{32}%+%c\n%gx%{004}%/%{31}%&%{64}%+%c\037:\ :cr=^M:do=^J:ff=^L:\ :hd=\036HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH\037:\ :ho=^]7`x @\037:\ :hu=\036DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\037:\ :is=\E8:le=^H:nd= :nw=^M^J:u0=\E~>\E8:u1=\E[42h:\ :up=^K: # # Wyse 160 Tektronix 4010/4014 emulator, # wy160-tek|Wyse 160 Tektronix 4010/4014 emulator:\ :..cm=\035%{3103}%{91}%p1%*%-%Py\n%p2%{55}%*%Px\n%gy%{128}%/%{31}%&%{32}%+%c\n%gy%{3}%&%{4}%*%gx%{3}%&%+%{96}%+%c\n%gy%{004}%/%{31}%&%{96}%+%c\n%gx%{128}%/%{31}%&%{32}%+%c\n%gx%{004}%/%{31}%&%{64}%+%c\037:\ :ho=^]8`g @\037:tc=wy99gt-tek: # # Wyse 370 Tektronix 4010/4014 emulator, # wy370-tek|Wyse 370 Tektronix 4010/4014 emulator:\ :am:os:\ :co#80:li#36:\ :bl=^G:cl=\E^L:\ :..cm=\035%{775}%{108}%p1%*%{5}%/%-%Py\n%p2%{64}%*%{4}%+%{5}%/%Px\n%gy%{32}%/%{31}%&%{32}%+%c\n%gy%{31}%&%{96}%+%c\n%gx%{32}%/%{31}%&%{32}%+%c\n%gx%{31}%&%{64}%+%c\037:\ :cr=^M:do=^J:ff=^L:\ :hd=\036HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH\037:\ :ho=^]8g @\037:\ :hu=\036DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\037:\ :is=\E8:kb=^H:kd=^J:kl=^H:kr=^I:ku=^K:le=^H:nd= :\ :nw=^M^J:u0=\E[?38h\E8:u1=\E[?38l\E)0:up=^K: # Vendor-supplied Wyse entries end here. # From: John Gilmore wyse-vp|wyse|Wyse 50 in ADDS Viewpoint emulation mode with "enhance" on:\ :am:\ :co#80:it#8:li#24:\ :al=\EM:bl=^G:cd=\Ek:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:\ :dc=\EW:dl=\El:do=^J:ei=\Er:ho=^A:\ :if=/usr/share/tabset/wyse-adds:im=\Eq:\ :is=\E`\072\E`9\017\Er:kb=^H:kd=^J:kh=^A:kl=^U:kr=^F:\ :ku=^Z:le=^H:ll=^A^Z:nd=^F:nw=^M^J:\ :r1=\E`\072\E`9\017\Er:se=^O:sf=^J:so=^N:ta=^I:ue=^O:\ :up=^Z:us=^N: wy75ap|wyse75ap|wy-75ap|wyse-75ap|Wyse WY-75 Applications and Cursor keypad:\ :is=\E[1;24r\E[?10;3l\E[?1;25h\E[4l\E[m\E(B\E=:kb=^H:\ :kd=\EOB:ke=10\E[?1l\E>:kh=\EOH:kl=\EOD:kr=\EOC:\ :ks=10\E[?1h\E=:ku=\EOA:tc=wy75: # From: Eric Freudenthal wy100q|Wyse 100 for Quotron:\ :co#80:li#24:sg#1:ug#1:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :\ :dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:\ :is=\E`\072\200\EC\EDF\E0\E'\E(\EA21:kd=^J:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=^L:se=\EG0:so=\EG4:sr=\Ej:\ :ue=\EG0:up=^K:us=\EG8: #### Kermit terminal emulations # # Obsolete Kermit versions may be listed in the section describing obsolete # non-ANSI terminal emulators later in the file. # # KERMIT standard all versions. # Straight ascii keyboard. :sr=\EI: not avail. many versions + bug prone in vi. # (kermit: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" -- esr) # From: greg small 9-25-84 kermit|standard kermit:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :ho=\EH:\ :is=K0 Standard Kermit 9-25-84\n:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=\EC:up=\EA: kermit-am|standard kermit plus auto-margin:\ :am:\ :is=K1 Standard Kermit plus Automatic Margins\n:tc=kermit: # IBMPC Kermit 1.2. # Bugs: , : do not work except at beginning of line! does # not work, but fake with :cl=\EH\EJ (since :cd=\EJ: works at beginning of # line). # From: greg small 8-30-84 pckermit|pckermit12|UCB IBMPC Kermit 1.2:\ :am:\ :li#25:\ :cd@:ce@:cl=\EH\EJ:\ :is=K2 UCB IBMPC Kermit 1.2 8-30-84\n:tc=kermit: # IBMPC Kermit 1.20 # Cannot use line 25, now acts funny like ansi special scrolling region. # Initialization must escape from that region by cursor position to line 24. # Cannot use character insert because 1.20 goes crazy if insert at col 80. # Does not use :am: because autowrap is lost when kermit dropped and restarted. # From: greg small 12-19-84 pckermit120|UCB IBMPC Kermit 1.20:\ :it#8:li#24:\ :al=\EL:dc=\EN:dl=\EM:do=\EB:ei@:im@:\ :is=\EO\Eq\EJ\EY7 K3 UCB IBMPC Kermit 1.20 12-19-84\n:\ :se=\Eq:so=\Ep:ta=^I:vs=\EO\Eq\EEK3:tc=kermit: # MS-DOS Kermit 2.27 for the IBMPC # Straight ascii keyboard. :sr=\EI: not avail. many versions + bug prone in vi. # Cannot use line 25, now acts funny like ansi special scrolling region. # Initialization must escape from that region by cursor position to line 24. # Does not use am: because autowrap is lost when kermit dropped and restarted. # Reverse video for standout like H19. # (msk227: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" -- esr) # From: greg small 3-17-85 msk227|mskermit227|MS-DOS Kermit 2.27 for the IBMPC:\ :am@:\ :co#80:it#8:li#24:\ :al=\EL:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :dc=\EN:\ :dl=\EM:do=\EB:ei=\EO:ho=\EH:im=\E@:\ :is=\EO\Eq\EG\Ew\EJ\EY7 K4 MS Kermit 2.27 for the IBMPC 3-17-85\n:\ :kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=\EC:rc=\Ek:\ :sc=\Ej:se=\Eq:so=\Ep:ta=^I:up=\EA:vs=\EO\Eq\EG\EwK4: # MS-DOS Kermit 2.27 with automatic margins # From: greg small 3-17-85 msk227am|mskermit227am|UCB MS-DOS Kermit 2.27 with automatic margins:\ :am:\ :is=\EO\Eq\EG\Ev\EJ\EY7 K5 MS Kermit 2.27 +automatic margins 3-17-85\n:\ :vs=\EO\Eq\EG\EvK5:tc=msk227: # MS-DOS Kermit 2.27 UCB 227.14 for the IBM PC # Automatic margins now default. Use ansi for highlights. # Define function keys. # (msk22714: removed obsolete ":kn#10:" -- esr) # From: greg small 3-17-85 msk22714|mskermit22714|UCB MS-DOS Kermit 2.27 UCB 227.14 IBM PC:\ :am:\ :is=\EO\Eq\EG\Ev\EJ\EY7 K6 MS Kermit 2.27 UCB 227.14 IBM PC 3-17-85\n:\ :k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:\ :k7=\E7:k8=\E8:k9=\E9:md=\E[1m:me=\E[m:mr=\E[7m:\ :se=\E[m:so=\E[1m:ue=\E[m:us=\E[4m:vs=\EO\Eq\EG\EvK6:tc=mskermit227: # This was designed for a VT320 emulator, but it is probably a good start # at support for the VT320 itself. # Please send changes with explanations to bug-gnu-emacs@prep.ai.mit.edu. # (vt320-k3: I added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt320-k3|MS-Kermit 3.00's vt320 emulation:\ :am:es:hs:km:mi:ms:xn:\ :co#80:it#8:li#49:pb#9600:vt#3:\ :AL=\E[%dL:CC=\E:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:\ :IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:SR=\E[%dL:UP=\E[%dA:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ds=\E[0$~:ec=\E[%dX:\ :ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E F\E[?1l\E[?7h\E[r\E[2$~:k0=\E[21~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:sc=\E7:\ :se=\E[27m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\r\E[K:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l\E[?5h\E[?5l\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: # From: Joseph Gil 13 Dec 1991 # (I removed a bogus boolean :mo: and added , , -- esr) vt320-k311|dec vt320 series as defined by kermit 3.11:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :al=3\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:\ :ei=\E[4l:fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:\ :l3=pf3:l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=^M\ED:r1=\E[?3l:rc=\E8:\ :rf=/usr/lib/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: ######## NON-ANSI TERMINAL EMULATIONS # #### Avatar # # These entries attempt to describe Avatar, a terminal emulation used with # MS-DOS bulletin-board systems. It was designed to give ANSI-like # capabilities, but with cheaper (shorter) control sequences. Messy design, # excessively dependent on PC idiosyncracies, but apparently rather popular # in the BBS world. # # No color support. Avatar doesn't fit either of the Tektronix or HP color # models that terminfo knows about. An Avatar color attribute is the # low 7 bits of the IBM-PC display-memory attribute. Bletch. # # I wrote these entries while looking at the Avatar spec. I don't have # the facilities to test them. Let me know if they work, or don't. # # From: Eric S. Raymond 1 Nov 1995 # (The ///// capabilities exist only to # tell ncurses that the corresponding highlights exist; it should use , # which is the only method that will actually work for multiple highlights.) avatar0|avatar terminal emulator level 0:\ :am:ms:ut:\ :co#80:it#8:li#25:\ :as=:ce=^V^G:cm=\026\010%.%.:cr=^M:do=^V^D:le=^V^E:\ :mb=^A^V\177:md=^V^A^P:me=^V^A^G:mk=^V^A\200:\ :mr=^A^Vp:nd=^V^F:r2=^L:rp=\031%.%d:\ :..sa=\026\001%{0}%?%p1%t%{112}%|%;%?%p2%t%{1}%|%;%?%p3%t%{112}%|%;%?%p4%t{128}%|%;%?%p6%t%{16}%|%;:\ :sf=^J:so=^A^Vp:up=^V^C:us=^V^A:tc=klone+acs: # From: Eric S. Raymond 1 Nov 1995 avatar0+|avatar terminal emulator level 0+:\ :dc=^V^N:ei=\026\n\200\200\200\200:im=^V^I:tc=avatar0: # From: Eric S. Raymond 1 Nov 1995 avatar|avatar1|avatar terminal emulator level 1:\ :RA=^V":SA=^V$:al=^V+:dl=^V-:ei=^V^P:ve=^V'^A:\ :vi=^V'^B:vs=^V^C:tc=avatar0+: ######## OLDER TERMINAL TYPES # # This section is devoted to older commercial terminal brands that are now # discontinued, but known to be still in use or represented by emulations. # #### AT&T (att, tty) # # This section also includes Teletype-branded VDTs. # # The AT&T/Teletype terminals group was sold to SunRiver Data Systems; for # details, see the header comment on the ADDS section. # # These are AT&T's official terminfo entries. All-caps aliases have been # removed. # att2300|sv80|AT&T 2300 Video Information Terminal 80 column mode:\ :am:eo:mi:ms:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[11r:\ :F2=\E[12r:F3=\E[13r:F4=\E[14r:F5=\E[15r:F6=\E[16r:\ :IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:\ :bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:\ :ho=\E[H:im=\E[4h:k1=\E[1r:k2=\E[2r:k3=\E[3r:\ :k4=\E[4r:k5=\E[5r:k6=\E[6r:k7=\E[7r:k8=\E[8r:\ :k9=\E[9r:k;=\E[10r:kA=\E[L:kB=\E[Z:kC=\E[J:kD=\E[P:\ :kI=\E[@:kL=\E[M:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:me=\E[m:mr=\E[7m:nd=\E[C:\ :pf=\E[4i:po=\E[5i:ps=\E[0i:se=\E[m:sf=^J:so=\E[7m:\ :ta=^I:up=\E[A: att2350|AT&T 2350 Video Information Terminal 80 column mode:\ :pf@:po@:ps@:tc=att2300: # Must setup RETURN KEY - CR, REC'VD LF - INDEX. # Seems upward compatible with vt100, plus ins/del line/char. # On sgr, the protection parameter is ignored. # No check is made to make sure that only 3 parameters are output. # standout= reverse + half-intensity = 3 | 5. # bold= reverse + underline = 2 | 3. # note that half-bright blinking doesn't look different from normal blinking. # NOTE:you must program the function keys first, label second! # (att4410: a BSD entry has been seen with the following capabilities: # =\E[?6l, =\EOc, =\EOd, =\EOe, =\EOg, # =\EOh, =\EOi, =\EOj, -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) att5410v1|att4410v1|tty5410v1|AT&T 4410/5410 80 columns - version 1:\ :am:hs:mi:ms:xo:\ :Nl#8:co#80:it#8:lh#2:li#24:lw#8:ws#80:\ :ac=``aaffhhggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~00++--\\\054\\\054..:\ :ae=^O:al=\E[L:as=^N:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:fs=\E8:ho=\E[H:\ :i1=\E[?3l\E)0:\ :i2=\E[1;03q f1 \EOP\E[2;03q f2 \EOQ\E[3;03q f3 \EOR\E[4;03q f4 \EOS\E[5;03q f5 \EOT\E[6;03q f6 \EOU\E[7;03q f7 \EOV\E[8;03q f8 \EOW:\ :ic=\E[@:im=:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOT:\ :k6=\EOU:k7=\EOV:k8=\EOW:kC=\E[2J:kH=\E[24;1H:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :ll=\E[24H:mb=\E[5m:md=\E[2;7m:me=\E[m\017:mh=\E[2m:\ :mk=\E[8m:mr=\E[7m:nd=\E[C:nw=^M^J:\ :r2=\Ec\E[?3l\E[2;0y:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EM:ta=^I:ts=\E7\E[25;%p1%{1}%+%dH:\ :ue=\E[m:up=\E[A:us=\E[4m: att4410v1-w|att5410v1-w|tty5410v1-w|AT&T 4410/5410 132 columns - version 1:\ :co#132:ws#132:\ :i1=\E[?3h\E)0:r2=\Ec\E[?3h\E[2;0y:tc=att5410v1: att4410|att5410|tty5410|AT&T 4410/5410 80 columns - version 2:\ :..px=\E[%p1%d;%p2%l%02dq f%p1%d %p2%s:tc=att5410v1: att5410-w|att4410-w|4410-w|tty5410-w|5410-w|AT&T 4410/5410 in 132 column mode:\ :co#132:ws#132:\ :i1=\E[?3h\E)0:r2=\Ec\E[?3h\E[2;0y:tc=att4410: # 5410 in terms of a vt100 # (v5410: added / based on init string -- esr) v5410|5410 in terms of a vt100:\ :am:mi:ms:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E(B\E)0:ei=:\ :ho=\E[H:ic=\E[@:im=:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:\ :k;=\EOx:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m\017:mr=\E[7m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # # Teletype Model 5420 -- A souped up 5410, with multiple windows, # even! the 5420 has three modes: scroll, window or page mode # this terminfo should work in scroll or window mode, but doesn't # take advantage of any of the differences between them. # # Has memory below (2 lines!) # 3 pages of memory (plus some spare) # The 5410 sequences for , , ,
, , , , # , would work for these, but these work in both scroll and window # mode... Unset insert character so insert mode works # sets 80 column mode, # escape sequence: # 1) turn off all fonts # 2) function keys off, keyboard lock off, control display off, # insert mode off, erasure mode off, # 3) full duplex, monitor mode off, send graphics off, nl on lf off # 4) reset origin mode # 5) set line wraparound # 6) exit erasure mode, positional attribute mode, and erasure extent mode # 7) clear margins # 8) program ENTER to transmit ^J, # We use \212 to program the ^J because a bare ^J will get translated by # UNIX into a CR/LF. The enter key is needed for AT&T uOMS. # 1 2 3 4 5 6 7 8 # set screen color to black, # No representation in terminfo for the delete word key: kdw1=\Ed # Key capabilities assume the power-up send sequence... # This is not strictly necessary, but it helps maximize # memory usefulness: =\Ez, # Alternate sgr0: =\E[m\EW^O, # Alternate sgr: =\E[%?%p1%t2;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p5%t;2%;%?%p7%t;8%;m%?%p8%t\EV%;%?%p9%t^N%e^O%;, # smkx programs the SYS PF keys to send a set sequence. # It also sets up labels f1, f2, ..., f8, and sends edit keys. # This string causes them to send the strings - # when pressed in SYS PF mode. # (att4415: I added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) att4415|tty5420|att5420|AT&T 4415/5420 80 cols:\ :db:mi:xo:\ :Nl#8:lh#2:lm#78:lw#8:ws#55:\ :@1=\Et:@7=\Ez:@8=\Eent:AL=\E[%dL:\ :CM=\E[%i%p1%d;%p2%dt:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:\ :IC=\E[%d@:LE=\E[%dD:LF=\E|:LO=\E~:RA=\E[?7l:\ :RI=\E[%dC:SA=\E[?7h:SF=\E[%dE:SR=\E[%dF:UP=\E[%dA:\ :bt=\E[Z:ch=\E[%+^AG:cl=\E[x\E[J:cm=\E[%i%d;%dx:\ :ct=\E[3g:cv=\E[%+^Ad:ec=\E[%ds\E[%dD:ei=\E[4l:\ :ho=\E[x:i1=\E[?3l:i2=\E[?5l:ic@:im=\E[4h:\ :is=\E[m\017\E[1;2;3;4;6l\E[12;13;14;20l\E[?6;97;99l\E[?7h\E[4i\Ex\E[21;1j\212:\ :k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:\ :k7=\EOi:k8=\EOj:kA=\E[L:kB=\E[Z:kD=\E[P:kE=\E[2K:\ :kF=\E[T:kH=\Eu:kI=\E[4h:kL=\E[M:kN=\E[U:kP=\E[V:\ :kR=\E[S:ke=\E[19;0j\E[21;1j\212:\ :ks=\E[19;1j\E[21;4j\Eent:l1=F1:l2=F2:l3=F3:l4=F4:\ :l5=F5:l6=F6:l7=F7:l8=F8:ll=\Ew:me=\E[m\017:mp=\EV:\ :pf=\E[?9i:po=\E[?4i:ps=\E[?2i:st=\EH:\ :ts=\E7\E[25;%p1%{8}%+%dH:vb=\E[?5h\E[?5l:\ :ve=\E[11;0j:vs=\E[11;1j:tc=att4410: att4415-w|tty5420-w|att5420-w|AT&T 4415/5420 132 cols:\ :co#132:lm#54:ws#97:\ :i1=\E[?3h:tc=att4415: att4415-rv|tty5420-rv|att5420-rv|AT&T 4415/5420 80 cols/rv:\ :i2=\E[?5h:vb=\E[?5l\E[?5h:tc=att4415: att4415-w-rv|tty5420-w-rv|att5420-w-rv|AT&T 4415/5420 132 cols/rv:\ :co#132:lm#54:ws#97:\ :i1=\E[?3h:i2=\E[?5h:vb=\E[?5l\E[?5h:tc=att4415: # Note that this mode permits programming USER PF KEYS and labels # However, when you program user pf labels you have to reselect # user pf keys to make them appear! att4415+nl|4415+nl|tty5420+nl|att5420+nl|generic AT&T 4415/5420 changes for not changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :..pn=\E[%p1%d;0;0;1q%p2%\072-16.16s:\ :..px=\E[%p1%d;%p2%l%02d;0;1q F%p1%d %p2%s: att4415-nl|4415-nl|tty5420-nl|att5420-nl|AT&T 4415/5420 without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:tc=att4415+nl:tc=att4415: att4415-rv-nl|tty5420-rv-nl|att5420-rv-nl|AT&T 4415/5420 reverse video without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:tc=att4415+nl:tc=att4415-rv: att4415-w-nl|tty5420-w-nl|att5420-w-nl|AT&T 4415/5420 132 cols without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:tc=att4415+nl:tc=att4415-w: att4415-w-rv-n|tty5420-w-rv-n|att5420-w-rv-n|AT&T 4415/5420 132 cols reverse without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:tc=att4415+nl:tc=att4415-w-rv: # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att5420_2|AT&T 5420 model 2 80 cols:\ :am:db:hs:mi:ms:xo:\ :co#80:it#8:li#24:lm#78:ws#55:\ :AL=\E[%dL:CM=\E[%i%p1%d;%p2%dt:DC=\E[%dP:DL=\E[%dM:\ :IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:SF=\E[%dE:SR=\E[%dF:\ :UP=\E[%dA:ae=^O:al=\E[L:as=^N:bt=\E[1Z:cd=\E[0J:\ :ce=\E[0K:cl=\EH\EJ:cm=\E[%i%d;%dH:cr=\EG:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[1B:\ :ec=\E[%ds\E[%dD:ei=:fs=\E8:ho=\E[H:\ :i1=\E[0;23r\Ex\Ey\E[2;0j\E[3;3j\E[4;0j\E[5;0j\E[6;0j\E[7;0j\E[8;0j\E[9;1j\E[10;0j\E[15;0j\E[16;1j\E[19;0j\E[20;1j\E[29;0j\E[1;24r:\ :ic=\E[@:im=:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:\ :k6=\EOh:k7=\EOi:k8=\EOj:kD=\E[P:kH=\Eu:kI=\E[4h:\ :kN=\E[U:kP=\E[V:kb=^H:kd=\E[B:ke=\E[19;0j:kh=\E[H:\ :kl=\E[D:kr=\E[C:ks=\E[19;1j:ku=\E[A:le=^H:ll=\Ew:\ :mb=\E[5m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[1C:\ :nw=^M^J:rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:\ :st=\EH:ta=^I:ts=\E7\E[25;%p1%{8}%+%dH:ue=\E[m:\ :us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[11;0j:vs=\E[11;1j: att5420_2-w|AT&T 5420 model 2 in 132 column mode:\ :co#132:\ :i1=\E[0;23r\Ex\Ey\E[2;0j\E[3;3j\E[4;0j\E[5;1j\E[6;0j\E[7;0j\E[8;0j\E[9;1j\E[10;0j\E[15;0j\E[16;1j\E[19;0j\E[20;1j\E[29;0j\E[1;24r:tc=att5420_2: att4418|att5418|AT&T 5418 80 cols:\ :am:xo:\ :co#80:li#24:\ :@8=\E[:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:\ :F1=\E[n:F2=\E[o:F3=\E[H:F4=\E[I:F5=\E[J:F8=\E[K:\ :F9=\E[L:FA=\E[E:FB=\E[_:FC=\E[M:FD=\E[N:FE=\E[O:\ :IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:\ :al=\E[1L:as=^N:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[1P:dl=\E[M:do=\E[B:ei=:\ :ho=\E[H:i1=\E[?3l:ic=\E[1@:im=:is=\E)0\E?6l\E?5l:\ :k1=\E[h:k2=\E[i:k3=\E[j:k6=\E[k:k7=\E[l:k8=\E[f:\ :k9=\E[w:k;=\E[m:kC=\E[%:kd=\EU:kh=\Ec:kl=\E@:kr=\EA:\ :ku=\ES:le=\E[D:mb=\E[5m:me=\E[m\017:mh=\E[2m:\ :mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:ue=\E[m:up=\E[A:us=\E[4m: att4418-w|att5418-w|AT&T 5418 132 cols:\ :co#132:\ :i1=\E[?3h:tc=att5418: att4420|tty4420|teletype 4420:\ :da:db:eo:ms:ul:xo:\ :co#80:li#24:lm#72:\ :al=\EL:bl=^G:cd=\EJ:ce=\Ez:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=\EG:dc=\EP:dl=\EM:dm@:do=\EB:ed@:ho=\EH:k0=\EU:\ :k3=\E@:kA=\EL:kB=\EO:kC=\EJ:kD=\EP:kF=\ES:kI=\E^:\ :kL=\EM:kR=\ET:kd=\EB:kh=\EH:kl=^H:kr=\EC:ku=\EA:\ :l0=segment advance:l3=cursor tab:le=\ED:nd=\EC:\ :se=\E~:sf=\EH\EM\EY7 :so=\E}:ue=\EZ:up=\EA:us=\E\\: # The following is a termcap entry for the Teletype 4424 # asynchronous keyboard-display terminal. It supports # the vi editor. The terminal must be "set up" as follows, # # HIGHLIGHT DEFINITION 3-TONE # DISPLAY FUNCTION GROUP III # # The second entry below provides limited (a la adm3a) # operation under GROUP II. # # This must be used with DISPLAY FUNCTION GROUP I or III # and HIGHLIGHT DEFINITION 3-TONE # The terminal has either bold or blink, depending on options # att4424|tty4424|teletype 4424:\ :am:xo:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\EL:\ :as=\E(0:bl=^G:bt=\EO:cd=\EJ:ce=\Ez:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\EF:dc=\EP:\ :dl=\EM:do=\EB:ei=:ho=\E[H:ic=\E^:im=:\ :is=\E[20l\E[?7h:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kC=\EJ:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\E3:md=\E3:me=\EX\E~\EZ\E4\E(B:\ :mh=\EW:mr=\E}:nd=\EC:nw=\EE:\ :..sa=\E[%?%p1%t7%;%?%p2%t;4%;%?%p3%t;7%;%?%p6%t;1%;%?%p6%p4%|%t;5%;%?%p5%t;0%;m:\ :se=\E~:sf=^J:so=\E}:sr=\ET:st=\EH:ta=^I:ti=\E[1m:\ :ue=\EZ:up=\EA:us=\E\\: att4424-1|tty4424-1|teletype 4424 in display function group I:\ :kC@:kd=\EB:kh@:kl=\ED:kr=\EC:ku=\EA:tc=att4424: # This entry is not one of AT&T's official ones, it was translated from the # 4.4BSD termcap file. The highlight strings are different from att4424. # I have no idea why this is -- older firmware version, maybe? # The following two lines are the comment originally attached to the entry: # This entry appears to avoid the top line - I have no idea why. # From: jwb Wed Mar 31 13:25:09 1982 remote from ihuxp att4424m|tty4424m|teletype 4424M:\ :am:da:db:mi:\ :co#80:it#8:li#23:\ :al=\EL:bl=^G:ce=\E[K:cl=\E[2;H\E[J:\ :cm=\E[%i%2;%2H\E[B:cr=^M:dc=\EP:dl=\EM:do=^J:ei=:\ :ic=\E^:im=:ip=2:is=\E[m\E[2;24r:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:nd=\E[C:nw=^M^J:se=\E[m:sf=^J:\ :so=\E[7m:sr=\ET:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # The Teletype 5425 is really version 2 of the Teletype 5420. It # is quite similar, except for some minor differences. No page # mode, for example, so all of the sequences used above have # to change back to what's being used for the 5410. Many of the # option settings have changed their numbering as well. # # This has been tested on a preliminary model. # # (att5425: added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att5425|tty5425|att4425|AT&T 4425/5425:\ :am:da:db:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:lm#78:ws#55:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dE:SR=\E[%dF:UP=\E[%dA:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%ds\E[%dD:\ :ei=\E[4l:fs=\E8:ho=\E[H:i1=\E<\E[?3l:i2=\E[?5l:\ :im=\E[4h:\ :is=\E[m\017\E[1;2;3;4;6l\E[12;13;14;20l\E[?6;97;99l\E[?7h\E[4i\Ex\E[25;1j\212:\ :k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:\ :k7=\EOi:k8=\EOj:kD=\E[P:kI=\E[4h:kb=^H:kd=\E[B:\ :ke=\E[21;0j\E[25;1j\212:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[21;1j\E[25;4j\Eent\E~:ku=\E[A:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[2;7m:me=\E[m\017:mh=\E[2m:mr=\E[7m:\ :nd=\E[C:nw=^M^J:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E7\E[25;%p1%{8}%+%dH:ue=\E[m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[12;0j:vs=\E[12;1j: att5425-nl|tty5425-nl|att4425-nl|AT&T 4425/5425 80 columns no labels:\ :ks=\E[21;1j\E[25;4j\Eent:tc=att4425: att5425-w|att4425-w|tty5425-w|teletype 4425/5425 in 132 column mode:\ :co#132:lm#54:ws#97:\ :i1=\E[?3h:tc=tty5425: # (att4426: his had bogus capabilities: :ri=\EM:, :ri=\E[1U:. # I also added / -- esr) att4426|tty4426|teletype 4426S:\ :am:da:db:xo:\ :co#80:li#24:lm#48:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:ae=\E(B:al=\EL:as=\E(0:bl=^G:\ :cd=\E[J:ce=\E[0K:ch=\E[%dG:\ :cl=\E[H\E[2J\E[1U\E[H\E[2J\E[1V:cm=\E[%i%d;%dH:\ :cr=^M:ct=\E[3g:cv=\E[%dd:dc=\EP:dl=\E[M:do=\E[B:ei=:\ :ho=\E[H:i1=\Ec\E[?7h:ic=\E^:im=:is=\E[m\E[1;24r:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOT:k6=\EOU:\ :k7=\EOV:k8=\EOW:kB=\EO:kC=\E[2J:kH=\E[24;1H:kb=^H:\ :kd=\EB:kh=\E[H:kl=\ED:kr=\EC:ku=\EA:le=\E[D:\ :ll=\E[24H:md=\E[5m:me=\E[m\E(B:mr=\E[7m:nd=\E[C:\ :nw=^M^J:r2=\Ec\E[?3l\E[2;0y:rc=\E8:sc=\E7:se=\E[m:\ :sf=^J:so=\E[5m:sr=\ET:st=\E1:ta=^I:ue=\E[m:up=\EA:\ :us=\E[4m: # Terminfo entry for the AT&T 510 A Personal Terminal # Function keys 9 - 16 are available only after the # screen labeled (soft keys/action blocks) are labeled. Function key # 9 corresponds to the leftmost touch target on the screen, # function key 16 corresponds to the rightmost. # # This entry is based on one done by Ernie Rice at Summit, NJ and # changed by Anne Gallup, Skokie, IL, ttrdc!anne # (untranslatable capabilities removed to fit entry within 1023 bytes) att510a|510a|bct510a|510A|AT&T 510A Personal Terminal:\ :am:mi:ms:xn:xo:\ :Nl#8:co#80:lh#2:li#24:lw#7:\ :#4=\E[u:%i=\E[v:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:\ :DO=\E[%dB:F1=\EOe:F2=\EOf:F3=\EOg:F4=\EOh:F5=\EOi:\ :F6=\EOj:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=hrisjjkkllmmnnqqttuuvvwwxx{{||}}~~-f\\\054h.e+g`b:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cb=\E[1K:cd=\E[0J:\ :ce=\E[0K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=\E[1B:eA=\E(B\E)1:ff=^L:ho=\E[H:\ :i1=\E(B\E)1\E[2l:i2=\E[21;1|\212:k1=\EOm:k2=\EOV:\ :k3=\EOu:k4=\ENj:k5=\ENe:k6=\ENf:k7=\ENh:k8=\E[H:\ :k9=\EOc:k;=\EOd:kB=\E[Z:kF=\E[S:kR=\E[T:kb=^H:\ :kd=\E[B:ke=\E[19;0|:kl=\E[D:kr=\E[C:ks=\E[19;1|:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[2;7m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:pf=\E[?8i:\ :po=\E[?4i:ps=\E[0i:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\E[11;3|:vi=\E[11;0|:vs=\E[11;2|: # Terminfo entry for the AT&T 510 D Personal Terminal # Function keys 9 through 16 are accessed by bringing up the # system blocks. # Function key 9 corresponds to the leftmost touch target on the screen, # function key 16 corresponds to the rightmost. # # There are problems with soft key labeling. These are due to # strangenesses in the native terminal that are impossible to # describe in a terminfo. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att510d|510d|bct510d|510D|AT&T 510D Personal Terminal:\ :am:da:db:mi:ms:xn:xo:\ :co#80:li#24:lm#48:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[0J:ce=\E[0K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=\E[1B:ei=\E[4l:ff=^L:ho=\E[H:\ :i1=\E(B\E)1\E[5;0|:i2=\E[21;1|\212:im=\E[4h:k1=\EOm:\ :k2=\EOV:k3=\EOu:k4=\ENj:k5=\ENe:k6=\ENf:k7=\ENh:\ :k8=\E[H:k9=\EOc:kb=^H:kd=\E[B:ke=\E[19;0|:kl=\E[D:\ :kr=\E[C:ks=\E[19;1|:ku=\E[A:le=^H:ll=\E#2:mb=\E[5m:\ :md=\E[2;7m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[11;3|:\ :vs=\E[11;2|: # (att500: I merged this with the att513 entry, att500 just used att513 -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att500|att513|500bct|513bct|AT&T 513 using page mode:\ :am:mi:ms:xn:xo:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dE:SR=\E[%dF:UP=\E[%dA:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=%i\E[%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :i1=\E?\E[3;3|\E[10;0|\E[21;1|\212\E[6;1|\E[1{\E[?99l:\ :im=\E[4h:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:\ :k6=\EOh:k7=\EOi:k8=\EOj:kD=\ENf:kI=\ENj:kN=\E[U:\ :kP=\E[V:kb=^H:kd=\E[B:ke=\E[19;0|\E[21;1|\212:\ :kh=\E[H:kl=\E[D:kr=\E[C:ks=\E[19;1|\E[21;4|\Eent:\ :ku=\E[A:le=^H:ll=\E#2:mb=\E[5m:md=\E[2;7m:\ :me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m:ve=\E[11;0|:vs=\E[11;1|: # 01-07-88 # printer must be set to EMUL ANSI to accept ESC codes # stops at top margin # sets cpi 10,lpi 6,form 66,left 1,right 132,top 1,bottom 66,font # and alt font ascii,wrap on,tabs cleared # disables newline on LF,Emphasized off # The capability sets form length att5310|att5320|AT&T Model 53210 or 5320 matrix printer:\ :YA:YD:\ :Ya#8192:Yi#10:Yj#12:Yk#100:Yl#72:Ym#120:co#132:it#8:\ :li#66:\ :DO=\E[%de:RI=\E[%da:\ :ZA=%?%p1%{10}%=%t\E[w%e%p1%{12}%=%t\E[2w%e%p1%{5}%=%t\E[5w%e%p1%{13}%=%p1%{14}%=%O%t\E[3w%e%p1%{16}%=%p1%{17}%=%O%t\E[4w%e%p1%{6}%=%t\E[6w%e%p1%{7}%=%t\E[7w%e%p1%{8}%=%t\E[8w%;:\ :ZB=%?%p1%{2}%=%t\E[4z%e%p1%{3}%=%t\E[5z%e%p1%{4}%=%t\E[6z%e%p1%{6}%=%t\E[z%e%p1%{8}%=%t\E[2z%e%p1%{12}%=%t\E[3z%;:\ :ZM=\E[5m:ZU=\E[m:\ :Zj=%?%p1%{0}%=%t\E(B%e%p1%{1}%=%t\E(A%e%p1%{2}%=%t\E(C%e%p1%{3}%=%t\E(D%e%p1%{4}%=%t\E(E%e%p1%{5}%=%t\E(H%e%p1%{6}%=%t\E(K%e%p1%{7}%=%t\E(R%e%p1%{8}%}%=%t\E(}%;:\ :Zl=\E[;%dr:Zm=\E[%+^As:Zn=\E[;%+^As:Zp=\E[%dr:\ :Zy=%?%p1%{0}%=%tusascii%e%p1%{1}%=%tenglish%e%p1%{2}%=%tfinnish%e%p1%{3}%=%tjapanese%e%p1%{4}%=%tnorwegian%e%p1%{5}%=%tswedish%e%p1%{6}%=%tgermanic%e%p1%{7:\ :ch=\E[%d`:cr=^M:cv=\E[%dd:do=^J:ff=^L:i1=\Ec:\ :is=\E[20l\r:nd= :ta=^I:u0=\E[%dt:up=\EM: # 5620 terminfo (2.0 or later ROMS with char attributes) # assumptions: (scroll forward one line) is only done at screen bottom # Be aware that older versions of the dmd have a firmware bug that affects # parameter defaulting; for this terminal, the 0 in \E[0m is not optional. # For more, see the 5620 FAQ maintained by David Breneman . att5620|dmd|tty5620|ttydmd|5620|5620 terminal 88 columns:\ :NL:NP:am:xo:\ :co#88:it#8:li#70:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:SF=\E[%dS:\ :SR=\E[%dT:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=:\ :ho=\E[H:ic=\E[@:im=:kC=\E[2J:kH=\E[70;1H:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :md=\E[2m:me=\E[0m:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=^J:\ :..px=\E[%p1%d;%p2%l%dq%p2%s:r1=\Ec:rc=\E8:sc=\E7:\ :se=\E[0m:sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:ue=\E[0m:\ :up=\E[A:us=\E[4m: att5620-24|dmd-24|teletype dmd 5620 in a 24x80 layer:\ :li#24:tc=att5620: att5620-34|dmd-34|teletype dmd 5620 in a 34x80 layer:\ :li#34:tc=att5620: # Entries for thru refer to the shifted system pf keys. # # Entries for thru refer to the alternate keypad mode # keys: = * / + 7 8 9 - 4 5 6 , 1 2 3 0 . ENTER # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att605|605bct|AT&T 605 80 column 102key keyboard:\ :am:eo:xo:\ :co#80:li#24:ws#80:\ :DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:ae=^O:al=\E[L:\ :as=\E)0\016:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=\E[4l:fs=\E8:\ :i1=\E[8;0|\E[?\E[13;20l\E[?\E[12h:ic=\E[@:im=\E[4h:\ :is=\E[m\017:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:\ :k6=\EOh:k7=\EOi:k8=\EOj:k9=\ENo:kD=\E[P:kI=\E[@:\ :kN=\E[U:kP=\E[V:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:ll=\E[24H:mb=\E[5m:md=\E[1m:\ :me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:ta=^I:\ :ts=\E7\E[25;%i%p1%dx:ue=\E[m:up=\E[A:us=\E[4m: att605-pc|605bct-pc|ATT 605 in pc term mode:\ :@7=\E[F:AL=\E[L:S4=250\E[?11l\E[50;1|:\ :S5=400\E[50;0|:XF=g:XN=e:\ :ac=k\277l\332m\300j\331n\305w\302q\304u\264t\303v\301x\263:\ :al=\E[L:bt=\E[Z:dc=\E[P:dl=\E[M:do=\E[B:ei=:ic=\E[@:\ :im=:k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:k5=\E[Q:k6=\E[R:\ :k7=\E[S:k8=\E[T:k9=\E[U:k;=\E[V:kB=\E[Z:kD=\E[P:\ :kI=\E[@:kL=\E[M:kN=\E[G:kP=\E[I:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:nd=\E[C:up=\E[A:tc=att605: att605-w|605bct-w|AT&T 605-w 132 column 102 key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h\E(B\E)0:tc=att605: # (att610: I added / based on the init string. I also # added and because the BSD file says the 615s have them, # and the 615 is like a 610 with a big keyboard, and most of their other # smart terminals support the same sequence -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att610|610bct|AT&T 610; 80 column; 98key keyboard:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:fs=\E8:ho=\E[H:\ :i1=\E[8;0|\E[?3;4;5;13;15l\E[13;20l\E[?7h\E[12h\E(B\E)0:\ :i2=\E(B\E)0:im=\E[4h:is=\E[m\017:k1=\EOc:k2=\EOd:\ :k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:\ :k9=\ENo:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:ll=\E[24H:mb=\E[5m:md=\E[1m:\ :me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:\ :ts=\E7\E[25;%i%p1%dx:ue=\E[m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h\E[?12l:vi=\E[?25l:\ :vs=\E[?12;25h: att610-w|610bct-w|AT&T 610; 132 column; 98key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att610: att610-103k|610-103k|610bct-103k|AT&T 610; 80 column; 103key keyboard:\ :!1=\EOO:!2=\EOP:!3=\EOS:#1=\EOM:%0=\EOt:%1=\EOm:\ :%2=\ENi:%3=\EOl:%4=\ENc:%5=\ENh:%6=\EOv:%7=\EOr:\ :%8=\ENg:%9=\EOz:%a=\EOL:%b=\ENC:%c=\ENH:%d=\EOR:\ :%e=\ENG:%f=\EOZ:%g=\EOT:%h=\EOY:%j=\EOQ:&0=\EOW:\ :&1=\EOb:&2=\ENa:&3=\EOy:&4=\EOB:&5=\EOq:&6=\EOo:\ :&7=\EOp:&8=\EOs:&9=\ENB:*0=\EOX:*1=\EOU:*2=\END:\ :*3=\EON:*4=\ENF:*5=\ENE:*6=\ENI:*7=\ENN:*8=\EOA:\ :*9=\EOK:@0=\EOx:@1=\E9:@2=\EOw:@3=\EOV:@4=\EOu:\ :@5=\ENd:@6=\EOn:@7=\E0:@8=^M:@9=\EOk:F1@:F2@:F3@:\ :F4@:k9@:k;@:kD=\ENf:kE=\EOa:kI=\ENj:kL=\ENe:kM=\ENj:\ :kN=\E[U:kP=\E[V:tc=att610: att610-103k-w|610-103k-w|610bct-103k-w|AT&T 610; 132 column; 103key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att610-103k: att615|615mt|AT&T 615; 80 column; 98key keyboard:\ :#4=\E[ A:%i=\E[ @:F5=\EOC:F6=\EOD:F7=\EOE:F8=\EOF:\ :F9=\EOG:FA=\EOH:FB=\EOI:FC=\EOJ:FD=\ENO:FE=\ENP:\ :FF=\ENQ:FG=\ENR:FH=\ENS:FI=\ENT:FJ=\EOP:FK=\EOQ:\ :FL=\EOR:FM=\EOS:FN=\EOw:FO=\EOx:FP=\EOy:FQ=\EOm:\ :FR=\EOt:FS=\EOu:FT=\EOv:FU=\EOl:FV=\EOq:FW=\EOr:\ :FX=\EOs:FY=\EOp:FZ=\EOn:Fa=\EOM:tc=att610: att615-w|615-w|615mt-w|AT&T 615; 132 column; 98key keyboard:\ :#4=\E[ A:%i=\E[ @:F5=\EOC:F6=\EOD:F7=\EOE:F8=\EOF:\ :F9=\EOG:FA=\EOH:FB=\EOI:FC=\EOJ:FD=\ENO:FE=\ENP:\ :FF=\ENQ:FG=\ENR:FH=\ENS:FI=\ENT:FJ=\EOP:FK=\EOQ:\ :FL=\EOR:FM=\EOS:FN=\EOw:FO=\EOx:FP=\EOy:FQ=\EOm:\ :FR=\EOt:FS=\EOu:FT=\EOv:FU=\EOl:FV=\EOq:FW=\EOr:\ :FX=\EOs:FY=\EOp:FZ=\EOn:Fa=\EOM:tc=att610-w: att615-103k|615-103k|615mt-103k|AT&T 615; 80 column; 103key keyboard:\ :#4=\E[ A:%i=\E[ @:tc=att610-103k: att615-103k-w|615-103k-w|615mt-103k-w|AT&T 615; 132 column; 103key keyboard:\ :#4=\E[ A:%i=\E[ @:tc=att610-103k-w: # (att620: I added / based on the init string and # / from a BSD termcap -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att620|620mtg|AT&T 620; 80 column; 98key keyboard:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :ae=\E(B\017:al=\E[L:as=\E)0\016:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:\ :fs=\E8:ho=\E[H:\ :i1=\E[8;0|\E[?3;4;5;13;15l\E[13;20l\E[?7h\E[12h:\ :i2=\E(B\E)0:im=\E[4h:is=\E[m\017:k1=\EOc:k2=\EOd:\ :k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:\ :k9=\ENo:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:ll=\E[24H:mb=\E[5m:md=\E[1m:\ :me=\E[m\E(B\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:\ :rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:\ :ts=\E7\E[25;%i%p1%dx:ue=\E[m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h\E[?12l:vi=\E[?25l:\ :vs=\E[?12;25h: att620-w|620-w|620mtg-w|AT&T 620; 132 column; 98key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att620: att620-103k|620-103k|620mtg-103k|AT&T 620; 80 column; 103key keyboard:\ :!1=\EOO:!2=\EOP:!3=\EOS:#1=\EOM:%0=\EOt:%1=\EOm:\ :%2=\ENi:%3=\EOl:%4=\ENc:%5=\ENh:%6=\EOv:%7=\EOr:\ :%8=\ENg:%9=\EOz:%a=\EOL:%b=\ENC:%c=\ENH:%d=\EOR:\ :%e=\ENG:%f=\EOZ:%g=\EOT:%h=\EOY:%j=\EOQ:&0=\EOW:\ :&1=\EOb:&2=\ENa:&3=\EOy:&4=\EOB:&5=\EOq:&6=\EOo:\ :&7=\EOp:&8=\EOs:&9=\ENB:*0=\EOX:*1=\EOU:*2=\END:\ :*3=\EON:*4=\ENF:*5=\ENE:*6=\ENI:*7=\ENN:*8=\EOA:\ :*9=\EOK:@0=\EOx:@1=\E9:@2=\EOw:@3=\EOV:@4=\EOu:\ :@5=\ENd:@6=\EOn:@7=\E0:@8=^M:@9=\EOk:F1@:F2@:F3@:\ :F4@:F5@:F6@:F7@:F8@:F9@:FA@:FB@:FC@:FD@:FE@:FF@:FG@:\ :FH@:FI@:FJ@:FK@:FL@:FM@:FN@:FO@:FP@:FQ@:FR@:FS@:FT@:\ :FU@:FV@:FW@:FX@:FY@:FZ@:Fa@:k9@:k;@:kD=\ENf:kE=\EOa:\ :kI=\ENj:kL=\ENe:kM=\ENj:kN=\E[U:kP=\E[V:tc=att620: att620-103k-w|620-103k-w|620mtg-103k-w|AT&T 620; 132 column; 103key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att620-103k: # (att630: added , and from a BSD termcap file -- esr) att630|5630|5630DMD|630MTG|AT&T 630 windowing terminal:\ :NP:am:da:db:mi:ms:xo:\ :co#80:it#8:li#60:lm#0:\ :@8=^M:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:\ :F1=\ENq:F2=\ENr:F3=\ENs:F4=\ENt:F5=\ENu:F6=\ENv:\ :F7=\ENw:F8=\ENx:F9=\ENy:FA=\ENz:FB=\EN{:FC=\EN|:\ :FD=\EN}:FE=\EN~:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:\ :SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:al=\E[L:bl=^G:bt=\E[Z:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :ic=\E[@:im=\E[4h:is=\E[m:k9=\ENo:k;=\ENp:kA=\E[L:\ :kB=\E[Z:kC=\E[2J:kD=\E[P:kI=\E[@:kL=\E[M:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:me=\E[m:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=^M^J:\ :pf=\E[?4i:po=\E[?5i:..px=\E[%p1%d;%p2%l%dq%p2%s:\ :r2=\Ec:rc=\E8:\ :..sa=\E[0%?%p2%t;4%;%?%p1%p3%|%p4%|%p5%|%t;7%;m:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: att630-24|5630-24|5630DMD-24|630MTG-24|AT&T 630 windowing terminal 24 lines:\ :li#24:tc=att630: # This entry was modified 3/13/90 by JWE. # fixes include additions of , correcting , and modification # of . (See comments below) # att730 has status line of 80 chars # These were commented out: =\E[%p1%dS, =\E[%p1%dT, # the and up keys are used for shifted system Fkeys # NOTE: JWE 3/13/90 The 98 key keyboard translation for shift/HOME is # currently the same as (unshifted HOME or \E[H). On the 102, 102+1 # and 122 key keyboards, the 730's translation is \E[2J. For consistency # has been commented out. The user can uncomment if using the # 102, 102+1, or 122 key keyboards # kHOM=\E[2J, # (att730: I added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att730|730MTG|AT&T 730 windowing terminal:\ :am:da:db:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#60:lm#0:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:\ :bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=\E[4l:fs=\E8:ho=\E[H:\ :i1=\E[8;0|\E[?3;4;5;13;15l\E[13;20l\E[?7h\E[12h\E(B\E)B:\ :i2=\E(B\E)0:im=\E[4h:is=\E[m\017:k1=\EOc:k2=\EOd:\ :k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:\ :k9=\ENo:kI=\E[@:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:\ :ts=\E7\E[;%i%p1%dx:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h\E[?12l:vi=\E[?25l:\ :vs=\E[?12;25h: att730-41|730MTG-41|AT&T 730-41 windowing terminal Version:\ :li#41:tc=att730: att730-24|730MTG-24|AT&T 730-24 windowing terminal Version:\ :li#24:tc=att730: att730r|730MTGr|AT&T 730 rev video windowing terminal Version:\ :i1=\E[8;0|\E[?3;4;13;15l\E[?5h\E[13;20l\E[?7h\E[12h\E(B\E)B:\ :vb=\E[?5l\E[?5h:tc=att730: att730r-41|730MTG-41r|AT&T 730r-41 rev video windowing terminal Version:\ :li#41:tc=att730r: att730r-24|730MTGr-24|AT&T 730r-24 rev video windowing terminal Version:\ :li#24:tc=att730r: # The following represents the screen layout along with the associated # bezel buttons for the 5430/pt505 terminal. The "kf" designations do # not appear on the screen but are shown to reference the bezel buttons. # The "CMD", "MAIL", and "REDRAW" buttons are shown in their approximate # position relative to the screen. # # # # +----------------------------------------------------------------+ # | | # XXXX | kf0 kf24 | XXXX # | | # | | # XXXX | kf1 kf23 | XXXX # | | # | | # XXXX | kf2 kf22 | XXXX # | | # | | # XXXX | kf3 kf21 | XXXX # | | # | | # XXXX | kf4 kf20 | XXXX # | | # | | # XXXX | kf5 kf19 | XXXX # | | # | | # XXXX | kf6 kf18 | XXXX # | | # | | # XXXX | | XXXX # | | # | | # +----------------------------------------------------------------+ # # XXXX XXXX XXXX XXXX XXXX XXXX XXXX XXXX XXXX XXXX # # Note: XXXX represents the screen buttons # CMD REDRAW # # MAIL # # version 1 note: # The character string sent by key 'kf26' may be user programmable # to send either \E[16s, or \E[26s. # The character string sent by key 'krfr' may be user programmable # to send either \E[17s, or \E[27s. # # Depression of the "CMD" key sends \E! (kcmd) # Depression of the "MAIL" key sends \E[26s (kf26) # "REDRAW" same as "REFRESH" (krfr) # # "kf" functions adds carriage return to output string if terminal is in # 'new line' mode. # # The following are functions not covered in the table above: # # Set keyboard character (SKC): \EPn1;Pn2w # Pn1= 0 Back Space key # Pn1= 1 Break key # Pn2= Program char (hex) # # Screen Definition (SDF): \E[Pn1;Pn2;Pn3;Pn4;Pn5t # Pn1= Window number (1-39) # Pn2-Pn5= Y;X;Y;X coordinates # # Screen Selection (SSL): \E[Pnu # Pn= Window number # # Set Terminal Modes (SM): \E[Pnh # Pn= 3 Graphics mode # Pn= > Cursor blink # Pn= < Enter new line mode # Pn= = Enter reverse insert/replace mode # Pn= ? Enter no scroll mode # # Reset Terminal Mode (RM): \E[Pnl # Pn= 3 Exit graphics mode # Pn= > Exit cursor blink # Pn= < Exit new line mode # Pn= = Exit reverse insert/replace mode # Pn= ? Exit no scroll mode # # Screen Status Report (SSR): \E[Pnp # Pn= 0 Request current window number # Pn= 1 Request current window dimensions # # Device Status Report (DSR): \E[6n Request cursor position # # Call Status Report (CSR): \E[Pnv # Pn= 0 Call failed # Pn= 1 Call successful # # Transparent Button String (TBS): \E[Pn1;Pn2;Pn3;{string # Pn1= Button number to be loaded # Pn2= Character count of "string" # Pn3= Key mode being loaded: # 0= Unshifted # 1= Shifted # 2= Control # String= Text string (15 chars max) # # Screen Number Report (SNR): \E[Pnp # Pn= Screen number # # Screen Dimension Report (SDR): \E[Pn1;Pn2r # Pn1= Number of rows available in window # Pn2= Number of columns available in window # # Cursor Position Report (CPR): \E[Pn1;Pn2R # Pn1= "Y" Position of cursor # Pn2= "X" Position of cursor # # Request Answer Back (RAB): \E[c # # Answer Back Response (ABR): \E[?;*;30;VSV # *= 0 No printer available # *= 2 Printer available # V= Software version number # SV= Software sub version number # (printer-available field not documented in v1) # # Screen Alignment Aid: \En # # Bell (lower pitch): \E[x # # Dial Phone Number: \EPdstring\ # string= Phone number to be dialed # # Set Phone Labels: \EPpstring\ # string= Label for phone buttons # # Set Clock: \EPchour;minute;second\ # # Position Clock: \EPsY;X\ # Y= "Y" coordinate # X= "X" coordinate # # Delete Clock: \Epr\ # # Programming The Function Buttons: \EPfPn;string\ # Pn= Button number (00-06, 18-24) # (kf00-kf06, kf18-kf24) # string= Text to sent on button depression # # The following in version 2 only: # # Request For Local Directory Data: \EPp12;\ # # Local Directory Data to host: \EPp11;LOCAL...DIRECTORY...DATA\ # # Request for Local Directory Data in print format: \EPp13;\ # # Enable 'Prt on Line' mode: \022 (DC2) # # Disable 'Prt on Line' mode: \024 (DC4) # # 05-Aug-86: # The following Terminfo entry describes functions which are supported by # the AT&T 5430/pt505 terminal software version 2 and later. att505|pt505|att5430|gs5430|AT&T Personal Terminal 505 or 5430 GETSET terminal:\ :am:xo:\ :co#80:it#8:li#24:\ :&2=\E[27s:@4=\E!:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:\ :DO=\E[%dB:F8=\E[18s:F9=\E[19s:FA=\E[20s:FB=\E[21s:\ :FC=\E[22s:FD=\E[23s:FE=\E24s:FG=\E26s:LE=\E[%dD:\ :RA=\E[11;1j:RI=\E[%dC:SA=\E[11;0j:UP=\E[%dA:\ :ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:cb=\E2K:cd=\E[0J:\ :ce=\E[0K:cl=\E[2J\E[H:cm=\E[%d;%dH:cr=^M:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\EPr\\E[0u\E[2J\E[0;0H\E[m\E[3l\E[l\E[=l\E[?l:\ :im=\E[4h:k0=\E[00s:k1=\E[01s:k2=\E[02s:k3=\E[03s:\ :k4=\E[04s:k5=\E[05s:k6=\E[06s:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:r1=\Ec:rc=\E8:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1m:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\E[>l:vs=\E[>h: # The following Terminfo entry describes functions which are supported by # the AT&T 5430/pt505 terminal software version 1. att505-24|pt505-24|gs5430-24|AT&T PT505 or 5430 GETSET version 1 24 lines:\ :li#24:\ :RA@:SA@:pf@:po@:rc@:sc@:tc=att505: tt505-22|pt505-22|gs5430-22|AT&T PT505 or 5430 GETSET version 1 22 lines:\ :li#22:tc=att505: # # -------------------- TERMINFO FILE CAN BE SPLIT HERE ----------------------- # This cut mark helps make life less painful for people running ncurses tic # on machines with relatively little RAM. The file can be broken in half here # cleanly and compiled in sections -- no `use' references cross this cut # going forward. # #### Ampex (Dialogue) # # Yes, these are the same people who are better-known for making audio- and # videotape. I'm told they are located in Redwood City, CA. # From: Fri Sep 11 22:38:32 1981 # (ampex80: some capabilities merged in from SCO's entry -- esr) ampex80|a80|d80|dialogue|dialogue80|ampex dialogue 80:\ :am:bw:ul:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:\ :cm=\E=%+ %+ :cr=^M:ct=\E3:dc=\EW:dl=\ER:do=^J:ei=:\ :ic=\EQ:im=:is=\EA:le=^H:nd=^L:se=\Ek:sf=^J:so=\Ej:\ :st=\E1:ta=^I:ue=\Em:up=^K:us=\El: # This entry was from somebody anonymous, Tue Aug 9 20:11:37 1983, who wrote: ampex175|ampex d175:\ :am:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\Ey:ce=\Et:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:\ :is=\EX\EA\EF:kA=\EE:kD=\EW:kI=\EQ:kL=\ER:kd=^J:\ :kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:nd=^L:se=\Ek:\ :sf=^J:so=\Ej:te=\EF:ti=\EN:ue=\Em:up=^K:us=\El: # No backspace key in the main QWERTY cluster. Fortunately, it has a # NEWLINE/PAGE key just above RETURN that sends a strange single-character # code. Given a suitable Unix (one that lets you set an echo-erase-as-BS-SP-BS # mode), this key can be used as the erase key; I find I like this. Because # some people and some systems may not, there is another termcap ("ampex175") # that suppresses this little eccentricity by omitting the relevant capability. ampex175-b|ampex d175 using left arrow for erase:\ :kb=^_:tc=ampex175: # From: Richard Bascove # (ampex210: removed obsolete ":kn#10:" -- esr) ampex210|a210|ampex a210:\ :am:hs:xn:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EE:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :\ :dc=\EW:dl=\ER:ei=:fs=\E.2:ho=^^:ic=\EQ:\ :if=/usr/share/tabset/std:im=:\ :is=\EC\Eu\E'\E(\El\EA\E%\E{\E.2\EG0\Ed\En:k0=^A0\r:\ :k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:k5=^A5\r:\ :k6=^A6\r:k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^V:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\EG0:so=\EG4:ta=^I:\ :ts=\E.0\Eg\E}\Ef:ue=\EG0:up=^K:us=\EG8:\ :vb=\EU\EX\EU\EX\EU\EX\EU\EX: # (ampex219: I added / based on the init string -- esr) ampex219|ampex-219|amp219|Ampex with Automargins:\ :hs:xn:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=%i\E[%2;%2r:\ :do=\E[B:ho=\E[H:\ :is=\E>\E[?1l\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :k0=\E[21~:k1=\E[7~:k2=\E[8~:k3=\E[9~:k4=\E[10~:\ :k5=\E[11~:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :kd=\E[B:ke=\E>:kh=\E[H:kl=\E[D:kr=\E[C:ks=\E=:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mh=\E[1m:\ :mr=\E[7m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:sr=\EM:\ :ta=^I:ue=\E[m:up=\E[A:us=\E[4m: ampex219w|ampex-219w|amp219w|Ampex 132 cols:\ :co#132:li#24:\ :bl=^G:cr=^M:do=^J:\ :is=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h:sf=^J:\ :vs=\E[?3h:tc=ampex219: ampex232|ampex-232|Ampex Model 232:\ :am:\ :co#80:li#24:sg#1:ug#1:\ :al=5*\EE:bt=\EI:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :\ :dc=\EW:dl=5*\ER:do=^V:ei=:ic=\EQ:\ :if=/usr/share/tabset/ampex:im=:is=\Eg\El:k0=^A@\r:\ :k1=^AA\r:k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:\ :k6=^AF\r:k7=^AG\r:k8=^AH\r:k9=^AI\r:kb=^H:kd=^V:\ :kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\EG0:so=\EG4:\ :ta=^I:ue=\EG0:up=^K:us=\EG8:vb=\Eb\Ed:ve=\E.4:\ :vi=\E.0: ampex232w|Ampex Model 232 / 132 columns:\ :co#132:li#24:\ :if=/usr/share/tabset/amp-132:is=\E\034Eg\El:tc=ampex232: #### Ann Arbor (aa) # # Originally from Mike O'Brien@Rand and Howard Katseff at Bell Labs. # Highly modified 6/22 by Mike O'Brien. # split out into several for the various screen sizes by dave-yost@rand # Modifications made 3/82 by Mark Horton # Modified by Tom Quarles at UCB for greater efficiency and more diversity # status line moved to top of screen, removed 5/82 # Some unknown person at SCO then hacked the init strings to make them more # efficient. # # assumes the following setup: # A menu: 0000 1010 0001 0000 # B menu: 9600 0100 1000 0000 0000 1000 0000 17 19 # C menu: 56 66 0 0 9600 0110 1100 # D menu: 0110 1001 1 0 # # Briefly, the settings are for the following modes: # (values are for bit set/clear with * indicating our preference # and the value used to test these termcaps) # Note that many of these settings are irrelevent to the terminfo # and are just set to the default mode of the terminal as shipped # by the factory. # # A menu: 0000 1010 0001 0000 # Block/underline cursor* # blinking/nonblinking cursor* # key click/no key click* # bell/no bell at column 72* # # key pad is cursor control*/key pad is numeric # return and line feed/return for key * # repeat after .5 sec*/no repeat # repeat at 25/15 chars per sec. * # # hold data until pause pressed/process data unless pause pressed* # slow scroll/no slow scroll* # Hold in area/don't hold in area* # functions keys have default*/function keys disabled on powerup # # show/don't show position of cursor during page transmit* # unused # unused # unused # # B menu: 9600 0100 1000 0000 0000 1000 0000 17 19 # Baud rate (9600*) # # 2 bits of parity - 00=odd,01=even*,10=space,11=mark # 1 stop bit*/2 stop bits # parity error detection off*/on # # keyboard local/on line* # half/full duplex* # disable/do not disable keyboard after data transmission* # # transmit entire page/stop transmission at cursor* # transfer/do not transfer protected characters* # transmit all characters/transmit only selected characters* # transmit all selected areas/transmit only 1 selected area* # # transmit/do not transmit line separators to host* # transmit/do not transmit page tab stops tabs to host* # transmit/do not transmit column tab stop tabs to host* # transmit/do not transmit graphics control (underline,inverse..)* # # enable*/disable auto XON/XOFF control # require/do not require receipt of a DC1 from host after each LF* # pause key acts as a meta key/pause key is pause* # unused # # unused # unused # unused # unused # # XON character (17*) # XOFF character (19*) # # C menu: 56 66 0 0 9600 0110 1100 # number of lines to print data on (printer) (56*) # # number of lines on a sheet of paper (printer) (66*) # # left margin (printer) (0*) # # number of pad chars on new line to printer (0*) # # printer baud rate (9600*) # # printer parity: 00=odd,01=even*,10=space,11=mark # printer stop bits: 2*/1 # print/do not print guarded areas* # # new line is: 01=LF,10=CR,11=CRLF* # unused # unused # # D menu: 0110 1001 1 0 # LF is newline/LF is down one line, same column* # wrap to preceding line if move left from col 1*/don't wrap # wrap to next line if move right from col 80*/don't wrap # backspace is/is not destructive* # # display*/ignore DEL character # display will not/will scroll* # page/column tab stops* # erase everything*/erase unprotected only # # editing extent: 0=display,1=line*,2=field,3=area # # unused # annarbor4080|aa4080|ann arbor 4080:\ :am:\ :co#80:li#40:\ :bl=^G:cl=\014:\ :..cm=\017%p2%{10}%/%{16}%*%p2%{10}%m%+%c%p1%?%p1%{19}%>%t%{12}%+%;%'@'%+%c:\ :cr=^M:ct=^^P^P:do=^J:ho=^K:kb=^^:kd=^J:kh=^K:kl=^H:\ :kr=^_:ku=^N:le=^H:nd=^_:sf=^J:st=^]^P1:ta=^I:up=^N: # If you're using the GNU termcap library, add # :cS=\E[%p1%d;%p2%d;%p3%d;%p4%dp: # to these capabilities. This is the nonstandard GNU termcap scrolling # capability, arguments are: # 1. Total number of lines on the screen. # 2. Number of lines above desired scroll region. # 3. Number of lines below (outside of) desired scroll region. # 4. Total number of lines on the screen, the same as the first parameter. # The generic Ann Arbor entry is the only one that uses this. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) aaa+unk|aaa-unk|ann arbor ambassador (internal - don't use this directly):\ :am:km:mi:xo:\ :co#80:it#8:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :ct=\E[2g:dc=\E[P:dl=\E[M:do=^K:ei=:ho=\E[H:\ :i1=\E[m\E7\E[H\E9\E8:i2=\E[1Q\E[>20;30l\EP`+x~M\E\\:\ :ic=\E[@:im=:k1=\EOA:k2=\EOB:k3=\EOC:k4=\EOD:k5=\EOE:\ :k6=\EOF:k7=\EOG:k8=\EOH:k9=\EOI:kD=\E[P:kI=\E[@:\ :kb=^H:kd=\E[B:\ :ke=\EP`>y~[[J`8xy~[[A`4xy~[[D`6xy~[[C`2xy~[[B\E\\:\ :kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\EP`>z~[[J`8xz~[[A`4xz~[[D`6xz~[[C`2xz~[[B\E\\:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mm=\E[>52h:\ :mo=\E[>52l:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:\ :sf=^K:so=\E[7m:st=\EH:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m: aaa+rv|ann arbor ambassador in reverse video:\ :i1=\E[7m\E7\E[H\E9\E8:mb=\E[5;7m:md=\E[1;7m:\ :me=\E[7m\016:mk=\E[7;8m:mr=\E[m:r1=\E[H\E[7m\E[J:\ :..sa=\E[%?%p1%p3%|%!%t7;%;%?%p2%t4;%;%?%p4%t5;%;%?%p6%t1;%;%?%p7%t8;%;m:\ :se=\E[7m:so=\E[m:ue=\E[7m:us=\E[4;7m: # Ambassador with the DEC option, for partial vt100 compatibility. aaa+dec|ann arbor ambassador in dec vt100 mode:\ :ac=aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}:\ :ae=^N:as=^O:cs=\E[%i%d;%dr:eA=\E(0:\ :..sa=\E[%?%p1%p3%|%!%t7;%;%?%p2%t4;%;%?%p4%t5;%;%?%p6%t1;%;%?%p7%t8;%;m%?%p9%t\017%e\016%;: aaa-18|ann arbor ambassador/18 lines:\ :li#18:\ :is=\E7\E[60;0;0;18p\E8:te=\E[60;0;0;18p\E[60;1H\E[K:\ :ti=\E[18;0;0;18p:tc=aaa+unk: aaa-18-rv|ann arbor ambassador/18 lines+reverse video:\ :tc=aaa+rv:tc=aaa-18: aaa-20|ann arbor ambassador/20 lines:\ :li#20:\ :is=\E7\E[60;0;0;20p\E8:te=\E[60;0;0;20p\E[60;1H\E[K:\ :ti=\E[20;0;0;20p:tc=aaa+unk: aaa-22|ann arbor ambassador/22 lines:\ :li#22:\ :is=\E7\E[60;0;0;22p\E8:te=\E[60;0;0;22p\E[60;1H\E[K:\ :ti=\E[22;0;0;22p:tc=aaa+unk: aaa-24|ann arbor ambassador/24 lines:\ :li#24:\ :is=\E7\E[60;0;0;24p\E8:te=\E[60;0;0;24p\E[60;1H\E[K:\ :ti=\E[24;0;0;24p:tc=aaa+unk: aaa-24-rv|ann arbor ambassador/24 lines+reverse video:\ :tc=aaa+rv:tc=aaa-24: aaa-26|ann arbor ambassador/26 lines:\ :li#26:\ :is=\E7\E[60;0;0;26p\E8:te=\E[60;0;0;26p\E[26;1H\E[K:\ :ti=\E[H\E[J\E[26;0;0;26p:tc=aaa+unk: aaa-28|ann arbor ambassador/28 lines:\ :li#28:\ :is=\E7\E[60;0;0;28p\E8:te=\E[60;0;0;28p\E[28;1H\E[K:\ :ti=\E[H\E[J\E[28;0;0;28p:tc=aaa+unk: aaa-30-s|aaa-s|ann arbor ambassador/30 lines w/status:\ :es:hs:\ :li#29:\ :ds=\E7\E[60;0;0;30p\E[1;1H\E[K\E[H\E8\r\n\E[K:\ :fs=\E[>51l:is=\r\n\E[A\E7\E[60;1;0;30p\E8:\ :te=\E[60;1;0;30p\E[29;1H\E[K:\ :ti=\E[H\E[J\E[30;1;0;30p\E[30;1H\E[K:\ :ts=\E[>51h\E[1;%p1%dH\E[2K:tc=aaa+unk: aaa-30-s-rv|aaa-s-rv|ann arbor ambassador/30 lines+status+reverse video:\ :tc=aaa+rv:tc=aaa-30-s: aaa-s-ctxt|aaa-30-s-ctxt|ann arbor ambassador/30 lines+status+save context:\ :te=\E[60;1;0;30p\E[59;1H\E[K:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:tc=aaa-30-s: aaa-s-rv-ctxt|aaa-30-s-rv-ct|ann arbor ambassador/30 lines+status+save context:\ :te=\E[60;1;0;30p\E[59;1H\E[K:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:tc=aaa-30-s-rv: aaa|aaa-30|ambas|ambassador|ann arbor ambassador/30 lines:\ :li#30:\ :is=\E7\E[60;0;0;30p\E8:te=\E[60;0;0;30p\E[30;1H\E[K:\ :ti=\E[H\E[J\E[30;0;0;30p:tc=aaa+unk: aaa-30-rv|aaa-rv|ann arbor ambassador/30 lines in reverse video:\ :tc=aaa+rv:tc=aaa-30: aaa-30-ctxt|aaa-ctxt|ann arbor ambassador/30 lines; saving context:\ :te=\E[60;0;0;30p\E[60;1H\E[K:ti=\E[30;0;0;30p:tc=aaa-30: aaa-30-rv-ctxt|aaa-rv-ctxt|ann arbor ambassador/30 lines reverse video; saving context:\ :te=\E[60;0;0;30p\E[60;1H\E[K:ti=\E[30;0;0;30p:tc=aaa+rv:tc=aaa-30: aaa-36|ann arbor ambassador/36 lines:\ :li#36:\ :is=\E7\E[60;0;0;36p\E8:te=\E[60;0;0;36p\E[36;1H\E[K:\ :ti=\E[H\E[J\E[36;0;0;36p:tc=aaa+unk: aaa-36-rv|ann arbor ambassador/36 lines+reverse video:\ :tc=aaa+rv:tc=aaa-36: aaa-40|ann arbor ambassador/40 lines:\ :li#40:\ :is=\E7\E[60;0;0;40p\E8:te=\E[60;0;0;40p\E[40;1H\E[K:\ :ti=\E[H\E[J\E[40;0;0;40p:tc=aaa+unk: aaa-40-rv|ann arbor ambassador/40 lines+reverse video:\ :tc=aaa+rv:tc=aaa-40: aaa-48|ann arbor ambassador/48 lines:\ :li#48:\ :is=\E7\E[60;0;0;48p\E8:te=\E[60;0;0;48p\E[48;1H\E[K:\ :ti=\E[H\E[J\E[48;0;0;48p:tc=aaa+unk: aaa-48-rv|ann arbor ambassador/48 lines+reverse video:\ :tc=aaa+rv:tc=aaa-48: aaa-60-s|ann arbor ambassador/59 lines+status:\ :es:hs:\ :li#59:\ :ds=\E7\E[60;0;0;60p\E[1;1H\E[K\E[H\E8\r\n\E[K:\ :fs=\E[>51l:is=\r\n\E[A\E7\E[60;1;0;60p\E8:\ :ts=\E[>51h\E[1;%p1%dH\E[2K:tc=aaa+unk: aaa-60-s-rv|ann arbor ambassador/59 lines+status+reverse video:\ :tc=aaa+rv:tc=aaa-60-s: aaa-60-dec-rv|ann arbor ambassador/dec mode+59 lines+status+rev video:\ :tc=aaa+dec:tc=aaa+rv:tc=aaa-60-s: aaa-60|ann arbor ambassador/60 lines:\ :li#60:\ :is=\E7\E[60;0;0;60p\E[1Q\E[m\E[>20;30l\E8:tc=aaa+unk: aaa-60-rv|ann arbor ambassador/60 lines+reverse video:\ :tc=aaa+rv:tc=aaa-60: aaa-db|ann arbor ambassador 30/destructive backspace:\ :i2=\E[1Q\E[m\E[>20l\E[>30h:le=\E[D:tc=aaa-30: guru|guru-33|guru+unk|ann arbor guru/33 lines 80 cols:\ :li#33:\ :i2=\E[>59l:is=\E7\E[255;0;0;33;80;80p\E8\E[J:\ :te=\E[255p\E[255;1H\E[K:ti=\E[33p:vb=\E[>59h\E[>59l:tc=aaa+unk: guru+rv|guru changes for reverse video:\ :i2=\E[>59h:vb=\E[>59l\E[>59h: guru-rv|guru-33-rv|ann arbor guru/33 lines+reverse video:\ :tc=guru+rv:tc=guru-33: guru+s|guru status line:\ :es:hs:\ :ds=\E7\E[;0p\E[1;1H\E[K\E[H\E8\r\n\E[K:fs=\E[>51l:\ :te=\E[255;1p\E[255;1H\E[K:\ :ts=\E[>51h\E[1;%p1%dH\E[2K: guru-nctxt|guru with no saved context:\ :ti=\E[H\E[J\E[33p\E[255;1H\E[K:tc=guru: guru-s|guru-33-s|ann arbor guru/33 lines+status:\ :li#32:\ :is=\r\n\E[A\E7\E[255;1;0;33;80;80p\E8\E[J:\ :ti=\E[33;1p\E[255;1H\E[K:tc=guru+s:tc=guru+unk: guru-24|ann arbor guru 24 lines:\ :co#80:li#24:\ :is=\E7\E[255;0;0;24;80;80p\E8\E[J:ti=\E[24p:tc=guru+unk: guru-44|ann arbor guru 44 lines:\ :co#97:li#44:\ :is=\E7\E[255;0;0;44;97;100p\E8\E[J:ti=\E[44p:tc=guru+unk: guru-44-s|ann arbor guru/44 lines+status:\ :li#43:\ :is=\r\n\E[A\E7\E[255;1;0;44;80;80p\E8\E[J:\ :ti=\E[44;1p\E[255;1H\E[K:tc=guru+s:tc=guru+unk: guru-76|guru with 76 lines by 89 cols:\ :co#89:li#76:\ :is=\E7\E[255;0;0;76;89;100p\E8\E[J:ti=\E[76p:tc=guru+unk: guru-76-s|ann arbor guru/76 lines+status:\ :co#89:li#75:\ :is=\r\n\E[A\E7\E[255;1;0;76;89;100p\E8\E[J:\ :ti=\E[76;1p\E[255;1H\E[K:tc=guru+s:tc=guru+unk: guru-76-lp|guru-lp|guru with page bigger than line printer:\ :co#134:li#76:\ :is=\E7\E[255;0;0;76;134;134p\E8\E[J:ti=\E[76p:tc=guru+unk: guru-76-w|guru 76 lines by 178 cols:\ :co#178:li#76:\ :is=\E7\E[255;0;0;76;178;178p\E8\E[J:ti=\E[76p:tc=guru+unk: guru-76-w-s|ann arbor guru/76 lines+status+wide:\ :co#178:li#75:\ :is=\r\n\E[A\E7\E[255;1;0;76;178;178p\E8\E[J:\ :ti=\E[76;1p\E[255;1H\E[K:tc=guru+s:tc=guru+unk: guru-76-wm|guru 76 lines by 178 cols with 255 cols memory:\ :co#178:li#76:\ :is=\E7\E[255;0;0;76;178;255p\E8\E[J:ti=\E[76p:tc=guru+unk: aaa-rv-unk|ann arbor unknown type:\ :Nl#0:lh#0:lw#0:\ :ho=\E[H:i1=\E[7m\E7\E[H\E9\E8:mb=\E[5;7m:md=\E[1;7m:\ :me=\E[7m:mk=\E[7;8m:mr=\E[m:r1=\E[H\E[7m\E[J:\ :..sa=\E[%?%p1%!%t7;%;%?%p2%t4;%;%?%p3%t7;%;%?%p4%t5;%;%?%p6%t1;%;%?%p7%t8;%;m:\ :se=\E[7m:so=\E[m:ue=\E[7m:us=\E[4;7m: #### Applied Digital Data Systems (adds) # # ADDS itself is long gone. ADDS was bought by NCR, and the same group made # ADDS and NCR terminals. When AT&T and NCR merged, the engineering for # terminals was merged again. Then AT&T sold the terminal business to # SunRiver. The engineers from Teletype, AT&T terminals, ADDS, # and NCR (who are still there as of early 1995) are at: # # SunRiver Data Systems # 100 Marcus Boulevard # Hauppauge, NY 117883-762 # Vox: (800)-231-5445 # Fax: (516)-342-7378 # # Their voice mail describes the place as "SunRiver (formerly ADDS)". # Regent: lowest common denominator, works on all regents. # (regent: renamed ":bc:" to ":le:" -- esr) regent|Adds Regent Series:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=\EY :le=^U:ll=^A:nd=^F:\ :sf=^J:up=^Z: # Regent 100 has a bug where if computer sends escape when user is holding # down shift key it gets confused, so we avoid escape. regent100|Adds Regent 100:\ :sg#1:ug#1:\ :bl=^G:cm=\013%+ %B\020%.:k0=^B1\r:k1=^B2\r:k2=^B3\r:\ :k3=^B4\r:k4=^B5\r:k5=^B6\r:k6=^B7\r:k7=^B8\r:l0=F1:\ :l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:se=\E0@:\ :so=\E0P:ue=\E0@:us=\E0`:tc=regent: regent20|Adds Regent 20:\ :bl=^G:cd=\Ek:ce=\EK:cm=\EY%+ %+ :tc=regent: regent25|Adds Regent 25:\ :bl=^G:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:tc=regent20: regent40|Adds Regent 40:\ :sg#1:ug#1:\ :al=\EM:bl=^G:dl=\El:k0=^B1\r:k1=^B2\r:k2=^B3\r:\ :k3=^B4\r:k4=^B5\r:k5=^B6\r:k6=^B7\r:k7=^B8\r:l0=F1:\ :l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:se=\E0@:\ :so=\E0P:ue=\E0@:us=\E0`:tc=regent25: regent40+|Adds Regent 40+:\ :is=\EB:tc=regent40: regent60|regent200|Adds Regent 60:\ :dc=\EE:ei=\EF:im=\EF:is=\EV\EB:kD=\EE:kI=\EF:kM=\EF:\ :se=\ER\E0@\EV:so=\ER\E0P\EV:tc=regent40+: # From: Thu Jul 9 09:27:33 1981 # (viewpoint: added , function key, and capabilities -- esr) viewpoint|addsviewpoint|adds viewpoint:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\Ek:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:dl=\El:\ :do=^J:is=\017\E0`:k0=^B1:k2=^B2:k3=^B!:k4=^B":\ :k5=^B#:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:le=^H:ll=^A:\ :nd=^F:se=^O:sf=^J:so=^N:ue=^O:up=^Z:us=^N:\ :ve=\017\E0`:vs=\017\E0P: # Some viewpoints have bad ROMs that foo up on ^O screwpoint|adds viewpoint with ^O bug:\ :se@:so@:ue@:us@:vs@:tc=viewpoint: # From: Jay S. Rouman 5 Jul 92 # The /// strings were added by ESR from specs. # Theory; the 3a+ wants \E0%c to set highlights, where normal=01000000, # underline=01100000, rev=01010000, blink=01000010,dim=01000001, # invis=01000100 and %c is the logical or of desired attributes. # There is also a `tag bit' enabling attributes, set by \E) and unset by \E(. vp3a+|viewpoint3a+|adds viewpoint 3a+:\ :am:bw:\ :co#80:it#8:li#24:\ :cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:\ :kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:me=\E(:\ :nd=^L:nw=^M^J:\ :..sa=\E0%'@'%?%p1%tQ%|%;%?%p2%t%'`'%|%;%?%p3%tP%|%;%?%p4%t%{2}%|%;%?%p5%t%{1}%|%;%?%p7%tD%|%;%c\E):\ :se=\E(:sf=^J:so=\E0Q\E):ta=^I:up=^K:ve=^X:vi=^W: vp60|viewpoint60|addsvp60|adds viewpoint60:\ :tc=regent40: # # adds viewpoint 90 - from cornell # Note: emacs sends ei occasionally to insure the terminal is out of # insert mode. This unfortunately puts the viewpoint90 IN insert # mode. A hack to get around this is =\EF\s\EF^U. (Also, # - :ei=:im=: must be present in the termcap translation.) # - indicates glitch that attributes stick to location # - means it's safe to move in standout mode # - =\EG\Ek: clears screen and visual attributes without affecting # the status line # Function key and label capabilities merged in from SCO. vp90|viewpoint90|adds viewpoint 90:\ :bw:ms:xs:\ :co#80:li#24:\ :cd=\Ek:ce=\EK:cl=\EG\Ek:cm=\EY%+ %+ :dc=\EE:dl=\El:\ :do=^J:ei=:ho=\EY :ic=\EF \EF\025:im=:k0=^B1\r:\ :k1=^B2\r:k2=^B3\r:k3=^B4\r:k4=^B5\r:k5=^B6\r:\ :k6=^B7\r:k7=^B8\r:k8=^B9\r:k9=^B\072\r:k;=^B;\r:\ :kb=^H:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:l0=F1:l1=F2:\ :l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:l8=F9:l9=F10:\ :la=F11:le=^H:ll=^A:nd=^F:se=\ER\E0@\EV:sf=^J:\ :so=\ER\E0Q\EV:ta=^I:ue=\ER\E0@\EV:up=^Z:\ :us=\ER\E0`\EV: # Note: if return acts weird on a980, check internal switch #2 # on the top chip on the CONTROL pc board. adds980|a980|adds consul 980:\ :am:\ :co#80:li#24:\ :al=\E\016:bl=^G:cl=\014\013@:cm=\013%+@\E\005%2:\ :cr=^M:dl=\E\017:do=^J:k0=\E0:k1=\E1:k2=\E2:k3=\E3:\ :k4=\E4:k5=\E5:k6=\E6:k7=\E7:k8=\E8:k9=\E9:le=^H:\ :nd=\E^E01:se=^O:sf=^J:so=^Y^^^N: #### C. Itoh Electronics # # As of 1995 these people no longer make terminals (they're still in the # printer business). Their terminals were all clones of the DEC VT series. # They're located in Orange County, CA. # # CIT 80 - vt-52 emulator, the termcap has been modified to remove # the delay times and do an auto tab set rather than the indirect # file used in vt100. cit80|cit-80|citoh 80:\ :am:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=\E[H\EJ:cm=\E[%i%2;%2H:cr=^M:ff=^L:\ :is=\E>:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:nd=\E[C:sf=^J:up=\E[A: # From: Tim Wood Fri Sep 27 09:39:12 PDT 1985 # (cit101: added / based on init string, merged this with c101 -- esr) cit101|citc|C.itoh fast vt100:\ :am:xn:\ :co#80:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=:\ :ic=\E[@:im=:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[3g\E[>5g:\ :kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:nd=\E[C:se=\E[m:so=\E[7m:ue=\E[m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[V\E8:\ :vs=\E7\E[U: # The CIT-500 was unusual in that it had a portrait-style display. # (cit500: I added / based on the init string -- esr) # (This entry used to have lines#40, but Michael Coughlin # says this is wrong, they actually have 64 lines. Perhaps someone was # thinking in hex? -- esr) cit500|cit-500|cit 500:\ :am:xn:\ :co#80:it#8:li#64:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=50\E[J:ce=3\E[K:\ :cl=50\E[H\E[2J:cm=5\E[%i%2;%2H:dc=\E[P:dl=\E[M:\ :do=\ED:is=\E(B\E)0\E>\E[?3l\E[?7h\E[?8h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kd=\EOB:ke=\E[?1l\E>:\ :kh=\E[H:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :nd=2\E[C:se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:\ :up=2\E[A:us=2\E[4m: citoh|ci8510|8510|c.itoh 8510a:\ :co#80:it#8:\ :is=\E(009\054017\054025\054033\054041\054049\054057\054065\054073.:\ :le@:md=\E!:me=\E"\EY:rp=\ER%r%03%.:sr=\Er:ue=\EY:\ :us=\EX:tc=lpr: citoh-pica|citoh in pica:\ :i1=\EN:tc=citoh: citoh-elite|citoh in elite:\ :co#96:\ :i1=\EE:\ :is=\E(009\054017\054025\054033\054041\054049\054057\054065\054073\054081\054089.:tc=citoh: citoh-comp|citoh in compressed:\ :co#136:\ :i1=\EQ:\ :is=\E(009\054017\054025\054033\054041\054049\054057\054065\054073\054081\054089\054097\054105\054113\054121\054129.:tc=citoh: # citoh has infinite cols because we don't want lp ever inserting \n\t**. citoh-prop|citoh-ps|ips|citoh in proportional spacing mode:\ :co#32767:\ :i1=\EP:tc=citoh: citoh-6lpi|citoh in 6 lines per inch mode:\ :i2=\EA:tc=citoh: citoh-8lpi|citoh in 8 lines per inch mode:\ :li#88:\ :i2=\EB:tc=citoh: #### Control Data (cdc) # cdc456|cdc 456 terminal:\ :am:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=^X:ce=^V:cl=^Y^X:cm=\E1%+ %+ :cr=^M:\ :dl=\EJ:do=^J:ho=^Y:le=^H:nd=^L:sf=^J:up=^Z: #### Human Designed Systems (Concept) # # Human Designed Systems # 400 Fehley Drive # King of Prussia, PA 19406 # Vox: (610)-277-8300 # Fax: (610)-275-5739 # Net: support@hds.com # # John Martin is their termcap expert. They're mostly out of # the character-terminal business now (1995) and making X terminals. In # particular, the whole `Concept' line described here was discontinued long # ago. # From: Sat Jun 27 07:41:20 1981 # Extensive changes to c108 by arpavax:eric Feb 1982 # Some unknown person at SCO then translated it to terminfo. # # There seem to be a number of different versions of the C108 PROMS # (with bug fixes in its Z-80 program). # # The first one that we had would lock out the keyboard of you # sent lots of short lines (like /usr/dict/words) at 9600 baud. # Try that on your C108 and see if it sends a ^S when you type it. # If so, you have an old version of the PROMs. # # You should configure the C108 to send ^S/^Q before running this. # It is much faster (at 9600 baud) than the c100 because the delays # are not fixed. # new status line display entries for c108-8p: # - init str #3 - setup term for status display - # set programmer mode, select window 2, define window at last # line of memory, set bkgnd stat mesg there, select window 0. # # - to status line - select window 2, home cursor, erase to # end-of-window, 1/2 bright on, goto(line#0, col#?) # # - from status line - 1/2 bright off, select window 0 # # - disable status display - set bkgnd status mesg with # illegal window # # # There are probably more function keys that should be added but # I don't know what they are. # # No delays needed on c108 because of ^S/^Q handshaking # c108|concept108|c108-8p|concept108-8p|concept 108 w/8 pages:\ :i2=\EU\E z"\Ev\001\177 !p\E ;"\E z \Ev \001\177p\Ep\n:\ :te=\Ev \001\177p\Ep\r\n:tc=c108-4p: c108-4p|concept108-4p|concept 108 w/4 pages:\ :es:hs:xo:\ :pb@:\ :ac=l\\qLkTxUmMjE:ae=\Ej :as=\Ej!:\ :..cm=\Ea%p1%?%p1%{95}%>%t\001%{96}%-%;%{32}%+%c%p2%?%p2%{95}%>%t\001%{96}%-%;%{32}%+%c:\ :cr=^M:dc=\E 1:ds=\E ;\177:fs=\Ee\E z :i1=\EK\E!\E F:\ :i2=\EU\E z"\Ev\177 !p\E ;"\E z \Ev \001 p\Ep\n:\ :sf=^J:te=\Ev \001 p\Ep\r\n:\ :ti=\EU\Ev 8p\Ep\r\E\025:\ :ts=\E z"\E?\E\005\EE\Ea %+ :ve=\Ew:vs=\EW:tc=c100: c108-rv|c108-rv-8p|concept 108 w/8 pages in reverse video:\ :te=\Ev \002 p\Ep\r\n:ti=\EU\Ev 8p\Ep\r:tc=c108-rv-4p: c108-rv-4p|concept108rv4p|concept 108 w/4 pages in reverse video:\ :i1=\Ek:se=\Ee:so=\EE:vb=\EK\Ek:tc=c108-4p: c108-w|c108-w-8p|concept108-w-8|concept108-w8p|concept 108 w/8 pages in wide mode:\ :co#132:\ :i1=\E F\E":te=\Ev ^A0\001D\Ep\r\n:\ :ti=\EU\Ev 8\001D\Ep\r:tc=c108-8p: # Concept 100: # These have only window relative cursor addressing, not screen # relative. To get it to work right here, smcup/rmcup (which # were invented for the concept) lock you into a one page # window for screen style programs. # # To get out of the one page window, we use a clever trick: # we set the window size to zero ("\Ev " in rmcup) which the # terminal recognizes as an error and resets the window to all # of memory. # # This trick works on c100 but does not on c108, sigh. # # Some tty drivers use cr3 for concept, others use nl3, hence # the delays on cr and ind below. This padding is only needed at # 9600 baud and up. One or the other is commented out depending on # local conventions. # # 2 ms padding on isn't always enough. 6 works fine. Maybe # less than 6 but more than 2 will work. # # Note: can't use function keys f7-f10 because they are # indistinguishable from arrow keys (!), also, del char and # clear eol use xon/xoff so they probably won't work very well. # # Also note that we don't define insrt/del char/delline/eop/send # because they don't transmit unless we reset them - I figured # it was a bad idea to clobber their definitions. # # The sequence changes the escape character to ^^ so that # escapes will be passed through to the printer. Only trouble # is that ^^ won't be - ^^ was chosen to be unlikely. # Unfortunately, if you're sending raster bits through to be # plotted, any character you choose will be likely, so we lose. # # \EQ"\EY(^W (send anything from printer to host, for xon/xoff) # cannot be # in is2 because it will hang a c100 with no printer # if sent twice. c100|concept100|concept|c104|c100-4p|hds concept 100:\ :am:eo:mi:ul:xn:\ :co#80:li#24:pb#9600:vt#8:\ :al=\E\022:bl=^G:cd=\E\005:ce=\E\025:cl=\E?\E\005:\ :cm=\Ea%+ %+ :cr=\r:dc=\E\021:dl=\E\002:do=^J:\ :ei=\E :i1=\EK:i2=\Ev \Ep\n:im=\E^P:ip=:\ :is=\EU\Ef\E7\E5\E8\El\ENH\E\200\Eo&\200\Eo'\E\Eo!\200\E\007!\E\010A@ \E4#\072"\E\072a\E4#;"\E\072b\E4#<"\E\072c:\ :k1=\E5:k2=\E6:k3=\E7:k4=\E8:k5=\E9:k6=\E\072a:\ :k7=\E\072b:k8=\E\072c:kA=\E^R:kB=\E':kD=\E^Q:\ :kE=\E^S:kF=\E[:kI=\E^P:kL=\E^B:kM=\E\200:kN=\E-:\ :kP=\E.:kR=\E\\:kS=\E^C:kT=\E]:kb=^H:kd=\E<:ke=\Ex:\ :kh=\E?:kl=\E>:kr=\E=:ks=\EX:kt=\E_:ku=\E;:le=^H:\ :mb=\EC:me=\EN@:mh=\EE:mk=\EH:mp=\EI:mr=\ED:nd=\E=:\ :pf=\036o \E\EQ!\EYP\027:po=\EQ"\EY(\027\EYD\Eo \036:\ :rp=\Er%.%+ :se=\Ed:sf=^J:so=\ED:ta=\011:\ :te=\Ev \Ep\r\n:ti=\EU\Ev 8p\Ep\r\E\025:ue=\Eg:\ :up=\E;:us=\EG:vb=\Ek\EK: c100-rv|c100-rv-4p|concept100-rv|c100 rev video:\ :i1=\Ek:se=\Ee:so=\EE:vb=\EK\Ek:ve@:vs@:tc=c100: oc100|oconcept|c100-1p|old 1 page concept 100:\ :in:\ :i3@:tc=c100: # through included to specify padding needed in raw mode. # (untranslatable capabilities removed to fit entry within 1023 bytes) avt-ns|concept avt no status line:\ :am:eo:mi:ul:xn:xo:\ :co#80:it#8:li#24:lm#192:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\016:al=\E[L:as=\017:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%+^AG:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[2g:\ :cv=\E[%+^Ad:dc=\E[P:dl=\E[M:do=^J:ei=\E4l:ho=\E[H:\ :i1=\E[=103l\E[=205l:ic=\E[@:im=\E1:ip=:\ :is=\E[1*q\E[2!t\E[7!t\E[=4;101;119;122l\E[=107;118;207h\E)1\E[1Q\EW\E[!y\E[!z\E>\E[0\0720\07232!r\E[0*w\E[w\E2\r\n\E[2;27!t:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kA=\E^C\r:kD=\E^B\r:\ :kI=\E^A\r:kS=\E^D\r:kb=^H:kd=\E[B:ke=\E[!z\E[0;2u:\ :kh=\E[H:kl=\E[D:kr=\E[C:ks=\E[1!z\E[0;3u:ku=\E[A:\ :le=^H:ll=\E[24H:mb=\E[5m:md=\E[1m:me=\E[m:mh=\E[1!{:\ :mk=\E8m:mp=\E[99m:mr=\E[7m:nd=\E[C:pf=\E[4i:\ :pl=\E[%d;0u#%s#:po=\E[5i:ps=\E[0i:px=\E[%d;1u#%s#:\ :rc=\E8:sc=\E7:se=\E[7!{:sf=\n:so=\E[7m:sr=\EM:\ :st=\EH:ta=\011:te=\E[w\E2\r\n:\ :ti=\E[=4l\E[1;24w\E2\r:ue=\E[4!{:up=\E[A:us=\E[4m:\ :ve=\E[=119l:vs=\E[=119h: avt-rv-ns|concept avt in reverse video mode/no status line:\ :i1=\E[=103l\E[=205h:vb=\E[=205l\E[=205h:tc=avt-ns: avt-w-ns|concept avt in 132 column mode/no status line:\ :i1=\E[=103h\E[=205l:ti=\E[H\E[1;24;1;132w:tc=avt-ns: avt-w-rv-ns|concept avt in 132 column mode/no status line/reverse video:\ :i1=\E[=103h\E[=205h:ti=\E[H\E[1;24;1;132w:\ :vb=\E[=205l\E[=205h:tc=avt-ns: # Concept AVT with status line. We get the status line using the # "Background status line" feature of the terminal. We swipe the # first line of memory in window 2 for the status line, keeping # 191 lines of memory and 24 screen lines for regular use. # The first line is used instead of the last so that this works # on both 4 and 8 page AVTs. (Note the lm#191 or 192 - this # assumes an 8 page AVT but lm isn't currently used anywhere.) # avt+s|concept avt status line changes:\ :es:hs:\ :lm#191:\ :ds=\E[0*w:fs=\E[1;1!w:\ :i2=\E[2w\E[2!w\E[1;1;1;80w\E[H\E[2*w\E[1!w\E2\r\n:\ :te=\E[2w\E2\r\n:ti=\E[2;25w\E2\r:\ :ts=\E[2;1!w\E[;%p1%dH\E[2K: avt|avt-s|concept-avt|avt w/80 columns:\ :tc=avt+s:tc=avt-ns: avt-rv|avt-rv-s|avt reverse video w/sl:\ :i1=\E[=103l\E[=205h:vb=\E[=205l\E[=205h:tc=avt+s:tc=avt-ns: avt-w|avt-w-s|concept avt 132 cols+status:\ :i1=\E[=103h\E[=205l:ti=\E[H\E[1;24;1;132w:tc=avt+s:tc=avt-ns: avt-w-rv|avt-w-rv-s|avt wide+status+rv:\ :i1=\E[=103h\E[=205h:ti=\E[H\E[1;24;1;132w:\ :vb=\E[=205l\E[=205h:tc=avt+s:tc=avt-ns: #### Contel Business Systems. # # Contel c300 and c320 terminals. contel300|contel320|c300|Contel Business Systems C-300 or C-320:\ :am:in:xo:\ :co#80:li#24:sg#1:\ :al=\EL:bl=^G:cd=\EJ:ce=\EI:cl=\EK:cm=\EX%+ \EY%+ :\ :cr=^M:ct=\E3:dc=\EO:dl=\EM:do=^J:ei=:ho=\EH:ic=\EN:\ :im=:ip=:k0=\ERJ:k1=\ERA:k2=\ERB:k3=\ERC:k4=\ERD:\ :k5=\ERE:k6=\ERF:k7=\ERG:k8=\ERH:k9=\ERI:kb=^H:le=^H:\ :ll=\EH\EA:nd=\EC:se=\E!\200:sf=^J:so=\E!\r:st=\E1:\ :up=\EA:vb=\020\002\020\003: # Contel c301 and c321 terminals. contel301|contel321|c301|c321|Contel Business Systems C-301 or C-321:\ :ei=:ic@:im=:ip@:se=\E!\200:so=\E!\r:vb@:tc=contel300: #### Data General (dg) # # According to James Carlson writing in January 1995, # the terminals group at Data General was shut down in 1991; all these # terminals have thus been discontinued. # # According to the 4.4BSD termcap file, the dg200 should be the # termcap equivalent of \020%p2%{128}%+%c%p1%{128}%+%c (in termcap # notation that's "^P%r%+\200%+\200"). Those \200s are suspicious, # maybe they were originally nuls (which would fit). dg200|data general dasher 200:\ :NL:am:bw:\ :co#80:li#24:\ :bl=^G:ce=^K:cl=^L:cm=\020%r%.%.:cr=^M:do=^Z:ho=^H:\ :k0=^^z:k1=^^q:k2=^^r:k3=^^s:k4=^^t:k5=^^u:k6=^^v:\ :k7=^^w:k8=^^x:k9=^^y:kd=^Z:kh=^H:kl=^Y:kr=^X:ku=^W:\ :l0=f10:le=^Y:nd=^X:nw=^J:se=^^E:sf=^J:so=^^D:ue=^U:\ :up=^W:us=^T: # From: Peter N. Wan # courtesy of Carlos Rucalde of Vantage Software, Inc. # (dg211: this had =\020%r%.%., which was an ancient termcap hangover. # I suspect the d200 function keys actually work on the dg211, check it out.) dg211|Data General d211:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb=^Y:l0@:\ :nw=^M^Z:se=00\036E\200/>:sf@:\ :so=00\036D\200\200\200\200\200/>:ta=^I:te=^L:\ :ti=^L^R:ve=^L:vs=^L^R:tc=dg200: # dg450 from cornell dg450|dg6134|data general 6134:\ :le@:nd=^X:tc=dg200: # Note: lesser Dasher terminals will not work with vi because vi insists upon # having a command to move straight down from any position on the bottom line # and scroll the screen up, or a direct vertical scroll command. The 460 and # above have both, the D210/211, for instance, has neither. We must use ANSI # mode rather than DG mode because standard UNIX tty drivers assume that ^H is # backspace on all terminals. This is not so in DG mode. # (dg460-ansi: removed obsolete ":kn#6:"; also removed ":mu=\EW:", on the # grounds that there is no matching ":ml:" # fixed garbled ":k9=\E[00\:z:" capability -- esr) dg460-ansi|Data General Dasher 460 in ANSI-mode:\ :am:ms:ul:\ :co#80:it#8:li#24:\ :al=\E[L:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%2;%2H:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:\ :is=^^F@:k0=\E[001z:k1=\E[002z:k2=\E[003z:k3=\E[004z:\ :k4=\E[005z:k5=\E[006z:k6=\E[007z:k7=\E[008z:\ :k8=\E[009z:k9=\E[010z:kb=\E[D:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:l0=f1:l1=f2:l2=f3:l3=f4:\ :l4=f5:l5=f6:l6=f7:l7=f8:l9=f10:le=^H:mb=\E[5m:\ :me=\E[m:mh=\E[2m:mr=\E[7m:nd=\E[C:nl=\ED:se=\E[m:\ :sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:ue=\E[05:up=\E[A:\ :us=\E[4m: # From: Wayne Throop # Data General 605x # Ought to work for a Model 6242, Type D210 as well as a 605x. # Note that the cursor-down key transmits ^Z. Job control users, beware! # (dg6053: the 4.4BSD file had =^H, =^J, =^S. -- esr) dg6053|data general 6053:\ :am:bs:bw:ul:\ :co#80:li#24:\ :bl=^G:ce=^K:cl=^L:cm=\020%r%.%.:cr=^M:do=^Z:ho=^H:\ :is=^R:k0=^^q:k1=^^r:k2=^^s:k3=^^t:k4=^^u:k5=^^v:\ :k6=^^w:k7=^^x:k8=^^y:kb=^Y:kd=^Z:kh=^H:kl=^Y:kr=^X:\ :ku=^W:le=^Y:nd=^X:nw=^M^Z:se=\200^^E:\ :so=\200\200\200\200\200\036D:ta=^I:te=^L:ti=^L^R:\ :ue=^U:up=^W:us=^T:ve=^L:vs=^L^R: #### Datamedia (dm) # cs10|colorscan|Datamedia Color Scan 10:\ :ms:\ :co#80:li#24:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%02;%02H:\ :cr=^M:do=^J:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:nd=\E[C:se=\E[m:sf=^J:\ :so=\E[7m:ue=\E[m:up=\E[A:us=\E[4m: cs10-w|Datamedia Color Scan 10 with 132 columns:\ :co#132:\ :cm=\E[%i%02;%03H:tc=cs10: # (dm1520: removed obsolete ":ma=^\ ^_^P^YH:" -- esr) dm1520|dm1521|datamedia 1520:\ :am:xn:\ :co#80:it#8:li#24:\ :bl=^G:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :cr=^M:do=^J:\ :ho=^Y:kd=^J:kh=^Y:kl=^H:kr=^\:ku=^_:le=^H:nd=^\:\ :sf=^J:ta=^I:up=^_: dm2500|datamedia2500|datamedia 2500:\ :nc:\ :co#80:li#24:\ :al=\020\n\030\035\030\035:bl=^G:ce=^W:cl=^^^^\177:\ :cm=\014%r%n%.%.:dc=\020\010\030\035:\ :dl=\020\032\030\035:dm=^P:do=^J:ed=^X^]:\ :ei=\377\377\030\035:ho=^B:ic=\020\034\030\035:im=^P:\ :le=^H:nd=^\:pc=\377:se=^X^]:sf=^J:so=^N:up=^Z: # dmchat is like DM2500, but DOES need "all that padding" (jcm 1/31/82) # also, has a meta-key. # From: # (dmchat: ":MT:" changed to ":km:" -- esr) dmchat|dmchat version of datamedia 2500:\ :km:\ :al=1*\020\n\030\035\030\035:dl=2\020\032\030\035:tc=dm2500: # (dm3025: ":MT:" changed to ":km:" -- esr) dm3025|datamedia 3025a:\ :km:\ :co#80:it#8:li#24:\ :al=\EP\n\EQ:bl=^G:cd=\EJ:ce=\EK:cl=\EM:\ :cm=\EY%r%+ %+ :cr=^M:dc=\010:dl=\EP\EA\EQ:dm=\EP:\ :do=^J:ed=\EQ:ei=\EQ:ho=\EH:im=\EP:ip=:is=\EQ\EU\EV:\ :le=^H:nd=\EC:se=\EO0:sf=^J:so=\EO1:ta=^I:up=\EA: dm3045|datamedia 3045a:\ :am:eo:km@:ul:xn:\ :al@:dc=\EB:dl@:dm@:ed@:ei=\EP:is=\EU\EV:k0=\Ey\r:\ :k1=\Ep\r:k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:\ :k6=\Eu\r:k7=\Ev\r:k8=\Ew\r:k9=\Ex\r:kh=\EH:kr=\EC:\ :ku=\EA:pc=\177:se@:so@:tc=dm3025: # Datamedia DT80 soft switches: # 1 0=Jump 1=Smooth # Autorepeat 0=off 1=on # Screen 0=Dark 1=light # Cursor 0=u/l 1=block # # 2 Margin Bell 0=off 1=on # Keyclick 0=off 1=on # Ansi/VT52 0=VT52 1=Ansi # Xon/Xoff 0=Off 1=On # # 3 Shift3 0=Hash 1=UK Pound # Wrap 0=Off 1=On # Newline 0=Off 1=On # Interlace 0=Off 1=On # # 4 Parity 0=Odd 1=Even # Parity 0=Off 1=On # Bits/Char 0=7 1=8 # Power 0=60Hz 1=50Hz # # 5 Line Interface 0=EIA 1=Loop # Aux Interface 0=EIA 1=Loop # Local Copy 0=Off 1=On # Spare # # 6 Aux Parity 0=Odd 1=Even # Aux Parity 0=Off 1=On # Aux Bits/Char 0=7 1=8 # CRT Saver 0=Off 1=On # dm80/1 is a vt100 lookalike, but it doesn't seem to need any padding. dm80|dmdt80|dt80|datamedia dt80/1:\ :cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=%i\E[%d;%dH:do=^J:\ :ho=\E[H:nd=\E[C:pf=\E[4i:po=\E[5i:ps=\E[0i:se=\E[m:\ :so=\E[7m:sr=\EM:ue=\E[m:up=\E[A:us=\E[4m:tc=vt100: # except in 132 column mode, where it needs a little padding. # This is still less padding than the vt100, and you can always turn on # the ^S/^Q handshaking, so you can use vt100 flavors for things like # reverse video. dm80w|dmdt80w|dt80w|datamedia dt80/1 in 132 char mode:\ :co#132:\ :cd=20\E[0J:ce=20\E[0K:cl=50\E[H\E[2J:\ :cm=5\E[%i%d;%dH:do=^J:up=5\E[A:tc=dm80: # From: Adam Thompson Sept 10 1995 dtx-sas|dt80-sas|Datamedia DT803/DTX for SAS usage:\ :am:bw:\ :co#80:li#24:\ :ae=\EG:al=\EL:as=\EF:bl=^G:cd=^K:ce=^]:cl=^L:\ :cm=\E=%r%+ %+ :cr=^M:\ :..cs=\E=%p1%' '%+%c%' '%c\E#1\E=%p2%' '%+%c%' '%c\E#2:\ :ct=\E'0:dl=\EM:do=\EB:ff=^L:ho=^Y:\ :is=\E)0\E<\EP\E'0\E$2:kC=^L:kE=^]:kS=^K:kd=^J:kh=^Y:\ :kl=^H:kr=^\:ku=^_:le=^H:me=^X:mr=\E$2\004:nd=^\:\ :pf=^O:po=^N:se=^X:sf=\EB:so=\E$2\004:sr=\EI:st=\E'1:\ :ta=^I:up=^_: #### Falco # # Falco Data Products # 440 Potrero Avenue # Sunnyvale, CA 940864-196 # Vox: (800)-325-2648 # Fax: (408)-745-7860 # Net: techsup@charm.sys.falco.com # # Current Falco models as of 1995 are generally ANSI-compatible and support # emulations of DEC VT-series, Wyse, and Televideo types. # Test version for Falco ts-1. See for info # This terminal was released around 1983 and was discontinued long ago. falco|ts1|ts-1|falco ts-1:\ :am:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET\EG0\010:cl=\E*:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:\ :im=\Eq:is=\Eu\E3:k0=^A0\r:kd=^J:kl=^H:kr=^L:ku=^K:\ :le=^H:nd=^L:se=\Eg0:sf=^J:so=\Eg1:ta=^I:ue=\Eg0:\ :up=^K:us=\Eg1: falco-p|ts1p|ts-1p|falco ts-1 with paging option:\ :am:da:db:mi:ms:ul:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET\EG0\010\Eg0:\ :cl=\E*:cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=\E[B:\ :ei=\Er:im=\Eq:is=\EZ\E3\E_c:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:nd=\E[C:se=\Eg0:sf=^J:so=\Eg4:\ :ta=^I:te=\E_b:ti=\E_d:ue=\Eg0:up=\E[A:us=\Eg1: # (ts100: I added / based on the init string -- esr) ts100|ts100-sp|falco ts100-sp:\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:\ :K5=\EOn:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E~E:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E~W:dl=\E~R:do=^J:eA=\E(B\E)0:ei=:\ :ho=\E[H:i1=\E~)\E~ea:ic=\E~Q:im=:k0=\EOy:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:\ :k8=\EOl:k9=\EOw:k;=\EOx:kb=^H:kd=\EOB:ke=\E[?1l\E>:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m\017:mr=\E[7m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: ts100-ctxt|falco ts-100 saving context:\ :te=\E~_b:ti=\E~_d\E[2J:tc=ts100: #### Florida Computer Graphics # # Florida Computer Graphics Beacon System, using terminal emulator program # "host.com", as provided by FCG. This description is for an early release # of the "host" program. Known bug: clears the whole screen, so it's # commented out. # From: David Bryant 1/7/83 beacon|FCG Beacon System:\ :am:da:db:\ :co#80:li#32:\ :al=\EE:bl=\ESTART\r\E37\r\EEND\r:ce=\ET:cl=\EZ:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=:ho=\EH:\ :ic=\EQ:im=:le=^H:mb=\ESTART\r\E61\0541\r\EEND\r:\ :me=\ESTART\r\E78\r\E70\0540\r\EEND\r:\ :mr=\ESTART\r\E59\0541\r\EEND\r:nd=\EV:\ :se=\ESTART\r\E70\0540\r\EEND\r:sf=^J:\ :so=\ESTART\r\E70\0546\r\EEND\r:\ :ti=\ESTART\r\E2\0540\r\E12\r\EEND\r:\ :ue=\ESTART\r\E60\0540\r\EEND\r:up=\EU:\ :us=\ESTART\r\E60\0541\r\EEND\r: #### Fluke # # The 1720a differences from ANSI: no auto margin, destructive # tabs, # of lines, funny highlighting and underlining f1720|f1720a|fluke 1720A:\ :xt:\ :co#80:li#16:sg#1:ug#1:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cr=^M:do=\E[B:is=\E[H\E[2J:kd=^]:kl=^_:kr=^^:ku=^\:\ :le=^H:nd=\E[C:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:\ :ue=\E[m:up=\E[A:us=\E[4m: #### Liberty Electronics (Freedom) # # Liberty Electronics # 48089 Fremont Blvd # Fremont CA 94538 # Vox: (510)-623-6000 # Fax: (510)-623-7021 # From: f100|freedom|freedom100|freedom model 100:\ :am:bw:hs:mi:ms:xo:\ :co#80:li#24:\ :ae=\E$:al=\EE:as=\E%:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :ch=\E]%+ :cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E3:cv=\E[%+ :\ :dc=\EW:dl=\ER:do=^J:ds=\Eg\Ef\r:ei=\Er:fs=^M:ho=^^:\ :im=\Eq:ip=:is=\Eg\Ef\r\Ed:k1=^A@\r:k2=^AA\r:\ :k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:k9=^AH\r:k;=^AI\r:kB=\EI:kb=^H:kd=^V:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\EG0:sf=^J:so=\EG4:\ :sr=\Ej:st=\E1:ta=^I:ts=\Eg\Ef:ue=\EG0:up=^K:us=\EG8:\ :vb=\Eb\Ed: f100-rv|freedom-rv|freedom 100 in reverse video:\ :is=\Eg\Ef\r\Eb:vb=\Ed\Eb:tc=f100: # The f110 and f200 have problems with vi(1). They use the ^V # code for the down cursor key. When kcud1 is defined in terminfo # as ^V, the Control Character Quoting capability (^V in insert mode) # is lost! It cannot be remapped in vi because it is necessary to enter # a ^V to to quote the ^V that is being remapped!!! # # f110 users will have to decide whether # to lose the down cursor key or the quoting capability. We will opt # initially for leaving the quoting capability out, since use of VI # is not generally applicable to most interactive applications # # The same applies to f200 users, except that another option exists. # This option has been chosen locally. It will not be distributed unless # a user runs into this problem and requests assistance. Very few users, # if any, should run into this problem. The local solution is in # vifix.local.ti. The f200 has the ability to reprogram the down cursor # key. The key is reprogrammed to ^J (linefeed). This value is remembered # in non-volatile RAM, so powering the terminal off and on will not cause # the change to be lost. The terminfo definition for the f200 is changed # to identify as ^J instead of ^V. # (f110: added , & from f100 -- esr) f110|freedom110|Liberty Freedom 110:\ :bw@:es:\ :it#8:ws#80:\ :ae=\E%%:al=\EE:as=\E$:dl=\ER:do=^V:ds=\Ef\r:\ :ei=\Er\EO:im=\EO\Eq:ip@:is@:k0=^AI\r:k;@:kA=\EE:\ :kC=^^:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kS=\EY:mb=\EG2:\ :md=\EG0:me=\EG0:mh=\EG@:mk=\EG1:mr=\EG4:pf=\Ea:\ :po=\E`:so=\EG<:sr=\EJ:ts=\Ef:vb=\Eb\Ed:ve=\E.2:\ :vi=\E.1:vs=\E.2:tc=f100: f110-14|Liberty Freedom 110 14inch:\ :dc@:tc=f110: f110-w|Liberty Freedom 110 - 132 cols:\ :co#132:tc=f110: f110-14w|Liberty Freedom 110 14in/132 cols:\ :co#132:\ :dc@:tc=f110: f200|freedom200|Liberty Freedom 200:\ :am:es:hs:mi:ms:xo:\ :co#80:it#8:li#24:ws#80:\ :ae=\E%%:al=\EE:as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :ch=\E]%+ :cl=^Z:cm=\E=%+ %+ :cr=^M:cs=\Em0%+ %+ :\ :ct=\E3:cv=\E[%+ :dc=\EW:dl=\ER:do=^V:ds=\Ef\r:\ :ei=\Er:fs=^M:ho=^^:im=\Eq:k0=^AI\r:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=\EE:kC=^^:kD=\EW:\ :kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^V:kl=^H:kr=^L:\ :ku=^K:le=^H:mb=\EG2:md=\EG0:me=\EG0:mh=\EG@:mk=\EG1:\ :mr=\EG4:nd=^L:pf=\Ea:po=\E`:se=\EG0:sf=^J:so=\EG<:\ :sr=\EJ:st=\E1:ts=\Ef:ue=\EG0:up=^K:us=\EG8:\ :vb=\Eo\En:ve=\E.1:vi=\E.0:vs=\E.1: f200-w|Liberty Freedom 200 - 132 cols:\ :co#132:tc=f200: f200vi|Liberty Freedom 200 for vi:\ :kd=^J:vb=\Eb\Ed:tc=f200: f200vi-w|Liberty Freedom 200 - 132 cols for vi:\ :co#132:tc=f200vi: #### GraphOn (go) # # Graphon Corporation # 544 Division Street # Campbell, CA 95008 # Vox: (408)-370-4080 # Fax: (408)-370-5047 # Net: troy@graphon.com (Troy Morrison) # # # The go140 and go225 have been discontinued. GraphOn now makes X terminals, # including one odd hybrid that starts out life on power-up as a character # terminal, than can be switched to X graphics mode (driven over the serial # line) by an escape sequence. No info on this beast yet. # (go140: I added / based on the init string -- esr) go140|graphon go-140:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=10\E[J:ce=\E[K:\ :cl=10\E[H\E[2J:cm=\E[%i%2;%2H:dc=\E[P:dl=\E[M:\ :ei=\E[4l:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E<\E=\E[?3l\E[?7l\E(B\E[J\E7\E[;r\E8\E[m\E[q:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kd=\EOB:\ :ke=\E[?1l\E>:kh=\E[H:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:nd=\E[C:se=\E[m:so=\E[7m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: go140w|graphon go-140 in 132 column mode:\ :am:\ :co#132:\ :is=\E<\E=\E[?3h\E[?7h\E(B\E[J\E7\E[;r\E8\E[m\E[q:tc=go140: # Hacked up vt200 termcap to handle GO-225/VT220 # From: # (go225: I added / based on the init string -- esr) go225|go-225|Graphon 225:\ :am:mi:xn:\ :co#80:it#8:li#25:vt#3:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cs=\E[%i%d;%dr:dc=\E[P:\ :dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:ke=\E>:\ :kh=\E[H:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r1=\E[!p\E[?7h\E[2;1;1#w:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:te=\E[!p\E[?7h\E[2;1;1#w:\ :ti=\E[2;0#w\E[1;25r:ue=\E[24m:up=\E[A:us=\E[4m: #### Harris (Beehive) # # Bletch. These guys shared the Terminal Brain Damage laurels with Hazeltine. # Their terminal group is ancient history now (1995) though the parent # company is still in business. # # Beehive documentation is undated and marked Preliminary and has no figures # so we must have early Superbee2 (Model 600, according to phone conversation # with mfr.). It has proved reliable except for some missing padding # (notably after \EK and at bottom of screen). # # The key idea is that AEP mode is poison for & that US's in # the local memory should be avoided like the plague. That means # that the 2048 character local buffer is used as 25 lines of 80 # characters, period. No scrolling local memory, folks. It also # appears that we cannot use naked INS LINE feature since it uses # US. The sbi fakes with an 80-space insert that may be too # slow at low speeds; also spaces get converted to \040 which is # too long for some programs (not vi). DEL LINE is ok but slow. # # The string is designed for last line of screen ONLY; cup to # 25th line corrects the motion inherent in scrolling to Page 1. # # There is one understood bug. It is that the screen appears to # pop to a new (blank) page after a , or leave a half-line # ellipsis to a quad that is the extra 48 memory locations. The # data received is dumped into memory but not displayed. Not to # worry if is being used; the lines not displayed will be, # whenever the cursor is moved up there. Since is addressed # relative to MEMORY of window, nothing is lost; but beware of # relative cursor motion (,,,). Recommended, # therefore, is setenv MORE -c . # # WARNING: Not all features tested. # # Timings are assembled from 3 sources. Some timings may reflect # SB2/Model 300 that were used if more conservative. # Tested on a Model 600 at 1200 and 9600 bd. # # The BACKSPACEkb option is cute. The NEWLINE key, so cleverly # placed on the keyboard and useless because of AEP, is made # into a backspace key. In use ESC must be pressed twice (to send) # and sending ^C must be prefixed by ESC to avoid that weird # transmit mode associated with ENTER key. # # IF TERMINAL EVER GOES CATATONIC with the cursor buzzing across # the screen, then it has dropped into ENTER mode; hit # RESET--ONLINE--!tset. # # As delivered this machine has a FATAL feature that will throw # it into that strange transmit state (SPOW) if the space bar is # hit after a CR is received, but before receiving a LF (or a # few others). # # The circuits MUST be modified to eliminate the SPOW latch. # This is done by strapping on chip A46 of the I/O board; cut # the p.c. connection to Pin 5 and strap Pin 5 to Pin 8 of that # chip. This mod has been checked out on a Mod 600 of Superbee II. # With this modification absurdly high timings on cr are # unnecessary. # # NOTE WELL that the rear panel switch should be set to CR/LF, # not AEP! # sb1|beehive superbee:\ :am:bw:da:db:mi:ul:xb:\ :co#80:li#25:sg#1:ug#1:\ :al=\EN\EL\EQ \EP \EO\ER\EA:\ :bl=^G:bt=\E`:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EF%r%03%03:\ :cr=\r:ct=\E3:dc=\EP:dl=\EM:do=^J:ei=\ER:ho=\EH:\ :im=\EQ\EO:is=\EE\EX\EZ\EO\Eb\Eg\ER:k0=\E2:k1=\Ep:\ :k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:\ :k9=\E1:kE=\EK:kI=\EQ\EO:kL=\EM:kM=\ER:kS=\EJ:kb=^_:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:l0=TAB CLEAR:\ :l9=TAB SET:le=^H:nd=\EC:se=\E_3:sf=^J:so=\E_1:\ :st=\E1:ta=^I:ti=\EO:ue=\E_3:up=\EA:us=\E_0: sbi|superbee|beehive superbee at Indiana U.:\ :xb:\ :al=1\EN\EL\EQ \EP \EO\ER\EA:cr=\r:tc=sb1: # Alternate (older) description of Superbee - f1=escape, f2=^C. # Note: there are at least 3 kinds of superbees in the world. The sb1 # holds onto escapes and botches ^C's. The sb2 is the best of the 3. # The sb3 puts garbage on the bottom of the screen when you scroll with # the switch in the back set to CRLF instead of AEP. This description # is tested on the sb2 but should work on all with either switch setting. # The f1/f2 business is for the sb1 and the can be taken out for # the other two if you want to try to hit that tiny escape key. # This description is tricky: being able to use cup depends on there being # 2048 bytes of memory and the hairy string. superbee-xsb|beehive super bee:\ :am:da:db:xb:\ :co#80:it#8:li#25:\ :cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EF%r%3%3:cr=\r:ct=\E3:\ :dc=\EP:dl=\EM:do=^J:ho=\EH:is=\EH\EJ:k1=\Ep:k2=\Eq:\ :k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:kd=\EB:\ :kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\E_3:\ :sf=\n\200\200\200\n\200\200\200\EA\EK\200\200\200\ET\ET:\ :so=\E_1:st=\E1:ta=^I:up=\EA:ve=^J: # This loses on lines > 80 chars long, use at your own risk superbeeic|super bee with insert char:\ :ei=\ER:ic=:im=\EQ:tc=superbee-xsb: sb2|sb3|fixed superbee:\ :xb@:tc=superbee: # Reports are that most of these Beehive entries (except superbee) have not # been tested and do not work right. is a trouble spot. Be warned. # (bee: was empty, which is obviously bogus -- esr) beehive|bee|harris beehive:\ :am:mi:\ :co#80:li#24:\ :al=\EL:bt=\E>:cd=\EJ:ce=\EK:cl=\EE:cm=\EF%+ %+ :\ :dc=\EP:dl=\EM:do=\EB:ei=\E@:ho=\EH:im=\EQ:kA=\EL:\ :kB=\E>:kC=\EE:kD=\EP:kE=\EK:kI=\EQ:kL=\EM:kM=\E@:\ :kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:\ :nd=\EC:se=\Ed@:so=\EdP:ue=\Ed@:up=\EA:us=\Ed`: # set tab is ^F, clear (one) tab is ^V, no way to clear all tabs. # good grief - does this entry make :sg:/:ug: when it doesn't have to? # look at those spaces in /. Seems strange to me... beehive3|bh3m|beehiveIIIm|harris beehive 3m:\ :am:\ :co#80:it#8:li#20:\ :al=\023:bl=^G:cd=^R:ce=^P:cl=^E^R:cr=^M:dl=\021:\ :do=^J:ho=^E:if=/usr/share/tabset/beehive:le=^H:\ :ll=^E^K:nd=^L:se= ^_:sf=^J:so=^] :ta=^I:up=^K: beehive4|bh4|beehive 4:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EE:cr=^M:do=^J:ho=\EH:\ :le=\ED:nd=\EC:sf=^J:up=\EA: microb|microbee|micro bee series:\ :am:\ :co#80:it#8:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EE:cm=\EF%+ %+ :cr=^M:do=^J:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:\ :k8=\Ew:k9=\Ex:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:\ :le=^H:nd=\EC:se=\Ed@ :sf=^J:so= \EdP:ta=^I:ue=\Ed@:\ :up=\EA:us=\Ed`: # 8675, 8686, and bee from Cyrus Rahman # (8675: changed k10, k11...k16 to k;, F1...F6 -- esr) ha8675|harris 8675:\ :F1=^W:F2=\ER:F3=\EE:F4=\EI:F5=\Ei:F6=\Eg:\ :is=\ES\E#\E*\Eh\Em\E?\E1\E9\E@\EX\EU:k1=^F:k2=^P:\ :k3=^N:k4=^V:k5=^J:k6=^T:k7=^H:k8=\177:k9=\Ee:k;=\Ed:tc=bee: # (8686: changed k10, k11...k16 to k;, F1...F6; fixed broken continuation # in :is: -- esr) ha8686|harris 8686:\ :F1=\EW:F2=\002\E{\003:F3=\002\E|\003:F4=\002\E}\003:\ :F5=\002\E~\003:F6=\002\E\177\003:\ :is=\ES\E#\E*\Eh\Em\E?\E1\E9\E@\EX\EU\E"*Z01\E"8F35021B7C83#\E"8F45021B7D83#\E"8F55021B7E83#\E"8F65021B7F83#\E"8F75021B7383#\E"8F851BD7#\E"8F95021B7083#\E"8FA5021B7183#\E"8FB5021B7283#:\ :k1=\002\Ep\003:k2=\002\Eq\003:k3=\002\Er\003:\ :k4=\002\Es\003:k5=\E3:k6=\EI:k7=\ER:k8=\EJ:k9=\E(:\ :k;=\Ej:tc=bee: #### Hazeltine # # Hazeltine appears to be out of the business now (1995). These guys were # co-owners of the Terminal Brain Damage Hall Of Fame along with Harris. # They have a hazeltine.com domain and can be reached at: # # Hazeltine # 450 East Pulaski Road # Greenlawn, New York 11740 # # As late as 1993, manuals for the terminal product line could still be # purchased from: # # TRW Customer Service Division # 15 Law Drive # P.O. Box 2076 # Fairfield, NJ 07007-2078 # # Since is blank, when you want to erase something you # are out of luck. You will have to do ^L's a lot to # redraw the screen. h1000 is untested. It doesn't work in # vi - this terminal is too dumb for even vi. (The code is # there but it isn't debugged for this case.) hz1000|hazeltine 1000:\ :co#80:li#12:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=^K:le=^H:nd= :sf=^J: # From: Thu Aug 20 09:09:18 1981 hz1420|hazeltine 1420:\ :am:\ :co#80:li#24:\ :al=\E^Z:bl=^G:cd=\E^X:ce=\E^O:cl=\E^\:\ :cm=\E\021%r%.%+ :cr=^M:dl=\E^S:do=^J:le=^H:nd=^P:\ :se=\E^Y:sf=^J:so=\E^_:ta=^N:up=\E^L: # New "safe" cursor movement (11/87) from . Prevents # freakout with out-of-range args and tn3270. No hz since it needs to # receive tildes. hz1500|hazeltine 1500:\ :am:hz:\ :co#80:li#24:\ :al=~\032:bl=^G:cd=~\030:ce=~^O:cl=~^\:\ :cm=~\021%r%>^^ %+`%+`:cr=^M:dl=~\023:do=~^K:ho=~^R:\ :kd=^J:kh=~^R:kl=^H:kr=^P:ku=~^L:le=^H:nd=^P:se=~^Y:\ :sf=^J:so=~^_:up=~^L: # h1510 assumed to be in sane escape mode. Else use h1500. # (h1510: early versions of this entry apparently had "=\E^_, # =\E^Y, but these caps were commented out in 8.3; also, # removed incorrect and overridden ":do=^J:" -- esr) hz1510|hazeltine 1510:\ :am:\ :co#80:li#24:\ :al=\E^Z:bl=^G:cd=\E^X:ce=\E^O:cl=\E^\:\ :cm=\E\021%r%.%.:cr=^M:dl=\E^S:do=\E^K:le=^H:nd=^P:\ :sf=^J:up=\E^L: # (h1520: removed incorrect and overridden ":do=^J:" -- esr) hz1520|hazeltine 1520:\ :am:hz:\ :co#80:li#24:\ :al=~^Z:bl=^G:cd=~^X:ce=~^O:cl=~^\:cm=~\021%r%.%.:\ :cr=^M:dl=~^S:do=~^K:ho=~^R:le=^H:nd=^P:se=~^Y:sf=^J:\ :so=~^_:up=~^L: # Note: the h1552 appears to be the first Hazeltine terminal which # is not braindamaged. It has tildes and backprimes and everything! # Be sure the auto lf/cr switch is set to cr. hz1552|hazeltine 1552:\ :al=\EE:dl=\EO:do=^J:k1=\EP:k2=\EQ:k3=\ER:l1=blue:\ :l2=red:l3=green:tc=vt52: hz1552-rv|hazeltine 1552 reverse video:\ :do=^J:se=\ET:so=\ES:tc=hz1552: # Note: h2000 won't work well because of a clash between upper case and ~'s. hz2000|hazeltine 2000:\ :am:nc:\ :co#74:li#27:\ :al=~\032:bl=^G:cl=~\034:cm=~\021%r%.%.:dl=~\023:\ :do=^J:ho=~^R:le=^H:pc=\177:sf=^J: # Date: Fri Jul 23 10:27:53 1982. Some unknown person wrote: # I tested this termcap entry for the Hazeltine Esprit with vi. It seems # to work ok. There is one problem though if one types a lot of garbage # characters very fast vi seems not able to keep up and hangs while trying # to insert. That's in insert mode while trying to insert in the middle of # a line. It might be because the Esprit doesn't have insert char and delete # char as a built in function. Vi has to delete to end of line and then # redraw the rest of the line. esprit|Hazeltine Esprit I:\ :am:bw:\ :co#80:li#24:\ :al=\E^Z:bl=^G:bt=\E^T:cd=\E^W:ce=\E^O:cl=\E^\:\ :cm=\E\021%r%.%.:cr=^M:dl=\E^S:do=\E^K:ho=\E^R:\ :is=\E?:k0=^B0^J:k1=^B1^J:k2=^B2^J:k3=^B3^J:k4=^B4^J:\ :k5=^B5^J:k6=^B6^J:k7=^B7^J:k8=^B8^J:k9=^B9^J:kb=^H:\ :kd=\E^K:ke=\E>:kh=\E^R:kl=^H:kr=^P:ks=\E<:ku=\E^L:\ :l0=0:l1=1:l2=2:l3=3:l4=4:l5=5:l6=6:l7=7:l8=8:l9=9:\ :le=^H:nd=^P:se=\E^Y:sf=^J:so=\E^_:up=\E^L: esprit-am|hazeltine esprit auto-margin:\ :am:tc=esprit: #### IBM # ibm327x|line mode IBM 3270 style:\ :gn:\ :ce=^M:cl=^M^J:ho=^M: # Beware! The 3101 entry IBM shipped with AIX 3 is *wrong*. Losers... # From: J.B. Nicholson-Owens 8 Mar 94 ibm3101|i3101|IBM 3101-10:\ :am:xo:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EK:cm=\EY%+ %+ :cr=^M:\ :ct=\E1:do=^J:ho=\EH:if=/usr/share/tabset/ibm3101:\ :kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :nw=^M^J:sf=^J:st=\E0:ta=^I:up=\EA: # Received from the IBM terminals division (given to DRB) # June 1988 for PS/2 OS 2.2.3 cut ibm3151|i3151|IBM 3151:\ :me=\E4@:\ :..sa=\E4%{64}%?%p1%{0}%>%p1%{4}%<%&%t%{8}%|%;%?%p1%{7}%=%t%{16}%|%;%?%p2%t%{1}%|%;%?%p3%t%{4}%|%;%?%p4%t%{2}%|%;%c:\ :se=\E4@:so=\E4A:ue=\E4@:us=\E4B:tc=ibm3163: # From: Mark Easter 29 Oct 1992 # I've commented out or translated some IBM extensions. ibm3161|ibm3163|wy60-316X|wyse60-316X|IBM 3161/3163 display:\ :am:mi:ms:\ :co#80:it#8:li#24:\ :F1=\Ek\r:F2=\El\r:F3=\E!a\r:F4=\E!b\r:F5=\E!c\r:\ :F6=\E!d\r:F7=\E!e\r:F8=\E!f\r:F9=\E!g\r:FA=\E!h\r:\ :FB=\E!i\r:FC=\E!j\r:FD=\E!k\r:FE=\E!l\r:\ :ac=l\354q\361k\353x\370j\352m\355w\367u\365v\366t\364n\356:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:\ :dc=\EQ:dl=\EO:do=\EB:ho=\EH:k1=\Ea\r:k2=\Eb\r:\ :k3=\Ec\r:k4=\Ed\r:k5=\Ee\r:k6=\Ef\r:k7=\Eg\r:\ :k8=\Eh\r:k9=\Ei\r:k;=\Ej\r:kA=\EN:kB=\E2:kC=\EL\r:\ :kD=\EQ:kE=\EI:kI=\EP \010:kL=\EO:kS=\EJ:kT=\E0:\ :ka=\E 1:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:kt=\E1:\ :ku=\EA:le=\ED:mb=\E4D:md=\E4H:me=\E4@\E<@:mk=\E4P:\ :mr=\E4A:nd=\EC:\ :..sa=\E4%'@'%?%p1%t%'A'%|%;\n%?%p2%t%'B'%|%;\n%?%p3%t%'A'%|%;\n%?%p4%t%'D'%|%;\n%?%p5%t%'@'%|%;\n%?%p6%t%'H'%|%;\n%?%p7%t%'P'%|%;%c\n%?%p9%t\E>A%e\E<@%;:\ :se=\E4@:sf=^J:so=\E4A:te=\E>A:ti=\E>A:ue=\E4@:\ :up=\EA:us=\E4B: # How the 3164 sgr string works: # %{32} # push space for no special video characteristics # %?%p2%t%{1}%|%; # if p2 set, then OR the 1 bit for reverse # %?%p3%t%{4}%|%; # if p3 set, then OR the 4 bit for blink # %?%p4%t%{2}%|%; # if p4 set, then OR the 2 bit for underline # %c # pop Pa1 # %{39}%p1%- # calculate 32 + (7 - p1) for foreground # %c # pop Pa2 # %{64} # use only black background for now # %c # pop Pa3 ibm3164|i3164|IBM 3164:\ :mb=\E4D:md=\E4H:me=\E4@:\ :..sa=\E4%{32}%?%p2%t%{1}%|%;%?%p3%t%{4}%|%;%?%p4%t%{2}%|%;%c%{39}%p1%-%c%{64}%c:tc=ibm3163: ibmaed|IBM Experimental display:\ :am:eo:ms:\ :co#80:it#8:li#52:\ :al=\EN:cd=\EJ:ce=\EI:cl=\EH\EK:cm=\EY%+ %+ :dc=\EQ:\ :dl=\EO:do=\EB:ei=:ho=\EH:ic=\EP:im=:kb=^H:kd=\EB:\ :kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\E0:so=\E0:\ :ta=^I:up=\EA:vb=\EG: ibm-apl|apl|IBM apl terminal simulator:\ :li#25:tc=dm1520: # (ibmmono: this had an unknown `sb' boolean, I changed it to `bs'. # Also it had ":I0=f10:" which pretty obviously should be "l0=f10" -- esr) ibmmono|ibm5151|IBM workstation monochrome:\ :es:hs:\ :al=\EL:dl=\EM:ds=\Ej\EY8 \EI\Ek:fs=\Ek:k0=\E<:\ :k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:\ :k8=\ER:k9=\EY:kF=\EE:kI=\200:kN=\EE:kP=\Eg:kR=\EG:\ :kb=^H:kh=\EH:l0=f10:md=\EZ:me=\Ew\Eq\Ez\EB:\ :mk=\EF\Ef0;\Eb0;:mr=\Ep:se=\Ez:so=\EZ:sr=\EA:\ :ts=\Ej\EY8%+ \Eo:ue=\Ew:us=\EW:tc=ibm3101: ibmega|ibm5154|IBM Enhanced Color Display:\ :cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ibmmono: ibmega-c|ibm5154-c|IBM Enhanced Color Display:\ :se=\EB:so=\EF\Ef3;:ue=\EB:us=\EF\Ef2;:tc=ibmmono: ibmvga-c|IBM VGA display color termcap:\ :cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ibmega-c: ibmvga|IBM VGA display:\ :cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ibmega: # ibmapa* and ibmmono entries come from ACIS 4.3 distribution rtpc|ibmapa16|ibm6155|IBM 6155 Extended Monochrome Graphics Display:\ :li#32:\ :ds=\Ej\EY@ \EI\Ek:ts=\Ej\EY@%+ \Eo:tc=ibmmono: # Advanced Monochrome (6153) and Color (6154) Graphics Display: ibmapa8c|ibmapa8|ibm6154|ibm6153|IBM 6153/4 Advanced Graphics Display:\ :li#31:\ :ds=\Ej\EY? \EI\Ek:ts=\Ej\EY?%+ \Eo:tc=ibmmono: ibmapa8c-c|ibm6154-c|IBM 6154 Advanced Color Graphics Display:\ :li#31:\ :ds=\Ej\EY? \EI\Ek:mh=\EF\Ef7;:ts=\Ej\EY?%+ \Eo:tc=ibmega-c: # From: Marc Pawliger # also in /usr/lpp/bos/bsdsysadmin. # (hft-c: this entry had :kb=\E[D:kf=\E[C: on the line with ku/kd/kh; this was # pretty obviously mislabeled for :le: and :nd:; also ":ul=\E[4m:" was clearly # a typo for ":us=\E[4m:"; also ":el=\E[K:" was a typo for ":ce=\E[K:". # I also added / based on the terminal reset string. # There was an unknown boolean ":ht:" which I assume was meant to set # hardware tabs, so I have inserted it#8. Finally, "ac=^N" paired with the # ae looked like a typo for ":as=^N:" -- esr) ibm8512|ibm8513|hft-c|IBM High Function Terminal:\ :am:mi:ms:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DL=\E[%dM:RA=\E[?7l:SA=\E[?7h:ae=^O:\ :al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:dl=\E[M:dm=\E[4h:do=^J:ec=\E[%dX:\ :ed=\E[4l:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\Eb\E[m\017\E[?7h:k0=\E[010q:k1=\E[001q:\ :k2=\E[002q:k3=\E[003q:k4=\E[004q:k5=\E[005q:\ :k6=\E[006q:k7=\E[007q:k8=\E[008q:k9=\E[009q:kd=\E[B:\ :kh=\E[H:ku=\E[A:le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:r1=\Eb\E[m\017\E[?7h\E[H\E[J:\ :rc=\E[u:sc=\E[s:se=\E[m:so=\E[7m:te=\E[20h:\ :ti=\E[20;4l\E[?7h\Eb:ue=\E[m:up=\E[A:us=\E[4m: hft|AIWS High Function Terminal:\ :am:xo:\ :co#80:li#25:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=\E6:\ :ho=\E[H:ic=\E[@:im=\E6:k1=\E[001q:k2=\E[002q:\ :k3=\E[003q:k4=\E[004q:k5=\E[005q:k6=\E[006q:\ :k7=\E[007q:k8=\E[008q:k9=\E[009q:kN=\E[153q:\ :kP=\E[159q:ka=\E[010q:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mk=\E[8m:mr=\E[7m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:\ :ta=^I:ue=\E[m:up=\E[A:us=\E[4m: ibm-system1|system1|ibm system/1 computer:\ :am:xt:\ :co#80:li#24:\ :bl=^G:cl=^Z:cm=\005%+ %+ :ho=^K:le=^H:nd=^\:sf=^J:\ :up=^^: # From: ibm5081|ibmmpel|IBM 5081 1024x1024 256/4096 color display:\ :es:hs:\ :li#33:\ :ds=\Ej\EYA \EI\Ek:fs=\Ek:ts=\Ej\EYA%+ \Eo:tc=ibmmono: ibm5081-c|ibmmpel-c|IBM 5081 1024x1024 256/4096 enhanced color display:\ :es:hs:\ :li#33:\ :ds=\Ej\EYA \EI\Ek:fs=\Ek:ts=\Ej\EYA%+ \Eo:tc=ibmega-c: ibm8514|IBM 8514 color display:\ :es:hs:\ :li#41:\ :cr=^M:do=^J:ds=\Ej\EYI \EI\Ek:fs=\Ek:kb=^H:kd=^J:\ :kl=^H:nw=^M^J:sf=^J:ta=^I:ts=\Ej\EYI%+ \Eo:tc=ibmega: ibm8514-c|IBM 8514 color display:\ :es:hs:\ :li#41:\ :cr=^M:do=^J:ds=\Ej\EYI \EI\Ek:fs=\Ek:kb=^H:kd=^J:\ :kl=^H:nw=^M^J:sf=^J:ta=^I:ts=\Ej\EYI%+ \Eo:tc=ibmega-c: # # AIX entries. IBM ships these with AIX 3. # AIX extension caps are commented out, # except for box1 which has been translated to an string. # aixterm-m|IBM AIXterm Monochrome Terminal Emulator:\ :es:hs:\ :ac=llqqkkxxjjmmwwuuvvttnn:ds=\E[?E:fs=\E[?F:\ :md=\E[1m:me=\E[0;10m\E(B:s0=\E(B:s1=\E(0:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sr@:ts=\E[?%p1%dT:tc=ibm6153: aixterm-m-old|IBM AIXterm Monochrome Terminal Emulator:\ :es:hs:\ :ds=\E[?E:fs=\E[?F:md=\E[1m:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sr@:ts=\E[?%p1%dT:tc=ibm6153: jaixterm-m|IBM Kanji AIXterm Monochrome Terminal Emulator:\ :ac@:tc=aixterm-m: #### Infoton/General Terminal Corp. # # gt100 sounds like something DEC would come out with. Let's hope they don't. i100|gt100|gt100a|General Terminal 100A (formerly Infoton 100):\ :am:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=^L:cm=\Ef%r%+ %+ :\ :cr=^M:dl=\EM:do=^J:ho=\EH:le=^H:nd=\EC:se=\Ea:sf=^J:\ :so=\Eb:up=\EA:vb=\Eb\Ea: i400|infoton 400:\ :am:\ :co#80:li#25:\ :al=\E[L:bl=^G:ce=\E[N:cl=\E[2J:cm=%i\E[%3;%3H:cr=^M:\ :dc=\E[4h\E[2Q\E[P\E[4l\E[0Q:dl=\E[M:do=^J:\ :ei=\E[4l\E[0Q:im=\E[4h\E[2Q:le=^H:nd=\E[C:sf=^J:\ :up=\E[A: # (addrinfo: removed obsolete ":bc=^Z:" -- esr) addrinfo:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^K:cl=^L:..cm=\037%p1%{1}%-%c%p2%{1}%-%c:\ :cr=^M:do=^J:ho=^H:le=^Z:ll=^H^\:nd=^Y:sf=^J:up=^\: # (infoton: used to have the no-ops #0, #0, #0 -- esr) infoton:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^K:cl=^L:cr=^M:do=^J:le=^Z:ll=^H^\:nd=^Y:\ :sf=^J:up=^\: #### Interactive Systems Corp # # ISC used to sell OEMed and customized hardware to support ISC UNIX. # ISC UNIX still exists in 1995, but ISC itself is no more; they got # bought out by Sun. # # From: Wed Sep 16 08:06:44 1981 # (intext: removed obsolete ":ma=^K^P^R^L^L ::bc=^_:", also the # ":le=^_:" later overridden -- esr) intext|Interactive Systems Corporation modified owl 1200:\ :am:\ :co#80:it#8:li#24:sg#1:\ :al=\020:bl=^G:bt=^Y:cd=\026J:ce=^Kp^R:cl=\014:\ :cm=\017%+ %+ :cr=^M:dc=\022:dl=\021:do=^J:ei=^V<:\ :im=^V;:ip=:k0=^VJ\r:k1=^VA\r:k2=^VB\r:k3=^VC\r:\ :k4=^VD\r:k5=^VE\r:k6=^VF\r:k7=^VG\r:k8=^VH\r:\ :k9=^VI\r:kb=^H:kd=^J:ke=^V9:kh=^Z:kl=^_:kr=^^:\ :ks=\036\072\264\026%:ku=^\:le=^H:nd=^^:se=^V# :\ :sf=^J:so=^V$\054:ta=^I:up=^\: intext2|intextii|INTERACTIVE modified owl 1251:\ :am:bw:ul:\ :co#80:li#24:sg#0:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%+^AG:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=:ic=\E[@:im=:k0=\E@\r:k1=\EP\r:k2=\EQ\r:\ :k3=\ES\r:k4=\ET\r:k5=\EU\r:k6=\EV\r:k7=\EW\r:\ :k8=\EX\r:k9=\EY\r:kb=^H:kd=\EB\r:kh=\ER\r:kl=\ED\r:\ :kr=\EC\r:ku=\EA\r:l0=REFRSH:l1=DEL CH:l2=TABSET:\ :l3=GOTO:l4=+PAGE:l5=+SRCH:l6=-PAGE:l7=-SRCH:l8=LEFT:\ :l9=RIGHT:nd=\E[C:se=\E[2 D:sf=\E[S:so=\E[6 D:\ :sr=\E[T:ta=^I:ue=\E[2 D:up=\E[A:us=\E[18 D:\ :vb=\E[;;;;;;;;;2;;u\E[;;;;;;;;;1;;u: #### Kimtron (abm, kt) # # Kimtron entries include (undocumented) codes for: enter dim mode, # enter bold mode, enter reverse mode, turn off all attributes. # # Kimtron ABM 85 added by Dual Systems # (abm85: removed duplicated ":kd=^J:" -- esr) abm85|Kimtron ABM 85:\ :am:bw:ms:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EE:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :\ :dc=\EW:dl=\ER:do=^J:ei=\Er:\ :if=/usr/share/tabset/stdcrt:im=\EQ:\ :is=\EC\EX\Eg\En\E%\Er\E(\Ek\Em\Eq:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\Ek:so=\Ej:ta=^I:\ :ue=\Em:up=^K:us=\El: # Kimtron ABM 85H added by Dual Systems. # Some notes about the 85h entries: # 1) there are several firmware revs of 85H in the world. Use abm85h-old for # firmware revs prior to SP51 # 2) Make sure to use 85h entry if the terminal is in 85H mode and the # 85e entry if it is in 920 emulation mode. They are incompatible in # some places and NOT software settable i.e., can't fix it) # 3) In 85h mode, the arrow keys and special functions transmit when # the terminal is in dup-edit, and work only locally in local-edit. # Vi won't swallow `del char' for instance, but turns on # dup-edit anyway so that the arrow keys will work right. If the # arrow keys don't work the way you like, change , , and # . Note that 920E mode does not have software commands to toggle # between dup and local edit, so you get whatever was set last on the # terminal. # 4) attribute is nice, but seems too slow to work correctly # (\Eb\Ed) # 5) Make sure `hidden' attributes are selected. If `embedded' attributes # are selected, the entry should be removed. # 6) auto new-line should be on (selectable from setup mode only) # # From: Erik Fair Sun Oct 27 07:21:05 1985 abm85h|Kimtron ABM 85H native mode:\ :hs:\ :sg@:ug@:\ :bl=^G:ds=\Ee:fs=^M:im=\EZ:\ :is=\EC\EN\EX\024\016\EA\Ea\E%\E9\Ee\Er\En\E"\E}\E'\E(\Ef\r\EG0\Ed\E.4\El:\ :kd=^V:me=\E(\EG0:mh=\E):mr=\EG4:se=\EG0:so=\EG4:\ :ts=\Eg\Ef:ue=\EG0:us=\EG8:vb@:ve=\E.4:vs=\E.2:tc=abm85: abm85e|Kimtron ABM 85H in 920E mode:\ :sg@:\ :bl=^G:im=\EZ:\ :is=\EC\EX\EA\E%\E9\Ee\Er\En\E"\E}\E'\E(\Ef\r\Ek\Eq\Em:\ :me=\E(\Ek:mh=\E):mr=\Ej:vb@:tc=abm85: abm85h-old|oabm85h|o85h|Kimtron ABM 85H with old firmware rev.:\ :sg@:\ :bl=^G:im=\EZ:\ :is=\E}\EC\EX\Ee\En\E%\Er\E(\Ek\Em\Eq\Ed\ET\EC\E9\EF:\ :me=\E(\Ek:mh=\E):mr=\Ej:tc=abm85: # From: # (kt7: removed obsolete :ma=^V^J^L :" -- esr) kt7|kimtron model kt-7:\ :am:\ :co#80:it#8:li#24:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :\ :dc=\EW:dl=\ER:do=^V:ei=:fs=\Eg:ho=^^:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:is=\El\E":k0=^AI\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=\EE:kB=\EI:\ :kC=^Z:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:\ :kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\EG0:\ :so=\EG4:ta=^I:ts=\Ef:ue=\EG0:up=^K:us=\EG8: #### Microterm (act, mime) # # The mime1 entries refer to the Microterm Mime I or Mime II. # The default mime is assumed to be in enhanced act iv mode. # # New "safe" cursor movement (5/87) from . Prevents # freakout with out-of-range args on Sytek multiplexors. No =^N and # =^N since it gets confused and it's too dim anyway. No # since Sytek insists ^S means xoff. # (act4: found ":ic=2^S:ei=:im=:ip=.1*^V:" commented out in 8.3 -- esr) act4|microterm|microterm act iv:\ :am:\ :co#80:li#24:\ :al=2.3*\001<2.3*/>:bl=^G:cd=2.2*\037:ce=.1*\036:\ :cl=12\014:cm=\024%+^X%>/0%+P:cr=^M:dc=.1*\004:\ :dl=2.3*\027:do=^K:ho=^]:kd=^K:kl=^H:kr=^X:ku=^Z:\ :le=^H:nd=^X:sf=^J:up=^Z: # The padding on :sr: and :ta: for act5 and mime is a guess and not final. # The act 5 has hardware tabs, but they are in columns 8, 16, 24, 32, 41 (!)... # (microterm5: removed obsolete ":ma==^Z^P^Xl^Kj:" -- esr) act5|microterm5|microterm act v:\ :kd=^K:kl=^H:kr=^X:ku=^Z:sr=\EH:uc=^H\EA:tc=act4: # Mimes using brightness for standout. Half bright is really dim unless # you turn up the brightness so far that lines show up on the screen. mime-fb|full bright mime1:\ :is=^S\E:se=^S:so=^Y:tc=mime: mime-hb|half bright mime1:\ :is=^Y\E:se=^Y:so=^S:tc=mime: # (mime: removed obsolete ":ma=^X ^K^J^Z^P:"; removed ":do=^K:" that overrode # the more plausible ":do=^J:" -- esr) # uc was at one time disabled to get around a curses bug, be wary of it mime|mime1|mime2|mimei|mimeii|microterm mime1:\ :am:\ :co#80:it#8:li#24:vt#9:\ :al=\001:bl=^G:cd=^_:ce=^^:cl=^]^C:\ :cm=\024%+^X%> 0%+P:cr=^M:dl=\027:do=^J:ho=^]:\ :is=^S\E^Q:kd=^K:kl=^H:kr=^X:ku=^Z:le=^H:nd=^X:sf=^J:\ :sr=\022:ta=\011:uc=^U:up=^Z: # These termcaps (for mime 2a) put the terminal in low intensity mode # since high intensity mode is so obnoxious. mime2a-s|microterm mime2a (emulating an enhanced soroc iq120):\ :am:\ :co#80:li#24:\ :al=\001:bl=^G:cd=\EJ:ce=\EK:cl=\EL:cm=\E=%+ %+ :\ :cr=^M:dc=\ED:dl=\027:do=^J:ei=^Z:ho=^^:im=\EE:ip=:\ :is=\E):kd=^J:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\E;:\ :sf=^J:so=\E\072:sr=\EI:ue=\E7:up=\EI:us=\E6: # This is the preferred mode (but ^X can't be used as a kill character) mime2a|mime2a-v|microterm mime2a (emulating an enhanced vt52):\ :co#80:it#8:li#24:\ :al=\001:bl=^G:cd=\EQ:ce=\EP:cl=\EL:cm=\EY%+ %+ :\ :cr=^M:dc=^N:dl=\027:do=^J:ei=^Z:ho=\EH:im=^O:ip=:\ :is=^Y:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :se=\E9:sf=^J:so=\E8:sr=\EA:ta=^I:ue=\E5:up=\EA:\ :us=\E4: # (mime3a: removed obsolete ":ma=^X ^K^J^Z^P:" -- esr) mime3a|mime1 emulating 3a:\ :am@:\ :kd=^K:kl=^H:kr=^X:ku=^Z:tc=adm3a: mime3ax|mime-3ax|mime1 emulating enhanced 3a:\ :it#8:\ :al=\001:cd=^_:ce=^X:dl=\027:ta=\011:tc=mime3a: # Wed Mar 9 18:53:21 1983 # We run our terminals at 2400 baud, so there might be some timing problems at # higher speeds. The major improvements in this model are the terminal now # scrolls down and insert mode works without redrawing the rest of the line # to the right of the cursor. This is done with a bit of a kludge using the # exit graphics mode to get out of insert, but it does not appear to hurt # anything when using vi at least. If you have some users using act4s with # programs that use curses and graphics mode this could be a problem. mime314|mm314|mime 314:\ :am:\ :co#80:li#24:\ :al=^A:cd=^_:ce=^^:cl=^L:cm=\024%.%.:dc=^D:dl=^W:\ :ei=^V:ho=^]:im=^S:kd=^K:kl=^H:kr=^X:ku=^Z:le=^H:\ :nd=^X:ta=^I:up=^Z: # Microterm mime 340 from University of Wisconsin mm340|mime340|mime 340:\ :co#80:li#24:\ :al=46\EU:cd=2*\037:ce=2.1\EL:cl=12\032:cm=\E=%+ %+ :\ :cr=^M:dc=2.1*\E#:dl=49.6\EV:do=^J:is=\E\054:kb=^H:\ :kd=^J:kl=^H:ku=^K:le=^H:nd=^L:nw=^M^J:sf=^J:ta=^I:\ :up=^K: # This came from University of Wisconsin marked "astro termcap for jooss". # (mt4520-rv: removed obsolete ":kn#4:" and incorrect ":ri=\E[C:"; # also added / based on the init string -- esr) mt4520-rv|micro-term 4520 reverse video:\ :am:hs:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[g:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:fs=\E[?5l\E[?5h:ho=\E[H:ic=\E[@:\ :im=:\ :is=\E(B\E[2l\E>\E[20l\E[?3l\E[?5h\E[?7h\E[1;24r\E[24;1H\E[H\E[J:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:ll=\E[24;1H:\ :nd=\E[C:nw=\EE:\ :r1=\E(B\E[2l\E>\E[20l\E[?3l\E[?5h\E[?7h\E[H\E[J:\ :rc=\E8:rf=/usr/lib/tabset/vt100:sc=\E7:se=\E[0m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[25;1H:\ :ue=\E[24m:up=\E[A:us=\E[4m:vb=\E[?5l\E[?5h:\ :ve=\E[0V\E8:vs=\E7\E[0U: # Fri Aug 5 08:11:57 1983 # This entry works for the ergo 4000 with the following setups: # ansi,wraparound,newline disabled, xon/xoff disabled in both # setup a & c. # # WARNING!!! There are multiple versions of ERGO 4000 microcode # Be advised that very early versions DO NOT WORK RIGHT !! # Microterm does have a ROM exchange program- use it or lose big # (ergo400: added / based on the init string -- esr) ergo4000|microterm ergo 4000:\ :da:db:ms:\ :co#80:li#66:\ :AL=\E[1L:RA=\E[?7l:SA=\E[?7m:bl=^G:cd=\E[0J:\ :ce=\E[0K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[1P:\ :dl=\E[1M:do=\E[B:ei=\E[4l:im=\E[4h:\ :is=\E<\E=\E[?1l\E[?4l\E[?5l\E[?7h\E[?8h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kd=\E[B:ke=\E=:kl=\E[D:\ :kr=\E[C:ks=\E=:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:nd=\E[C:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:\ :up=\E[A: #### NCR # # NCR's terminal group was merged with AT&T's when AT&T bought the company. # For what happened to that group, see the ADDS section. # # NCR7900 DIP switches: # # Switch A: # 1-4 - Baud Rate # 5 - Parity (Odd/Even) # 6 - Don't Send or Do Send Spaces # 7 - Parity Enable # 8 - Stop Bits (One/Two) # # Switch B: # 1 - Upper/Lower Shift # 2 - Typewriter Shift # 3 - Half Duplex / Full Duplex # 4 - Light/Dark Background # 5-6 - Carriage Return Without / With Line Feed # 7 - Extended Mode # 8 - Suppress Keyboard Display # # Switch C: # 1 - End of line entry disabled/enabled # 2 - Conversational mode / (Local?) Mode # 3 - Control characters displayed / not displayed # 4 - (2-wire?) / 4-wire communications # 5 - RTS on and off for each character # 6 - (50Hz?) / 60 Hz # 7 - Exit after level zero diagnostics # 8 - RS-232 interface # # Switch D: # 1 - Reverse Channel (yes / no) # 2 - Manual answer (no / yes) # 3-4 - Cursor appearance # 5 - Communication Rate # 6 - Enable / Disable EXT turnoff # 7 - Enable / Disable CR turnoff # 8 - Enable / Disable backspace # # From , init string hacked by SCO. ncr7900i|7900i|ncr7900|7900|ncr 7900 model 1:\ :am:bw:ul:\ :co#80:li#24:sg#1:ug#1:\ :bl=^G:cd=\Ek:ce=\EK:cl=^L:cm=\E1%r%.%.:cr=^M:do=^J:\ :is=\E0@\010\E3\E4\E7:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:\ :le=^H:ll=^A:mb=\E0B:me=\E0@:mh=\E0A:mr=\E0P:nd=^F:\ :pf=^T:po=^R:\ :..sa=\E0%p5%'@'%+%p4%{2}%*%+%p3%{16}%*%+%p2%{32}%*%+%p1%{17}%*%+%c:\ :se=\E0@:sf=^J:so=\E0Q:ue=\E0@:up=^Z:us=\E0`: ncr7900iv|ncr 7900 model 4:\ :am:bw:es:hs:\ :co#80:li#24:\ :al=\E^N:bl=^G:cl=^L:cm=\013%+@\E\005%02:cr=^M:\ :dl=\E^O:do=^J:ds=\Ey1:fs=\Ek\Ey5:ho=\013@\E^E00:\ :k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:\ :k8=\ER:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:\ :l6=blue:l7=red:l8=white:le=^H:nw=^M^J:sf=^J:\ :ts=\Ej\Ex5\Ex1\EY8%p1%{32}%+%c\Eo: ncr7901|7901|ncr 7901 model:\ :am:bw:ul:\ :co#80:li#24:\ :bl=^G:cd=\Ek:ce=\EK:ch=\020%+^J:cl=^L:cm=\EY%+ %+ :\ :cr=^M:cv=\013%+@:do=^J:is=\E4^O:kC=^L:kd=^J:kh=^H:\ :kl=^U:kr=^F:ku=^Z:le=^H:ll=^A:mb=\E0B:me=^O:mh=\E0A:\ :mr=\E0P:nd=^F:pf=^T:po=^R:\ :..sa=\E0%p5%'@'%+%p4%{2}%*%+%p3%{16}%*%+%p2%{32}%*%+%p1%{17}%*%+%c\016:\ :se=^O:sf=^J:so=\E0Q\016:ue=^O:up=^Z:us=\E0`\016:\ :ve=^X:vi=^W: #### Perkin-Elmer (Owl) # # These are official terminfo entries from within Perkin-Elmer. # bantam|pe550|pe6100|perkin elmer 550:\ :co#80:li#24:\ :bl=^G:ce=\EI:cl=\EK:cm=\EX%+ \EY%+ :cr=^M:do=^J:\ :ho=\EH:le=^H:ll=\EH\EA:nd=\EC:sf=^J:up=\EA: fox|pe1100|perkin elmer 1100:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EH\EJ:cm=\EX%+ \EY%+ :cr=^M:\ :ct=\E3:do=^J:ho=\EH:le=^H:ll=\EH\EA:nd=\EC:sf=^J:\ :st=\E1:up=\EA:vb=\020\002\020\003: owl|pe1200|perkin elmer 1200:\ :am:in:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EI:cl=\EH\EJ:\ :cm=\EX%+ \EY%+ :cr=^M:ct=\E3:dc=\EO:dl=\EM:do=^J:\ :ei=:ho=\EH:ic=\EN:im=:ip=:k0=\ERJ:k1=\ERA:k2=\ERB:\ :k3=\ERC:k4=\ERD:k5=\ERE:k6=\ERF:k7=\ERG:k8=\ERH:\ :k9=\ERI:kb=^H:le=^H:ll=\EH\EA:nd=\EC:se=\E!\200:\ :sf=^J:so=\E!^H:st=\E1:up=\EA:vb=\020\002\020\003: pe1251|pe6300|pe6312|perkin elmer 1251:\ :am:\ :co#80:it#8:li#24:pb#300:sg#1:vt#8:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EK:cm=\EX%+ \EY%+ :cr=^M:\ :ct=\E3:do=\EB:ho=\EH:k0=\ERA:k1=\ERB:k2=\ERC:\ :k3=\ERD:k4=\ERE:k5=\ERF:k6=\ERG:k7=\ERH:k8=\ERI:\ :k9=\ERJ:k;=\ERK:le=\ED:nd=\EC:sf=^J:st=\E1:up=\EA: # (pe7000m: this had # rmul=\E!\0, smul=\E!\040, # which is probably wrong, it collides with kf0 pe7000m|perkin elmer 7000 series monochrome monitor:\ :am:\ :co#80:li#24:\ :bl=^G:bt=\E!Y:cd=\EJ:ce=\EI:cl=\EK:cm=\ES%+ %+ :\ :cr=^M:do=\EB:ho=\EH:i1=\E!\200\EW 7o\Egf\ES7 :\ :k0=\E!\200:k1=\E!^A:k2=\E!^B:k3=\E!^C:k4=\E!^D:\ :k5=\E!^E:k6=\E!^F:k7=\E!^G:k8=\E!^H:k9=\E!^I:\ :k;=\E!^J:kb=^H:kd=\E!U:kh=\E!S:kl=\E!V:kr=\E!W:\ :ku=\E!T:le=\ED:ll=\ES7 :nd=\EC:sf=^J:sr=\ER:up=\EA: pe7000c|perkin elmer 7000 series colour monitor:\ :i1=\E!\200\EW 7o\Egf\Eb0\Ec7\ES7 :se=\Eb0:so=\Eb2:\ :ue=\E!\200:us=\E! :tc=pe7000m: #### Sperry Univac # # Sperry Univac has merged with Burroughs to form Unisys. # # This entry is for the Sperry UTS30 terminal running the TTY # utility under control of CP/M Plus 1R1. The functionality # provided is comparable to the DEC vt100. # (uts30: I added / based on the init string -- esr) uts30|sperry uts30 with cp/m@1R1:\ :am:bw:hs:\ :co#80:li#24:ws#40:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7m:SF=\E[%dB:\ :SR=\E[%dA:UP=\E[%dA:ae=\Ed:al=\EN:as=\EF:bl=^G:\ :cd=\E[J:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:cr=^M:\ :cs=\EU%+ %+ :dc=\EM:dl=\EL:do=\EB:ei=:fs=^M:ho=\E[H:\ :ic=\EO:im=:is=\E[U 7\E[24;1H:kb=^H:kd=\EOB:kh=\E[H:\ :kl=\EOD:kr=\EOC:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\EC:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\EX:\ :rf=/usr/lib/tabset/vt100:sc=\EW:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EI:ta=^I:ts=\E]:uc=\EPB:ue=\E[m:\ :up=\E[A:us=\E[4m:ve=\ES:vi=\ER: #### Tandem # # Tandem builds these things for use with its line of fault-tolerant # transaction-processing computers. They aren't generally available # on the merchant market, and so are fairly uncommon. # tandem6510|adm3a repackaged by Tandem:\ :tc=adm3a: # A funny series of terminal that TANDEM uses. The actual model numbers # have a fourth digit after 653 that designates minor variants. These are # natively block-mode and rather ugly, but they have a character mode which # this doubtless(?) exploits. There is a 6520 that is slightly dumber. # (tandem653: had ":sb=\ES:", probably someone's mistake for sf -- esr) tandem653|t653x|Tandem 653x multipage terminal:\ :am:da:db:hs:\ :co#80:li#24:sg#1:ug#1:ws#64:\ :cd=\EJ:ce=\EK:cl=\EI:cm=\023%+ %+ :do=^J:ds=\Eo\r:\ :fs=^M:ho=\EH:if=/usr/share/tabset/tandem653:le=^H:\ :nd=\EC:se=\E6 :sf=\ES:so=\E6$:sr=\ET:ts=\Eo:ue=\E6 :\ :up=\EA:us=\E60: #### Tandy/Radio Shack # # Tandy has a line of VDTs distinct from its microcomputers. # dmterm|deskmate terminal:\ :am:bw:\ :co#80:li#24:\ :al=\EP:bl=^G:cd=\EJ:ce=\EK:cl=\Ej:cm=\EY%+ %+ :\ :cr=^M:dc=\ES:dl=\ER:do=\EB:ei=:ho=\EH:ic=\EQ:im=:\ :k0=\E1:k1=\E2:k2=\E3:k3=\E4:k4=\E5:k5=\E6:k6=\E7:\ :k7=\E8:k8=\E9:k9=\E0:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :ku=\EA:l0=f1:l1=f2:l2=f3:l3=f4:l4=f5:l5=f6:l6=f7:\ :l7=f8:l8=f9:l9=f10:le=^H:ll=\EE:nd=\EC:se=\EG0:\ :sf=\EX:so=\EG4:ta=^I:up=\EA:ve=\EG6:vi=\EG5: dt100|dt-100|Tandy DT-100 terminal:\ :xo:\ :co#80:li#24:sg#1:ug#1:\ :ac=kkllmmjjnnwwvvttuuqqxx:ae=^O:al=\E[L:as=^N:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\010\E[%i%d;%dH:\ :cr=^M:cs=\E[%2;%2r:dc=\E[P:dl=\E[M:do=\E[B:ei=:\ :ho=\E[H:ic=\E[@:im=:is=\E[?3l\E)0\E(B:k1=\E[?3i:\ :k2=\E[2i:k3=\E[@:k4=\E[M:k5=\E[17~:k6=\E[18~:\ :k7=\E[19~:k8=\E[20~:k9=\E[21~:k;=\E[?5i:kN=\E[29~:\ :kP=\E[28~:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :l1=f1:l2=f2:l3=f3:l4=f4:l5=f5:l6=f6:l7=f7:l8=f8:\ :le=^H:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: dt100w|dt-100w|Tandy DT-100 terminal (wide mode):\ :co#132:tc=dt100: dt110|Tandy DT-110 emulating ansi:\ :xo:\ :co#80:li#24:\ :@7=\E[K:ac=kkllmmjjnnwwvvuuttqqxx:ae=^O:al=\E[0L:\ :as=^N:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:\ :cm=\010\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=\E[0P:\ :dl=\E[0M:do=\E[0B:eA=\E(B\E)0:ei=:ho=\E[H:ic=\E[0@:\ :im=:is=\E[?3l\E)0\E(B:k1=\E[1~:k2=\E[2~:k3=\E[3~:\ :k4=\E[4~:k5=\E[5~:k6=\E[6~:k7=\E[7~:k8=\E[8~:\ :k9=\E[9~:k;=\E[10~:kI=\E[@:kN=\E[26~:kP=\E[25~:\ :kd=\E[B:kh=\E[G:kl=\E[D:kr=\E[C:ku=\E[A:l0=f1:l1=f2:\ :l2=f3:l3=f4:l4=f5:l5=f6:l6=f7:l7=f8:l8=f9:l9=f10:\ :le=^H:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[0A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: pt210|TRS-80 PT-210 printing terminal:\ :hc:os:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: #### Tektronix (tek) # # Tektronix tubes are graphics terminals. Most of them use modified # oscilloscope technology incorporating a long-persistence green phosphor, # and support vector graphics on a main screen with an attached "dialogue # area" for interactive text. # tek|tek4012|4012|tektronix 4012:\ :os:\ :co#75:li#35:\ :bl=^G:cl=\E\014:cr=^M:do=^J:ff=\014:is=\E^O:le=^H: tek4013|4013|tektronix 4013:\ :ae=\E^O:as=\E^N:tc=tek4012: tek4014|4014|tektronix 4014:\ :co#81:li#38:\ :is=\E\017\E9:tc=tek4012: tek4015|4015|tektronix 4015:\ :ae=\E^O:as=\E^N:tc=tek4014: tek4014-sm|4014-sm|tektronix 4014 in small font:\ :co#121:li#58:\ :is=\E\017\E\072:tc=tek4014: tek4015-sm|4015-sm|tektronix 4015 in small font:\ :ae=\E^O:as=\E^N:tc=tek4014-sm: tek4023|4023|tex|tektronix 4023:\ :am:\ :co#80:li#24:vt#4:\ :bl=^G:cl=\E\014:cm=\034%r%+ %+ :cr=^M:do=^J:le=^H:\ :nd=^I:se=^_@:sf=^J:so=^_P: # It is recommended that you run the 4025 at 4800 baud or less; # various bugs in the terminal appear at 9600. It wedges at the # bottom of memory (try "cat /usr/dict/words"); ^S and ^Q typed # on keyboard don't work. You have to hit BREAK twice to get # one break at any speed - this is a documented feature. # Can't use cursor motion because it's memory relative, and # because it only works in the workspace, not the monitor. # Same for home. Likewise, standout only works in the workspace. # # was commented out since vi and rogue seem to work better # simulating it with lots of spaces! # # and had 145ms of padding, but that slowed down vi's ^U # and didn't seem necessary. # tek4024|tek4025|tek4027|tektronix 4024/4025/4027:\ :am:da:db:\ :co#80:it#8:li#34:lm#0:\ :AL=\037up\r\037ili %d\r:CC=^_:DL=\037dli %d\r\006:\ :DO=\037dow %d\r:LE=\037lef %d\r:RI=\037rig %d\r:\ :UP=\037up %d\r:al=\037up\r\037ili\r:bl=^G:\ :cd=\037dli 50\r:cl=\037era\r\n\n:cr=^M:dc=\037dch\r:\ :dl=\037dli\r\006:do=^F^J:ei=:ic=\037ich\r \010:im=:\ :is=!com 31\r\n\037sto 9 17 25 33 41 49 57 65 73\r:\ :ke=\037lea p2\r\037lea p4\r\037lea p6\r\037lea p8\r\037lea f5\r:\ :ks=\037lea p4 /h/\r\037lea p8 /k/\r\037lea p6 / /\r\037lea p2 /j/\r\037lea f5 /H/\r:\ :le=^H:nd=\037rig\r:sf=^F^J:ta=^I:up=^K: tek4025-17|4025-17|4027-17|tek 4025 17 line window:\ :li#17:tc=tek4025: tek4025-17-ws|4025-17-ws|4025-17ws|4027-17ws|4027-17-ws|tek 4025 17 line window in workspace:\ :is=!com 31\r\n\037sto 9 17 25 33 41 49 57 65 73\r\037wor 17\r\037mon 17\r:\ :se=\037att s\r:so=\037att e\r:te=\037mon h\r:\ :ti=\037wor h\r:tc=tek4025-17: tek4025-ex|tek4027-ex|tek 4025/4027 w/!:\ :is=\037com 33\r\n!sto 9 17 25 33 41 49 57 65 73\r:\ :te=\037com 33\r:ti=!com 31\r:tc=tek4025: # Tektronix 4025a # From: Doug Gwyn # The following status modes are assumed for normal operation (replace the # initial "!" by whatever the current command character is): # !COM 29 # NOTE: changes command character to GS (^]) # ^]DUP # ^]ECH R # ^]EOL # ^]RSS T # ^]SNO N # ^]STO 9 17 25 33 41 49 57 65 73 # Other modes may be set according to communication requirements. # If the command character is inadvertently changed, termcap can't restore it. # Insert-character cannot be made to work on both top and bottom rows. # Clear-to-end-of-display emulation via !DLI 988 is too grotty to use, alas. # There also seems to be a problem with vertical motion, perhaps involving # delete/insert-line, following a typed carriage return. This terminal sucks. # Delays not specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # (tek4025a: removed obsolete ":xx:". This may mean the tek4025a entry won't # work any more. -- esr) tek4025a|4025a|Tektronix 4025A:\ :am:bw:da:db:xo:\ :co#80:it#8:li#34:\ :CC=^]:DC=\035dch %d;:DL=\035dli %d;:DO=\035dow %d;:\ :LE=\035lef %d;:RI=\035rig %d;:SF=\035dow %d;:\ :UP=\035up %d;:al=\013\035ili;:bl=^G:bt=\035bac;:\ :ce=\035dch 80;:ch=\r\035rig %d;:\ :cl=\035era;\n\035rup;:cr=^M:ct=\035sto;:dc=\035dch;:\ :dl=\035dli;:do=^J:le=^H:nd=\035rig;:\ :rs=!com 29\035del 0\035rss t\035buf\035buf n\035cle\035dis\035dup\035ech r\035eol\035era g\035for n\035pad 203\035pad 209\035sno n\035sto 9 17 25 33 41 49 57 65 73\035wor 0;:\ :sf=^J:ta=^I:up=^K: # From: cbosg!teklabs!davem Wed Sep 16 21:11:41 1981 # Here's the command file that I use to get rogue to work on the 4025. # It should work with any program using the old curses (e.g. it better # not try to scroll, or cursor addressing won't work. Also, you can't # see the cursor.) # (This "learns" the arrow keys for rogue. I have adapted it for termcap - mrh) tek4025-cr|4025-cr|tek 4025 for curses and rogue:\ :am:\ :co#80:it#8:li#33:\ :cl=\037era;:cm=\037jum%i%d\054%d;:do=^F^J:\ :is=!com 31\r\n\037sto 9 17 25 33 41 49 57 65 73\r:\ :le=^H:nd=\037rig;:sf=^F^J:ta=^I:te=\037wor 0:\ :ti=\037wor 33h:up=^K: # next two lines commented out since curses only allows 128 chars, sigh. # :ti=\037lea p1/b/\037lea p2/j/\037lea p3/n/\037lea p4/h/\037lea p5/ /\037lea p6/l/\037lea p7/y/\037lea p8/k/\037lea p9/u/\037lea p./f/\037lea pt/`era w/13\037lea p0/s/\037wor 33h:\ # :te=\037lea p1\037lea p2\037lea p3\037lea p4\037lea pt\037lea p5\037lea p6\037lea p7\037lea p8\037lea p9/la/13\037lea p.\037lea p0\037wor 0: tek4025ex|4025ex|4027ex|tek 4025 w/!:\ :is=\037com 33\r\n!sto 9\05417\05425\05433\05441\05449\05457\05465\05473\r:\ :te=\037com 33\r:ti=!com 31\r:tc=tek4025: tek4105|4105|tektronix 4105:\ :am:mi:ms:ul:xn:xt:\ :co#79:it#8:li#29:\ :ae=\E[m:al=\E[1L:as=\E[1m:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%2;%2H:cr=^M:ct=\E[1g:\ :dc=\E[1P:dl=\E[1M:do=\E[1B:ei=\E[4l:ho=\E[H:\ :i1=\E%!1\E[m:im=\E[4h:is=\E%!1\E[?6141\E[m:kb=^H:\ :kd=\E[1B:kl=\E[1D:kr=\E[1C:ku=\E[1A:mb=\E[=3;<7m:\ :md=\E[=7;<4m:me=\E[=0;<1m:mh=\E[=1;<6m:mk=\E[=6;<5:\ :mr=\E[=1;<3m:nd=\E[1C:se=\E[=0;<1m:sf=\E[S:\ :so=\E[=2;<3m:sr=\E[T:ta=^I:ti=\E%!1\E[?6l\E[2J:\ :ue=\E[=0;<1m:up=\E[1A:us=\E[=5;<2m: # (tek4105-30: I added / based on the init string -- esr) tek4105-30|4105-30|4015 emulating 30 line vt100:\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#30:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:\ :K5=\EOn:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:do=^J:eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:\ :k8=\EOl:k9=\EOw:k;=\EOx:kb=^H:kd=\EOB:ke=\E[?1l\E>:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m\017:mr=\E[7m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: tek4107|tek4109|4107|4109|tektronix terminals 4107 4109:\ :am:mi:ms:ul:xn:xt:\ :co#79:it#8:li#29:\ :bl=^G:cd=\EJ:ce=\EK:cl=\ELZ:cm=\EY%+ %+ :cr=^M:\ :do=^J:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:\ :mb=\E%!1\E[5m\E%!0:md=\E%!1\E[1m\E%!0:\ :me=\E%!1\E[m\E%!0:mh=\E%!1\E[<0m\E%!0:\ :mr=\E%!1\E[7m\E%0:nd=\EC:\ :..sa=\E%%!1\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m\E%%!0:\ :se=\E%!1\E[m\E%!0:sf=^J:so=\E%!1\E[7;5m\E%!0:sr=\EI:\ :ta=^I:ue=\E%!1\E[m\E%!0:up=\EA:us=\E%!1\E[4m\E%!0:\ :ve=\E%!0:vs=\E%!3: # Tektronix 4207 with sysline. In the ancestral termcap file this was 4107-s; # see the note attached to tek4207. tek4207-s|Tektronix 4207 with sysline but no memory:\ :es:hs:\ :ds=\E7\E[?6l\E[2K\E[?6h\E8:fs=\E[?6h\E8:\ :i1=\E%!1\E[2;32r\E[132D\E[2g\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[J:\ :is=\E7\E[?6l\E[2K\E[?6h\E8:\ :ts=\E7\E[?6l\E[2K\E[;%i%df:tc=tek4107: # The 4110 series may be a wonderful graphics series, but they make the 4025 # look good for screen editing. In the dialog area, you can't move the cursor # off the bottom line. Out of the dialog area, ^K moves it up, but there # is no way to scroll. # # Note that there is a floppy for free from Tek that makes the # 4112 emulate the vt52 (use the vt52 termcap). There is also # an expected enhancement that will use ANSI standard sequences. # # 4112 in non-dialog area pretending to scroll. It really wraps # but vi is said to work (more or less) in this mode. # # 'vi' works reasonably well with this entry. # otek4112|o4112-nd|otek4113|otek4114|old tektronix 4110 series:\ :am:\ :co#80:li#34:\ :bl=^G:cl=\E^L:cr=^M:do=^J:le=^H:sf=^J:te=\EKA1\ELV1:\ :ti=\EKA0\ELV0\EMG0:up=^K: # The 4112 with the ANSI compatibility enhancement tek4112|tek4114|tektronix 4110 series:\ :am:db:\ :co#80:li#34:\ :al=\E[L:bt=\E[Z:cd=\E[0J:ce=\E[0K:cl=\E[2J\E[0;0H:\ :cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=:ic=\E[@:im=:\ :is=\E3!1:le=^H:nd=\E[C:se=\E[m:sf=\E7\E[0;0H\E[M\E8:\ :so=\E[7m:sr=\E7\E[0;0H\E[L\E8:ue=\E[m:up=\EM:\ :us=\E[4m: tek4112-nd|4112-nd|4112 not in dialog area:\ :ns:\ :up=^K:tc=tek4112: tek4112-5|4112-5|4112 in 5 line dialog area:\ :li#5:tc=tek4112: # (tek4113: this used to have "=\LM1\s\LM0:", someone's mistake; # removed "=\E^N, =\E^O:", which had been commented out in 8.3. # Note, the !0 and !1 sequences in /// were # previously \0410 and \0411 sequences...I don't *think* they were supposed # to be 4-digit octal -- esr) tek4113|tektronix 4113 color graphics with 5 line dialog area:\ :am:da:eo:\ :co#80:li#5:\ :cl=\ELZ:do=^J:is=\EKA1\ELL5\ELV0\ELV1:le=^H:\ :nd=\ELM1 \ELM0:uc=\010\ELM1_\ELM0:\ :vb=\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERB0: tek4113-34|4113-34|tektronix 4113 color graphics with 34 line dialog area:\ :li#34:\ :is=\EKA1\ELLB2\ELV0\ELV1:tc=tek4113: # :ns: left off to allow vi visual mode. APL font (:as=\E^N:/:ae=\E^O:) not # supported here. :uc: is slow, but looks nice. Suggest setenv MORE -up . # :vb: needs enough delay to let you see the background color being toggled. tek4113-nd|4113-nd|tektronix 4113 color graphics with no dialog area:\ :am:eo:\ :co#80:it#8:li#34:\ :cl=\E^L:do=^J:ho=\ELF7l\177 @:\ :is=\ELZ\EKA0\ELF7l\177 @:le=^H:ll=\ELF hl @:nd=^I:\ :se=\EMT1:so=\EMT2:ta=^I:uc=\010\EMG1_\EMG0:up=^K:\ :vb=\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERB0:\ :vs=\ELZ\EKA0: # This entry is from Tek. Inc. (Brian Biehl) # (tek4115: :bc: renamed to :le:, / added based on init string -- esr) otek4115|Tektronix 4115:\ :am:bs:da:db:eo:\ :co#80:it#8:li#34:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:\ :im=\E[4h:\ :is=\E%!0\E%\014\ELV0\EKA1\ELBB2\ENU@=\ELLB2\ELM0\ELV1\EKYA?\E%!1\E[<1l\E[?7h\E[?8h\E[34;1H\E[34B\E[m:\ :kb=^H:ke=\E>:ks=\E=:le=\E[D:nd=\E[C:se=\E[m:\ :so=\E[7m:sr=\EM:ta=^I:\ :te=\E%!0\ELBG8\E%!1\E[34;1H\E[J:ti=\E%!0\ELBB2\E%!1:\ :ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E%!0\ELBG8\E%!1\E[34;1H:vs=\E%!0\ELBB2\E%!1: tek4115|newer tektronix 4115 entry with more ANSI capabilities:\ :am:xo:\ :co#80:li#34:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:\ :RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:al=\E[L:\ :bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%+^AG:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[2g:\ :cv=\E[%+^Ad:dc=\E[P:dl=\E[M:do=^J:ei=:ho=\E[H:\ :ic=\E[@:im=:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mk=\E[8m:\ :mr=\E[7m:nd=\E[C:..rp=%p1%c\E[%p2%{1}%-%db:\ :..sa=\E[%?%p1%t7;%;%?%p2%t4;%;%?%p3%t7;%;%?%p4%t5;%;%?%p6%t1;%;m:\ :se=\E[m:sf=^J:so=\E[7m:st=\EH:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m: # The tek4125 emulates a vt100 incorrectly - the scrolling region # command is ignored. The following entry replaces with the needed # , , and ; removes some cursor pad commands that the tek4125 # chokes on; and adds a lot of initialization for the tek dialog area. # Note that this entry uses all 34 lines and sets the cursor color to green. # Steve Jacobson 8/85 # (tek4125: there were two "\!"s in the is that I replaced with "\E!" -- esr) tek4125|tektronix 4125:\ :li#34:\ :al=\E[1L:cs@:dl=\E[1M:im=\E1:\ :is=\E%\E!0\EQD1\EUX03\EKA\ELBB2\ELCE0\ELI100\ELJ2\ELLB2\ELM0\ELS1\ELX00\ELV1\E%\E!1\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :ks=\E=:rc@:sc@:tc=vt100: # From: # (tek4207: This was the termcap file's entry for the 4107/4207, but SCO # supplied another, less capable 4107 entry. So we'll use that for 4107 and # note that if jcoker wasn't confused you may be able to use this one. -- esr) tek4207|Tektronix 4207 graphics terminal with memory:\ :am:bw:mi:ul:xn:\ :co#80:it#8:li#32:\ :al=3\E[L:bt=\E[Z:cd=\E[J:ce=5\E[K:cl=156\E[H\E[J:\ :cm=\E[%i%d;%dH:dc=4\E[P:dl=3\E[M:do=^J:ei=:ho=\E[H:\ :ic=4\E[@:im=:\ :is=\E%!0\ELBP0\E%!1\E[H\E[2g\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[J:\ :kd=\ED:kh=\E[H:kl=\E[D:kr=\E[C:ku=\EM:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:se=\E[m:\ :so=\E[7m:ta=^I:te=\E[?6h\E%!0\ELBP0\E%!1\E[32;1f:\ :ti=\E[?6l\E[H\E[J:ue=\E[m:up=\EM:us=\E[4m: # From: Thu Oct 31 12:54:27 1985 # (tek4404: There was a "\!" in that I replaced with "\E!". # Tab had been given as \E2I,that must be the tab-set capability -- esr) tek4404|tektronix 4404:\ :co#80:it#8:li#32:\ :al=\E[1L:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[1M:\ :do=^J:ei=\E[4l:ho=\E[H:im=\E[4h:kd=\E[B:ke=\E[?1h:\ :kl=\E[D:kr=\E[C:ks=\E[?1l:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:\ :so=\E[7m:st=\E[2I:ta=^I:te=\E[1;1H\E[0J\E[?6h\E[?1l:\ :ti=\E%\E!1\E[1;32r\E[?6l\E>:ue=\E[m:up=\E[A:\ :us=\E[4m: # Some unknown person wrote: # I added the is string - straight Unix has ESC ; in the login # string which sets a ct8500 into monitor mode (aka 4025 snoopy # mode). The is string here cleans up a few things (but not # everything). ct8500|tektronix ct8500:\ :am:bw:da:db:\ :co#80:li#25:\ :al=\E^L:bl=^G:bt=\E^I:cd=\E^U:ce=\E^T:cl=\E^E:\ :cm=\E|%+ %+ :cr=^M:dc=\E^]:dl=\E^M:do=^J:ei=:\ :ic=\E^\:im=:is=\037\EZ\Ek:le=^H:me=\E :nd=\ES:\ :se=\E :sf=^J:so=\E$:sr=\E^A:ta=^I:ue=\E :up=\ER:\ :us=\E!: # Tektronix 4205 terminal. # # am is not defined because the wrap around occurs not when the char. # is placed in the 80'th column, but when we are attempting to type # the 81'st character on the line. (esr: hmm, this is like the vt100 # version of xenl, perhaps am + xenl would work!) # # Bold, dim, and standout are simulated by colors and thus not allowed # with colors. The tektronix color table is mapped into the RGB color # table by setf/setb. All colors are reset to factory specifications by oc. # The cap uses RGB notation to define colors. for arguments 1-3 the # interval (0-1000) is broken into 8 smaller sub-intervals (125). Each sub- # interval then maps into pre-defined value. # (untranslatable capabilities removed to fit entry within 1023 bytes) tek4205|4205|tektronix 4205:\ :cc:mi:ms:\ :Co#8:NC#49:co#80:it#8:li#30:pa#63:\ :AL=\E[%dL:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[1L:as=^N:bl=^G:bt=\E[Z:cb=\E[1K:cd=\E[J:\ :ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:ct=\E[1g:\ :dc=\E[1P:dl=\E[1M:do=\E[B:eA=\E)0:ec=\E%dX:ei=\E[4l:\ :ho=\E[H:i1=\E%!0\ETM1\E%!1\E[m:im=\E[4h:k0=\EOA:\ :k1=\EOB:k2=\EOC:k3=\EOD:k4=\EP:k5=\EQ:k6=\ER:k7=\ES:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:\ :mb=\E[5m:md=\E[=7;<4m:me=\E[=0;<1m\E[24;25;27m\017:\ :mh=\E[=1;<6m:mk=\E[=6;<5:mr=\E[7m:nd=\E[C:\ :oc=\E%!0\n\ETFB0\n0000\n1F4F4F4\n2F400\n30F40\n4A4C because of a bug in old vi (if stty says you have # a "newline" style terminal (-crmode) vi figures all it needs is nl # to get crlf, even if is not ^M.) # (tty40: removed obsolete ":nl=\EG\EB:", it's just do+cr -- esr) tty40|ds40|ds40-2|dataspeed40|teletype dataspeed 40/2:\ :xo:\ :co#80:li#24:\ :al=\EL:cd=\EJ:cl=\EH\EJ:cr=\EG:ct=\EH\E2:dc=\EP:\ :dl=\EM:do=\EB:ei=:ho=\EH:ic=\E^:im=:kb=^]:kl=^H:\ :le=^H:nd=\EC:pf=^T:po=\022:r2=\023\ER:se=\E4:sf=\ES:\ :so=\E3:sr=\ET:st=\E1:ta=\E@:up=\E7: tty43|model 43 teletype:\ :am:hc:os:xo:\ :co#132:\ :bl=^G:cr=^M:do=^J:kb=^H:le=^H:sf=^J: #### Tymshare # # You can add =\E< to put this 40-column mode, though I can't # for the life of me think why anyone would want to. scanset|sc410|sc415|Tymshare Scan Set:\ :am:bw:ms:\ :co#80:li#24:\ :ac=l:rc=^C:sc=^B:sf=^J:up=^K: #### Volker-Craig (vc) # # Missing in vc303a and vc303 descriptions: they scroll 2 lines at a time # every other linefeed. vc303|vc103|vc203|volker-craig 303:\ :am:ns:\ :co#80:li#24:\ :bl=^G:cl=\014:cr=^M:do=^J:ho=\013:kd=^J:kl=^H:kr=^I:\ :ku=^N:le=^H:ll=\017W:nd=^I:up=^N: vc303a|vc403a|volker-craig 303a:\ :ce=\026:cl=\030:ho=\031:kr=^U:ku=^Z:ll=^P:nd=^U:\ :up=^Z:tc=vc303: # (vc404: removed obsolete ":ma=^Z^P^U :" -- esr) vc404|volker-craig 404:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\027:ce=\026:cl=\030:cm=\020%+ %+ :cr=^M:\ :do=^J:ho=\031:kd=^J:kl=^H:kr=^U:ku=^Z:le=^H:nd=^U:\ :sf=^J:up=^Z: vc404-s|volker-craig 404 w/standout mode:\ :do=^J:se=^O:so=^N:tc=vc404: # From: # (vc414: merged in cup/dl1/home from an old vc414h-noxon) vc414|vc414h|Volker-Craig 414H in sane escape mode.:\ :am:bs:\ :co#80:li#24:\ :al=\E\032:cd=\E^X:ce=10\E\017:cl=\E\034:\ :cm=\E\021%r%.%.:dc=\E3:dl=\E\023:do=\E^K:ei=:\ :ho=\E^R:ic=\E\072:im=:k0=\EA:k1=\EB:k2=\EC:k3=\ED:\ :k4=\EE:k5=\EF:k6=\EG:k7=\EH:kd=\E^K:kh=\E^R:kl=^H:\ :kr=^P:ku=\E^L:l0=PF1:l1=PF2:l2=PF3:l3=PF4:l4=PF5:\ :l5=PF6:l6=PF7:l7=PF8:nd=^P:se=\E^_:so=\E^Y:up=\E^L: vc415|volker-craig 415:\ :cl=^L:tc=vc404: ######## OBSOLETE PERSONAL-MICRO CONSOLES AND EMULATIONS # #### IBM PC and clones # # The pcplot IBM-PC terminal emulation program is really messed up. It is # supposed to emulate a vt-100, but emulates the wraparound bug incorrectly, # doesn't support scrolling regions, ignores add line commands, and ignores # delete line commands. Consequently, the resulting behavior looks like a # crude adm3a-type terminal. # Steve Jacobson 8/85 pcplot|pc-plot terminal emulation program:\ :xn@:\ :AL@:DL@:al@:cs@:dl@:rc@:sc@:tc=vt100: # (kaypro: removed obsolete ":ma=^K^P:" -- esr) kaypro|kaypro2|kaypro II:\ :am:\ :co#80:li#24:\ :cl=1\032:cm=\E=%+ %+ :ho=^^:kd=^J:kl=^H:kr=^L:ku=^K:\ :le=^H:nd=^L:up=^K: # From IBM, Thu May 5 19:35:27 1983 ibmpc|ibm-pc|ibm5051|5051|IBM Personal Computer (no ANSI.SYS):\ :am:\ :co#80:li#24:\ :bl=^G:cl=^L^K:cr=^M^^:do=^J:ho=^K:im=\200R:kd=^_:\ :le=^]:nd=^\:sf=\n:up=^^: #### Apple # appleII|apple ii plus:\ :am:\ :co#80:it#8:li#24:\ :cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :do=^J:ho=\E^Y:\ :is=\024T1\016:kd=^J:kr=^U:le=^H:nd=^\:se=^N:so=^O:\ :ta=^I:up=^_:vb=\024G1\024T1:ve=^TC2:vs=^TC6: # Originally by Gary Ford 21NOV83 # From: Fri Oct 11 21:27:00 1985 apple-80|apple II with smarterm 80 col:\ :am:bw:\ :co#80:li#24:\ :bt=^R:cd=10*\013:ce=10\035:cl=10*\014:\ :cm=\036%r%+ %+ :cr=10*\r:do=^J:ho=^Y:le=^H:nd=^\:\ :up=^_: apple-soroc|apple emulating soroc 120:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:do=^J:\ :ho=^^:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:sf=^J:\ :up=^K: # From Peter Harrison, Computer Graphics Lab, San Francisco # ucbvax!ucsfmis!harrison .....uucp # ucbvax!ucsfmis!harrison@BERKELEY .......ARPA # "These two work. If you don't have the inverse video chip for the # Apple with videx then remove the so and se fields." # (apple-videx: this used to be called DaleApple -- esr) apple-videx|Apple with videx videoterm 80 column board with inverse video:\ :am:xn:\ :co#80:it#8:li#24:\ :cd=^K:ce=^]:cl=300\014:cm=\036%r%+ %+ :do=^J:ho=^Y:\ :kd=^J:kh=^Y:kl=^H:kr=^U:le=^H:nd=^\:se=^Z2:so=^Z3:\ :ta=^I:up=^_: lisa|apple lisa console display (black on white):\ :am:eo:ms:\ :co#88:it#8:li#32:\ :ac=lfmekcjdttuvvuwsqax`nb:ae=\E[10m:al=\E[L:\ :as=\E[11m:cd=\E[J:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:\ :is=\E>\E[m\014:kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:nd=\E[C:se=\E[m:so=\E[7m:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m:vi=\E[5h:vs=\E[5l: liswb|apple lisa console display (white on black):\ :is=\E>\E[0;7m\014:se=\E[0;7m:so=\E[m:ue=\E[0;7m:\ :us=\E[4m:tc=lisa: mac|macintosh|Macintosh with MacTerminal:\ :xn:\ :dN#30:\ :al=20\E[L:dc=7\E[P:dl=20\E[M:ei=:ic=9\E[@:im=:ip=7:tc=vt100: #### Radio Shack/Tandy # # (coco3: This had "ta" used incorrectly as a boolean and bl given as "bl#7". # I read these as mistakes for ":it#8:" and ":bl=\007:" respectively -- esr) # From: <{pbrown,ctl}@ocf.berkeley.edu> 12 Mar 90 coco3|os9LII|Tandy CoCo3 24*80 OS9 Level II:\ :am:\ :co#80:it#8:li#24:\ :al=^_0:bl=^G:cd=^K:ce=^D:cl=5*\014:cm=2\002%r%+ %+ :\ :dl=^_1:do=^J:ho=^A:kd=^J:kl=^H:kr=^I:ku=^L:le=^H:\ :mb=^_":md=\E\072^A:me=\037!\E\072\200:mr=^_ :nd=^F:\ :se=^_!:so=^_ :ue=^_#:up=^I:us=^_":ve=^E!:vi=^E : # (trs2: removed obsolete ":nl=^_:" -- esr) trs2|trsII|trs80II|Radio Shack Model II using P&T CP/M:\ :am:ms:\ :co#80:it#8:li#24:\ :al=^D:bl=^G:cd=^B:ce=^A:cl=^L:cm=\EY%+ %+ :cr=^M:\ :dl=^K:do=^_:ho=^F:kb=^H:kd=^_:kl=^\:kr=^]:ku=^^:\ :le=^H:nd=^]:se=^O:sf=^J:so=^N:ta=^I:up=^^: # From: Kevin Braunsdorf # (This had extension capabilities # :BN=\E[?33h:BF=\E[?33l:UC=\E[_ q:BC=\E[\177 q:\ # :CN=\ERC:CF=\ERc:NR=\ERD:NM=\ER@: # I also deleted the unnecessary ":kn#2:", ":sg#0:" -- esr) trs16|trs-80 model 16 console:\ :am:\ :co#80:it#8:li#24:\ :ac=l_mbk`javewcquxs:ae=\ERg:al=\EL:as=\ERG:bl=^G:\ :cd=\EJ:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:dc=\EQ:\ :dl=\EM:do=\EB:ei=:ho=\EH:ic=\EP:im=:k0=^A:k1=^B:\ :k2=^D:k3=^L:k4=^U:k5=^P:k6=^N:k7=^S:kb=^H:kd=\EB:\ :kh=^W:kl=\ED:kr=\EC:ku=\EA:l0=f1:l1=f2:l2=f3:l3=f4:\ :l4=f5:l5=f6:l6=f7:l7=f8:le=^H:nd=\EC:pf=\E]+:\ :po=\E]=:se=\ER@:sf=^J:so=\ERD:ta=^I:up=\EA:ve=\ERC:\ :vi=\ERc: #### Atari ST # # From: Simson L. Garfinkel atari|atari st:\ :am:\ :co#80:it#8:li#25:\ :al=\EL:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :dl=\EM:\ :do=\EB:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=\ED:nd=\EC:\ :se=\Eq:so=\Ep:sr=\EI:ta=^I:up=\EA: # UniTerm terminal program for the Atari ST: 49-line VT220 emulation mode # From: Paul M. Aoki uniterm|uniterm49|UniTerm VT220 emulator with 49 lines:\ :li#49:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;49r\E[49;1H:tc=vt220: #### Commodore Business Machines # # Formerly located in West Chester, PA; went spectacularly bust in 1994 # after years of shaky engineering and egregious mismanagement. Made one # really nice machine (the Amiga) and boatloads of nasty ones (PET, C-64, # C-128, VIC-20). The C-64 is said to have been the most popular machine # ever (most units sold); they can still be found gathering dust in closets # everywhere. # # From: Kent Polk , 30 May 90 # Added a few more entries, converted caret-type control sequence (^x) entries # to '\0xx' entries since a couple of people mentioned losing '^x' sequences. # # :as:, :ae: Support for alternate character sets. # :ve=\E[\040p:vi=\E[\060\040p: cursor visible/invisible. # :xn: vt100 kludginess at column 80/NEWLINE ignore after 80 cols(Concept) # This one appears to fix a problem I always had with a line ending # at 'width+1' (I think) followed by a blank line in vi. The blank # line tended to disappear and reappear depending on how the screen # was refreshed. Note that this is probably needed only if you use # something like a Dnet Fterm with the window sized to some peculiar # dimension larger than 80 columns. # :k0=\E9~: map F10 to k0 - could have F0-9 -> k0-9, but ... F10 was 'k;' # (amiga: removed obsolete ":kn#10:" -- esr) amiga-old|Amiga ANSI:\ :am:bs:bw:xn:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=:ho=\E[H:ic=\E[@:im=:is=\E[20l:k0=\E9~:k1=\E0~:\ :k2=\E1~:k3=\E2~:k4=\E3~:k5=\E4~:k6=\E5~:k7=\E6~:\ :k8=\E7~:k9=\E8~:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\E[D:mb=\E[7;2m:md=\E[1m:me=\E[m:mh=\E[2m:\ :mk=\E[8m:mr=\E[7m:nd=\E[C:r1=\Ec:se=\E[m:sf=\E[S:\ :so=\E[7m:sr=\E[T:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[ p:\ :vi=\E[0 p: # From: Hans Verkuil , 4 Dec 1995 amiga|Amiga ANSI:\ :bw:ms:\ :co#80:li#24:\ :DC=\233%dP:DO=\233%dB:IC=\233%d@:LE=\233%dD:\ :RI=\233%dC:SF=\233%dS:SR=\233%dT:UP=\233%dA:ae=^O:\ :as=^N:bl=^G:bt=\233Z:cd=\233J:ce=\233K:\ :cl=\233H\233J:cm=\233%i%d;%dH:cr=^M:dc=\233P:\ :do=\233B:ec=\233%dP:ei=:ho=\233H:ic=\233@:im=:\ :is=\23320l:k0=\2339~:k1=\2330~:k2=\2331~:k3=\2332~:\ :k4=\2333~:k5=\2334~:k6=\2335~:k7=\2336~:k8=\2337~:\ :k9=\2338~:kD=\177:kb=^H:kd=\233B:kl=\233D:kr=\233C:\ :ku=\233A:le=\233D:mb=\2337;2m:md=\2331m:me=\2330m:\ :mh=\2332m:mk=\2338m:mr=\2337m:nd=\233C:nw=\233B\r:\ :r1=\Ec:se=\2330m:sf=\233S:so=\2337m:sr=\233T:ta=^I:\ :te=\233?7h:ti=\233?7l:ue=\2330m:up=\233A:us=\2334m:\ :vb=^G:ve=\233 p:vi=\2330 p: #### Osborne # # Thu Jul 7 03:55:16 1983 # # As an aside, be careful; it may sound like an anomaly on the # Osborne, but with the 80-column upgrade, it's too easy to # enter lines >80 columns! # # I've already had several comments... # The Osborne-1 with the 80-col option is capable of being # 52, 80, or 104 characters wide; default to 80 for compatibility # with most systems. # # The tab is destructive on the Ozzie; make sure to 'stty -tabs'. ozzie|osborne|osborne1|osborne 1:\ :ms:ul:xt:\ :co#104:li#24:\ :al=\EE:bl=^G:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:dc=\EW:\ :dl=\ER:do=^J:ei=:ic=\EQ:im=:kd=^J:kl=^H:kr=^L:ku=^K:\ :le=^H:nd=^L:se=\E(:sf=^J:so=\E):ue=\Em:up=^K:us=\El: #### Console types for obsolete UNIX clones # # Coherent, Minix, Venix, and several lesser-known kin were OSs for 8088 # machines that tried to emulate the UNIX look'n'feel. Coherent and Venix # were commercial, Minix an educational tool sold in conjuction with a book. # Memory-segmentation limits and a strong tendency to look like V7 long after # it was obsolete made all three pretty lame. Venix croaked early. Coherent # and Minix were ported to 32-bit Intel boxes, only to be run over by a # steamroller named `Linux' (which, to be fair, traces some lineage to Minix). # Coherent's vendor, the Mark Williams Company, went belly-up in 1994. # minix|minix console:\ :co#80:it#8:li#25:\ :AL=\E[%dLce=\E[K:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:\ :IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:\ :cd=\E[0J:cl=\E[H\E[0J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:k0=\E[Y:\ :k1=\E[V:k2=\E[U:k3=\E[T:k4=\E[S:k5=\E[G:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=^M^J:\ :se=\E[0m:sf=^J:so=\E[7m:sr=\EM:ta=^I:ue=\E[0m:\ :up=\E[A:us=\E[4m: # According to the Coherent 2.3 manual, the PC console is similar # to a z19. The differences seem to be (1) 25 lines, (2) no status # line, (3) standout is broken, (4) ins/del line is broken, (5) # has blinking and bold. pc-coherent|pcz19|coherent|IBM PC console running Coherent:\ :am:mi:\ :co#80:it#8:li#25:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :cr=^M:\ :dc=\EN:do=\EB:ei=\EO:ho=\EH:im=\E@:kb=^H:kd=\EB:\ :kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\Eq:\ :sf=^J:so=\Ep:sr=\EI:ta=^I:up=\EA: # According to the Venix 1.1 manual, the PC console is similar # to a DEC vt52. Differences seem to be (1) arrow keys send # different strings, (2) enhanced standout, (3) added insert/delete line. # Note in particular that it doesn't have automatic margins. # There are other keys (f1-f10, pgup, pgdn, backtab, insch, delch) # not described here. pc-venix|venix|IBM PC console running Venix:\ :co#80:it#8:li#25:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:dl=\EM:do=^J:kb=^H:kd=\EP:kh=\EG:kl=\EK:\ :kr=\EM:ku=\EH:le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:\ :up=\EA: #### Miscellaneous microcomputer consoles # # If you know anything more about any of these, please tell me. # basis from Peter Harrison, Computer Graphics Lab, San Francisco # ucbvax!ucsfmis!harrison ...uucp / ucbvax!ucsfmis!harrison@BERKELEY ...ARPA # (basis: removed obsolete ":ma=^K^P^R^L^L :nl=5000*^J:" -- esr) basis|BASIS108 computer with terminal translation table active:\ :cd=\EY:ce=\ET:cl=300\E*:do=5000\n:kb=^H:kd=^J:kl=^H:\ :kr=^L:ku=^K:se=\E):so=\E(:tc=adm3a: # luna's BMC terminal emulator luna|luna68k|LUNA68K Bitmap console:\ :co#88:li#46:tc=ansi-mini: megatek|pegasus workstation terminal emulator:\ :am:os:\ :co#83:li#60: # The Xerox 820 was a Z80 micro with a snazzy XEROX PARC-derived # interface (pre-Macintosh by several years) that went nowhere. xerox820|x820|Xerox 820:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^Q:ce=^X:cl=1^Z:cm=\E=%+ %+ :cr=^M:do=^J:\ :ho=^^:le=^H:nd=^L:sf=^J:up=^K: #### Videotex and teletext # # standard-issue France Telecom minitel terminal (made by Philips) # (m2-nam: had unknown ":zd=\E[1m:zb=\E[5m:zc=lkmjqxtuwvn:"; # also deleted unnecessary ":ug#0:sg#0:" -- esr) m2-nam|minitel|minitel-2|minitel-2-nam|France Telecom Minitel:\ :xn:\ :co#80:it#8:li#24:\ :ae=\E(B:al=\E[L:as=\E(0:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=\E[4l:ho=\E[H:\ :im=\E[4h:ip=7:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:sr=\EM:\ :ta=^I:ue=\E[m:up=\E[A:us=\E[4m: ######## OBSOLETE VDT TYPES # # These terminals are *long* dead -- these entries are retained for # historical interest only. #### Amtek Business Machines # # (abm80: early versions of this entry apparently had ":se=\E^_:so=\E^Y", # but these caps were commented out in 8.3; also, removed overridden # ":do=^J:" -- esr) abm80|amtek business machines 80:\ :am:bw:\ :co#80:li#24:\ :al=\E^Z:bt=^T:cd=\E^X:ce=\E^O:cl=\E^\:\ :cm=\E\021%r%+ %+ :dl=\E^S:do=\E^K:ho=\E^R:le=^H:\ :nd=^P:up=\E^L: #### Bell Labs blit terminals # # These were AT&T's official entries. The 5620 FAQ maintained by # David Breneman has this to say: # # Actually, in the beginning was the Jerq, and the Jerq was white with a # green face, and Locanthi and Pike looked upon the Jerq and said the Jerq # was good. But lo, upon the horizon loomed a mighty management-type person # (known now only by the initials VP) who said, the mighty Jerq must stay # alone, and could not go forth into the world. So Locanthi and Pike put the # Jerq to sleep, cloned its parts, and the Blit was brought forth unto the # world. And the Jerq lived the rest of its days in research, but never # strayed from those paths. # # In all seriousness, the Blit was originally known as the Jerq, but when # it started to be shown outside of the halls of the Bell Labs Research # organization, the management powers that be decided that the name could # not remain. So it was renamed to be Blit. This was in late 1981. # # (The AT&T 5620 was the commercialized Blit. Its successors were the 630, # 730, and 730+.) # blit|jerq|blit running teletype rom:\ :am:eo:ul:xo:\ :co#87:it#8:li#72:\ :AL=\EF%+ :DC=\Ee%+ :DL=\EE%+ :IC=\Ef%+ :al=\EF!:\ :bl=^G:ce=\EK:cl=^L:cm=\EY%r%+ %+ :cr=^M:dc=\Ee!:\ :dl=\EE!:do=^J:ei=:ic=\Ef!:im=:k1=\Ex:k2=\Ey:k3=\Ez:\ :kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=\ED:nd=\EC:\ :sf=^J:ta=^I:up=\EA: # (cbblit: here's a BSD termcap that says =\EG -- esr) cbblit|fixterm|blit running columbus code:\ :co#88:\ :cd=\EJ:ei=\ER:ic@:im=\EQ:pO=\EP%03:pf=^T:po=^R:\ :se=\EV!:so=\EU!:ue=\EV":us=\EU":vb=\E^G:tc=blit: oblit|ojerq|first version of blit rom:\ :am:da:db:eo:mi:ul:xo:\ :co#88:it#8:li#72:\ :AL=\Ef%+ :DL=\Ee%+ :al=\EF:bl=^G:cd=\EJ:ce=\EK:\ :cl=^L:cm=\EY%r%+ %+ :cr=^M:dc=\EO:dl=\EE:do=^J:\ :ei=\ER:im=\EQ:kb=^H:le=\ED:nd=\EC:sf=^J:ta=^I:\ :up=\EA:vb=\E^G: #### Bolt, Beranek & Newman (bbn) # # The BitGraph was a product of the now-defunct BBN Computer Corporation. # The parent company, best known as the architects of the Internet, is # still around. # # Entries for the BitGraph terminals. The problem # with scrolling in vi can only be fixed by getting BBN to put # smarter scroll logic in the terminal or changing vi or padding # scrolls with about 500 ms delay. # # I always thought the problem was related to the terminal # counting newlines in its input buffer before scrolling and # then moving the screen that much. Then vi comes along and # paints lines in on the bottom line of the screen, so you get # this big white gap. bitgraph|bg2.0nv|bg3.10nv|bbn bitgraph 2.0 or later (normal video):\ :is=\E>\E[?5l\E[?7h:vb=\E[?5h\E[?5l:tc=bg2.0: bg2.0rv|bg3.10rv|bbn bitgraph 2.0 (reverse video):\ :is=\E>\E[?5h\E[?7h:vb=\E[?5l\E[?5h:tc=bg2.0: bg2.0|bg3.10|bbn bitgraph 2.0 or later (no init):\ :xn:\ :co#85:li#64:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=%i\E[%d;%dH:cr=^M:cs=\E[%i%d;%dr:dl=\E[M:do=\E[B:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kd=\E[B:ke=\E>:\ :kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:l1=PF1:l2=PF2:l3=PF3:\ :l4=PF4:le=^H:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:sf=\n:\ :so=\E[7m:ta=^I:up=\E[A: bg1.25rv|bbn bitgraph 1.25 (reverse video):\ :is=\E>\E[?5h\E[?7h:vb=\E[?5l\E[?5h:tc=bg1.25: bg1.25nv|bbn bitgraph 1.25 (normal video):\ :is=\E>\E[?5l\E[?7h:vb=\E[?5h\E[?5l:tc=bg1.25: # (bg1.25: I added / based on the init string -- esr) bg1.25|bbn bitgraph 1.25:\ :co#85:li#64:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=%i\E[%d;%dH:cr=^M:dl=\E[M:do=\E[B:\ :k1=\EP:k2=\EQ:k3=\ER:k4=\ES:kd=\EB:ke=\E>:kl=\ED:\ :kr=\EC:ks=\E=:ku=\EA:l1=PF1:l2=PF2:l3=PF3:l4=PF4:\ :le=^H:ll=\E[64;1H:nd=\E[C:se=\E[m:sf=\n:so=\E[7m:\ :ta=^I:up=\E[A: #### Chromatics # # I have put the long strings in /. Ti sets up a window # that is smaller than the screen, and puts up a warning message # outside the window. Te erases the warning message, puts the # window back to be the whole screen, and puts the cursor at just # below the small window. I defined and to really turn # the cursor on and off, but I have taken this out since I don't # like the cursor being turned off when vi exits. cg7900|chromatics|chromatics 7900:\ :am:\ :co#80:li#40:\ :al=^A>2:bl=^G:cd=^Al:ce=^A`:cl=^L:\ :cm=\001M%r%d\\\054%d\\\054:cr=^M:dc=^A<1:dl=^A<2:\ :do=^J:ei=:ho=^\:ic=^A>1:im=:le=^H:ll=^A|:nd=^]:\ :se=\001C1\\\054\001c2\\\054:sf=^J:\ :so=\001C4\\\054\001c7\\\054:\ :te=\001W0\\\05440\\\05485\\\05448\\\054\014\001W0\\\0540\\\05485\\\05448\\\054\001M0\\\05440\\\054:\ :ti=\001P0\001O1\001R1\001C4\\\054\001c0\\\054\014\001M0\\\05442\\\054WARNING DOUBLE ENTER ESCAPE and \025\001C1\\\054\001c2\\\054\001W0\\\0540\\\05479\\\05439\\\054:\ :uc=\001\001_\001\200:up=^K: #### Computer Automation # ca22851|computer automation 22851:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^\:ce=^]:cl=\014:cm=\002%i%.%.:cr=^M:do=^J:\ :ho=^^:kd=^W:kh=^^:kl=^U:ku=^V:le=^U:nd=^I:sf=^J:\ :up=^V: #### Cybernex # # This entry has correct padding and the undocumented "ri" capability cyb83|xl83|cybernex xl-83:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\020:ce=\017:cl=\014:cm=\027%+ %+ :cr=^M:\ :do=^J:ho=^K:kd=^J:kl=^H:kr=^I:ku=^N:le=^H:nd=^I:\ :sf=^J:sr=^N:up=^N: # (mdl110: removed obsolete ":ma=^Z^P:" and overridden ":cd=145^NA^W:" -- esr) cyb110|mdl110|cybernex mdl-110:\ :am:\ :co#80:li#24:\ :al=\016A\016\035:bl=^G:cd=\016@\026:ce=\016@\026:\ :cl=\030:cm=\020%+ %+ :cr=^M:dc=\016A\036:\ :dl=\016A\016\036:do=^J:ei=:ho=^Y:ic=\016A\035:im=:\ :le=^H:nd=^U:se=^NG:sf=^J:so=^NF:ta=\011:up=^Z: #### Datapoint # # Datapoint is gone. They used to be headquartered in Texas. # They created ARCnet, an Ethernet competitor that flourished for a while # in the early 1980s before 3COM got wise and cut its prices. The service # side of Datapoint still lives (1995) in the form of Intelogic Trace. # dp3360|datapoint|datapoint 3360:\ :am:\ :co#82:li#25:\ :bl=^G:cd=^_:ce=^^:cl=^]^_:cr=^M:do=^J:ho=^]:le=^H:\ :nd=^X:sf=^J:up=^Z: #### DEC terminals (Obsolete types: DECwriter and vt40/42/50) # # These entries are DEC's official terminfos for its older terminals. # Contact Bill Hedberg of Terminal Support # Engineering for more information. Updated terminfos and termcaps # are kept available at ftp://gatekeeper.dec.com/pub/DEC/termcaps. # gt40|dec gt40:\ :os:\ :co#72:li#30:\ :bl=^G:cr=^M:do=^J:le=^H: gt42|dec gt42:\ :os:\ :co#72:li#40:\ :bl=^G:cr=^M:do=^J:le=^H: vt50|dec vt50:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cr=^M:do=^J:le=^H:\ :nd=\EC:sf=^J:ta=^I:up=\EA: vt50h|dec vt50h:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:\ :do=^J:le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: # (vt61: there's a BSD termcap that claims =\EPd, =\EPf. =^H) vt61|vt-61|vt61.5|dec vt61:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=\r:\ :do=^J:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :sf=\n:sr=\EI:ta=^I:up=\EA: # The gigi does standout with red! # (gigi: I added / based on the init string, corrected cub1 -- esr) gigi|vk100|dec gigi graphics terminal:\ :am:xn:\ :co#84:li#24:\ :DO=\E[%dB:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:do=^J:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?20l\E[?7h\E[?8h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kd=\EOB:ke=\E[?1l\E>:\ :kh=\E[H:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :nd=\E[C:se=\E[m:sf=^J:so=\E[7;31m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # DEC PRO-350 console (VT220-style). The 350 was DEC's attempt to produce # a PC differentiated from the IBM clones. It was a total, ludicrous, # grossly-overpriced failure (among other things, DEC's OS didn't include # a format program, so you had to buy pre-formatted floppies from DEC at # a hefty premium!). pro350|decpro|dec pro console:\ :co#80:it#8:li#24:\ :ae=\EG:as=\EF:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :do=\EB:ho=\EH:k0=\EE:k1=\EF:k2=\EG:k3=\EH:k4=\EI:\ :k5=\EJ:k6=\Ei:k7=\Ej:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :ku=\EA:le=^H:nd=\EC:se=\E^N:so=\E^H:sr=\EI:ta=^I:\ :ue=\E^C:up=\EA:us=\E^D: dw1|decwriter I:\ :hc:os:\ :co#72:\ :bl=^G:cr=^M:do=^J:le=^H:sf=^J: dw2|decwriter|dw|decwriter II:\ :hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:kb=^H:le=^H:sf=^J: # \E(B Use U.S. character set (otherwise # => british pound !) # \E[20l Disable "linefeed newline" mode (else puts \r after \n,\f,\v) # \E[w 10 char/in pitch # \E[1;132 full width horizontal margins # \E[2g clear all tab stops # \E[z 6 lines/in # \E[66t 66 lines/page (for \f) # \E[1;66r full vertical page can be printed # \E[4g clear vertical tab stops # \E> disable alternate keypad mode (so it transmits numbers!) # \E[%i%p1%du set tab stop at column %d (origin == 1) # (Full syntax is \E[n;n;n;n;n;...;nu where each 'n' is # a tab stop) # # The dw3 does standout with wide characters. # dw3|la120|decwriter III:\ :hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:\ :i1=\E(B\E[20l\E[w\E[0;132s\E[2g\E[z\E[66t\E[1;66r\E[4g\E>:\ :is=\E[9;17;25;33;41;49;57;65;73;81;89;97;105;113;121;129u\r:\ :kb=^H:le=^H:se=\E[w:sf=^J:so=\E[6w:ta=^I: dw4|decwriter IV:\ :am:hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:is=\Ec:k0=\EOP:k1=\EOQ:k2=\EOR:\ :k3=\EOS:kb=^H:le=^H:sf=^J:ta=^I: # These aren't official ln03|dec ln03 laser printer:\ :hc:\ :co#80:li#66:\ :bl=^G:cr=^M:do=^J:hd=\EK:hu=\EL:nw=^M^J:se=\E[22m:\ :sf=^J:so=\E[1m:ta=^I:ue=\E[24m:us=\E[4m: ln03-w|dec ln03 laser printer 132 cols:\ :co#132:\ :bl=^G:cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:\ :ta=^I:tc=ln03: #### Delta Data (dd) # # Untested. The cup sequence is hairy enough that it probably needs work. # The idea is ctrl(O), dd(row), dd(col), where dd(x) is x - 2*(x%16) + '9'. # There are BSD-derived termcap entries floating around for this puppy # that are *certainly* wrong. delta|dd5000|delta data 5000:\ :am:\ :co#80:li#27:\ :bl=^G:ce=^NU:cl=^NR:cm=\017%+^P%+^P:dc=^NV:do=^J:\ :ho=^NQ:le=^H:nd=^Y:sf=^J:up=^Z: #### Digital Data Research (ddr) # # (ddr: I added / based on the init string -- esr) ddr|rebus3180|ddr3180|Rebus/DDR 3180 vt100 emulator:\ :am:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[7l:SA=\E[7l:cd=50\E[J:ce=3\E[K:cl=50\E[H\E[2J:\ :cm=5\E[%i%d;%dH:cs=\E[%i%d;%dr:do=^J:ho=\E[H:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\E[B:ke=\E[?1l\E>:kl=\E[D:kr=\E[C:\ :ks=\E[?1h\E=:ku=\E[A:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/lib/tabset/vt100:sc=\E7:se=\E[m:\ :sf=5\ED:so=\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: #### General Electric (ge) # terminet1200|terminet300|tn1200|tn300|terminet|GE terminet 1200:\ :hc:os:\ :co#120:\ :bl=^G:cr=^M:do=^J:sf=^J: #### Heathkit/Zenith # # Here is a description of the H19 DIP switches: # # S401 # 0-3 = baud rate as follows: # # 3 2 1 0 # --- --- --- --- # 0 0 1 1 300 baud # 0 1 0 1 1200 baud # 1 0 0 0 2400 baud # 1 0 1 0 4800 baud # 1 1 0 0 9600 baud # 1 1 0 1 19.2K baud # # 4 = parity (0 = no parity) # 5 = even parity (0 = odd parity) # 6 = stick parity (0 = normal parity) # 7 = full duplex (0 = half duplex) # # S402 # 0 = block cursor (0 = underscore cursor) # 1 = no key click (0 = keyclick) # 2 = wrap at end of line (0 = no wrap) # 3 = auto LF on CR (0 = no LF on CR) # 4 = auto CR on LF (0 = no CR on LF) # 5 = ANSI mode (0 = VT52 mode) # 6 = keypad shifted (0 = keypad unshifted) # 7 = 50Hz refresh (1 = 60Hz refresh) # # Factory Default settings are as follows: # 7 6 5 4 3 2 1 0 # S401 1 0 0 0 1 1 0 0 # S402 0 0 0 0 0 0 0 0 # (h19: I added / based on the init string -- esr) h19-a|heath-ansi|heathkit-a|heathkit h19 ansi mode:\ :am:mi:ms:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:ae=\E[11m:al=\E[1L:as=\E[10m:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :dc=\E[1P:dl=\E[1M:do=\E[1B:ei=\E[4l:ho=\E[H:\ :im=\E[4h:\ :is=\E<\E[>1;2;3;4;5;6;7;8;9l\E[m\E[11m\E[?7h:\ :k1=\EOS:k2=\EOT:k3=\EOU:k4=\EOV:k5=\EOW:k6=\EOP:\ :k7=\EOQ:k8=\EOR:kb=^H:kd=\E[1B:kh=\E[H:kl=\E[1D:\ :kr=\E[1C:ku=\E[1A:l6=blue:l7=red:l8=white:le=^H:\ :nd=\E[1C:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :up=\E[1A:ve=\E[>4l:vs=\E[>4h: h19-bs|heathkit w/keypad shifted:\ :ke=\Eu:ks=\Et:tc=h19-b: h19-smul|heathkit w/keypad shifted/underscore cursor:\ :ke=\Eu:ks=\Et:tc=h19-u: # (h19: merged in from BSDI hp19-e entry> h19|heath|h19-b|heathkit|heath-19|z19|zenith|heathkit h19:\ :am:es:hs:mi:ms:\ :co#80:it#8:li#24:\ :ae=\EG:al=\EL:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EE:\ :cm=\EY%+ %+ :cr=^M:dc=\EN:dl=\EM:do=\EB:ei=\EO:\ :fs=\Ek\Ey5:ho=\EH:im=\E@:ip=1.5<1.5/>:k1=\ES:k2=\ET:\ :k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:k8=\ER:kb=^H:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:l6=blue:l7=red:\ :l8=white:le=^H:nd=\EC:se=\Eq:sf=^J:so=\Ep:sr=\EI:\ :ta=^I:ts=\Ej\Ex5\EY8%p1%{32}%+%c\Eo\Eo:up=\EA:\ :ve=\Ey4:vs=\Ex4: h19-u|heathkit with underscore cursor:\ :ve@:vs@:tc=h19-b: h19-us|h19us|heathkit w/keypad shifted/underscore cursor:\ :ke=\Eu:ks=\Et:tc=h19-u: h19-g|h19g|heathkit w/block cursor:\ :ve=\Ex4:tc=h19-b: alto-h19|altoh19|altoheath|alto-heath|alto emulating heathkit h19:\ :li#60:\ :al=\EL:dl=\EM:tc=h19: # The major problem with the Z29 is that it requires more padding than the Z19. # # The problem with declaring an H19 to be synonymous with a Z29 is that # it needs more padding. It especially loses if a program attempts # to put the Z29 into insert mode and insert text at 9600 baud. It # even loses worse if the program attempts to insert tabs at 9600 # baud. Adding padding to text that is inserted loses because in # order to make the Z29 not die, one must add so much padding that # whenever the program tries to use insert mode, the effective # rate is about 110 baud. # # What program would want to put the terminal into insert mode # and shove stuff at it at 9600 baud you ask? # # Emacs. Emacs seems to want to do the mathematically optimal # thing in doing a redisplay rather than the practical thing. # When it is about to output a line on top of a line that is # already on the screen, instead of just killing to the end of # the line and outputting the new line, it compares the old line # and the new line and if there are any similarities, it # constructs the new line by deleting the text on the old line # on the terminal that is already there and then inserting new # text into the line to transform it into the new line that is # to be displayed. The Z29 does not react kindly to this. # # But don't cry for too long.... There is a solution. You can make # a termcap entry for the Z29 that says the Z29 has no insert mode. # Then Emacs cannot use it. "Oh, no, but now inserting into a # line will be really slow", you say. Well there is a sort of a # solution to that too. There is an insert character option on # the Z29 that will insert one character. Unfortunately, it # involves putting the terminal into ansi mode, inserting the # character, and changing it back to H19 mode. All this takes 12 # characters. Pretty expensive to insert one character, but it # works. Either Emacs doesn't try to use its inserting hack when # it's only given an insert character ability or the Z29 doesn't # require padding with this (the former is probably more likely, # but I haven't checked it out). z29|zenith29|z29b|zenith z29b:\ :am:ms:\ :co#80:li#24:\ :ae=\EF:al=\EL:as=\EG:bl=^G:bt=\E-:cd=\EJ:ce=\EK:\ :cl=\EE:cm=\EY%+ %+ :cr=^M:dc=\EN:dl=\EM:do=\EB:ei=:\ :ho=\EH:ic=\E<\E[1@\E[?2h:im=:is=\E<\E[?2h\Ev:k0=\E~:\ :k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:\ :k8=\ER:k9=\E0I:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :ku=\EA:l0=home:le=^H:nd=\EC:se=\Eq:sf=\n:so=\Ep:\ :sr=\EI:ta=^I:ue=\Es0:up=\EA:us=\Es8:ve=\Ey4:vs=\Ex4: # z29 in ansi mode. Assumes that the cursor is in the correct state, and that # the world is stable. causes the terminal to be reset to the state # indicated by the name. kc -> key click, nkc -> no key click, uc -> underscore # cursor, bc -> block cursor. # From: Mike Meyers z29a|z29a-kc-bc|h29a-kc-bc|heath/zenith 29 in ansi mode:\ :es:hs:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:\ :dc=\E[1P:do=^J:ds=\E[>1l:fs=\E[u\E[>5l:ho=\E[H:\ :if=/usr/share/tabset/zenith29:k0=\E[~:k1=\EOS:\ :k2=\EOT:k3=\EOU:k4=\EOV:k5=\EOW:k6=\EOP:k7=\EOQ:\ :k8=\EOR:k9=\EOX:kC=\E[J:kS=\E[J:kb=^H:kd=\EOB:\ :kh=\E[H:kl=\EOD:kr=\EOC:ku=\EOA:l0=help:le=^H:\ :mb=\E[5m:md=\E[2m:me=\E[m:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :nw=^M\ED:ps=\E#7:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>4h\E[>1;2;3;5;6;7;8;9l\E[m\E[11m:\ :rc=\E[r:sc=\E[s:se=\E[m:sf=\ED:so=\E[7;2m:sr=\EM:\ :st=\EH:ta=^I:te=\E[?7h:ti=\E[?7l:\ :ts=\E[s\E[>5;1h\E[25;%i%dH\E[1K:ue=\E[m:up=\E[A:\ :us=\E[4m: z29a-kc-uc|h29a-kc-uc|z29 ansi mode with keyckick and underscore cursor:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>1;2;3;4;5;6;7;8;9l\E[m\E[11m:tc=z29a: z29a-nkc-bc|h29a-nkc-bc|z29 ansi mode with block cursor and no keyclick:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>2;4h\E[>1;3;5;6;7;8;9l\E[m\E[11m:tc=z29a: z29a-nkc-uc|h29a-nkc-uc|z29 ansi mode with underscore cursor and no keyclick:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>2h\E[>1;3;4;5;6;7;8;9l\E[m\E[11m:tc=z29a: # From: Jeff Bartig 31 Mar 1995 z39-a|z39a|zenith39-a|zenith39-ansi|Zenith 39 in ANSI mode:\ :5i:am:es:hs:mi:ms:xo:\ :co#80:li#24:\ :%1=\E[~:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:\ :K1=\EOw:K2=\EOy:K3=\EOu:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooqqssttuuvvwwxx~~0a:ae=\E(B:\ :al=\E[1L:as=\E(0:bl=^G:bt=\E[1Z:cb=\E[1K:cd=\E[0J:\ :ce=\E[0K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[1P:dl=\E[1M:do=\E[B:\ :ds=\E[>1l:ei=\E[4l:fs=\E[u:ho=\E[H:im=\E[4h:\ :is=\E<\E[>1;3;5;6;7l\E[0m\E[2J:k1=\EOS:k2=\EOT:\ :k3=\EOU:k4=\EOV:k5=\EOW:k6=\EOP:k7=\EOQ:k8=\EOR:\ :k9=\EOX:kS=\E[J:kb=^H:kd=\E[B:ke=\E[>7l:kh=\E[H:\ :kl=\E[D:kr=\E[C:ks=\E[>7h:ku=\E[A:le=^H:ll=\E[24;1H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mh=\E[2m:mr=\E[7m:\ :nd=\E[C:pf=\E[4i:po=\E[5i:ps=\E[?19h\E[i:\ :r2=\E<\Ec\200:rc=\E[u:sc=\E[s:se=\E[0m:sf=^J:\ :so=\E[7m:st=\EH:ta=^I:ts=\E[s\E[>1h\E[25;%i%p1%dH:\ :ue=\E[0m:up=\E[A:us=\E[4m:ve=\E[>5l:vi=\E[>5h: # From: Brad Brahms z100|h100|z110|z-100|h-100|heath/zenith z-100 pc with color monitor:\ :ve=\Ey4\Em70:vs=\Ex4\Em71:tc=z100bw: # (z100bw: removed obsolete ":kn#10:" -- esr) z100bw|h100bw|z110bw|z-100bw|h-100bw|heath/zenith z-100 pc:\ :mi:ms:\ :co#80:it#8:li#24:\ :ae=\EG:al=5*\EL:as=\EF:cd=\EJ:ce=\EK:cl=5*\EE:\ :cm=1*\EY%+ %+ :dc=1*\EN:dl=5*\EM:do=\EB:ei=\EO:\ :ho=\EH:im=\E@:k0=\EJ:k1=\ES:k2=\ET:k3=\EU:k4=\EV:\ :k5=\EW:k6=\EP:k7=\EQ:k8=\ER:k9=\EOI:kb=^H:kd=\EB:\ :kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\Eq:\ :so=\Ep:sr=\EI:ta=^I:up=\EA:ve=\Ey4:vs=\Ex4: p19|h19-b with il1/dl1:\ :al=2*\EL:dl=2*\EM:tc=h19-b: # From: # (ztx: removed duplicate :sr: -- esr) ztx|ztx11|zt-1|htx11|ztx-1-a|ztx-10 or 11:\ :am:es:hs:\ :co#80:it#8:li#24:\ :al=\EL:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :dl=\EM:\ :do=^J:ds=\Ey1:fs=\Ek\Ey5:ho=\EH:\ :is=\Ej\EH\Eq\Ek\Ev\Ey1\Ey5\EG\Ey8\Ey9\Ey>:k0=\ES:\ :k1=\EB:k2=\EU:k3=\EV:k4=\EW:k5=\EP:k6=\EQ:k7=\ER:\ :kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :se=\Eq:so=\Es5:sr=\EI:ta=^I:\ :ts=\Ej\Ex5\Ex1\EY8%+ \Eo:ue=\Eq:up=\EA:us=\Es2: #### IMS International (ims) # # There was a company called IMS International located in Carson City, # Nevada, that flourished from the mid-70s to mid-80s. They made S-100 # bus/Z80 hardware and a line of terminals called Ultimas. # From: Erik Fair Sun Oct 27 07:21:05 1985 ims950-b|bare ims950 no init string:\ :is@:tc=ims950: # (ims950: removed obsolete ":ko@:" -- esr) ims950|ims televideo 950 emulation:\ :xn@:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb@:kd@:kh@:\ :kl@:kr@:ku@:vb@:tc=tvi950: # (ims950-rv: removed obsolete ":ko@:" -- esr) ims950-rv|ims tvi950 rev video:\ :xn@:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb@:kd@:kh@:\ :kl@:kr@:ku@:vb@:tc=tvi950-rv: ims-ansi|ultima2|ultimaII|IMS Ultima II:\ :am:\ :co#80:it#8:li#24:\ :cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:cm=\E[%i%2;%2H:\ :do=\ED:if=/usr/share/tabset/vt100:\ :is=\E[m\E[>14l\E[?1;?5;20l\E>\E[1m\r:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:se=\E[m\E[1m:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m\E[1m:up=\EM:us=\E[4m: #### Intertec Data Systems # # I think this company is long dead as of 1995. They made an early CP/M # micro called the "Intertec Superbrain" that was moderately popular, # then sank out of sight. # superbrain|intertec superbrain:\ :am:bw:\ :co#80:li#24:\ :bl=^G:cd=\E~k<10*>:ce=\E~K:cl=\014:cm=\EY%+ %+ :\ :cr=^M:do=^J:kd=^J:kl=^U:kr=^F:ku=^K:le=^H:nd=^F:\ :sf=^J:ta=^I:te=^L:ti=^L:up=^K: intertube|intertec|Intertec InterTube:\ :am:\ :co#80:li#25:\ :bl=^G:cl=^L:cm=\EY%+ %+ :cr=^M:do=^J:ho=^A:le=^H:\ :nd=^F:se=\E0@:sf=^J:so=\E0P:up=^Z: # The intertube 2 has the "full duplex" problem like the tek 4025: if you # are typing and a command comes in, the keystrokes you type get interspersed # with the command and it messes up intertube2|intertec data systems intertube 2:\ :ce=\EK:ch=\020%+^J:cm=\016%.\020%+^J:cv=\013%.:\ :ll=^K^X\r:tc=intertube: #### Ithaca Intersystems # # This company made S100-bus personal computers long ago in the pre-IBM-PC # past. They used to be reachable at: # # Ithaca Intersystems # 1650 Hanshaw Road # Ithaca, New York 14850 # # However, the outfit went bankrupt years ago. # # The Graphos III was a color graphics terminal frome Ithaca Intersystems. # These entries were written (originally in termcap syntax) by Brian Yandell # and Mike Meyer at the # University of Wisconsin. # (graphos: removed obsolete and syntactically incorrect :kn=4: -- esr) graphos|graphos III:\ :am:mi:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:dm=\E[4h:\ :do=\E[B:ed=\E[4l:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/init.graphos:im=\E[4h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:nd=\E[C:nw=^M\ED:\ :rc=\E8:rf=/usr/lib/tabset/init.graphos:sc=\E7:\ :se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:up=\E[A:\ :ve=\Ez56;2;0;0z\Ez73z\Ez4;1;1z:\ :vs=\Ez4;2;1z\Ez56;2;80;24z: graphos-30|graphos III with 30 lines:\ :li#30:\ :vs=\Ez4;2;1z\Ez56;2;80;30z:tc=graphos: #### Modgraph # # These people used to be reachable at: # # Modgraph, Inc # 1393 Main Street, # Waltham, MA 02154 # Vox: (617)-890-5796. # # However, if you call that number today you'll get an insurance company. # I think Modgraph is long gone. # modgraph|mod|modgraph terminal emulating vt100:\ :xn@:\ :co#80:li#24:\ :is=\E^9;0s\E^7;1s\E[3g\E^11;9s\E^11;17s\E^11;25s\E^11;33s\E^11;41s\E^11;49s\E^11;57s\E^11;65s\E^11;73s\E^11;81s\E^11;89s:\ :rf@:sr=5\EM\E[K:vs=\E^9;0s\E^7;1s:tc=vt100: # The GX-1000 manual is dated 1984. This looks rather like a VT-52. modgraph2|modgraph gx-1000 80x24 with keypad not enabled:\ :am:da:db:\ :co#80:it#8:li#24:\ :cd=50\EJ:ce=3\EK:cl=50\EH\EJ:cm=5\EY%+ %+ :\ :is=\E<\E^5;2s\E^7;1s\E[3g\E^11;9s\E^11;17s\E^11;25s\E^11;33s\E^11;41s\E^11;49s\E^11;57s\E^11;65s\E^11;73s\E^11;81s\E^11;89s\E^12;0s\E^14;2s\E^15;9s\E^25;1s\E^9;1s\E^27;1:\ :le=^H:nd=2\EC:sr=5\EI:ta=^I:up=2\EA: #### Morrow Designs # # This was George Morrow's company. They started in the late 1970s making # S100-bus machines. They used to be reachable at: # # Morrow # 600 McCormick St. # San Leandro, CA 94577 # # but they're long gone now (1995). # # The mt70 terminal was shipped with the Morrow MD-3 microcomputer. # Jeff's specimen was dated June 1984. # From: Jeff Wieland 24 Feb 1995 mt70|mt-70|Morrow MD-70; native Morrow mode:\ :am:mi:ms:xo:\ :co#80:it#8:li#24:\ :%1=^AO\r:F1=^A`\r:F2=^Aa\r:F3=^Ab\r:F4=^Ac\r:\ :F5=^Ad\r:F6=^Ae\r:F7=^Af\r:F8=^Ag\r:F9=^Ah\r:\ :FA=^Ai\r:ac=+z\\\054{.yOi-x`|jGkFlEmDnHtLuKvNwMxIqJ:\ :ae=\E%:al=\EE:as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:\ :ei=:ho=^^:i1=\E"2\EG0\E]:ic=\EQ:im=:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:kB=^A^Z\r:\ :kC=^An\r:kD=\177:kb=^H:kd=^AK\r:kh=^AN\r:kl=^AL\r:\ :kr=^AM\r:ku=^AJ\r:le=^H:me=\EG0:mh=\EG2:mr=\EG4:\ :nd=^L:nw=^_:se=\EG0:sf=^J:so=\EG4:ta=^I:\ :ti=\E"2\EG0\E]:up=^K:us=\EG1:vb=\EK1\EK0:ve=\E"2:\ :vi=\E"0: #### Omron # # This company is still around in 1995, manufacturing point-of-sale systems. omron|Omron 8025AG:\ :am:da:db:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\ER:ce=\EK:cl=\EJ:cr=^M:dc=\EP:\ :dl=\EM:do=^J:ho=\EH:le=^H:nd=\EC:se=\E4:sf=\ES:\ :so=\Ef:sr=\ET:up=\EA:vs=\EN: #### Signetics # # From University of Wisconsin vsc|Signetics Vsc Video driver by RMC:\ :am:ms:\ :co#80:it#8:li#26:\ :ce=\E[K:cl=50\E[;H\E[2J:cm=\E[%i%d;%dH:cr=^M:do=^J:\ :ho=\E[H:kb=^H:kd=^J:kl=^H:le=^H:me=^_!:mr=^_ :\ :nd=\E[C:nw=^M^J:se=^_!:sf=^J:so=^_ :ta=^I:ue=^_#:\ :up=\E[A:us=^_": #### Soroc # # Alan Frisbie writes: # # As you may recall, the Soroc logo consisted of their name, # with the letter "S" superimposed over an odd design. This # consisted of a circle with a slightly smaller 15 degree (approx.) # wedge with rounded corners inside it. The color was sort of # a metallic gold/yellow. # # If I had been more of a beer drinker it might have been obvious # to me, but it took a clue from their service department to make # me exclaim, "Of course!" The circular object was the top of # a beer can (the old removable pop-top style) and "Soroc" was an # anagram for "Coors". # # I can just imagine the founders of the company sitting around # one evening, tossing back a few and trying to decide what to # call their new company and what to use for a logo. # # (soroc120: removed obsolete ":ma=^K^P^R^L^L :" -- esr) soroc120|iq120|soroc|soroc iq120:\ :cd=\EY:ce=\ET:cl=\E*:do=^J:kd=^J:kl=^H:kr=^L:ku=^K:tc=adm3a: soroc140|iq140|soroc iq140:\ :am:mi:\ :co#80:li#24:\ :al=\Ee:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:dc=\Ew:dl=\Er:do=^J:ei=\E8:ho=^^:\ :im=\E9:k0=^A0\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:\ :kh=^^:kr=^L:ku=^K:le=^H:ll=^^^K:nd=^L:se=\E\177:\ :sf=^J:so=\E\177:ue=\E^A:up=^K:us=\E^A: #### Southwest Technical Products # # These guys made an early personal micro called the M6800. # The ct82 was probably its console terminal. # # (swtp: removed obsolete ":bc=^D:" -- esr) swtp|ct82|southwest technical products ct82:\ :am:\ :co#82:li#20:\ :al=^^Y:bl=^G:cd=^V:ce=^F:cl=^L:cm=\013%r%.%.:cr=^M:\ :dc=^^H:dl=^Z:do=^J:ei=:ho=^P:ic=^^X:im=:\ :is=\034\022\036\023\036\004\035\027\011\023\036\035\036\017\035\027\022\011:\ :le=^D:ll=^C:nd=^S:se=^^^F:sf=^N:so=^^^V:sr=^O:up=^A: #### Synertek # # Bob Manson writes (28 Apr 1995): # # Synertek used to make ICs, various 6502-based single-board process # control and hobbyist computers, and assorted peripherals including a # series of small inexpensive terminals (I think they were one of the # first to have a "terminal-on-a-keyboard", where the terminal itself # was only slightly larger than the keyboard). # # They apparently had a KTM-1 model, which I've never seen. The KTM-2/40 # was a 40x24 terminal that could connect to a standard TV through a # video modulator. The KTM-2/80 was the 80-column version (the 2/40 # could be upgraded to the 2/80 by adding 2 2114 SRAMs and a new ROM). # I have a KTM-2/80 still in working order. The KTM-2s had fully # socketed parts, used 2 6507s, a 6532 as keyboard scanner, a program # ROM and 2 ROMs as character generators. They were incredibly simple, # and I've never had any problems with mine (witness the fact that mine # was made in 1981 and is still working great... I've blown the video # output transistor a couple of times, but it's a 2N2222 :-) # # The KTM-3 (which is what is listed in the terminfo file) was their # attempt at putting a KTM-2 in a box (and some models came with a # CRT). It wasn't much different from the KTM-2 hardware-wise, but the # control and escape sequences are very different. The KTM-3 was always # real broken, at least according to the folks I've talked to about it. # # The padding in the entry is probably off--these terminals were very # slow (it takes like 100ms for the KTM-2 to clear the screen...) And # anyone with any sanity replaced the ROMs with something that provided # a reasonable subset of VT100 functionality, since the usual ROMs were # obviously very primitive... oh, you could get an upgraded ROM from # Synertek for some incredible amount of money, but what hacker with an # EPROM burner would do that? :) # # Sorry I don't have any contact info; I believe they were located in # Sunnyvale, and I'm fairly sure they are still manufacturing ICs # (they've gone to ASICs and FPGAs), but I doubt they're in the computer # business these days. # Tested, seems to work fine with vi. synertek|ktm|synertek380|synertek ktm 3/80 tubeless terminal:\ :am:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=^Z:cm=\E=%+ %+ :le=^H:nd=^L:up=^K: #### Tab Office Products # # TAB Products Co. - Palo Alto, California # Electronic Office Products, # 1451 California Avenue 94304 # # I think they're out of business. # # The tab 132 uses xon/xoff, so no padding needed. # / have nothing to do with arrow keys. # sets 80 col mode, normal video, autowrap on (for ). # Seems to be no way to get rid of status line. # The manual for this puppy was dated June 1981. It claims to be VT52- # compatible but looks more vt100-like. tab132|tab|tab132-15|tab 132/15:\ :da:db:\ :co#80:dN@:li#24:lm#96:\ :al=\E[L:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=^J:\ :ei=\E[4l:im=\E[4h:is=\E[?7h\E[?3l\E[?5l:kd=\E[B:ke@:\ :kl=\E[D:ks@:ku=\E[A:tc=vt100: tab132-w|tab132 in wide mode:\ :co#132:\ :is=\E[?7h\E[?3h\E[?5l:tc=tab132: tab132-rv|tab132 in reverse-video mode:\ :is=\E[?7h\E[?3l\E[?5h:tc=tab132: tab132-w-rv|tab132 in reverse-video/wide mode:\ :is=\E[?7h\E[?3h\E[?5h:tc=tab132-w: #### Teleray # # Research Incorporated # 6425 Flying Cloud Drive # Eden Prairie, MN 55344 # Vox: (612)-941-3300 # # The Teleray terminals were all discontinued in 1992-93. RI still services # and repairs these beasts, but no longer manufactures them. The Teleray # people believe that all the types listed below are very rare now (1995). # There was a newer line of Telerays (Model 7, Model 20, Model 30, and # Model 100) that were ANSI-compatible. # # Note two things called "teleray". Reorder should move the common one # to the front if you have either. A dumb teleray with the cursor stuck # on the bottom and no obvious model number is probably a 3700. # t3700|dumb teleray 3700:\ :co#80:li#24:\ :bl=^G:cl=^L:cr=^M:do=^J:le=^H:sf=^J: t3800|teleray 3800 series:\ :co#80:it#8:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:do=^J:\ :ho=\EH:le=^H:ll=\EY7 :nd=\EC:sf=^J:ta=^I:up=^K: t1061|teleray|teleray 1061:\ :am:km:xs:xt:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\014:cm=\EY%+ %+ :\ :cr=^M:ct=\EG:dc=\EQ:dl=\EM:do=^J:ei=:ho=\EH:ic=\EP:\ :im=:ip=:\ :is=\Ee\EU01^Z1\EV\EU02^Z2\EV\EU03^Z3\EV\EU04^Z4\EV\EU05^Z5\EV\EU06^Z6\EV\EU07^Z7\EV\EU08^Z8\EV\Ef:\ :k1=^Z1:k2=^Z2:k3=^Z3:k4=^Z4:k5=^Z5:k6=^Z6:k7=^Z7:\ :k8=^Z8:le=^H:nd=\EC:se=\ER@:sf=^J:so= \ERD:st=\EF:\ :ta=^I:ue=\ER@:up=\EA:us=\ERH: t1061f|teleray 1061 with fast PROMs:\ :al=\EL:dl=\EM:ip@:tc=t1061: # "Teleray Arpa Special", officially designated as # "Teleray Arpa network model 10" with "Special feature 720". # This is the new (1981) fast microcode updating the older "arpa" proms # (which gave meta-key and programmable-fxn keys). 720 is much much faster, # converts the keypad to programmable function keys, and has other goodies. # Standout mode is still broken (magic cookie, etc) so is suppressed as no # programs handle such lossage properly. # Note: this is NOT the old termcap's "t1061f with fast proms." # From: J. Lepreau Tue Feb 1 06:39:37 1983, Univ of Utah # (t10: removed overridden ":so@:se@:us@:ue@:" -- esr) t10|teleray 10 special:\ :km:xs:xt:\ :co#80:it#8:li#24:sg#2:ug#2:\ :al=\EL:cd=\EJ:ce=\EK:cl=30\Ej:cm=\EY%+ %+ :dc=\EQ:\ :dl=\EM:ei=:ho=\EH:ic=\EP:im=:le=^H:nd=\EC:pc=\200:\ :se=\ER@:sf=\Eq:so=\ERD:sr=\Ep:ta=^I:ue=\ER@:up=\EA:\ :us=\ERH: # teleray 16 - map the arrow keys for vi/rogue, shifted to up/down page, and # back/forth words. Put the function keys (f1-f10) where they can be # found, and turn off the other magic keys along the top row, except # for line/local. Do the magic appropriate to make the page shifts work. # Also toggle ^S/^Q for those of us who use Emacs. t16|teleray 16:\ :am:da:db:mi:xs:xt:\ :co#80:li#24:\ :al=\E[L:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:\ :cm=%i\E[%d;%df:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:im=\E[4h:k1=^Z1:k2=^Z2:k3=^Z3:\ :k4=^Z4:k5=^Z5:k6=^Z6:k7=^Z7:k8=^Z8:k9=^Z9:k;=^Z0:\ :le=^H:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:sr=\E[T:ta=^I:\ :te=\E[V\E[24;1f\E[?38h:ti=\E[U\E[?38l:ue=\E[m:\ :up=\E[A:us=\E[4m: #### Texas Instruments (ti) # # The Silent 700 was so called because it was built around a quiet thermal # printer. It was portable, equipped with an acoustic coupler, and pretty # neat for its day. ti700|ti733|ti735|ti745|ti800|ti silent 700/733/735/745 or omni 800:\ :hc:os:\ :co#80:\ :bl=^G:cr=\r:do=^J:le=^H:sf=^J: ti924|Texas Instruments 924 VDT 8859/1 7 bit CTRL:\ :am:xo:\ :co#80:it#8:li#24:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:\ :cm=%i\E[%d;%dH:cr=^M:cs=%i\E[%d;%dr:ct=\E[3g:\ :dl=\E[M:do=\E[B:ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[16~:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kD=\E[P:kI=\E[@:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\E[?25h:vi=\E[?25l:vs=\E[?31h: ti924-8|Texas Instruments 924 VDT 8859/1 8 bit CTRL:\ :am:xo:\ :co#80:it#8:li#24:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:\ :cm=%i\E[%d;%dH:cr=^M:cs=%i\E[%d;%dr:ct=\E[3g:\ :dl=\E[M:do=\E[B:ho=\E[H:k1=P\217>:k2=Q\217>:\ :k3=R\217>:k4=S\217>:k5=~\23316>:k6=~\23317>:\ :k7=~\23318>:k8=~\23319>:k9=~\23320>:kD=P\233>:\ :kI=@\233>:kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:\ :ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:\ :vi=\E[?25l:vs=\E[?31h: ti924w|Texas Instruments 924 VDT 7 bit - 132 column mode:\ :co#132:tc=ti924: ti924-8w|Texas Instruments 924 VDT 8 bit - 132 column mode:\ :co#132:tc=ti924-8: ti931|Texas Instruments 931 VDT:\ :am:xo:\ :co#80:li#24:\ :al=\EN:bl=^G:cd=\EJ:ce=\EI:cl=\EL:cm=\EY%+ %+ :\ :cr=^M:dc=\EQ:dl=\EO:do=\EB:ei=:ho=\EH:ic=\ER\EP\EM:\ :im=:is=\EGB\E(@B@@\E):k1=\Ei1:k2=\Ei2:k3=\Ei3:\ :k4=\Ei4:k5=\Ei5:k6=\Ei6:k7=\Ei7:k8=\Ei8:k9=\Ei9:\ :kA=\EN:kD=\EQ:kI=\EP:kL=\EO:kd=\EB:kl=\ED:kr=\EC:\ :ku=\EA:le=\ED:mb=\E4P:me=\E4@:mk=\E4H:mr=\E4B:\ :nd=\EC:se=\E4@:sf=\Ea:so=\E4A:sr=\Eb:ue=\E4@:up=\EA:\ :us=\E4D:ve=\E4@: ti926|Texas Instruments 926 VDT 8859/1 7 bit CTRL:\ :cs@:sf=\E[1S:sr=\E[1T:tc=ti924: # (ti926-8: I corrected this from the broken SCO entry -- esr) ti926-8|Texas Instruments 926 VDT 8859/1 8 bit CTRL:\ :cs@:sf=\2331S:sr=\2331T:tc=ti924-8: ti_ansi|basic entry for ti928:\ :am:eo:ut:xn:xo:\ :Co#8:co#80:it#8:li#25:pa#64:\ :@7=\E[F:Sb=\E[4%dm:Sf=\E[3%dm:al=\E[L:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[@:im=:k0=\E[V:k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:\ :k5=\E[Q:k6=\E[R:k7=\E[S:k8=\E[T:k9=\E[U:kN=\E[G:\ :kP=\E[I:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:nd=\E[C:\ :op=\E[37;40m:se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # # 928 VDT 7 bit control mode # ti928|Texas Instruments 928 VDT 8859/1 7 bit CTRL:\ :%9=\E[35~:@7=\E_1\E\\:@8=\E[8~:F1=\E[29~:F2=\E[31~:\ :F3=\E[32~:F5=\E[34~:k1=\E[17~:k2=\E[18~:k3=\E[19~:\ :k4=\E[20~:k5=\E[21~:k6=\E[23~:k7=\E[24~:k8=\E[25~:\ :k9=\E[26~:k;=\E[28~:kD=\E[P:kI=\E[@:kN=\E[S:kP=\E[T:tc=ti_ansi: # # 928 VDT 8 bit control mode # ti928-8|Texas Instruments 928 VDT 8859/1 8 bit CTRL:\ :%9=\23335~:@7=\2371\234:@8=\2338~:F1=\23329~:\ :F2=\23331~:F3=\23332~:F5=\23334~:k1=\23317~:\ :k2=\23318~:k3=\23319~:k4=\23320~:k5=\23321~:\ :k6=\23323~:k7=\23324~:k8=\23325~:k9=\23326~:\ :k;=\23328~:kD=\233P:kI=\233@:kN=\233S:kP=\233T:\ :kh=\233H:tc=ti_ansi: #### Zentec (zen) # # (zen30: removed obsolete ":ma=^L ^R^L^K^P:" -- esr) zen30|z30|zentec 30:\ :am:mi:ul:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:le=^H:\ :nd=^L:se=\EG0:sf=^J:so=\EG6:up=^K: # (zen50: this had extension capabilities # :BS=^U:CL=^V:CR=^B: # UK/DK/RK/LK/HM were someone's aliases for ku/kd/kl/kr/kh, # which were also in the original entry -- esr) # (zen50: removed obsolete ":ma=^Hh^Ll^Jj^Kk:" -- esr) zen50|z50|zentec zephyr:\ :am:\ :co#80:li#24:sg#1:\ :al=\EE:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :dc=\EW:\ :dl=\ER:ei=:ic=\EQ:im=:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:\ :le=^H:se=\EGO:so=\EG4:up=^K: ######## OBSOLETE UNIX CONSOLES # #### Masscomp consoles # # Masscomp has gone out of business. Their product line was purchased by # comany in Georgia (US) called "XS International", parts and service may # still be available through them. # # (masscomp: ":MT:" changed to ":km:"; -- esr) masscomp|masscomp workstation console:\ :km:mi:\ :co#80:it#8:li#24:\ :al=\E[L:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:im=\E[4h:\ :is=\EGc\EGb\EGw:kb=^H:kd=\EOB:kl=\EOD:kr=\EOC:\ :ku=\EOA:le=^H:nd=\E[C:se=\E[m:so=\E[7m:ta=^I:\ :ue=\EGau:up=\E[A:us=\EGu: masscomp1|masscomp large screen version 1:\ :co#104:li#36:tc=masscomp: masscomp2|masscomp large screen version 2:\ :co#64:li#21:tc=masscomp: #### DEC consoles # # The MicroVax console. Tim Theisen writes: # The digital uVax II's had a graphic display called a qdss. It was # supposed to be a high performance graphic accelerator, but it was # late to market and barely appeared before faster dumb frame buffers # appeared. I have only used this display while running X11. However, # during bootup, it was in text mode, and probably had a terminal emulator # within it. And that is what your termcap entry is for. In graphics # mode the screen size is 1024x864 pixels. qdss|qdcons|qdss glass tty:\ :am:\ :co#128:li#57:\ :cl=1\032:cm=\E=%.%.:do=^J:le=^H:nd=^L:up=^K: ######## OTHER OBSOLETE TYPES # # These terminals are *long* dead -- these entries are retained for # historical interest only. #### Obsolete non-ANSI software emulations # # CTRM terminal emulator # 1. underlining is not allowed with colors: first, is is simulated by # black on white, second, it disables background color manipulations. # 2. BLINKING, REVERSE and BOLD are allowed with colors, # so we have to save their status in the static registers A, B and H # respectively, to be able to restore them when color changes # (because any color change turns off ALL attributes) # 3. and sequences alternate modes, # rather then simply entering them. Thus we have to check the # static register B and H to determine the status, before sending the # escape sequence. # 4. now must set the status of all 3 register (A,B,H) to zero # and then reset colors # 5. implementation of the protect mode would badly penalize the performance. # we would have to use \E&bn sequence to turn off colors (as well as all # other attributes), and keep the status of protect mode in yet another # static variable. If someone really needs this mode, they would have to # create another terminfo entry. # 6. original color-pair is white on black. # store the information about colors into static registers # 7. set foreground color. it performs the following steps. # 1) turn off all attributes # 2) turn on the background and video attributes that have been turned # on before (this information is stored in static registers X,Y,Z,A,B,H,D). # 3) turn on foreground attributes # 4) store information about foreground into U,V,W static registers # 8. turn on background: similar to turn on foreground above # (untranslatable capabilities removed to fit entry within 1023 bytes) ctrm|C terminal emulator:\ :am:ut:xo:\ :Co#8:NC#2:Nl#0:co#80:lh#0:li#24:lm#0:lw#0:pa#63:\ :pb#19200:vt#6:\ :al=\EL:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:ch=\E&a%dC:\ :cl=\EH\EJ:cm=\E&a%r%dc%dY:cr=^M:ct=\E3:cv=\E&a%dY:\ :dc=\EP:dl=\EM:do=^J:ei=\ER:im=\EQ:ip=:is=\E&jA\r:\ :k1=\Ep\r:k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:\ :k6=\Eu\r:k7=\Ev\r:k8=\Ew\r:kb=^H:kd=\Ew\r:ke=\E&jA:\ :kh=\Ep\r:kl=\Eu\r:kr=\Ev\r:ks=\E&jB:ku=\Et\r:le=^H:\ :mb=\E&dA%{1}%PA:md=%?%gH%{0}%=%t\E&dH%{1}%PH%;:\ :me=\E&d@%{0}%PA%{0}%PB%{0}%PH:\ :mr=%?%gB%{0}%=%t\E&dB%{1}%PB%;:nd=\EC:\ :op=\E&bn\E&bB\E&bG\E&bR\n%{0}%PX%{0}%PY%{0}%PZ\n%{1}%PW%{1}%PV%{1}%PU:\ :sf=^J:so=\E&dD:st=\E1:ta=\011:up=\EA:us=\E&dD: # gs6300 - can't use blue foreground, it clashes with underline; # it's simulated with cyan gs6300|emots|AT&T PC6300 with EMOTS terminal emulator:\ :am:ms:ut:xo:\ :Co#8:co#80:it#8:li#24:pa#63:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:LF=\E|:RI=\E[%dC:Sb=\E[?;%dm:\ :..Sf=\E[?%?%p1%{0}%=%t0\n%e%p1%{1}%=%t2\n%e%p1%{1}%-%d%;m:\ :UP=\E[%dA:\ :ac=\\\054\\\054..--++``aaffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=^J:ei=:ho=\E[H:ic=\E[@:im=:is=\E[m:k1=\E[0s:\ :k2=\E[24s:k3=\E[1s:k4=\E[23s:k5=\E[2s:k6=\E[22s:\ :k7=\E[3s:k8=\E[21s:kB=^R^I:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m\E[10m:mr=\E[7m:nd=\E[C:op=\E[?;m:pf=\E[4i:\ :po=\E[5i:r1=\Ec:sf=^J:so=\E[1m:sr=\E[L:ta=^I:\ :up=\E[A:us=\E[4m: # From: 29 Oct 85 05:40:18 GMT # MS-Kermit with Heath-19 emulation mode enabled # (h19k: changed ":pt@:" to ":it@" h19k|h19kermit|heathkit emulation provided by Kermit (no auto margin):\ :am@:da:db:xt:\ :it@:\ :ta@:tc=h19-u: # Apple Macintosh with Versaterm, a terminal emulator formerly # distributed by Peripherals Computers & Supplies, Inc # 2232 Perkiomen Ave., Mt. Penn, PA 19606, (215) 779-0522 # The number no longer reaches them and they are no longer listed. versaterm|versaterm vt100 emulator for the macintosh:\ :am:xn:\ :co#80:it#8:li#24:\ :al=9\E[1L:bl=^G:cd=50\E[J:ce=3\E[K:cl=50\E[;H\E[2J:\ :cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=7\E[1P:\ :dl=9\E[1M:do=^J:ei=:ho=\E[H:ic=7\E[1@:im=:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\EOB:ke=\E>\E[?1l:kl=\EOD:kr=\EOC:\ :ks=\E=\E[?1h:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:r1=\E>:rc=\E8:\ :rf=/usr/lib/tabset/vt100:sc=\E7:se=2\E[m:so=2\E[7m:\ :sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:us=2\E[4m: # vs100 emulator using tsim # From: # (vs100t: had Al/Dl in front of obvious AL/DL capabilities -- esr) vs100t|tsim|vs100-tsim|tsim vs100 emulator:\ :am:\ :co#80:it#8:li#24:\ :AL=\E+%+ :DL=\E-%+ :al=\EI:cd=\EQ:ce=\EL:cl=\EE:\ :cm=\EM%+ %+ :cs=\ES%+ %+ :dc=\Ed:dl=\ED:do=^J:ei=:\ :ho=\EH:i1=\ER:ic=\Ei:im=:le=^H:nd=\En:se=\Er:so=\Eh:\ :ta=^I:ue=\Ev:up=^K:us=\Eu: # From: Rick Thomas # (xtalk: I added / based on the init string. # I also removed #1, I don't believe it on a PC display -- esr) xtalk|IBM PC with xtalk communication program (versions up to 3.4):\ :am:mi:ms:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:\ :K5=\EOn:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:dl=\E[M:\ :do=^J:eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:\ :k9=\EOw:k;=\EOx:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:se=\E[m :sf=^J:\ :so=\E[7m :sr=\EM:st=\EH:ta=^I:up=\E[A: # The official PC terminal emulator program of the AT&T Product Centers. # Note - insert mode commented out - doesn't seem to work on AT&T PC. simterm|attpc running simterm:\ :am:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\E=%+ %+ :\ :cr=^M:dc=\ER:dl=\EM:do=\EB:ho=\EH:im=\EQ:le=^H:\ :nd=\EC:sf=^J:so=\E&dB:te=\EVE:ti=\EVS:up=\EA: #### Daisy wheel printers # # This section collects Diablo, DTC, Xerox, Qume, and other daisy # wheel terminals. These are now largely obsolete. # diablo1620|diablo1720|diablo450|ipsi|diablo 1620:\ :hc:os:\ :co#132:it#8:\ :ch=\E\011%i%.:ct=\E2:do=^J:hd=\ED:hu=\EU:\ :if=/usr/share/tabset/xerox1720:kb=^H:le=^H:st=\E1:\ :ta=^I:up=\E^J: diablo1620-m8|diablo1640-m8|diablo 1620 w/8 column left margin:\ :co#124:\ :is=\r \E9:tc=diablo1620: diablo1640|diablo1730|diablo1740|diablo630|x1700|diablo|xerox|diablo 1640:\ :bl=^G:if=/usr/share/tabset/xerox1730:se=\E&:so=\EW:\ :ue=\ER:us=\EE:tc=diablo1620: diablo1640-lm|diablo-lm|xerox-lm|diablo 1640 with indented left margin:\ :co#124:\ :if=/usr/share/tabset/xerox1730-lm:se=\E&:so=\EW:\ :ue=\ER:us=\EE:tc=diablo1620: diablo1740-lm|630-lm|1730-lm|x1700-lm|diablo 1740 printer:\ :tc=diablo1640-lm: # DTC 382 with VDU. Has no so we fake it with . Standout # =^P\s\002^PF works but won't go away without dynamite =^P\s\200. # The terminal has tabs, but I'm getting tired of fighting the braindamage. # If no tab is set or the terminal's in a bad mood, it glitches the screen # around all of memory. Note that return puts a blank ("a return character") # in the space the cursor was at, so we use ^P return (and thus ^P newline for # newline). Note also that if you turn off :pt: and let Unix expand tabs, # curses won't work (some old BSD versions) because it doesn't clear this bit, # and cursor addressing sends a tab for row/column 9. What a losing terminal! # I have been unable to get tabs set in all 96 lines - it always leaves at # least one line with no tabs in it, and once you tab through that line, # it completely weirds out. dtc382|DTC 382:\ :am:da:db:xs:\ :co#80:li#24:lm#96:\ :al=^P^Z:bl=^G:cd=\020\025\020\023\020\023:ce=^P^U:\ :cl=\020\035:cm=\020\021%r%.%.:cr=^P^M:dc=^X:dl=^P^S:\ :ei=^Pi:ho=^P^R:im=^PI:le=^H:nd=^PR:pc=\177:sf=^J:\ :te=\020\035:ue=^P \200:up=^P^L:us=^P ^P:ve=^Pb:\ :vs=^PB: dtc300s|DTC 300s:\ :hc:os:\ :co#132:\ :bl=^G:cr=^M:ct=\E3:do=^J:ff=^L:hd=\Eh:hu=\EH:kb=^H:\ :le=^H:sf=^J:st=\E1:ta=^I:up=^Z: gsi|mystery gsi terminal:\ :hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:hd=\Eh:hu=\EH:le=^H:sf=^J:ta=^I:\ :up=^Z: aj830|aj832|aj|anderson jacobson:\ :hc:os:\ :bl=^G:cr=^M:do=^J:hd=\E9:hu=\E8:le=^H:sf=^J:up=\E7: # From: Chris Torek Thu, 7 Nov 85 18:21:58 EST aj510|Anderson-Jacobson model 510:\ :am:mi:\ :co#80:li#24:\ :al=2*\E&I:cd=\E'P:ce=\E'L:cl=^L:cm=\E#%+ %+ :\ :dc=.1*\E'D:dl=2*\E&D:ei=\E'J:ic=:im=\E'I:ip=.1*:\ :kd=\EZ:kl=\EW:kr=\EX:ku=\EY:le=^H:nd=\EX:pc=\177:\ :se=\E"I:so=\E"I:te=\E"N:ti=\E"N:ue=\E"U:up=\EY:\ :us=\E"U: # From: Thu Aug 20 09:09:18 1981 # This is incomplete, but it's a start. nec5520|nec|spinwriter|nec 5520:\ :hc:os:\ :co#132:it#8:\ :bl=^G:cr=^M:ct=\E3:do=^J:ff=^L:hd=\E]s\n\E]W:\ :hu=\E]s\E9\E]W:kb=^H:le=^H:sf=^J:st=\E1:ta=^I:\ :up=\E9: qume5|qume|Qume Sprint 5:\ :hc:os:\ :co#80:it#8:\ :bl=^G:cr=^M:ct=\E3:do=^J:ff=^L:hd=\Eh:hu=\EH:kb=^H:\ :le=^H:sf=^J:st=\E1:ta=^I:up=^Z: # I suspect the xerox 1720 is the same as the diablo 1620. xerox1720|x1720|x1750|xerox 1720:\ :hc:os:\ :co#132:it#8:\ :bl=^G:cr=^M:ct=\E2:do=^J:ff=^L:le=^H:sf=^J:st=\E1:\ :ta=^I: #### Miscellaneous obsolete terminals, manufacturers unknown # # If you have any information about these (like, a manufacturer's name, # and a date on the serial-number plate) please send it! cad68-3|cgc3|cad68 basic monitor transparent mode size 3 chars:\ :am:\ :co#73:li#36:\ :cl=^Z:ho=^^:le=^H:nd=^L:up=^K: cad68-2|cgc2|cad68 basic monitor transparent mode size 2 chars:\ :am:\ :co#85:li#39:\ :cl=^Z:ho=^^:k1=\E5:k2=\E6:k3=\E7:k4=\E8:kd=\E2:\ :kl=\E3:kr=\E4:ku=\E1:le=^H:nd=^L:se=\Em^C:so=\Em^L:\ :up=^K: cops10|cops|cops-10|cops 10:\ :am:bw:\ :co#80:li#24:\ :bl=^G:cd=^W:ce=^V:cl=30\030:cm=\020%+ %+ :cr=^M:\ :do=^J:kb=^H:kd=^J:kh=^Y:kl=^H:kr=^L:ku=^K:le=^H:\ :nd=^L:sf=^J:up=^K: # (d132: removed duplicate ":ic=\E5:" -- esr) d132|datagraphix|datagraphix 132a:\ :da:db:in:\ :co#80:li#30:\ :al=\E3:bl=^G:cl=^L:cr=^M:dc=\E6:do=^J:ei=:ho=\Et:\ :ic=\E5:im=:nd=\El:sf=\Ev:sr=\Ew:up=\Ek:ve=\Em\En:\ :vs=\Ex: # The d800 was an early portable terminal from c.1984-85 that looked a lot # like the original Compaq `lunchbox' portable (but no handle). It had a vt220 # mode (which is what this entry looks like) and several other lesser-known # emulations. d800|Direct 800/A:\ :am:da:db:ms:xs:\ :co#80:it#8:li#24:\ :ae=\E[m:as=\E[1m:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[1;1H\E[2J:cm=\E[%i%d;%dH:cr=^M:do=^J:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOT:k6=\EOU:k7=\EOV:\ :k8=\EOW:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :nd=\E[C:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m:ve=\E[>12h:vs=\E[>12l: digilog|digilog 333:\ :co#80:li#16:\ :bl=^G:ce=^X:cr=^M:do=^J:ho=^N:le=^H:nd=^I:sf=^J:\ :up=^O: env230|envision230|envision 230 graphics terminal:\ :xn@:\ :pf=\E[4i:po=\E[5i:ps=\E[0i:\ :..sa=\E[%?%p1%t;1%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:tc=vt100: # These execuports were impact-printer ttys with a 30- or maybe 15-cps acoustic # coupler attached, the whole rig fitting in a suitcase and more or less # portable. Hot stuff for c.1977 :-) -- esr ep48|ep4080|execuport 4080:\ :am:os:\ :co#80:\ :bl=^G:cr=^M:do=^J:hd=^\:hu=^^:le=^H:sf=^J: ep40|ep4000|execuport 4000:\ :co#136:tc=ep4080: # Adam Thompson tells us: # Informer series - these are all portable units, resembling older # automatic bread-baking machines. The terminal looks like a `clamshell' # design, but isn't. The structure is similar to the Direct terminals, # but only half the width. The entire unit is only about 10" wide. # It features an 8" screen (6" or 7" if you have color!), and an 9"x6" # keyboard. All the keys are crammed together, much like some laptop # PCs today, but perhaps less well organized...all these units have a # bewildering array of plugs on the back, including a built-in modem. # The 305 was a color version of the 304; the 306 and 307 were mono and # color terminals built for IBM bisync protocols. # From: Paul Leondis ifmr|Informer D304:\ :am:\ :co#80:li#24:\ :cd=\E/:ce=\EQ:cl=\EZ:cm=\EY%r%+ %+ :dc=\E\\:do=^J:\ :ei=:ho=\EH:ic=\E[:im=:le=^H:nd=\EC:se=\EK:so=\EJ:\ :sr=\En:up=\EA: # Entry largely based on wy60 and has the features of wy60ak. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) opus3n1+|Esprit Opus3n1+ in wy60 mode with ANSI arrow keys:\ :am:bw:hs:km:mi:ms:ul:xo:\ :co#80:li#24:ws#80:\ :ae=\EH^C:al=\EE:as=\EH^B:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :cl=\E*:cm=\Ea%i%dR%dC:cr=^M:ct=\E0:dc=\EW:dl=\ER:\ :do=^J:ds=\Ez(\r:ei=\Er:fs=^M:ho=\036:\ :if=/usr/share/tabset/std:im=\Eq:ip=:\ :is=\E`\072\Ee(\EO\Ee6\Ec41\E~4\Ec21\Ed/\Ezz&\E[A\177\Ezz'\E[B\177\Ezz(\E[D\177\Ezz)\E[C\177\Ezz<\E[Q\177\Ezz`\E[F\177\EA1*\EZH12:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:\ :kN=\EK:kP=\EJ:kb=^H:kd=\E[B:kh=^^:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\EG2:me=\E(\EH\003\EG0\EcD:mh=\EGp:\ :mr=\EG4:nd=^L:nw=\r\n:se=\EG0:sf=^J:so=\EG4:sr=\Ej:\ :st=\E1:ta=\011:\ :ti=\Ezz&\E[A\177\Ezz'\E[B\177\Ezz(\E[D\177\Ezz)\E[C\177\Ezz<\E[Q\177:\ :ts=\Ez(:uc=\EG8%p1%c\EG0:ue=\EG0:up=^K:us=\EG8:\ :ve=\E`1:vi=\E`0: # (ps300: changed ":pt@:" to "it@" -- esr) ps300|Picture System 300:\ :xt:\ :it@:\ :se@:so@:ue@:us@:tc=vt100: teletec|Teletec Datascreen:\ :am:\ :co#80:li#24:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=^^:le=^H:nd=^_:sf=^J:\ :up=^K: # Terak made a PDP-11 based machine with a bitmapped display that ran UCSD # Pascal as the native OS. It was quite a nice box, and there were several # at UC Berkeley. terak|Terak emulating Datamedia 1520:\ :tc=dm1520: # From: Mark Dornfeld # This termcap is for the LANPAR Technologies VISION 3220 # terminal. The function key definitions k0-k5 represent the # edit keypad: FIND, INSERT HERE, REMOVE, SELECT, PREV SCREEN, # NEXT SCREEN. The key definitions k6-k9 represent the PF1 to # PF4 keys. # (v3220: removed obsolete ":kn#10:", # I added / based on the init string -- esr) v3220|LANPAR Vision II model 3220/3221/3222:\ :am:mi:xn:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=\E[4l:\ :im=\E[4h:is=\E>\E[?3l\E[?7h\E[?8h\E[p:k0=\E[1~:\ :k1=\E[2~:k2=\E[3~:k3=\E[4~:k4=\E[5~:k5=\E[6~:\ :k6=\E[OP:k7=\E[OQ:k8=\E[OR:k9=\E[OS:kd=\E[B:ke=\E>:\ :kh=\E[H:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:\ :nd=\E[C:se=\E[m:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: ######## ICH/ICH1 VERSUS RMIR/SMIR # # Some non-curses applications get confused if both ich/ich1 and rmir/smir # are present; the symptom is doubled characters in an update using insert. # These applications are technically correct; in both 4.3BSD termcap and # terminfo, you're not actually supposed to specify both ich/ich1 and rmir/smir # unless the terminal needs both. This requirement is now rare; most ich # sequences do not require previous smir, and most smir insert modes do not # require ich1 before each character. # # For ncurses-based applications this is not a problem, as ncurses uses # one or the other as appropriate but never mixes the two. Therefore we # have not corrected entries like `linux' and `xterm' that specify both. # If you see doubled characters from these, use the linux-nic and xterm-nic # entries that suppress ich/ich1. And upgrade to ncurses! # ######## VT100/ANSI/ISO 6429/ECMA-48/PC-TERM TERMINAL STANDARDS # # ANSI X3.64 has been withdrawn and replaced by ECMA-48. The ISO 6429 and # ECMA-48 standards are said to be almost identical, but are not the same # as X3.64 (though for practical purposes they are close supersets of it). # # You can obtain ECMA-48 for free by sending email to helpdesk@ecma.ch # requesting the standard(s) you want (i.e. ECMA-48, "Control Functions for # Coded Character Sets"), include your snail-mail address, and you should # receive the document in due course. Don't expect an email acknowledgement. # # Related standards include "X3.4-1977: American National Standard Code for # Information Interchange" (the ASCII standard) and "X3.41.1974: # Code-Extension Techniques for Use with the 7-Bit Coded Character Set of # American National Standard for Information Interchange." I believe (but # am not certain) that these are effectively identical to ECMA-6 and ECMA-35 # respectively. # #### VT100/ANSI/ECMA-48 # # ANSI Standard (X3.64) Control Sequences for Video Terminals and Peripherals # and ECMA-48 Control Functions for Coded Character Sets. # # Most of the content of this comment is adapted from a table prepared by # Richard Shuford, based on a 1984 Byte article. Terminfo correspondences, # discussion of some terminfo-related issues, and updates to capture ECMA-48 # have been added. Control functions described in ECMA-48 only are tagged # with * after their names. # # The table is a complete list of the defined ANSI X3.64/ECMA-48 control # sequences. In the main table, \E stands for an escape (\033) character, # SPC for space. Pn stands for a single numeric parameter to be inserted # in decimal ASCII. Ps stands for a list of such parameters separated by # semicolons. Parameter meanings for most parametrized sequences are # decribed in the notes. # # (NOTE: THE ECMA-48 COVERAGE IN THE TABLE IS NOT YET ACTUALLY COMPLETE, # IT IS ONLY COMPLETE UP TO THE BROKEN LINE OF DASHES. Have patience, # reading the legalese and adding entries is a long-drawn-out and tedious # process...) # Default Type # Sequence Sequence Parameter or # Mnemonic Name Sequence Value Mode terminfo # ----------------------------------------------------------------------------- # APC Applicatn Program Command \E _ - Delim - # BEL Bell * ^G - - bel # BPH Break Permitted Here * \E B - * - # BS Backpace * ^H - EF - # CAN Cancel * ^X - - - (A) # CBT Cursor Backward Tab \E [ Pn Z 1 eF cbt # CCH Cancel Previous Character \E T - - - # CHA Cursor Horizntal Absolute \E [ Pn G 1 eF hpa (B) # CHT Cursor Horizontal Tab \E [ Pn I 1 eF tab (C) # CMD Coding Method Delimiter * \E # CNL Cursor Next Line \E [ Pn E 1 eF nel (D) # CPL Cursor Preceding Line \E [ Pn F 1 eF - # CPR Cursor Position Report \E [ Pn ; Pn R 1, 1 - - (E) # CSI Control Sequence Intro \E [ - Intro - # CTC Cursor Tabulation Control \E [ Ps W 0 eF - (F) # CUB Cursor Backward \E [ Pn D 1 eF cub # CUD Cursor Down \E [ Pn B 1 eF cud # CUF Cursor Forward \E [ Pn C 1 eF cuf # CUP Cursor Position \E [ Pn ; Pn H 1, 1 eF cup (G) # CUU Cursor Up \E [ Pn A 1 eF cuu # CVT Cursor Vertical Tab \E [ Pn Y - eF - (H) # DA Device Attributes \E [ Pn c 0 - - # DAQ Define Area Qualification \E [ Ps o 0 - - # DCH Delete Character \E [ Pn P 1 eF dch # DCS Device Control String \E P - Delim - # DL Delete Line \E [ Pn M 1 eF dl # DLE Data Link Escape * ^P - - - # DMI Disable Manual Input \E \ - Fs - # DSR Device Status Report \E [ Ps n 0 - - (I) # DTA Dimension Text Area * \E [ Pn ; Pn SPC T - PC - # EA Erase in Area \E [ Ps O 0 eF - (J) # ECH Erase Character \E [ Pn X 1 eF ech # ED Erase in Display \E [ Ps J 0 eF ed (J) # EF Erase in Field \E [ Ps N 0 eF - # EL Erase in Line \E [ Ps K 0 eF el (J) # EM Eend of Medium * ^Y - - - # EMI Enable Manual Input \E b Fs - # ENQ Enquire ^E - - - # EOT End Of Transmission ^D - - - # EPA End of Protected Area \E W - - - (K) # ESA End of Selected Area \E G - - - # ESC Escape ^[ - - - # ETB End Transmission Block ^W - - - # ETX End of Text ^C - - - # FF Form Feed ^L - - - # FNK Function Key * \E [ Pn SPC W - - - # GCC Graphic Char Combination* \E [ Pn ; Pn SPC B - - - # FNT Font Selection \E [ Pn ; Pn SPC D 0, 0 FE - # GSM Graphic Size Modify \E [ Pn ; Pn SPC B 100, 100 FE - (L) # GSS Graphic Size Selection \E [ Pn SPC C none FE - # HPA Horz Position Absolute \E [ Pn ` 1 FE - (B) # HPB Char Position Backward \E [ j 1 FE - # HPR Horz Position Relative \E [ Pn a 1 FE - (M) # HT Horizontal Tab * ^I - FE - (N) # HTJ Horz Tab w/Justification \E I - FE - # HTS Horizontal Tab Set \E H - FE hts # HVP Horz & Vertical Position \E [ Pn ; Pn f 1, 1 FE - (G) # ICH Insert Character \E [ Pn @ 1 eF ich # IDCS ID Device Control String \E [ SPC O - * - # IGS ID Graphic Subrepertoire \E [ SPC M - * - # IL Insert Line \E [ Pn L 1 eF il # IND Index \E D - FE - # INT Interrupt \E a - Fs - # JFY Justify \E [ Ps SPC F 0 FE - # IS1 Info Separator #1 * ^_ - * - # IS2 Info Separator #1 * ^^ - * - # IS3 Info Separator #1 * ^] - * - # IS4 Info Separator #1 * ^\ - * - # LF Line Feed ^J - - - # LS1R Locking Shift Right 1 * \E ~ - - - # LS2 Locking Shift 2 * \E n - - - # LS2R Locking Shift Right 2 * \E } - - - # LS3 Locking Shift 3 * \E o - - - # LS3R Locking Shift Right 3 * \E | - - - # MC Media Copy \E [ Ps i 0 - - (S) # MW Message Waiting \E U - - - # NAK Negative Acknowledge * ^U - - - # NBH No Break Here * \E C - - - # NEL Next Line \E E - FE nel (D) # NP Next Page \E [ Pn U 1 eF - # NUL Null * ^@ - - - # OSC Operating System Command \E ] - Delim - # PEC Pres. Expand/Contract * \E Pn SPC Z - - - # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # PLD Partial Line Down \E K - FE - # PLU Partial Line Up \E L - FE - # PM Privacy Message \E ^ - Delim - # PP Preceding Page \E [ Pn V 1 eF - # PU1 Private Use 1 \E Q - - - # PU2 Private Use 2 \E R - - - # QUAD Typographic Quadding \E [ Ps SPC H 0 FE - # REP Repeat Char or Control \E [ Pn b 1 - rep # RI Reverse Index \E M - FE - # RIS Reset to Initial State \E c - Fs - # RM Reset Mode \E [ Ps l none - - # SD Scroll Down \E [ Pn T 1 eF rin # SEM Select Edit Extent Mode \E [ Ps Q 0 - - # SGR Select Graphic Rendition \E [ Ps m 0 FE sgr (O) # SI Shift In ^O - - - (P) # SL Scroll Left \E [ Pn SPC @ 1 eF - # SM Select Mode \E [ Ps h none - - # SO Shift Out ^N - - - (Q) # SPA Start of Protected Area \E V - - - # SPI Spacing Increment \E [ Pn ; Pn SPC G none FE - # SR Scroll Right \E [ Pn SPC A 1 eF - # SS2 Single Shift 2 (G2 set) \E N - Intro - # SS3 Single Shift 3 (G3 set) \E O - Intro - # SSA Start of Selected Area \E F - - - # ST String Terminator \E \ - Delim - # STS Set Transmit State \E S - - - # SU Scroll Up \E [ Pn S 1 eF indn # TBC Tab Clear \E [ Ps g 0 FE tbc # TSS Thin Space Specification \E [ Pn SC E none FE - # VPA Vert Position Absolute \E [ Pn d 1 FE vpa # VPR Vert Position Relative \E [ Pn e 1 FE - (R) # VTS Vertical Tabulation Set \E J - FE - # # --------------------------------------------------------------------------- # # Notes: # # Some control characters are listed in the ECMA-48 standard without # being assigned functions relevant to terminal control there (they # referred to other standards such as ISO 1745 or ECMA-35). They are listed # here anyway for completeness. # # (A) ECMA-48 calls this "CancelCharacter" but retains the CCH acronyms. # # (B) There seems to be some confusion abroad between CHA and HPA. Most # `ANSI' terminals accept the CHA sequence, not the HPA. but terminfo calls # the capability (hpa). ECMA-48 calls this "Cursor Character Absolute" but # preserved the CHA acronym. # # (C) CHT corresponds to terminfo (tab). Usually it has the value ^I. # Occasionally (as on, for example, certain HP terminals) this has the HTJ # value. ECMA-48 calls this "Cursor Forward Tabulation" but preserved the # CHT acronym. # # (D) terminfo (nel) is usually \r\n rather than ANSI \EE. # # (E) ECNA-48 calls this "Active Position Report" but preserves the CPR # acronym. # # (F) CTC parameter values: 0 = set char tab, 1 = set line tab, 2 = clear # char tab, 3 = clear line tab, 4 = clear all char tabs on current line, # 5 = clear all char tabs, 6 = clear all line tabs. # # (G) CUP and HVP are identical in effect. Some ANSI.SYS versions accept # HVP, but always allow CUP as an alternate. ECMA-48 calls HVP "Character # Position Absolute" but retains the HVP acronym. # # (H) ECMA calls this "Cursor Line Tabulation" but preserves the CVT acronym. # # (I) DSR parameter values: 0 = ready, 1 = busy, 2 = busy, will send DSR # later, 3 = malfunction, 4 = malfunction, will send DSR later, 5 = request # DSR, 6 = request CPR response. # # (J) ECMA calls ED "Erase In Page". EA/ED/EL parameters: 0 = clear to end, # 1 = clear from beginning, 2 = clear. # # (K) ECMA calls this "End of Guarded Area" but preserves the EPA acronym. # # (L) The GSM parameters are vertical and horizontal parameters to scale by. # # (M) Some ANSI.SYS versions accept HPR, but more commonly `ANSI' terminals # use CUF for this function and ignore HPR. ECMA-48 calls this "Character # Position Relative" but retains the HPR acronym. # # (N) ECMA-48 calls this "Character Tabulation" but retains the HT acronym. # # (O) SGR parameter values: 0 = default mode (attributes off), 1 = bold, # 2 = dim, 3 = italicized, 4 = underlined, 5 = slow blink, 6 = fast blink, # 7 = reverse video, 8 = invisible, 9 = crossed-out (marked for deletion), # 10 = primary font, 10 + n (n in 1..9) = nth alternative font, 20 = Fraktur, # 21 = double underline, 22 = turn off 2, 23 = turn off 3, 24 = turn off 4, # 25 = turn off 5, 26 = proportional spacing, 27 = turn off 7, 28 = turn off # 8, 29 = turn off 9, 30 = black fg, 31 = red fg, 32 = green fg, 33 = yellow # fg, 34 = blue fg, 35 = magenta fg, 36 = cyan fg, 37 = white fg, 38 = set # fg color as in CCIT T.416, 39 = set default fg color, 40 = black bg # 41 = red bg, 42 = green bg, 43 = yellow bg, 44 = blue bg, 45 = magenta bg, # 46 = cyan bg, 47 = white bg, 48 = set bg color as in CCIT T.416, 39 = set # default bg color, 50 = turn off 26, 51 = framed, 52 = encircled, 53 = # overlined, 54 = turn off 51 & 52, 55 = not overlined, 56-59 = reserved, # 61-65 = variable highlights for ideograms. # # (P) SI is also called LSO, Locking Shift Zero. # # (Q) SI is also called LS1, Locking Shift One. # # (R) Some ANSI.SYS versions accept VPR, but more commonly `ANSI' terminals # use CUD for this function and ignore VPR. # # (S) MC parameters: 0 = start xfer to primary aux device, 1 = start xfer from # primary aux device, 2 = start xfer to secondary aux device, 3 = start xfer # from secondary aux device, 4 = stop relay to primary aux device, 5 = # start relay to primary aux device, 6 = stop relay to secondary aux device, # 7 = start relay to secondary aux device. # # --------------------------------------------------------------------------- # # Abbreviations: # # Intro an Introducer of some kind of defined sequence; the normal 7-bit # X3.64 Control Sequence Introducer is the two characters "Escape [" # # Delim a Delimiter # # x/y identifies a character by position in the ASCII table (column/row) # # eF editor function (see explanation) # # FE format effector (see explanation) # # F is a Final character in # an Escape sequence (F from 3/0 to 7/14 in the ASCII table) # a control sequence (F from 4/0 to 7/14) # # Gs is a graphic character appearing in strings (Gs ranges from # 2/0 to 7/14) in the ASCII table # # Ce is a control represented as a single bit combination in the C1 set # of controls in an 8-bit character set # # C0 the familiar set of 7-bit ASCII control characters # # C1 roughly, the set of control characters available only in 8-bit systems. # This is too complicated to explain fully here, so read Jim Fleming's # article in the February 1983 BYTE, especially pages 214 through 224. # # Fe is a Final character of a 2-character Escape sequence that has an # equivalent representation in an 8-bit environment as a Ce-type # (Fe ranges from 4/0 to 5/15) # # Fs is a Final character of a 2-character Escape sequence that is # standardized internationally with identical representation in 7-bit # and 8-bit environments and is independent of the currently # designated C0 and C1 control sets (Fs ranges from 6/0 to 7/14) # # I is an Intermediate character from 2/0 to 2/15 (inclusive) in the # ASCII table # # P is a parameter character from 3/0 to 3/15 (inclusive) in the ASCII # table # # Pn is a numeric parameter in a control sequence, a string of zero or # more characters ranging from 3/0 to 3/9 in the ASCII table # # Ps is a variable number of selective parameters in a control sequence # with each selective parameter separated from the other by the code # 3/11 (which usually represents a semicolon); Ps ranges from # 3/0 to 3/9 and includes 3/11 # # * Not relevant to terminal control, listed for completeness only. # # Format Effectors versus Editor Functions # # A format effector specifies how following output is to be displayed. # An editor function allows you to modify the display. Informally # format effectors may be destructive; format effectors should not be. # # For instance, a format effector that moves the "active position" (the # cursor or equivalent) one space to the left would be useful when you want to # create an overstrike, a compound character made of two standard characters # overlaid. Control-H, the Backspace character, is actually supposed to be a # format effector, so you can do this. But many systems use it in a # nonstandard fashion, as an editor function, deleting the character to the # left of the cursor and moving the cursor left. When Control-H is assumed to # be an editor function, you cannot predict whether its use will create an # overstrike unless you also know whether the output device is in an "insert # mode" or an "overwrite mode". When Control-H is used as a format effector, # its effect can always be predicted. The familiar characters carriage # return, linefeed, formfeed, etc., are defined as format effectors. # # NOTES ON THE DEC VT100 IMPLEMENTATION # # Control sequences implemented in the VT100 are as follows: # # CPR, CUB, CUD, CUF, CUP, CUU, DA, DSR, ED, EL, HTS, HVP, IND, # LNM, NEL, RI, RIS, RM, SGR, SM, TBC # # plus several private DEC commands. # # Erasing parts of the display (EL and ED) in the VT100 is performed thus: # # Erase from cursor to end of line Esc [ 0 K or Esc [ K # Erase from beginning of line to cursor Esc [ 1 K # Erase line containing cursor Esc [ 2 K # Erase from cursor to end of screen Esc [ 0 J or Esc [ J # Erase from beginning of screen to cursor Esc [ 1 J # Erase entire screen Esc [ 2 J # # Some brain-damaged terminal/emulators respond to Esc [ J as if it were # Esc [ 2 J, but this is wrong; the default is 0. # # The VT100 responds to receiving the DA (Device Attributes) control # # Esc [ c (or Esc [ 0 c) # # by transmitting the sequence # # Esc [ ? l ; Ps c # # where Ps is a character that describes installed options. # # The VT100's cursor location can be read with the DSR (Device Status # Report) control # # Esc [ 6 n # # The VT100 reports by transmitting the CPR sequence # # Esc [ Pl ; Pc R # # where Pl is the line number and Pc is the column number (in decimal). # # The specification for the DEC VT100 is document EK-VT100-UG-003. #### ANSI.SYS # # Here is a description of the color and attribute controls supported in the # the ANSI.SYS driver under MS-DOS. Most console drivers and ANSI # terminal emulators for Intel boxes obey these. # # 0 all attributes off # 1 foreground bright # 4 underscore on # 5 blink on/background bright (not reliable with brown) # 7 reverse-video # 8 set blank (non-display) # 10 set primary font # 11 set first alternate font (on PCs, display ROM characters 1-31) # 12 set second alternate font (on PCs, display IBM high-half chars) # # Color attribute sets # 3n set foreground color / 0=black, 1=red, 2=green, 3=brown, # 4n set background color \ 4=blue, 5=magenta, 6=cyan, 7=white # Bright black becomes gray. Bright brown becomes yellow, # These coincide with the prescriptions of the ISO 6429/ECMA-48 standard. # # * If the 5 attribute is on and you set a background color (40-47) it is # supposed to enable bright background. # # * Many VGA cards (such as the Paradise and compatibles) do the wrong thing # when you try to set a "bright brown" (yellow) background with attribute # 5 (you get a blinking yellow foreground instead). A few displays # (including the System V console) support an attribute 6 that undoes this # braindamage (this is required by iBCS2). # # * Some older versions of ANSI.SYS have a bug that causes thems to require # ESC [ Pn k as EL rather than the ANSI ESC [ Pn K. # # The entries following are not standalone. They are meant to be included # via use= in other entries. # #### Intel Binary Compatibility Standard # # For comparison, here are the capabilities implied by the Intel Binary # Compatibility Standard for UNIX systems (Intel order number 468366-001). # These recommendations are optional. IBCS2 allows the leading escape to # be either the 7-bit \E[ or 8-bit \0233 introducer, in accordance with # the ANSI X.364/ISO 6429/ECMA-48 standard. Here are the iBCS2 capabilities # (as described in figure 9-3 of the standard). Those expressed in the ibcs2 # terminfo entry are followed with the corresponding capability in parens: # # CSI k disable (n=0) or enable (n=1) keyclick # CSI 2h lock keyboard # CSI 2i send screen as input # CSI 2l unlock keyboard # CSI 6m enable background color intensity # CSI <0-2>c reserved # CSI <0-59>m select graphic rendition # CSI ;H (cup) cursor to line n and column m # CSI ;f cursor to line n and column m # CSI @ (ich) insert characters # CSI A (cuu) cursor up n lines # CSI B (cud) cursor down n lines # CSI C (cuu) cursor right n characters # CSI D (cud) cursor left n characters # CSI E cursor down n lines and in first column # CSI F cursor up n lines and in first column # CSI G (hpa) position cursor at column n-1 # CSI J (ed) erase in display # CSI K (el) erase in line # CSI L (il) insert line(s) # CSI P (dch) delete characters # CSI S (indn) scroll up n lines # CSI T (rin) scroll down n lines # CSI X (ech) erase characters # CSI Z (cbt) back up n tab stops # CSI ` cursor to column n on line # CSI a (cuu) cursor right n characters # CSI d (vpa) cursor to line n # CSI e cursor down n lines and in first column # CSI g (cbt) clear all tabs # CSI z make virtual terminal n active # CSI ?7h (smam) turn automargin on # CSI ?7l (rmam) turn automargin off # CSI s save cursor position # CSI u restore cursor position to saved value # CSI =A set overscan color # CSI =F set normal foreground color # CSI =G set normal background color # CSI =H set reverse foreground color # CSI =I set reverse foreground color # CSI =J set graphic foreground color # CSI =K set graphic foreground color # CSI =g (dispc) display n from alternate graphics character set # CSI =

;B set bell parameters # CSI =;C set cursor parameters # CSI =D enable/disable intensity of background color # CSI =E set/clear blink vs. bold background # CSI 7 (sc) (sc) save cursor position # CSI 8 (rc) (rc) restore cursor position to saved value # CSI H (hts) (hts) set tab stop # CSI Q define function key string # (string must begin and end with delimiter char) # CSI c (clear) clear screen # # The lack of any specification for attributes in SGR (among other things) # makes this a wretchedly weak standard. The table above is literally # everything iBSC2 has to say about terminal escape sequences; there is # no further discussion of their meaning or how to set the parameters # in these sequences at all. # ######## NONSTANDARD CAPABILITY TRANSLATIONS USED IN THIS FILE # # The historical termcap file entries were written primarily in 4.4BSD termcap. # The 4.4BSD termcap set was substantially larger than the original 4.1BSD set, # with the extension names chosen for compatibility with the termcap names # assigned in System V terminfo. There are some variant extension sets out # there. We try to describe them here. # # XENIX extensions: # # The XENIX extensions include a set of function-key capabilities as follows: # # code XENIX variable name terminfo name name clashes? # ---- ------------------- ------------- ----------------------- # CL key_char_left # CR key_char_right # CW key_change_window create_window # EN key_end kend # HM key_home khome # HP ?? # LD key_delete_line kdl1 # LF key_linefeed label_off # NU key_next_unlocked_cell # PD key_page_down knp # PL ?? # PN start_print mc5 # PR ?? # PS stop_print mc4 # PU key_page_up kpp pulse # RC key_recalc remove_clock # RF key_toggle_ref req_for_input # RT key_return kent # UP key_up_arrow kcuu1 parm_up_cursor # WL key_word_left # WR key_word_right # # The XENIX extensions also include the following character-set and highlight # capabilities: # # XENIX terminfo function # ----- -------- ------------------------------ # GS smacs start alternate character set # GE rmacs end alternate character set # GG :as:/:ae: glitch (analogous to :sg:/:ug:) # bo blink begin blink (not used in /etc/termcap) # be end blink (not used in /etc/termcap) # bb blink glitch (not used in /etc/termcap) # it dim begin dim (not used in /etc/termcap) # ie end dim (not used in /etc/termcap) # ig dim glitch (not used in /etc/termcap) # # Finally, XENIX also used the following forms-drawing capabilities: # # single double type ASCII approximation # ------ ------ ------------- ------------------- # GV Gv vertical line | # GH Gv horizontal line - _ # G1 G5 top right corner _ | # G2 G6 top left corner | # G3 G7 bottom left corner |_ # G4 G8 bottom right corner _| # GD Gd down-tick character T # GL Gl left-tick character -| # GR Gr right-tick character |- # GC Gc middle intersection -|- # GU Gu up-tick character _|_ # # These were invented to take advantage of the IBM PC ROM character set. One # can compose an acsc string from the single-width characters as follows # "j{G4}k{G1}l{G2}m{G3}q{GH}x{GV}t{GR}u{GL}v{GU}w{GD}n{GC}" # The double forms characters don't fit the SVr4 terminfo model. # # AT&T Extensions: # # The old AT&T 5410, 5420, 5425, pc6300plus, 610, and s4 entries used a set of # nonstandard capabilities. Its signature is the KM capability, used to name # some sort of keymap file. EE, BO, CI, CV, XS, DS, FL and FE are in this # set. Comments in the original, and a little cross-checking with other AT&T # documentation, seem to establish that BO=:mr: (start reverse video), DS=:mh: # (start dim), XS=:mk: (secure/invisible mode), EE=:me: (end highlights), # FL=:LO: (enable soft labels), FE=:LF: (disable soft labels), CI=:vi: (make # cursor invisible), and CV=:ve: (make cursor normal). # # HP Extensions # # The HP library (as of mid-1995, their term.h file version 70.1) appears to # have the System V capabilities up to SVr1 level. After that, it supports # two nonstandard caps meml and memu corresponding to the old termcap :ml:, # :mu: capabilities. After that, it supports caps plab_norm, label_on, # label_off, and key_f11..key_f63 capabilities like SVr4's. This makes the # HP binary format incompatible with SVr4's. # # IBM Extensions # # There is a set of nonstandard terminfos used by IBM's AIX operating system. # The AIX terminfo library diverged from SVr1 terminfo, and replaces all # capabilities following prtr_non with the following special capabilties: # box[12], batt[12], colb[0123456789], colf[0123456789], f[01234567], kbtab, # kdo, kcmd, kcpn, kend, khlp, knl, knpn, kppn, kppn, kquit, ksel, kscl, kscr, # ktab, kmpf[123456789], apstr, ksf1..ksf10, kf11...kf63, kact, topl, btml, # rvert, lvert. Some of these are identical to XPG4/SVr4 equivalents: # kcmd, kend, khlp, and kf11...kf63. Two others (kbtab and ksel) can be # renamed (to kcbt and kslt). The places in the box[12] capabilities # correspond to acsc chars, here is the mapping: # # box1[0] = ACS_ULCORNER # box1[1] = ACS_HLINE # box1[2] = ACS_URCORNER # box1[3] = ACS_VLINE # box1[4] = ACS_LRCORNER # box1[5] = ACS_LLCORNER # box1[6] = ACS_TTEE # box1[7] = ACS_RTEE # box1[8] = ACS_BTEE # box1[9] = ACS_LTEE # box1[10] = ACS_PLUS # # The box2 characters are the double-line versions of these forms graphics. # The AIX binary terminfo format is incompatible with SVr4's. # # TC Extensions: # # There is a set of extended termcaps associated with something # called the "Terminal Control" or TC package created by MainStream Systems, # Winfield Kansas. This one also uses GS/GE for as/ae, and also uses # CF for civis and CO for cvvis. Finally, they define a boolean :ct: # that flags color terminals. # ######## CHANGE HISTORY # # The last /etc/termcap version maintained by John Kunze was 8.3, dated 8/5/94. # Releases 9 and up are maintained by Eric S. Raymond as part of the ncurses # project. # # This file contains all the capability information present in John Kunze's # last version of the termcap master file, except as noted in the change # comments at end of file. Some information about very ancient obsolete # capabilities has been moved to comments. Some all-numeric names of older # terminals have been retired. # # I changed :MT: to :km: (the 4.4BSD name) everywhere. I commented out some # capabilities (EP, dF, dT, dV, kn, ma, ml, mu, xr, xx) that are no longer # used by BSD curses. # # The 9.1.0 version of this file was translated from my lightly-edited copy of # 8.3, then mechanically checked against 8.3 using Emacs Lisp code written for # the purpose. Unless the ncurses tic implementation and the Lisp code were # making perfectly synchronized mistakes which I then failed to catch by # eyeball, the translation was correct and perfectly information-preserving. # # Here is a log of the changes since then: # # 9.1.0 (Wed Feb 1 04:50:32 EST 1995): # * First terminfo master translated from 8.3. # 9.2.0 (Wed Feb 1 12:21:45 EST 1995): # * Replaced Wyse entries with updated entries supplied by vendor. # # 9.3.0 (Mon Feb 6 19:14:40 EST 1995): # * Added contact & status info from G. Clark Brown . # 9.3.1 (Tue Feb 7 12:00:24 EST 1995): # * Better XENIX keycap translation. Describe TC termcaps. # * Contact and history info supplied by Qume. # 9.3.2 (Sat Feb 11 23:40:02 EST 1995): # * Raided the Shufort FTP site for recent termcaps/terminfos. # * Added information on X3.64 and VT100 standard escape sequences. # 9.3.3 (Mon Feb 13 12:26:15 EST 1995): # * Added a correct X11R6 xterm entry. # * Fixed terminfo translations of padding. # 9.3.4 (Wed Feb 22 19:27:34 EST 1995): # * Added correct acsc/smacs/rmacs strings for vt100 and xterm. # * Added u6/u7/u8/u9 capabilities. # * Added PCVT entry. # 9.3.5 (Thu Feb 23 09:37:12 EST 1995): # * Emacs uses :so:, not :mr:, for its mode line. Fix linux entry # to use reverse-video standout so Emacs will look right. # * Added el1 capability to ansi. # * Added smacs/rmacs to ansi.sys. # # 9.4.0 (Sat Feb 25 16:43:25 EST 1995): # * New mt70 entry. # * Added COPYRIGHTS AND OTHER DELUSIONS. # * Added AT&T 23xx & 500/513, vt220 and vt420, opus3n1+, netronics # smartvid & smarterm, ampex 175 & 219 & 232, # env230, falco ts100, fluke, intertube, superbrain, ncr7901, vic20, # ozzie, trs200, tr600, Tandy & Texas Instruments VDTs, intext2, # screwpoint, fviewpoint, Contel Business Systems, Datamedia Colorscan, # adm36, mime314, ergo4000, ca22851. Replaced att7300, esprit, dd5500. # * Replaced the Perkin-Elmer entries with vendor's official ones. # * Restored the old minimal-ansi entry, luna needs it. # * Fixed some incorrect ip and proportional-padding translations. # 9.4.1 (Mon Feb 27 14:18:33 EST 1995): # * Fix linux & AT386 sgr strings to do A_ALTCHARSET turnoff correctly. # * Make the xterm entry 65 lines again; create xterm25 and xterm24 # to force a particular height. # * Added beehive4 and reorganized other Harris entries. # 9.4.2 (Thu Mar 9 01:45:44 EST 1995): # * Merged in DEC's official entries for its terminals. The only old # entry I kept was Doug Gwyn's alternate vt100 (as vt100-avo). # * Replaced the translated BBN Bitgraph entries with purpose-built # ones from AT&T's SVr3. # * Replaced the AT&T entries with AT&T's official terminfos. # * Added teleray 16, vc415, cops10. # * Merged in many individual capabilities from SCO terminfo files. # 9.4.3 (Mon Mar 13 02:37:53 EST 1995): # * Typo fixes. # * Change linux entry so A_PROTECT enables IBM-PC ROM characters. # 9.4.4 (Mon Mar 27 12:32:35 EST 1995): # * Added tty35, Ann Arbor Guru series. vi300 and 550, cg7900, tvi803, # pt210, ibm3164, IBM System 1, ctrm, Tymshare scanset, dt200, adm21, # simterm, citoh and variants. # * Replaced sol entry with sol1 and sol2. # * Replaced Qume QVT and Freedom-series entries with purpose-built # terminfo entries. # * Enhanced vt220, tvi910, tvi924, hpterm, hp2645, adm42, tek # and dg200 entries using caps from from SCO. # * Added the usual set of function-key mappings to ANSI entry. # * Corrected xterm's function-key capabilities. # 9.4.5 (Tue Mar 28 14:27:49 EST 1995): # * Fix in xterm entry, cub and cud are not reliable under X11R6. # 9.4.6 (Thu Mar 30 14:52:15 EST 1995): # * Fix in xterm entry, get the arrow keys right. # * Change some \0 escapes to \200. # 9.4.7 (Tue Apr 4 11:27:11 EDT 1995) # * Added apple (Videx card), adm1a, oadm31. # * Fixed malformed ampex csr. # * Fixed act4, cyb110; they had old-style prefix padding left in. # * Changed mandatory to advisory padding in many entries. # * Replaced HP entries up to hpsub with purpose-built ones. # * Blank rmir/smir/rmdc/smdc capabilities removed. # * Small fixes merged in from SCO entries for lpr, fos, tvi910+, tvi924. # 9.4.8 (Fri Apr 7 09:36:34 EDT 199): # * Replaced the Ann Arbor entries with SCO's, the init strings are # more efficient (but the entries otherwise identical). # * Added dg211 from Shuford archive. # * Added synertek, apple-soroc, ibmpc, pc-venix, pc-coherent, xtalk, # adm42-nl, pc52, gs6300, xerox820, uts30. # * Pull SCO's padding into vi200 entry. # * Improved capabilities for tvi4107 and other Televideo and Viewpoint # entries merged in from SCO's descriptions. # * Fixed old-style prefix padding on zen50, h1500. # * Moved old superbee entry to superbee-xsb, pulled in new superbee # entry from SCO's description. # * Reorganized the special entries. # * Added lm#0 to cbunix and virtual entries. # # 9.5.0 (Mon Apr 10 11:30:00 EDT 1995): # * Restored cdc456tst. # * Fixed sb1 entry, SCO erroneously left out the xsb glitch. # * Added megatek, beacon, microkit. # * Freeze for ncurses-1.9 release. # 9.5.1 (Fri Apr 21 12:46:42 EDT 1995): # * Added historical data for TAB. # * Comment fixes from David MacKenzie. # * Added the new BSDI pc3 entry. # 9.5.2 (Tue Apr 25 17:27:52 EDT 1995) # * A change in the tic -C logic now ensures that all entries in # the termcap translation will fit in < 1024 bytes. # * Added `bobcat' and `gator' HP consoles and the Nu machine entries # from GNU termcap file. This merges in all their local information. # 9.5.3 (Tue Apr 25 22:28:13 EDT 1995) # * Changed tic -C logic to dump all capabilities used by GNU termcap. # * Added warnings about entries with long translations (restoring # all the GNU termcaps pushes a few over the edge). # 9.5.4 (Wed Apr 26 15:35:09 EDT 1995) # * Yet another tic change, and a couple of entry tweaks, to reduce the # number of long (> 1024) termcap translations back to 0. # # 9.6.0 (Mon May 1 10:35:54 EDT 1995) # * Added kf13-kf20 to Linux entry. # * Regularize Prime terminal names. # * Historical data on Synertek. # * Freeze for ncurses-1.9.1. # 9.6.1 (Sat May 6 02:00:52 EDT 1995): # * Added true xterm-color entry, renamed djm's pseudo-color entry. # * Eliminate whitespace in short name fields, this tanks some scripts. # * Name field changes to shorten some long entries. # * Termcap translation now automatically generates empty rmir/smir # when ich1/ich is present (copes with an ancient vi bug). # * Added `screen' entries from FSF's screen-3.6.2. # * Added linux-nic and xterm-nic entries. # 9.6.2 (Sat May 6 17:00:55 EDT 1995): # * Change linux entry to use smacs=\E[11m and have an explicit acsc, # eliminating some special-case code in ncurses. # # 9.7.0 (Tue May 9 18:03:12 EDT 1995): # * Added vt320-k3, rsvidtx from the Emacs termcap.dat file. I think # that captures everything unique from it. # * Added reorder script generator. # * Freeze for ncurses 1.9.2 release. # 9.7.1 (Thu Jun 29 09:35:22 EDT 1995): # * Added Sean Farley's kspd, flash, rs1 capabilities for linux. # * Added Olaf Siebert's corrections for adm12. # * ansi-pc-color now includes the colors and pairs caps, so that # entries which use it will inherit them automatically. # * The linux entry can now recognize the center (keypad 5) key. # * Removed some junk that found its way into Linux acsc. # # 9.8.0 (Fri Jul 7 04:46:57 EDT 1995): # * Add 50% cut mark as a desperate hack to reduce tic's core usage. # * xterm doesn't try to use application keypad mode any more. # * Freeze for ncurses-1.9.3 release. # 9.8.1 (Thu Jul 19 17:02:12 EDT 1995): # * Added corrected sun entry from vendor. # * Added csr capability to linux entry. # * Peter Wemm says the at386 hpa should be \E[%i%p1%dG, not \E[%p1%dG. # * Added vt102-nsgr to cope with stupid IBM PC `VT100' emulators. # * Some commented-out caps in long entries come back in, my code # for computing string-table lengths had a bug in it. # * pcansi series modified to fit comm-program reality better. # 9.8.2 (Sat Sep 9 23:35:00 EDT 1995): # * BSD/OS actually ships the ibmpc3 bold entry as its console. # * Correct some bad aliases in the pcansi series # * Added entry for QNX console. # * Clean up duplicate long names for use with 4.4 library. # * Change vt100 standout to be normal reverse vide, not bright reverse; # this makes the Emacs status line look better. # 9.8.3 (Sun Sep 10 13:07:34 EDT 1995): # * Added Adam Thompson's VT320 entries, also his dtx-sas and z340. # * Minor surgery, mostly on name strings, to shorten termcap version. # # 9.9.0 (Sat Sep 16 23:03:48 EDT 1995): # * Added dec-vt100 for use with the EWAN emulator. # * Added kmous to xterm for use with xterm's mouse-tracking facility. # * Freeze for 1.9.5 alpha release. # 9.9.1 (Wed Sep 20 13:46:09 EDT 1995): # * Changed xterm lines to 24, the X11R6 default. # 9.9.2 (Sat Sep 23 21:29:21 EDT 1995): # * Added 7 newly discovered, undocumented acsc characters to linux # entry (the pryz{|} characters). # * ncurses no longer steals A_PROTECT. Simplify linux sgr accordingly. # * Correct two typos in the xterm entries introduced in 9.9.1. # * I finally figured out how to translate ko capabilities. Done. # * Added tvi921 entries from Tim Theisen. # * Cleanup: dgd211 -> dg211, adm42-nl -> adm42-nsl. # * Removed mystery tec entry, it was neither interesting nor useful. # * shortened altos3, qvt203, tvi910+, tvi92D, tvi921-g, tvi955, vi200-f, # vi300-ss, att505-24, contel301, dm3045, f200vi, pe7000c, vc303a, # trs200, wind26, wind40, wind50, cdc456tst, dku7003, f110, dg211, # by making them relative to use capabilities # * Added cuf1=^L to tvi925 from deleted variant tvi925a. # * fixed cup in adm22 entry and parametrized strings in vt320-k3. # * added it#8 to entries that used to have :pt: -- tvi912, vi200, # ampex80, # * Translate all home=\E[;H capabilities to home=\E[H, they're # equivalent. # * Translate \E[0m -> \E[m in [rs]mso, [rs]mul, and init strings of # vt100 and ANSI-like terminals. # 9.9.3 (Tue Sep 26 20:11:15 EDT 1995): # * Added it#8 and ht=\t to *all* entries with :pt:; the ncurses tic # does this now, too. # * fviewpoint is gone, it duplicated screwpoint. # * Added hp2627, graphos, graphos-30, hpex, ibmega, ibm8514, ibm8514-c, # ibmvga, ibmvga-c, minix, mm340, mt4520-rv, screen2, screen3, # versaterm, vi500, vsc, vt131, vt340, vt400 entries from UW. # The UW vi50 replaces the old one, which becomes vi50adm, # * No more embedded commas in name fields. # # 9.10.0 (Wed Oct 4 15:39:37 EDT 1995): # * XENIX forms characters in fos, trs16, scoansi become acsc strings, # * Introduced klone+* entries for describing Intel-console behavior. # * Linux kbs is default-mapped to delete for some brain-dead reason. # * -nsl -> -ns. The -pp syntax is obsolete. # * Eliminate [A-Z]* primaries in accordance with SVr4 terminfo docs. # * Make xterm entry do application-keypad mode again. I got complaints # that it was messing up someone's 3270 emulator. # * Added some longname fields in order to avoid warning messages from # older tic implementations. # * According to ctrlseqs.ms, xterm has a full vt100 graphics set. Use # it! (This gives us pi, greater than, less than, and a few more.) # * Freeze for ncurses-1.9.6 release. # 9.10.1 (Sat Oct 21 22:18:09 EDT 1995): # * Add xon to a number of console entries, they're memory-mapped and # don't need padding. # * Correct the use dependencies in the ansi series. # * Hand-translate more XENIX capabilities. # * Added hpterm entry for HP's X terminal emulator. # * Added aixterm entries. # * Shortened four names so everything fits in 14 chars. # # 9.11.0 (Thu Nov 2 17:29:35 EST 1995): # * Added ibcs2 entry and info on iBCS2 standard. # * Corrected hpa/vpa in linux entry. They still fail the worm test. # * We can handle the HP meml/memu capability now. # * Added smacs to klone entries, just as documentation. # * Carrected ansi.sys and cit-500 entries. # * Added z39, vt320-k311, v220c, and avatar entries. # * Make pcansi use the ansi.sys invis capability. # * Added DIP switch descriptions for vt100, adm31, tvi910, tvi920c, # tvi925, tvi950, dt80, ncr7900i, h19. # * X3.64 has been withdrawn, change some references. # * Removed function keys from ansi-m entry. # * Corrected ansi.sys entry. # * Freeze for ncurses-1.9.7 release. # 9.11.1 (Tue Nov 6 18:18:38 EST 1995): # * Added rmam/smam capabilities to many entries based on init strings. # * Added correct hpa/vpa to linux. # * Reduced several entries relative to vt52. # 9.11.2 (Tue Nov 7 00:21:06 EST 1995): # * Exiled some utterly unidentifiable custom and homebrew types to the # UFO file; also, obsolete small-screen hardware; also, entries which # look flat-out incorrect, garbled, or redundant. These include the # following entries: carlock, cdc456tst, microkit, qdss, ramtek, tec, # tec400, tec500, ubell, wind, wind16, wind40, wind50, plasma, agile, # apple, bch, daleblit, nucterm, ttywilliams, nuterminal, nu24, bnu, # fnu, nunix-30, nunix-61, exidy, ex3000, sexidy, pc52, sanyo55, # yterm10, yterm11, yterm10nat, aed, aed-ucb, compucolor, compucolor2, # vic20, dg1, act5s, netx, smartvid, smarterm, sol, sol2, dt200, # trs80, trs100, trs200, trs600, xitex, rsvidtx, vid, att2300-x40, # att2350-x40, att4410-nfk, att5410-ns, otty5410, att5425-nl-w, # tty5425-fk, tty5425-w-fk, cita, c108-na, c108-rv-na, c100-rv-na, # c108-na-acs, c108-rv-na-acs, ims950-ns, infotonKAS, ncr7900i-na, # regent60na, scanset-n, tvi921-g, tvi925n, tvi925vbn, tvi925vb, # vc404-na, vc404-s-na, vt420nam, vt420f-nam, vt420pc-nam, vt510nam, # vt510pc-nam, vt520nam, vt525nam, xterm25, xterm50, xterm65, xterms. # * Corrected pcvt25h as suggested by Brian C. Grayson # . # 9.11.3 (Thu Nov 9 12:14:40 EST 1995): # * Added kspd=\E[P, kcbt=\E[Z, to linux entry, changed kbs back to ^H. # * Added kent=\EOM to xterm entry. # # 9.11.4 (Fri Nov 10 08:31:35 EST 1995): # * Corrected gigi entry. # * Restored cuf/cud1 to xterm, their apparent bugginess was due to # bad hpa/vpa capabilities. # * Corrected flash strings to have a uniform delay of .2 sec. No # more speed-dependent NUL-padding! # * terminfo capabilities in comments bracketed with <>. # 9.11.5 (Fri Nov 10 15:35:02 EST 1995): # * Replaced pcvt with the 3.31 pcvt entries. # * Freeze for 1.9.7a. # 9.11.6 (Mon Nov 13 10:20:24 EST 1995): # * Added emu entry from the X11R6 contrib tape sources. # # 9.12.0 (Wed Nov 29 04:22:25 EST 1995): # * Improved iris-ansi and sun entries. # * More flash string improvements. # * Corrected wy160 & wy160 as suggested by Robert Dunn # * Added dim to at386. # * Reconciled pc3 and ibmpc3 with the BSDI termcap file. Keith says # he's ready to start using the termcap generated from this one. # * Added vt102-w, vt220-w, xterm-bold, wyse-vp, wy75ap, att4424m, # ln03, lno3-w, h19-g, z29a*, qdss. Made vt200 an alias of vt220. # * Improved hpterm, apollo consoles, fos, qvt101, tvi924. tvi925, # att610, att620, att630, # * Changed hazeltine name prefix from h to hz. # * Sent t500 to the UFI file. # * I think we've sucked all the juice out of BSDI's termcap file now. # * Freeze for ncurses 1.9.8 release # # 9.12.1 (Thu Nov 30 03:14:06 EST 1995) # * Unfreeze, linux kbs needed to be fixed. # * Tim Theisen pinned down a bug in the DMD firmware. # # 9.12.2 (Thu Nov 30 19:08:55 EST 1995): # * Fixes to ansi and klone capabilities (thank you, Aaron Ucko). # (The broken ones had been shadowed by sgr.) # # 9.12.3 (Thu Dec 7 17:47:22 EST 1995): # * Added documentation on ECMA-48 standard. # * New Amiga entry. # ######## REORDER # # Older termcap distributions featured a kluge called `reorder' intended to # time-optimize access to selected terminals by moving them to the front of # the file. This is obsolete under terminfo, but for completeness's sake # we give a reorder script generator here (strip off the leading #s to use). # #: mkreorder -- generate script to optimize access to given terminal types #: #: entries named on command line will be sorted to the front in reverse order #echo "ed -- termcap <reorder # # The following sets edit modes for GNU EMACS # Local Variables: # fill-prefix:"\t" # fill-column:75 # End: ######## SHANTIH! SHANTIH! SHANTIH! # $Id: disktab,v 1.3 1995/10/30 20:37:33 pk Exp $ # # @(#)disktab 5.5 (Berkeley) 2/27/91 # # Disk geometry and partition layout tables. # Key: # ty type of disk # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # rm rpm, 3600 default # se sector size, 512 default # sf supports bad144-style bad sector forwarding # so partition offsets in sectors # p[a-h] partition sizes in sectors # b[a-h] partition block sizes in bytes # f[a-h] partition fragment sizes in bytes # # pseudo-geometry taken from rd7945 miniroot:\ :ty=winchester:ns#16:nt#7:nc#968:\ :pa#10240:ba#8192:fa#1024: floppy|floppy3|3in|3.5in High Density Floppy:\ :ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:\ :pb#2880:ob#0:\ :pc#2880:oc#0: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: QUANTUM EMPIRE_2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: QUANTUM LPS540S:\ :ty#winchester:ns#125:nt#4:nc#2113: QUANTUM PD1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: QUANTUM XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum ProDrive 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N Elite 9:\ :ty#winche# $NetBSD: install.md,v 1.3.2.5 1996/08/26 15:45:28 gwr Exp $ # # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # # machine dependent section of installation/upgrade script. # # Machine-dependent install sets MDSETS="xbin xman xinc xcon" md_set_term() { if [ ! -z "$TERM" ]; then return fi echo -n "Specify terminal type [sun]: " getresp "sun" TERM="$resp" export TERM } md_makerootwritable() { # Was: do_mfs_mount "/tmp" "2048" # /tmp is the mount point # 2048 is the size in DEV_BIZE blocks umount /tmp > /dev/null 2>&1 if ! mount_mfs -s 2048 swap /tmp ; then cat << \__mfs_failed_1 FATAL ERROR: Can't mount the memory filesystem. __mfs_failed_1 exit fi # Bleh. Give mount_mfs a chance to DTRT. sleep 2 } md_get_diskdevs() { # return available disk devices dmesg | egrep "(^sd[0-9] |^x[dy][0-9] )" | cut -d" " -f1 | sort -u } md_get_cddevs() { # return available CDROM devices dmesg | grep "^cd[0-9] " | cut -d" " -f1 | sort -u } md_get_ifdevs() { # return available network devices dmesg | egrep "(^le[0-9] |^ie[0-9] )" | cut -d" " -f1 | sort -u } md_get_partition_range() { # return range of valid partition letters echo "[a-h]" } md_installboot() { echo "Installing boot block..." /usr/mdec/binstall ffs /mnt } md_native_fstype() { } md_native_fsopts() { } md_checkfordisklabel() { # $1 is the disk to check local rval disklabel $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk _disk=$1 md_checkfordisklabel $_disk case $? in 0) echo -n "Do you wish to edit the disklabel on $_disk? [y]" ;; 1) echo "WARNING: Disk $_disk has no label" echo -n "Do you want to create one with the disklabel editor? [y]" ;; 2) echo "WARNING: Label on disk $_disk is corrupted" echo -n "Do you want to try and repair the damage using the disklabel editor? [y]" ;; esac getresp "y" case "$resp" in y*|Y*) ;; *) return ;; esac # display example cat << \__md_prep_disklabel_1 Here is an example of what the partition information will look like once you have entered the disklabel editor. Disk partition sizes and offsets are in sector (most likely 512 bytes) units. Make sure these size/offset pairs are on cylinder boundaries (the number of sector per cylinder is given in the `sectors/cylinder' entry, which is not shown here). Do not change any parameters except the partition layout and the label name. It's probably also wisest not to touch the `8 partitions:' line, even in case you have defined less than eight partitions. [Example] 8 partitions: # size offset fstype [fsize bsize cpg] a: 50176 0 4.2BSD 1024 8192 16 # (Cyl. 0 - 111) b: 64512 50176 swap # (Cyl. 112 - 255) c: 640192 0 unknown # (Cyl. 0 - 1428) d: 525504 114688 4.2BSD 1024 8192 16 # (Cyl. 256 - 1428) [End of example] __md_prep_disklabel_1 echo -n "Press [Enter] to continue " getresp "" disklabel -W ${_disk} disklabel -e ${_disk} } md_copy_kernel() { echo -n "Copying kernel..." cp -p /netbsd /mnt/netbsd echo "done." } md_welcome_banner() { { if [ "$MODE" = "install" ]; then echo "" echo "Welcome to the NetBSD/sparc ${VERSION} installation program." cat << \__welcome_banner_1 This program is designed to help you put NetBSD on your disk, in a simple and rational way. You'll be asked several questions, and it would probably be useful to have your disk's hardware manual, the installation notes, and a calculator handy. __welcome_banner_1 else echo "" echo "Welcome to the NetBSD/sparc ${VERSION} upgrade program." cat << \__welcome_banner_2 This program is designed to help you upgrade your NetBSD system in a simple and rational way. As a reminder, installing the `etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the `etc' set into those files which already exist on your system. __welcome_banner_2 fi cat << \__welcome_banner_3 As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __welcome_banner_3 } | more } md_not_going_to_install() { cat << \__not_going_to_install_1 OK, then. Enter `halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __not_going_to_install_1 } md_congrats() { local what; if [ "$MODE" = "install" ]; then what="installed"; else what="upgraded"; fi cat << __congratulations_1 CONGRATULATIONS! You have successfully $what NetBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __congratulations_1 }  `@# ` !Ф" $@` `T@ " a@"@  "c0  0  " 8 " D * " > NetBSD BOOT [%s] netbsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@@` !x @   ` L@ %   % + / -   c@{ @M 2%c @r!@M 2@   @   a@_ $ ! @V@@-Bad format %d+%d+[%d+%d]=0x%x boot: short read x%@/ < ?@ ?# @!2?3 a/?@ ?# @!% a!?@ ?# @!  a ?@ ?# @ 2   `"  "p @"?@ ?# @! "` a ` @ ג܀ 2 @?@?# @! a ?@ ?# @!" a  @" .@`@2.@ "@@  2b @@  .@  `耢 8@ ` @"@ 耢 2? @# b,@ x  5 @ה b,   ?`@ g2$ @ "@e ` ?> " "@[@   8  #0     Āb00"@E  promprom0㿘  8  @ #0 (*  "# @" "`K` -  * K     J  8*   b"K  *K ) K  * #0` ` " @ `&J@ -" @   *:  d` d s aJ@ J@  #` @"J@  @Can't open device `%s' Can't open network device `%s' 㿘@   `8 ` @w  $  !` #0`  #`#`$@2$   $   l$   # @| 0+% @ː $ &  2  !X a@ɔ @]  @a 0!@ a@   `8` H $$ 㿘# c0   ` ༟* `c0   '@`20,6 * '@ 㿘  @ߒ& & $& (`   €@ " '@ 㿘 ` @@  #0` (`(`@0@ 㿘   @@  & ? $  P*@ 㿘 #0  4㿘 #0  8` @xmit: not a network device 㿘 `,  @ ?@a`@i`?㿘  ,@K €@T㿐 0`  #0  #0O`P/O O /O㿐 #0     O ?X/O O /O㿐 #0  / 0T@㿘  㿘 #0 t㿘@ @`t㿐 #0    X #0 p%x mac-address drop swap 6 cmoveX  8 #   b耢  b  Њ@*@` "@< 0c0` `€0  c@c0 |@ielefdxyxdstsddevice_typeblocknetworkbyte㿘 #0` ! `@ @X`Ȱ @S`؀ '  @K`   @C`耢    x` xN@J2N`J@" 2 node %x property %s length %d > %d 㿘 #0 `€  `  !@N 㿘 cޖ ??" *Invalid controller number prom_iopen: "%s" error=%d 㿘)  T ?C   @ #@ 8$ $  $ $`  @"* @ *`@`@G $0` "`@$4` " @ $ @ &  T  % T@"ذ 㿘# `T    @ 4 "$`T@ & 4$`Tprom_mapin: length=%d prom_mapin: invalid maptype %d 㿘  <* @  x@. !0          @     !4  <<  D@;@ ?*@Ԣ &@ `  @ !4 @  H 0?( , H L\ T ` X` P d l  t$ p   P*?  8Ĉ`Ī` Đ`IJ`  dvma_mapin㿘? #@(1? @ "1?dvma_mapout㿘 #@(1 @ "1㿘@ " ْ㿘 @ 㿘  X  @   "a8   @0 `X "`X㿘 `X ? "`X @z!8boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' @08?7 ! !x @ *'@ @8 )   @ @ a8 `X# b 8@b  ! b `@ '@ b8@%'      2   㿘     @W   `" $    "`?    ?   㿘 ;  < 㿘  `t @.2  '" ?$Revision: 1.4 $pؐ@ @ 8 $@`@ y    #\ $#`ab  @`?    H 2 "`@ Y  "`?㽠Px@Ȓ @ H @ 8 `$@ >$`      h#\#`ab  @ƚ`$?   4  2  @   $0@  D nfsread: short packet, %d < %ld 0ȴ @  $'$&`$&`( L#\$L#`ab  @ ,?  `"" " H@L@ ݔ0   @ x  H"`?㿘@   "`!"!6 & 5@ 2 ? "0""0 "`0!"`4"`8 ?nfs_open: must mount first. 㿘 "0  @ <"x @ x "0$  < "0<@ x0&` 㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' # ! % @    W? `   @ H ;  @ B > & @ 2&       D": 0 0  @C :  ` : ??0  04 (2`:2` <"` @"`D :`0 㿐` @z0@ z`@ย@༠,@@|@:@x`* d` , 00@ @ x*`  @>  ?*```" ?% Ȑ@U0㿘 ` .` 8Z& , @&@,J G&F @ h`, &, @`0$ @   d,@``  ,@ `0  2 , `0@ӑ," ,  @  @1 ,`& 㿐   < @ /P 40P* :  8  20 8 0< @D@L @ Ȁ(r 2: @0$  " @  d   *   Ā 0@$ $  &@$@&   b 8   @   " & 㿐`@0  +<@ 1 "  2  @)  2 & * @@ B <@`@@8Ԑ@2 ``@̐ 㻀  @" Ц@% &`@@ $` `  찒`@2 %\F!T@  0@eg`0 @   @ t,   "  'g` @ ~7<`/2L@`L@ /"`L@ "q   Ӓ  ``d `L@  /,@Q谒W,@5R` ( 2GL@@q $C  @`@ $%(`8@ 0 U䰒)`@ ` d ` *  0ఒ@O /' '`L@  @ `@x 0 @s Ё㿘  &  .  "  @b`0  .  "  @W`0 @T@Q Ё 㿐% `@@8 ``@N@ @@ B <@߲@2&     ":0 " 0 @C : ` :??0 2`"` "`:`0 㿘  * &  * & %L?2%, &%P%, %  0 :* * ?: >%0 t:   @   %0@ C >%0 H8: >%8 L8: >%@bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p(0ФXa"'А ''ؐ 'ܐ' !x'@В S? a?"a4 ?$#\!#`ab  @#@  @ 7?# `! @ 4 `'ab@    @i?'  " a@{ ?  " a@p ? @``  4''  a@G 2B?@ Ӑ@= 28? a?"a6   &#@#\"#`ab  @a   H"`?' '@$ ?@F  ?#'@` 㿘 `&"@ &@G 㿘`&@  @&@4.@& @"  #d d  e  f g  #" ?+d +e+f+gd"@ #rarp: bad socket. %d No response for RARP request   !@E?@ h .Ɛ 7Ɛ(7Ȑ /ʐ /ː 7̠@ܔ @ؔ  4#\ b . "@H~  @g! ?! !x@ !x   ? !x0   ??"b !x$ 㿘 0 @L 5㿐@[ "   5@2?@ 2?`(2?`&2?` ` ? @ $  ?callrpc: error = %d 㿐`@?;6 '?'??@ Ւ  '?ܐ '?? b( "b('?'?Ȑ '?'?'?'?\@"#\ b $   @? @`` `2 `"@ɐ#p  H"`?recvrpc: reject, astat=%d, errno=%d 㿘 " @ $?@ "(@2?``2 ?`` ` "  @ ??"@?2  (  ( 2  2 2 *?      ( @""@" " " getport: %s㾐a"@1 o'?' ''''p#\ #`ab  -   p'0 ! @a  @!"H H$ ?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorUnknown error: code %d㿘`V  *`@4:l4:x4:4:4:4:`4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:$4:04:<4:H4:T1 ,#81 )#P1 &#h1 ##1  #1 #1 #1 #1 #1  1  1   H1  `1  p @(`x p㿘@       2  2  ᬄ` ` "  " ᨝㿐. *  ! @@ 2  $"` "'@       "`    "`&?㿐  ! " `     ?"`$$ $ '23$   * "J    $" @$  !p@` !' .`* @€`p@.``" $ " ?㿘  - ` ".` 0.".,.&```""#..* 0?$ "   0 @̠L  0İ 0  0sendudp: bad write (%d != %d)x@  <* @*@@ &6 . . &&@ 6 6 66'''''@ܒ 6@6&&&&&`  "  @ @   'ܐ@ܖ@(@? "@Dreadudp: huge packet, udp len %d x@טް?} {ހ( (` u?@zp?2n?@<  2g?` 2c?@.\@| 2X?V`&T? `` 2L? @@ה& 6` &` @2=?` "5`T` %  @b/?@'`'`'` '`'@/ `6` @>  &@&`&`&` &`&@&`&`&` &`` ??sendrecv: short write! (%d < %d)㿘\   )  <+  % (?@@b@, 4 2     $@$Ӧ`l *`Є  * (Ї8  *`J. 64 "2/?`"8" ?#   `(?`(d(  `(d(h( ?#㿘@㿘1  .  . ?@ /  0.@ Ȓ ?@ %  0.@   0?.?.`4 "@  Ї((*8"@  Є (@㿐 1 N -* N # .! Ւ* ? N  . ƒ*`?# @N  .    J@?   `&     ,` ` ` (   `߀` ܗ(2 :?# :* arpwhohas: overflowed arp_list! arp: no response for %s @'l  ! "@6  l "?`@   b  "b @ 8@ .ƒ 7Ɛ(7Ȑ /ʐ /7̐`@ `@ l@ l& 4#\ a . "a~?2  l'hh @ `  @Ք  b "b㿘 0@s(㿐@ " (2(?@ 2$?`(2 ?`&2?`  @?2? "* @*` !@`@A  ?㿘@ 0`(,`&(` $` @%   6```@k `@f  @b @^  .@(㿘 @O @K 6? ??㿘?  @ݔ    "0@֔  "` ?` 7? Ȓ   : 0 (  ( (``(  Ȁ   @ ? *@0 *@ ` 㿘'H'L'P'T'X ` 2 @"`@H @s!Mexit㿘 !㿘  !, *  " @   , 㿘. *  !@  @ 2  %"` 2  " @  `  ` @`$ "   " ? ` *@㿘'L'P'T'X! $  #H@L *㿘'H'L'P'T'X "@ H㿘 "@8  T  N@ %` N@? `* 4P4Qp4Q4RP4RP4RP4RP4RP4RP4RP4P4RP4RP4Q4RP4RP4RP4Q4RP4R4RP4RP4R0 L@`@p ϒ L@?,` < ,L@`L@  L@L@ 4`L@ `` >0 L@ `L@ `N@  - @- N@@% N@@ ~N@@ vN@ %`n lj0123456789abcdef㿈 "@ , @ ?L?|/-\㿘 `" ` "J@  㿐@a㿘@W   *  @ *   "@ @b  88  b   㿘  `  `  @4 0%@/  & &@*&& @@ "   ` 㿘?c @ 6 @o6` `B  & $ @*&@$@@W@S2  *   , "@@ 4 "  "  ,`@@ 4`   ,@@ 4  @@*  㿐  `  ` @` ?2   2@  *2  ?*@   *  2@*@  㿘  `  ` @1  `  &  4 @ *    ?: : 2@  *:  ?*@   *  2@*@    B 'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@; ) ... . .. chflags chgrp ftp gzipf gunzip gzcat sed  sortf tar tip  basenameu cksum sum cut gawkf awk getopt grepf egrep fgrep netstat rsh strings tsetf reset viD lessfX moref . ..ataris . .. Acre[0! DeNoronha "East#Westt z@P@QHP@ "PɪPxQ 3!3" #X,#Q%8%@'!+P'@) P)@*P+},P-].P/=0P1i2i2K4I4-6)u6J@8 W8,@99:@;VPE@?P@%@AqPBCQPCE1PEΔGGvHIXJڠKwu@LMWW@NdO79@PPQ@RccPR@TCEPT@V#'PVX PXYPZ[\_]^?_`(@akb@cKcd@e+qeF@gPg(@hpPi @jRPkq&l4PmQnPo0p}2qr]rtE? @%Aq BCQ CE1 EjGGLHI.JvKwKLXMW-N:O7PW QRc9 RTC TֵV" VѐX XY Z[ݠ\_w]^?Y_`(vakbXcKec:e+Gegd ghF ij( kpl mPސn o0p}qr\rt<̠tfvvwxeyrzyG{ŏ |Y)}q ~9 S LMTFSTFDT rI@40t 80 ܹY 0ޛ ݚ0}^ d0p Q,0 Ұ0}Ɏ0xנ5 3Ϡ!" Ƞ#X#5%7% '!0' )0) *0+},0-].0/=k0y01M2i2/4Iw46)Y6. 8 ;8 9: ;:0E ?0@% Aq0BCQ0CE10ExGGZHIE0? @@%0Aq@B°CQ@CE1@EΆGGhHIJJڒKwg0LtMWI0NVO7+0Ps@Q 0RcU@R0TC7@T0V#@VX@XϰY@Z[\_]^?u_`(0akbt0cKcV0e+ce80g@g0hb@i0jD@kql&@mPn@o0ܰp}$qr]rt^`W G7'֨ƧP`P`Po`_kPOj`?MP/L`(i.`KJ-,wpP``PP@`0P ` 5P xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P `!P"q`#j$Z%J&:'*e(d) G)F*)+(,FP- .(P/'`0 P1 `2rP3b`4RP5B`62P7"`89 9:;ې<ˏ=r>q?T@SAqPBk5CdSPDTR`ED5PF44`G$PH`IPI`JPK`LM`NOPQ|RlS\TLU<~V,aW`X~PY}`Y`PZ_`[BP\A`]$P^#`_P``a~"bd`c^dNe=f-gh hij݌k͋lƩPm`nPo`pmPqvl`rfOPsVN`tF1Pu60`v/Mw`x/x.yz{|}~ADTAST8pj`ZpI`9p)`p `p`١pҾp𒒂rdbcRFBE2("'E` Dp'`&p `p`p`pjpcSC3#qpSRp`4R`Qp4`|3pl`\pK`;p+`pԺĹ𿴜~„}}`d_]}`M|p=_`-^pA` @p#`"p`p!϶ Ці҅ueUE5.``p`މpl`޾kp߮N`Mp0`~/pwL^pW.G-7'ֶƵ`p`p`op_y`Oxp?[`/Zp(w?b@aA`BkCCda`DT`pEDC`F4BpG$%`H$pI`IpJ`KpLMpNOPQ|RlS\TLUpv/[w px=xp~=wZ^W?p@pApBkRCdopDTnEDQpF4PG$3pH2IpIJpKLM؀NOPQ|RlS\TLU<V,}W}XpYY|pZ{[^p\]]@p^?_"p`!a~>bec^ dN e>f.gh hijݨkͨlpmĀnpoppqvrfkpsVjtFMpu6Lv/iw.xKxKy-z-{|}~CDTCSTASTU87qj6Z5J:) ܀ې龀ٽrbRcBb2E"Da `CB%$逢萣jʐcSC3#pǒQnmP|Ol2\1L<+„}d|]M={-z] \?>! >϶=Ц і҆veUE5.ĀÐޥΈ޾߮jiL~Kwi^-WKGJ7-',рАo_O?w/v(XvuXW:9wqaP@0ހ5 5  ࡐ ٿ yeidYGIF9))("E '& ̀ ̐!"q#j$Z%J&:'*() r)q*T+S,p-5.R/Q04132s3c4R5B62ڀ7"ِ89 9:;ۻ<˺=>?@~ABk`Cd}DT|ED_F4^G$AH@I#I"JKL"MNOPQ|RlS\TLU<V,WXYYZ剐[l\k]N^M_0`/a~Mbec^/dN.e>f.gh hijݷkͶlӀmҐnopqvrfysVxtF[u6Zv/xw ?@ ABkn CdDTEDmF4lG$OHNI1I0JKL0MNO PQ| RlS\ TLU< V,W XYYZ嗠[z\y]\^[_>`=a~[bec^=dN< e>f. gh hi jk lmnÐo pqvrfsVtFiu6hv/wJxhxg yJzI {,|+ }~ PDTPSTq0T S06 q50jRZQJ4:3* ڠٰ 0 0r b0R B~02a "`0} |_^A@#"" j氥d T0C 30# 0 0 Ӌ0̨m0l|klN\ML00? @0ABk|0CdDTED{F4zG$]H\I?I>J!K L> MN O0P Q}0Rl S\0TL U<0V, W0XĠYðYZ奰[Ո\Ň]j^i_L`Ka~i be-c^K dNJ0e>- f.,0g h0h i0j k0lmnѠoаpqvrfsVtFwu6vv/ wXxv xu0yX zW0{: |90} ~0 pYDTYSTESTCSTMSTPSTpYSTs`HST2 . ..3Comoro$4 Antananarivo[5 Mauritius 6Mayotte7Reunion8Mahe9Chagos:Maldives ; Christmas <DCocos(*0LMTEAT 3⫹@,*08@*0LMTEATEAST58@LMTSMT*h*0LMTEAT948@LMTSMTd38@LMTSMTFPPKT/ØDFPMMTPKTbpJVT[hCCTǰCMTAST @2SC <  @@p\X<@`bT U2Sr(pA2SDe2SD U2SD"2SLA2SD7n2SO) 2SO)  2SVA2SEp2SE!2SE! 2Sb 2SKܓ2SK 2SK ../../instbin2Sj 2SK4΀2SK2SK../../instbin2Sn 2SK&%2SK'V2SK'V../../instbin2Sr 2SK)'2SK+2SK+../../instbin2St 2SK-D2SK/2SK/../../instbin2Sv 2SK2b2SK3B2SK3B../../instbin2Sx 2SK52SK7n2SK7n../../instbin2Sz 2SK92SL2SL../../instbin2S| 2SLbZ2SL2SL../../instbin2S~ 2SL2SL2SL../../instbin2S 2SNe2SN /2SN /../../instbin2S 2SN"2SN$[܀2SN$[܀../../instbin2S 2SN&62SN(2SN(../../instbin2S 2SN*T2SN,2SN,../../instbin2S 2SN.}2SN0G2SN0G../../instbin2S 2SN22SN4s2SN4s../../instbin2S 2SN7n2SN8C2SN8C../../instbin2S 2SN:i2SO2SO../../instbin2S 2SO,2SO]J2SO]J../../instbin2S 2SO2SO h2SO h../../instbin2S 2SO 2SO 2SO ../../instbin2S 2SO߀2SOI 2SOI ../../instbin2S 2SOC2SOu*2SOu*../../instbin2S 2SOׄ2SO2SO../../instbin2S 2SOk 2SO4΀2SO4΀../../instbin2S 2SO(2SO!`2SO!`../../instbin2S 2SO#F2SO$s2SO$s../../instbin2S 2SO'V2SO) 2SO) ../../instbin2SAm2Szt2Oe2S 2S$2Szt2O]2S+ 2S$2Szt2O\2S$[܀ 2S$2Szt2O]2S'V2S$2Szt2O]2S(2SAm2Szv2J{2S92S$2Szv2O`2S8C2S$2Szv2Oa2S;32S$2Szv2Oa2S2S$2Szv2Oa2S2S$2Szv2Oa2S h2S$2Szv2Oa2S 2S$82Szv2Oa2Sv2S$82Szv2Oa2Sܓ2S $82Szv2Oa2Sׄ2S"$82Szv2Oa2Sk  2S$$82Szw2Oa2S /!2S&$82Szw2Ob2S&6"2S($82Szw2Ob2S*T#2S*A2Sz|2JD2SW$2S$I2Sz}2OE2SbZ%2S$h2Sz}2OF2Sw&2S$I2Sz}2OF2S S+'2S$I2Sz}2OF2S沀(2S$I2Sz}2OG2Sf)2S$I2Sz}2OG2S>*2S$82Sz}2OH2S+2S$I2Sz}2OJ2S,2S$82Sz}2ON2S$s-2S$82Sz}2ON2S'c.2SA2Sz2Od2S2S$2Sz2OR2Sܓ`2S$2Sz2OR2Sׄa2S$I2Sz2OR2S8b2S$+2Sz2OW2S'cc2S$&2Sz2OW2S*Qd2S$72Sz2OW2S/qe2S$Q2Sz2OX2S7nf2S$2Sz2OX2SWg2S$$"2Sz2OX2S9h2S&$2Sz2OZ2SbZi2S($I2Sz2OZ2S]Jj2S*$Z2Sz2OZ2SX;k2S,$A2Sz2OZ2S l2S.$2Sz2OZ2S m2S0$x2Sz2OZ2S沀n2S2$I2Sz2OZ2Sz9o2S4$|2Sz2OZ2Sܓp2S6$s2Sz2OZ2S(q2S8$I2Sz2OZ2SGr2S:$2Sz2OZ2Ss2S<$q2Sz2OZ2Set2S>$I2Sz2O[2S Uu2S@$I2Sz2O[2S#Fv2SB$q2Sz2O[2S&%w2SD$2Sz2O[2S) x2SF$q2Sz2O[2S*Ty2SH$2Sz2O[2S S+z2SJ$`2Sz2O[2S1xˀ{2SL$I2Sz2O[2S3%|2SN$2Sz2O[2S6=}2SP$I2Sz2O[2S98p~2SR$N2Sz2O[2S2ST$I2Sz2O\2S2SV$I2Sz2O\2S/2SX$2Sz2O\2S 2SZ$I2Sz2O\2SI2S\$2Sz2O\2S2S^$I2Sz2O\2S 2S`$I2Sz2O\2S'V2Sb$2Sz2O\2S82Sd$W2Sz2O\2S /2Sf$\2Sz2O\2S"2Sh$I2Sz2O]2S3%2Sj$W2Sz2O]2S62Sl$I2Sz2O]2S;32Sn$Z2Sz2O^2S2Sp$[2Sz2O^2S2Sr$2Sz2O^2S !2St$2Sz2O^2S 2Sv$y2Sz2O^2S2Sx$I2Sz2O^2SC2Sz$2Sz2O^2S2S|$Z2Sz2O^2S82S~vL\Mn@4$#$ڰ˰Ӽí0000|0 l0!\0"Lp0#]?8@f?AU0BF!Cd70D&ED0FG#0G0I0I0J0K0L۰M0NOn0PQWRlS7TLcUjV,EVLXb0X.YD0Z[&0\-0]0^0_0`_0a~b?0c]d0e=ʰfѰgg賰hiȕjpkwlƍ0mYno0oh;pQ0qQX0rf30s1:0tF0u0v/1v0xx0yz0{װ|ް}~y$LMTMGTMGT DSTEGTEGT DSTuhM|P42$#PPPP|P lP!\P"LP#<}P$,nP%_P& PP'{'l(])N*?+0,!-./t0d1^P2rP3=P4RP5P62P6P88ݙP9:{P;ې<=r>y?T@f[AqPBF=CdSPD&ED5PFG$PGPIPIPJPKPLMPNOnPPQWRlS7TLUV,aVhX~PXJY`PZ,[BP\IP]$P^+P_P`` Pa~"b?Pc^dPe=fgghiȱj݌klƩPmunPohWpmPqQtPrfOPs1VPtF1Pu8Pv/MvPx/xPyzP{|}~yπLMTWGTWGT DSTwLMTASTˉa&G *)  x q(a'Q A 0C ΐ ௠    ysir YUIT 97)6 "S  5CB%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k  pPSTPWTPDTAKDTAKSTˉ(a4 U08 70 x0q6a5QA0Q ܠ 0 ཰  0 0y i0Yc Ib09E )D0"a &0CB%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k pp YSTYWTYDTAKSTAKDTˉDaP@UqPT@SP6@x5PqRaQQ4A31m  P @ @P@Py@iPY@I~P9a@)`P"} BP_B%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k ePs`ePs` pNSTNWTBSTBDTAKSTAKDTH*FL ˉ auXW:9wqaP@0ހ   ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O PWTPSTMSTMWTMDT,ppsp NGpˈa ۗ`Ӥ pUsޗݩp޾y߉rp[iTp~=I6p^)pG<7'pp:wp``pP`@p0`p p ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p CWTCSTCDTESTEDT,ppˈa u@Jg+@p@0p' p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A CWTCSTCDTESTY|g;ؑ1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~] LMTPSTMSTPDT75 LMTAST 73BPLMTESTAST 7BOxp?[`/Zp(wp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p|LMTEDTEST y$丅ctnvTP_`0>P8 LMTBMTADTAST7^ٰ;EQء.nX^PX>2X'`X`X`جǤ`vخ`Vذh`6زpشPf|ض0HߙX*฿{X ຟ]X)`?X `_!X`?Xx`(X`8`!ɧsːXUpXb`Paq`7PP  LMTCHDTCSTCDT KMTEST @6I`nP+`PP'`(n@ SJMTCDTCST b˜ӔPt]@[fQ@;Hʼm$eP̜O P;ӣP`}@=DS;@ũh@wp@`P5@PH@ P{ P j@ iP ن KPhP}@Qf1F[&{;d]F?(\@ >@zSP @ Z5P!o@"CQ#N@$#3%.@&''()*צ+,-P.j/kP0wL1KP2`i@3+~P4@K@5 `P6 -@6BP8@8^9@:@; <"=>t?@SAhB=PCHDPE(wEPG@GܩPHv@IPJX@KmPL:@MN@OekPz8QEMRZS%/T9UVV.PWXPY٢ZP[¿@\P]@^mP_@`MPabe@b6cBG@de")@exg EgZh'iPrS@sPt3@tPv@vwr@xyT@z{p|}R~gg|4HMTCDTCST4LpLMTASTB`K@C{HpPHPPH0P P`  SDMTEDTESTEHDTAST զ !\P"z#<}P`LMTCDTCST4dLMTASTPLMTAST U`͖,x`P$LMTCDTCSTo nqF@P@P@P@ P!w@"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pD PPMTEDTEST LKD !\P"z#<}P<LMTCDTCST p ` ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p KMTESTEDT 0Mn@4 FFMTASTADT5ŬLMTAST-HCt` >PQoP1QP$ MMTCSTESTCDTbPMTEST2`ASTAWT744LMTAST= . ..> Scoresbysund[?Godthab@ThuleNew_YorkChicagoDenver Los_AngelesAJuneauBYakutat AnchorageCNomeAdakPhoenixDBoise Indianapolisx/bIndianaE LouisvillepDetroitF Menomineep St_JohnsHalifax MontrealWinnipeg Regina Edmonton  VancouverETijuana WhitehorseG Mexico_CityFMazatlanGEnsenadapHAnguilla IAntiguaJNassauKBarbados LBelizeMCaymanN Costa_Rica OHavanaPDominica Q Santo_Domingo[R El_SalvadorSGrenadaT Guadeloupe U Guatemala VPort-au-PrinceW TegucigalpaXJamaicaY Martinique Z Montserrat [Managua\Panama] Puerto_Rico^St_Kitts_St_Lucia `Miquelon a St_Vincent b Grand_Turk cTortolad St_Thomas e Buenos_Aires[0fArubagLa_Paz!Noronha" Sao_Paulo#Manaus  Porto_AcreSantiagohBogotaiCuracaoj Guayaquil kCayennelGuyanamAsuncion nLimao Paramaribo p Port_of_Spain[0q Montevideo rCaracasShiprockAtka Fort_WayneKnox_INdVirginu8ncYI 8(" @@P@P@P@ u!w@"U#j$5%Ju&'*W'P) 9)މP*+kP,8@-MP.@/~/P0@1gK2r@3G-4R@5'62@7889:Ƶ;ۂP?F@oPAc@BOxPCdE@D/ZPED'@Fp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p KMTESTEDT7lLMTAST7` LMTASTB<{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v'!0'X)0):*0+W  CMTASTADTARSTARDT /8HHLMTNAST LPMTLPDTASTXU`BMTEST . H`LMTNASTBhQMTEST +5LMTASTEST y }<xD LMTBGSTEST+@ S t ʰ x0-@Z1t`FȰ8@'0L /@c0۳08l@O0 p!a@"S#DX@$4;0%A;@&n'@'0()'0*w+Z,@-0./|0n@1_F2P@3@z0415!6@70718f09ֶ:ƙ;@<0=>?zQ@@kA\@BL0C> D-E=@F 0GpG0HIذJ)@K 0L\M?N@OwİPi@QX0RJHS:+T+|@U_0V V0W4XYh@ZK0[\~]@^_uT@`e70aVbFjc7@d'0ef #0fsgVhܧ@i̊0jkl@mBn@oqv0pbqRrC@s30t%-ub0vvw@x0yz{M@|}@~}0o AMTASTESTADT  t@JPE@/J-, p%&|LMTEDTEST*Kb,1H<L LMTPMTDGSTEST73TLMTAST9%Y8C0Ìvԗyy8_[}x8?=]Z8=<8<080UT0͕_ . EJ r T s 6ꦠ>0bqؖ(0ɨX0Ǡ ZG( ݠ0 U0nG!T0";>#$ %Jg%vD  MMTUHDTUSTEDTESTEHDT ,PH0CMTVZTAST   @"@  ` ' @ jܰ   >.h8!  a  &a L @$ L` &`>.h$!   @"@    ' @ 62 >a|   ">.g"]   @"@    ' @  '  @#'` *   L 9 2  <      @      2  >`h? h && h l 4 & h    p $ & h  @  L  $ L $ T $ DD ;  D 6  @"@    ' @   L $ L  @"@   ' @  0  $ \ $ 0$ @nfs server %s: %s 㿘" f>0cؔff h`0 'V @`$ "4`0沢"' '̐ԔؖИ ̠ #Ѐ 2` #`0  `"@`8" &`$@&`8 2&` @O9 `0 4&`0 1&`0"' '̐ԔؖИ šЀ`  (Ԁ`Д "`( "&`$" &`("     #2`0Ѐ 2'耦 `$ `0 @nfs getstream㿐 0  >1eĐ"H $ 0 < 2I 8 8 $ 0        & &   2    *   `& ? &  8?$ 8 *@`$ < 0  0 ?$ 0 < !@ H 0 8 <@ $ $ <$ 8@$ 9  @/   <@  " $  < "@&  < ""@&  < 0 # $ <@& $  8$ <"$ 8 0 ?$ 0 ,  ,@@ 2@"@ 0 "c < , ( (` ,"`$ $ ,$ (T$ ,㿘& 0 ". 7 $`2`( 7 & $$`& (T`  $ ؒ TE $ ,$ 0$ <` $ @&&a F Tnfsd wakeup㿘 0 #>!h" 0>2 " ? `"dŐ D `& D[" 0 2 0> & 0`"㿘>#x> 4U>"a4>""x"x" nfsrcnfsrv cache㿀 < 2  Xl ,  >2Z*  X>a2  >a4* @ q>%> \ X @2g   D 2b       8@   "V   2Ґ  ` ,  "` "@$|$ |"$|   >2dN#2 a,  *$a,   a4$a4  #\#`#dZ     沔a4  $a4 ʰ &a0  $a0 ,   ,  , [0뀤 2 X>\8#>b>#x`"8  4D @ߒ b $b >bx  " %>2  ,  Y bx      `,  "`   "@`"  "`>""| "   @   @"L H /* ' >R *`@ ?2@ H 0  ` "( H /* '`>!x"@> 2` ?* *   >  "@  ?" #?H 0   >R *`@ E*'  , $>b|$ b|""b| ,  X$  8  ` 2  ,  `  @,  8 $  D>a4  X>!42  *   $  X2  *  "`  Xa!42  * " X2  *  $ ,  , Z/ 㿘 < i X>a2  >a4* @ \>#|># X @2Q   D 2L       8@ +  "@      , >2X  X ,  `#,  D* @ "  L >!D@*   T $   ,  沔q $ `,    ,  , YĐ0 2 X㿘>"x">"x` "`  "@`"`$`"@ DK 42>""build > MLEN㿘 >cC   6 H /* '>a` 2`H 0 &&  & 6  ' (8& H /* '5>쀢    쀢& >!x" > 2`  * >a` ?"`  &H 0  " & & (& $ &  6 &   !@!> |h   2 >" .`@h  >" .`@`"   @   `I      $ @  "@`  3   ?& 4,  >cB  2H /* '>a` 2`H 0 """2  & &     & "@` F"`     $ @  "@`  3   ?& ,  >cB9  2H /* '>a` 2`H 0 """2 @ & &      & "@&㿐> ` # \B  4`H /* '>a` 2`H 0 $@$``$` 4` 0 ( 8 cH /* '!>!쀢    !쀢$`>!x" > 2`  * >a` ?"` `$!H 0` "$` $`($`$`$`   4` <`"@$`` D$`$`       $ "   1% , >cA  4 H /* '>a` 2`H 0 $$  $ 4   $@$` ` ` '> `$` >!  >@#>* $"`P>`P  "`P "`P`Ppa#$> Ԡ $>"t $ % I$   a"$b   $b $>!D.@$ $$ f``  ```$` @  "@   7`  ?$@/ >c@  4 H /* '>a` 2`H 0 $$  $ 4    l($@>4`<#0$` ` ? ?` @ $` $ $  $  $ $ ` @ $  `>!7>`  ```$` @  @`  ?@2_` >c@  4 H /* ' 4H 0 $$  $ 4   (5$@H /* '쀢   ) 쀢$ >!x" > 2`  *  ?$  &H 0  " $@$ ($ $ $  4 $@$` ``  ```$` @  "@`  ?$@   ؒ@&` v$`   ?"$` @6` ,`@` $` `  ```$` @  "@`  3`  ?$@ , >c?  4 H /* '>a` 2`H 0 $$  $ 4   $@$` ` ` ` $`  $$ >!7>`  ```$` @  @`  ?@2_` >c?  4 H /* ' 4H 0 $$  $ 4   (5$@H /* '쀢   = 쀢$ >!x" > 2`  *  ?$  &H 0  " $@$ ($ $ $  4 $@$` ``  ```$` @  "@`  ?$@   @&` v$`  ?" @6` ,`@` $` $$ d$@h%  (l% #㿘   " ?R"` $_ @`2`Y @@@$,@"M H "@` 뒔$@ה$@$@`<  B>```"&`@`8 @`@?&``&@"@@`""`&4`&&6 @&㿘m@`? ?">!3>       $ @  "@  ?$ n >c>s  4 H /* '` 5`H 0 $$  $ 4  | "5$ H /* 'a쀢     a쀢$ >!x" > 2`  * ` ?%`  &aH 0  " $ $ ($ $ $  4 $ %     $  @  "@   ?$     곒 $  $ $  <` B>  "a& @"@&`"M"`$N       $ @  "@   0   ?$( >c=  4 H /* '>a` 2`H 0 $$  $ 4  Ȓ $ %   @*@` $ '  ''@ nfs S too big㿘 & &@&@'@` d] H( >:\Ґ!>c=b  4 H /* '>a` 2`H 0 $$  $ 4  i & $ $" $  '@ "! H @  ֤ $@ @$ "$ ``怤 $ & &@   "   H &" "@㿘       $  @  "@   ?% ? @ "@ `  % 銔& % >!/> >c<Ȕ  4H /* '` 5`H 0 $$$4 ђ l(5H /* '쀢   ^ 쀢$>!x" > 2`  * ` ?%` %H 0 " $($$$  4 2(  l d$ %  "@`   ?$  6   ?"@@$ &~&  &@ 㿘>"#l> "bt>" > "#$>""d>"#>" >"!P>" > "a|>a""a>% I"`8>""8>" >?"`8>!0 @ d!> $"$">ϐ!8 L"@<"@>"!!" @  >a 2>>bp"bp" >c>b! > />  #a>L->"a>"  "  㿈@!``   Db"  T F쀢  > + `*`@D''* H &'>` *  ` < >!2` @4'8*`" *  * ''`28" 8$|`$8> $8? >`8$|$ |>b$|$2&`&&`&`( o6`,&`l&`T&`X  <`(!&`86`. &`0&`4&`@&`D"&`H&`p &`t8&`<<&`L@&`PL&`\P  &``&`h+>`x6`. &`0&`4 >`@&`H *  :>`p(&`<,&`L0*`" *  * &`P&`P$ @<$ 4$ 8@  $ << P ` 2 `@> 2 `  8 `2  ` @( `<  >``@M>>`> h&`疔 ``$!"`&$`&(`" `&,`&0 㿘 |'>h  `" h  @" h @" < ;h @" >`\> `\>`\`  B"``\ "`\ @   ( D @ ( 2 @  8  2 `  D@(` <` @<  @ؐ< & ` $!" &`$ &`( "  &`, &`0 㿈\`d h :S$$4@ @ $ " "v H "K` `/2,h   `@,'@ ?"& &2O` `$ $`$`0#\#`@H2=``8 "` 3  2`$`$`#`!$`$` 2 ``@@`  YdR  $@d$` `:     1"   + ( 0$ , " "    (  #2" 㿘\@`J@      $ @  "@`  3   ?$ ,  >c9e  2H /* '>a` 2`H 0 """2 l $ $     >` $ X"      $ @  "@`  3   ?$ -  >c9  2H /* '>a` 2`H 0 """2 $ $ $    >"8`$ ""","0"4"8 "$@'@@㿘`J`  ```$` @  "@`  3`  ?&@ , >c8  2H /* '>a` 2`H 0 """2  &@ &` ` ` >` &` M#@`  ```$` @  "@`W  3`  ?&@ W, >c8p  2H /* '>a` 2`H 0 """2 w &@ &` ` X`` >"8X&` @#@&'㿘V`&`& ` & L )>@`x*  &` /&`&`&`H&`L& `F&$`G&(&,`&0&4`&8`$&<`(&@`,&D`0&H`4&L`8E&P>@ T*`@&@`2>`>a@!`*`@ &`&` &@ 2`D?& "@N`H& `&$`&(`$&,`(?"&0@ɒ#&0`,&4`0?"&8@#&8`4&<`8?"&@@#&@㿈\`&  N F `$ Dh )0" 16  d&&R  @66   `4 6 `"S @6   $@$@` >c8'c8'* @@     @`?㿘 $@נ@2 1>F (`4?:! T7G &` &@ " $  "&` ?ဦ2@` 4@6$ @! T7& "`@ "@@" &@"` 4@`  &`.  @H( 2 0` $`$``$"`$2H L`Q D?>Ї(R   P " P  R# @ > @    @*:* *  `㿘@ P 6@ &` &` 6` V  @6 V` `"V @V` ʐ`0 < '' D''@''ؐ@  `<'`@'  `(€Ӑ `O nfsd init㾘  a` "@ '>%>Ah !`  K;$!`!` h@ !@14` / D''''J'$@ " `! @"@ @  $@ `@+  `  &`' @ܰ`Ŕ |@ À @  0  `@֤ *  L  `@2  <      9     2  2@> 0@6 0`$@ | 35 0  6 3}@2$  `"  "`   "@` "`$  "  "$  $  `  PT $  4 $ 4 `l$ l`p $ p>`h`x`t x $ h < "$  ` 2   $  ` 沐 $ Ḕ <D $ $ $  "$ `@F *  L  $ `@= *  L "` `@5 * " L`@/ *  L$ Ḑ o``L @"`L@  @"` $`@ߔ ? 㿘  R    >" 0 "TS T   !!t "TA0 22  >c4Ŕ  2H /* '>a`$ 2`$H 0 """2 ̒ ?c  #@ ]"  ` 254RR` 214R >c4  2H /* '>a`$ 2`$H 0 """2     # %" 4R4vP t 4P ?4t! 24S @!$``$` $@>bl$`bl""bl$`$`  4 $`H /*!$>1 0$| $`0ŐH 0 nfsdmbuf siz=%d Bad nfs svc reply㿈''   H /* ! ! 44 &@M!%%>al%al>"8"al "8 2  #>! 2 !>!>C@  4`% H$ 4 4 ?$ 4 >!  2 >! >"h 0 ` " 202 >a ?"a "0 Y  @D&0 &D%  ?&04 쪔 4>`h ; 0(@ (@b2`* @ *` b2*@*@D4`, @`h`,`: @E " H`" @ 8  2 `      % 0   "% 4` T'H 0`   W@4`v>`h`<"```h`"`d"`8"`8 # ?%`8  &&\`&d  h    | ݮ >ϔ>`< >>`h@4>>@ " >`h>b"@ " `<>`< `L 2`D  "`D!"`T > "`@   ?%  "`D "`TP>*(􀤠 D >"x  >`<  3 > Dc+    D >`\a "aŒ  < "0> Da+   # " ,     !@ >C#HR>CQŐ#X $ .$   2   ?" 4  ?"    ?$ `$    "    "   $   "@琒 0  `<I  ># @.<`KH /* '>R`a*`@?2@H 0 <` *H /* '`>!x"@> 2` ?* *   `< >"`< "  H 0  <>R *`2@  ,  - @ S ?2 T@=H /* !p # @  , < >2 T'>`h;3`+ +`@ b 2`* *` b2*@* @ 0(@`h`(: @EH /* !H   8  2       H 0H /* ! 떔 "D%  @%<`""` Q>"!l"@H 021 4>`8&? "`8@ 㿘 0  ? & 0&   d" |"X  `GH /* '>R`!*`@ ?2@ H 0  ` "( H /* '`>!x"@> 2` ?* *   >  "@  ?" #?H 0  >R *`1@ & $ $  ! ` "`   "@` "`&  "   1 3@2 H /* ! H  "$$$ $$   T1"2 & HH 0㿘 D? & D 0 `"  "`>""l "@1k 2㿘>a` " >AO" "a`>"h "h 0 .` "`&   21E"@2 01>&"h"h>`$` `"` "`F>"!h!h" ! 2>! 0 #!!>$"@ T!""``"` "h "@"h" $`! 2 >!>$"h"h/"#>$a@ :!a"``"` "@ "` "a$  >* (    `2 L" L" D" D" 82"">`h ``h"*  ( ( d( " `h">"b   "bnfsidl㿘 ? >Θ"  @ "  `> "  ` "`>! >쀦 !>Ϣ!8,$! >HDk >a` "$>!`U !  ```"`%``"@`$@"`P \ 8aH o*@ e 0   $  2 % $ $ $0 H 0 ? $ P $ $ P`4 "`4 `X 2`Pa`2` >>ΐ","@>`?"`nfsauth1nfsauth2㿘 @\@$  >I>0C*`<!E@! T + .$&$ Ȑ!$ $ @$  E.$ @` `;>I5> Ē 0`C*`<@  `  *@$ P "  / T*@$` ' Д :$@*@ @$*@$D 㿈` C@ *  쀦`>` ```2``>`h`h 6@@ ``"`& `@"@&@  &`  T"& .G  "`t "& &'>h `l  hh 2 `p`p@ h&`l&`p &`p`l'`p '' '' x '@ \}'``  "    ' ܖ2} '> h' '' a,m > 0@6  `&  | 3- `"  "`  "@`"`& "@&`&> hg&hx&l &pn&t& & "& `@ ͒ C*  쀢  &`@ Ē C*  "` `@  C* " `@  C*  & ``  "  ?   '| ~''@nfsbuild > MLENh'  Lv "3 ` 5 @`@`>`\`  "` D %`'| R `  ?   $  @  "@  c|   ?$4[|  $ @  "@   9  ?"1 >c-  2H /* '>a` 2`H 0 """2 }  l(>JLU!"'" '` "` |R '"? "?|`R`V `R`ԒP0      $ @  "@`  5  ?$ . >c,  2H /* '>a` 2`H 0 """2 | "'" '  " ` |' .#\#` ۂ谒"` .`'  '@"@   ' Әܖ   ؒm y ؀ 耢 t}f`` ` " 3`  `4''  4ܖL 6@6`  8 `%&`"&`?Д "@h&`  ?Д "@`&`?Д "@X&`c &`$  &`&`&`  &`&`&`&`@ `Lh؉ Z’`؅ Z`<@@ }=R2 p  D>`\` #``| 'R`  ?   $  @  "@  e`|   ?$4]`|  $ @  "@   9  ?"1 >c+  2H /* '>a` 2`H 0 """2 {  l>JJŐ!"'" '` "` `|R '"? "?`|`R`  `R`B#\#` >찒"x .  '@"@   ' 푘^   ܒ+ P M  @"@ /0  ' 0j7 `@a >$` ` $`$``@a >$`` $`$``@c <$`` $`$`@ $@|$root/root on %s nfs_mountroot: vfs_locknfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapswap on %s nfs_mountroot: getattr for swap>h>`;  <"hА@!(~>Ma !>Ma( @l>M!0J >>MI!@@$`$ @ 2`"@">""D$ P#>c p@>l'P'T'X'\c'`*` @#! >MI!X@H 0&>>"Pb ">>MI!x 䀢 >MJd!0 >Mal~Ĕ>Ma @Dl>M!JR|l "`8"@$  'P'T'X'\c'``* @@P >MIP!ذ *2 @ 2 $nfs_mountroot: malloc mount for %snfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %dP!  ) >N pI@! > H$ $ @ H'  ' ' j'Ĕ 'Ȕ ' z='̴>N H @& @T>N Hnfs_args: retrying connect nfscon㿘H /* !   ` @ `?* ? @&H 0 `  `,`>!0>@7b@ @0 @& d& d, "* @4& d` " ``0  d& h d& h`""`  ` " `  > & "&   @  4&   4& ` " `$  > & "&   @  4&   4& `@" ``(  <# & $` "  &  4& ` "``4 (& `@"``8 (& `@"``< :(& `@" P`@ (&  P Զ T 3>N#>!>N!  Ha`< "= @} H 2O " I K@@! ?   '6 ] 2/P Y 2% Z @$  Y 2@ @$ \  2 'Đ@`@@!y|  (' @o!&a$  $ >JY!-$  ! &`>!0>b@$ $ d $ h$ $ $  $  $  $  $  $ $  $ L   Ԩ6```X@@Д `Ԟ Z`hԚ Z$ `r $ T  T`$ X` !&`$ L}ۖ> '@>  ?x'''`* @@x  Ȑ(˒ y#nfsdism㿐6`` L} A T` $8   ` $'>1>P< !(<  <>" *@$e @$0|x `% (y  㿐! L}b  `8   "`8 "@&@ x   0'>%> '' * @@ 2 $ 0 " $U  ''''' * @@؀ 2 $ 2  -    -㿀  ږ#\#`  .x_build > MLENp` "  `8    `F `@  H>`\`P #`P|`'R`  ? ``$`` @  "@  e|``  ?$@4]|  $ @  "@   9  ?"1 >c&  2H /* '>a` 2`H 0 """2 v  l>QEΐ 8"'" '` "` |R '"? "?|`R`  `R`Kw0  $ @  "@`  5  ?" . >c&"  2H /* '>a` 2`H 0 """2 v) "'" '`  "` ' a8@  `2 `@2  "2 `@2 "  #\#`"I .  '@"@  ' :"w* 0.  ܒӖ 쀦   @"@   '  2 w0@<.   | 8 `!" !4> h`@$ !  @6   !" 2y` `@ `$`@` f   v՘  c @` Y<`` )   vĘ  "R @ސ$` 8 2   <` > c''''c' * @@ 5- > c''''c' * @@ "`Ā@" 8   <`   v}    @$`!"$` 㿘  `8 $`|`!      @9   4    vM $   ?4   x|!c "d2ݐ ` >`\`D  "`D D s`'| R `  ?   $  @  "@  b|   ?$4Z|  $ @  "@   9  ?"1 >c$]  2H /* '>a` 2`H 0 """2 td  l(>QC 8"'" ' " |@R '"@`? "?|VR`R`#P0l      $ @  "@`  5  ?$ . >c#  2H /* '>a` 2`H 0 """2 t "'" '  " ` |' }  #\#` .  'Ք u㿘`` @  ?| ?2 ?2 $?2  ,?2  ?#@"     ?28 ?"M ,8?`(>T"*`@ R0 R8 R8 R R8 R8e  ,? $?? #@  ? ?P ??7<   G      `  `  `tŘ 4 <@<@ ` ?28 $?"` 8  `  `t  2`  ` `@ ?2<@ ?<@<@dp>`\! `H  "`H D<  Ȗ'|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >c"  2H /* '>a` 2`H 0 """2 r  l(>QA 8"'" '` "` |R '"? "?|`R`V `R`wP0`  ```$` @  "@`  5`  ?$@ . >c"P  2H /* '>a` 2`H 0 """2 rW "'" '  " ` |' ?`#@P  $ @  "@`  5  ?" . >c!  2H /* '>a` 2`H 0 """2 r "'" '' >"8`" "`M"  $ @  "@`  5  ?" . >c!  2H /* '>a` 2`H 0 """2 q "'" '' > `" "`?P  $ @  "@`  5  ?" . >c!^  2H /* '>a` 2`H 0 """2 qe "'" '' >"8`" "`M"  $ @  "@`  5  ?" . >c!  2H /* '>a` 2`H 0 """2 q "'" '' > `" "` ?P  $ @  "@`  5  ?" . >c   2H /* '>a` 2`H 0 """2 pȒ "'" '' >"8`" "` M"  $ @  "@`  5  ?" . >c s  2H /* '>a` 2`H 0 """2 pz "'" '' > `" "`?`?"S  $ @  "@`   5  ?" . >c   2H /* '>a` 2`H 0 """2 p' "'" ' ' >"8` " "`"`L"  $ @  "@`  5  ?" . >cД  2H /* '>a` 2`H 0 """2 oג "'" '' > `" "`$> h@R  $ @  "@`   5  ?" . >c}  2H /* '>a` 2`H 0 """2 o "'" '  ' "  "`$"`("  $ @  "@`  5  ?" . >c-  2H /* '>a` 2`H 0 """2 o4 "'" ' ' "  L"  $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2 n "'" ' ' " "`,> h@R  $ @  "@`   5  ?" . >c  2H /* '>a` 2`H 0 """2 n "'" '  ' "  "`,"`0"  $ @  "@`  5  ?" . >c@  2H /* '>a` 2`H 0 """2 nG "'" ' ' "  L"  $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2 m "'" ' ' " "  $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2 m "'" '' > `" "  $ @  "@`  5  ?" . >c]  2H /* '>a` 2`H 0 """2 md "'" '  ' " ?`#28>  8`2>>!!*`@ $`?2$ > 8$ ` ?2$ > 8$ `$ `$$ `(?"$ @#$ `,$ `0?"$ @#$ #\#` 찒"i .W  @"@   ' SN >b8   @"@  ' 83   '@"@   ' !  ܒ໖  'ؐؒఖ  m    ! @ % "  "8? e 8 a |'`F ` D>  4{  23%,>  c''''c'* @@ | @> \ `"   @  (%  Ӑ%>\  L`"  "L ` ? H $ ߖ|'x| R `  ?   $  @  "@  xc|   ?$4[|x  $ @  "@   9x  ?"1 >cɔ  2H /* '>a` 2`H 0 """2 kВ  l(x>Q; 8"'x" '|x` |"` |R '|# ? "?|`R`V `R`xގ|P0W      $ @  "@`  5x  ?$ .x >cg  2H /* '>a` 2`H 0 """2 kn x"'x" '|x | " ` |'| ``l ?x ?` $ @  "@  xbx  ?"Zxx  $ @  "@   9|  ?"1 >c  2H /* '>a` 2`H 0 """2 k  lx>Q:? 8"'x" '||x '|" # ? "? q  |  p l t#\ɼ#`".p~ . (p  'dl@"@    'l  hta h [dplާ tS Pd l  @"@    'l ht: h  @pt0 H p`` l "   ?  @  'lplĘht h }``z @xR`2 `@ 2kt$ p1`y`M p  '\l@"@    'lpl ܊htް h  \pl$ tа \p  'Xl@"@    'lpl dht h Xpl t 'TTpl t T%k8t  R`2`@9 2  4o``kt0 Np  'Pl@"@    'lpl htd h  Pplݪ tV Pp  'Ll@"@    'lpl ht> h Lpl݄ t0 L'HHplw t# H  @"  (%  @"%  @2 %` \v# %tj ""  2 @ 2   ?   @ (% 㿘  8 2    e 㿘 8 2    e p`>!`\`T  "`T D  ձ'`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 h  l(>Q7 8"'" '` "` `|R '"? "?`|`R`V `R``P0      $ @  "@`  5  ?$ . >c9  2H /* '>a` 2`H 0 """2 h@ "'" '  " ` `|' ĺ `#\#`"X .&  '@"@   ' _<   ܒ . +  @"@   ' 8  H ؙ䖒 ip ` ``< B!  "Ѱ h0h H0h 0ŀ>!> \ X`" X , P @'`| R `  ?   $  @  "@  a`|   ?$4Y`|  $ @  "@   7  ?"/ >c*  2H /* '` 5`H 0 """2 g3  l(>Q6r 8"'" '` "` `|R '"? "?`|`R`V `R`QhW0+      $ @  "@`  3  ?$ , >cȔ  2H /* '` 5`H 0 """2 fђ "'" '  " ` `|' K  $ @  "@`   3  ?" , >c|  2H /* '` 5`H 0 """2 f "'" '  ' " `"` ""` """ `#\M#`" .;  '@"@   ' ؞  ܒ: ܀   @"@   ' |~ 'ؐؒ q  @"@   ' \^S  䖒Og=$ 2     E>nfs: writerpc iovcnt > 1X''' ` ! @` ">b5 ! ``=  B {  r f ǹ j>!> \ \`" \` ? X 4 F'|`R `  ? ``$`` @  "@  a|``  ?$@4Y|  $ @  "@   7  ?"/ >c0  2H /* ' 5H 0 """2 e9  l(>Q4x 8"'" '` "` |R '$ ?"?|`R`W`R`Rf]`  ```$` @  "@`  3`  ?$@ , >c͔  2H /* ' 5H 0 """2 d֒ "'" '  " ` |' PS  $ @  "@`  3  ?" , >c  2H /* ' 5H 0 """2 d "'" '  ' " `$` $  $ N$  $ @  "@`  3  ?" , >c.  2H /* ' 5H 0 """2 d7 "'" '`  "`  ` '$ $ $$ Wg` Ԛ#\#`" .   @"@     ' NE>b8   @"@    ' 5, |   `?  '@"@    '   ܒ״ ܀ a  @"@    ' ` @6@@$ " "@@ `;  "`` @ b `>` &` 2@ " @# ` @%@`Ԓ@   Ē   'ؐؒO ؀|`T"`d% >̀  &`X  !` "D >b''b'* @@q -> 8> \ l`" l   ? T 0  <  ϸ '|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 b  l(>Q1 8"'" '` "` |R '"? "?|`R`V `R`g䰒P0-`  ```$` @  "@`  5`  ?$@ . >c@  2H /* '>a` 2`H 0 """2 bG "'" '  " ` |'   c{۰ ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >cє  2H /* '>a` 2`H 0 """2 aؒ  l>Q1 8"'" '` "` '?" "?H  ԗ䰒_   $ @  "@`/  4  ?" /, >co  2H /* '>a` 2`H 0 """2 av "'" '` 0 0"` >`x*  '">"8">` /""" " "$"("" ,"$0"(?   $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2 a  "'" ' ' " F"Gp"  $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2 ` "'" ' ` "  `'>a@>!*`@ $> 8$ $ $ $$ (?"$ @^#$ ,$ 0?"$ @U#$   #\l#`+ .    Ԓ@"@   'Ԑ ҼЖ   `G !  Ԓ@"@   'ԐؒԔ ҞЖ   @ H `` Ԑ "   ?  @  'Ԑؒ|ЖͰ f̖ð  2  Ԓ@"@   'ԐؒԔ XЖ Ѐ`"   Ԓ@"@ S Tؒҵ T 'Ԁ`'Ȓؔؖ  Ȁ` "/  @ǚİ  h  Ԓ@"@    'ԐؒԔ ЖS >b8 "  Ԓ@"@   'ԐؒԔ Ж7 Ѐ` |  `?  'Ԓ@"@   'ԐؒԔ ŘЖ   ؔ_  `` " @d&@1 |`` 2`|" 㿐   h``` ' !  @  b`ؖڰ> \ ``" `  ? L ( <  ˮ'|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 ^  l(>Q-ސ 8"'" '` "` |R '"? "?|`R`V `R`]P0`  ```$` @  "@`  5`  ?$@ . >c6  2H /* '>a` 2`H 0 """2 ^= "'" '  " ` |'   _qͰ ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >c ǔ  2H /* '>a` 2`H 0 """2 ]Β  l>Q-  8"'" '` "` '?" "?>  ЍQ  $ @  "@`  5  ?" . >c d  2H /* '>a` 2`H 0 """2 ]k "'" ' ' " "  $ @  "@`+  4  ?" +, >c   2H /* '>a` 2`H 0 """2 ]" "'" ' >"8`," " >` /""" " " $" (""  ,"$, 0'p"(  $ @  "@`  5  ?" . >c   2H /* '>a` 2`H 0 """2 \Ò "'" ' ` "  `' >a@>! *`@ $> 8$ $ $  $$  (?"$ @b#$  ,$  0?"$ @Y#$   #\p#`+ .   @"@   '    `G!  @"@   ' ΢   @ H ``  "   ?  @  '΀Ͱ bܖð  2  @"@   ' \ `"   @"@ S Tι T '䀤`'ؒܖ  ؀``"3  @˚԰ h  @"@    ' S >b8 "  @"@   ' 7  |  `?  '@"@   ' ɘ   Вc  Ѐ\ `  2 @}g`" 3 |` 2`|" nfs_remove: no namenfs_remove: bad v_usecount      $`|>l*`#T`  >l*Y# 1>  c''''c'`* @@ 2W $}   \S       @# "     2 @}  ǒ $53㿘   @ p`>!`\`p  "`p ? H $ c'`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >c M  2H /* '>a` 2`H 0 """2 ZT  l(>Q) 8"'" '` "` `|@R '#@`? "?`|`R`V `R`P0J      $ @  "@`  5  ?$ . >c   2H /* '>a` 2`H 0 """2 Y "'" '  " ` `|' l[' ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >c }  2H /* '>a` 2`H 0 """2 Y  l>Q(Ð 8"'" '@ '@# #@`?@ "  D~#\#` @찒"6q`| .h  @"@   ` ' ːS @>b8 "  @"@  ` ' t7  `|`  `?  '@"@  ` ' S @  ܒ  ܀Z.`|` 2``|" nfs_rename: no name㿐     `$  $2 >o(!@2:  "  @ 1 " T  $  | 2  @J 2    `` `#\`#`@6 8`   8 {{ ѐ ِ̐א " 㿐``` #\` #`@p `>!`\`x  "`x ?` ?  H@ '`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 W  l(>Q'+ 8"'" '` "` `|@R '#@`? "?`|`R`W `R`ʪQ0      $ @  "@`  5  ?$ . >c  2H /* '>a` 2`H 0 """2 W "'" '`  "`  `|'`  M ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 W  l>Q&^ 8"'" '@ '@# #@`?@ "  ߖ4|R   ?` $ @  "@  c|  ?"4[|  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 V  l(>Q% 8"'" '` "` |@R '#@`? "?|`R`W `R`_Q0  $ @  "@`  5  ?" . >c8  2H /* '>a` 2`H 0 """2 V? "'" '`  "`  |'`  ``Ws` ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >cɔ  2H /* '>a` 2`H 0 """2 UВ  l>Q% 8"'" '@ '@# #@`?@ "A  Ȑ#\#`` \찒"6`| .  @"@   ` ' ܘ @>b8 "  @"@  ` '   `|`  `?  '@"@  ` ' ǟ} @` ܒ9 o ܀  @"@   ` ' uS @>b8 "  @"@  ` ' Y7   |`  `?  '@"@  ` ' 8 @` ؒҖ  ؀ V`|` 2`|` 2``|" |" X     @  b     > `''' '`'* @@>`\`| "`| `  ?  D ,ܠ`'| R `  ?   $  @  "@  b|   ?$4Z|  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 T  l(>Q#\ 8"'" '` ܐ"` |R '"? "?|`VR``R`ܒܰP0@      $ @  "@`  5  ?$ .ؐ >c  2H /* '>a` 2`H 0 """2 S "'" '` ܐ "`  |'` 6 `|R   ?` $ @  "@  b|  ?"4Z|  $ @  "@   9  ?"1 >cI  2H /* '>a` 2`H 0 """2 SP  l(>Q" 8"'" '` ܐ"` |R '"? "?|`VR``R`ܰP0s  $ @  "@`  5  ?" .ؐ >c  2H /* '>a` 2`H 0 """2 R "'" '` ܐ "`  |'` i    T#! ?ؐ ?` $ @  "@  c   ?"4[   $ @  "@   9  ?"1 >cy  2H /* '>a` 2`H 0 """2 R  l>Q! 8"'" '` ܐ"` ' ?" "?     ?ܰ   #\;#`"`6  .`  '̒@"@   '̐ ċȖz  ĒД% ԰ k   ̒@"@    '̐В̔ dȖS >b8 "  ̒@"@   '̐В̔ HȖ7 Ȁ |  `?  '̒@"@   '̐В̔ 'Ȗ   Д  S  |` 2`|" |"  " h```  >!`\`h  "`h`@u   ?`  L (@`<`  ,'| R `  ?   $  @  "@  c|   ?$4[|  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 Q  l(>Q \ 8"'" '` "` |R '# ? "?|`R`V `R`ےP05      $ @  "@`  5  ?$ . >c  2H /* '>a` 2`H 0 """2 P "'" '  " ` |' 5  ߐ  ?` $ @  "@  c   ?"4[   $ @  "@   9  ?"1 >cI  2H /* '>a` 2`H 0 """2 PP  l>Q 8"'" '` "` ' ?#  "?     k_  $ @  "@`+  4  ?" +, >c  2H /* '>a` 2`H 0 """2 O "'" ' >"8`," "`>` /""" " "`$"`("" `,"$,`0'"(Q ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >ch  2H /* '>a` 2`H 0 """2 Oo  l>Q 8"'" ' '" # ? "?`  `/j  $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2 O  "'" '`  "` `>!@ > 8&& & & `$&  `(' @ֵ#& & `,& `0?"& @֪#&    #\#`" .   @"@    '  `G!  @"@    ' ٰ   @ϰ H ``  "   ?  @  'Ҙ TWܖ  2  @"@    '  `"   @"@ S T  Ty '䀤` 'ؒ. k   @"@     ' nS >b8 "  @"@    ' R7 ` |   `?  '@"@    ' 1   Ԓ˖  Ԁ`O "   |`` 2`|"  " h'   >!`\ `d "`d` ? H $` <  <`'|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >c&  2H /* '>a` 2`H 0 """2 M-  l(>Ql 8"'" '` "` |R '# ? "?|`R`V `R`P0`  ```$` @  "@`  5`  ?$@ . >cĔ  2H /* '>a` 2`H 0 """2 L˒ "'" '  " ` |' E``Ng ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >cV  2H /* '>a` 2`H 0 """2 L]  l>Q 8"'" ' '" # ? "?Β  ```  $ @  "@`+  4  ?" +, >c  2H /* '>a` 2`H 0 """2 K "'" ' >"8`," ">` /""" " "$"("" ,"$,0'h"(  $ @  "@`  5  ?" . >c  2H /* '>a` 2`H 0 """2 K "'" '`  "` >!@ > 8$$ $ $ $$  (' @F#$ $ ,$ 0?"$ @;#$   #\R#`6| . `  @"@    '   G`!  @"@    ' ۰   @Ѱ H ``  "   ?  @  'a Pܖ  `2  @"@    ' = "   @"@ S T T{ '䀥 'ؒ m ؀`h  @"@     ' S >b8 "  @"@    ' ߘ7  |   `?  '@"@    '    ԒX  ԀK|` 2`|"   "|  @ 3а  8 2   " |"  |{p   `! @ "|l|j  > \ t`" t   ? H $  '`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 I  l(>QՐ 8"'" '` "` `|R '"? "?`|`R`V `R`TP0L      $ @  "@`  5  ?$ . >c-  2H /* '>a` 2`H 0 """2 I4 "'" '  " ` `|'   Jh ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 HŒ  l>Q 8"'" '` "` '?" "?5  ~  #\#`" 6q . h  @"@    ' ИS >b8 "  @"@   ' 7 ` `|  `?  '@"@   '    ܒ-  ܀`In `|`` 2``|" jjztzr " nfs_readdir: lost in space   8  |  4  R N @4I@2 @A = !!"  |> h@$@+ྀ '>`\`  2"`> c''''c' * @@ Ā@ >`\`  "`  D  2G  >`\`  "` :"@27`"3    > P"@:`   @ E# `@ "@$ "@"""nfs readdirrpc bad uioEEK! readdirrpc resid > 0 `` `| ! `   b`  >``#">g#@   >& !''􀥠瀤>`\`  "` D" '`| R `  ?   $  @  "@  a`|   ?$4Y`|  $ @  "@   7  ?"/ >c  2H /* ' 5H 0 """2 F  l(>Q 8"'" '` "` `|R '# ? "?`|`R`W `R`e찒RGː0      $ @  "@`  3  ?$ , >c<  2H /* ' 5H 0 """2 FE "'" '`  "`  `|'`  T  $ @  "@`  3  ?" , >c  2H /* ' 5H 0 """2 E "'" '`  "`  '# # # J#  $ @  "@`  3  ?" , >c  2H /* ' 5H 0 """2 E "'" '`  "`  '#   #`#\s#`" .?  'ܒ@"@    'ܐ Ęؖd  Ԓa YԀ   ܒ@"@    'ܐܔ ؖC& &F0N  ܒ@"@   'ܐܔ ؖ'〤  ܒ@"@    'ܐܔ nؖ ' '  ܒ@"@    'ܐܔ Uؖ: ?  `" "" @   4@@ "@@`; " "`` @ B `>`" &``@8 =@4$,", ```B >`@&`@ "@@``? "`uܖ@*@@$"@@`""``< @ B `>`"&`  ܒ@"@   Tܖ|'܀  ܒ@"@   'ܐ   ܒ@"@    'ܐܔ ؖU؀ '  '"       ܒ@"@    'ܐܔ ؖ,`?Ez䀤  ""@ 4@ "@ " "`;  B`>`" &`" ``>EV H0ER 0 >/#X`  x ""nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 't    '\`'l|!`'d` c  >``#"'>  `  7 >K ''T'\  \>`\` U#`| 'R`  ?   $  @  "@  e|   ?$4]|  $ @  "@   9  ?"1 >cA  2H /* '> 0H 0 """2 CH  l>Q 8"'" '` "` |R '# ? "?|`R`  `R`  $ @  "@`  5  ?" . >cޔ  2H /* '> 0H 0 """2 B "'" ' "  '# #` #` #dघ ## `tT #\#`"I .  '@"@    'T       @"@    ' ٘'` '`  \  @"@    '  '  '@"""`@   5@@ "@@`; " "`` @ B `>`" &``@8'\\A@5%-"- ```B >`@&`@ "@@`?"`@& &Ֆ@,@@$@"@@`""``<`@ B `>`"&`  @"@   `'  @"@    ' &J\" ' '  ``  "S  T T,'  @"@    ' L  @"@    ' ۘ``@  @"@ ` ?    'W`2`@˷ 2'|  5G7||  ^x'x '>'>''| (a*   x2 -l@  & @W` @@& 3lc9,  @"@    ' [  @"@ ` ?   l'sK   @"@    ' ,P Z\   @"@    ' 6`?B \ ""@ 5@ "@ " "`;  B`>`" &`\"``$?`Aܐ!AAӰ HAΰ  > А`   ""rΐnfs: sillyrename dir.nfsAxxxx4.4㿐b`|`8`'>"ؐ  '  &@&``>`4`"0` ˔  &` >` , .`<   .`<   4 .` .``` @@' 籔`@@ " ` .`* :  z ri`!@ h`|`>!`\`L  "`L ? H $ '`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 ?  l(>Q̐ 8"'" '` "` `|@R '#@`? "?`|`R`V `R`KP0      $ @  "@`  5  ?$ . >c$  2H /* '>a` 2`H 0 """2 ?+ "'" '  " ` `|' @`Q ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >c  2H /* '>a` 2`H 0 """2 >  l>Q  8"'" '@ '@# #@`?@ ".  }֐#\#` y찒"`ɀ` . 쀤!  @"@  ` ' Ƙ @``@ H ``  " ` ?    ' @`"%U R` @ '܀`@4 `, T`R @ ܀`@ T "`ܐ` 2 2` @r 2``  4Cܰ?U0V 4  '@"@  ` ' I+ @  ؒ  ؀ @ ?"p7! 'ԐԒʖ  ?`@  p0'@h ?!@@ l   D>`\` M#` |'R`  ? $ @  "@  e |  ?&4] |  $ @  "@   9  ?"1 >c9  2H /* '>a` 2`H 0 """2 =@  l>Q  8"'" '` "`  |@R '&@`?"? |`R` `R`ߐ  $ @  "@`   5  ?" . >cՔ  2H /* '>a` 2`H 0 """2 <ܒ "'" ' ` ' &@&`&`#\#`䰒" .  ܒ@"@ `  'ܐ ؖj @>b8   ܒ@"@  'ܐܔ ؖO   'ܒ@"@  ` 'ܐܔ ̘ؖ8 @  Ԓf * '  ܒ@"@  ` 'ܐܔ ؖ ش`Ԑ@Ɯ  ʔ !1=㿘  "  ``$ @X:` $ nfs physio/async㿘  $`  > X# $  >  $@" ` \ $ =’? >  㿘    @ nfsfsyncnfs_fsync: not dirty''' 't??  'd @ !'l |'|'*  ! !"a `^H /* % 0 L @ G  $ 2?X}d`2 ` `@-?'d- $% $ " H ; 2`* @ *`  T:  @ 2 X( X X T" :  @   H 0`d d'@' @# -`? H ` :`2*  *  T X :"@  :`@2`@-`!1   @%?#?!-`? $ % $" 4Y`& 4 $% X% $ $% T % $lR\=`@-`H /* % 0 h @ +> $ , `2Zl`2V> $ t " $H 0`| J>!0 * 't $ l>  ؀`` $ 2"Wl`` $  $% $H 0a'' Pa`* @@0 H 0l`"'l3 `) 4>t$Z&" 4| 逥2 4>!0 * 't 4  4 0 `Z`  ?`0` 㿐     |  #\a tag VT_NFS, fileid %ld fsid 0x%lx 㿘  |<>8 ^#p 8 2>> U#  - - - - -㿘 @  bwrite: buffer is not busy???㿐 $  $>` > F (` $?! @& $` Pk; @@`0 "`0@  P @4 `4"4 H P :`2*   T*  X@ T :` $ @  `#  @ & $ $@*@& $ & X& T $ & $Z !1  P  `> $@ & $>'' P`* @@`2 Z` Pjِ0`0 "`0X_       "   8    2   > c''''c' * @@ 2  o 㿘 `|ྒa2>`h"਒`h`*"@ *`@ *`">c>*` @㿘 `|ྒb2>`h"ఒ`h`*"@ *`@ *`">`>*` @  |#"H>$0P B>  =>>!А! ? ? ? ? (? 0? 8? @? H? P? X??!"''"" '' > c''''c'* @@>#,>b* @@㿘 `|ྒa2>`h"਒`h`*"@ *`@ *`">c>*` @㿘 `|ྒb2>`h"ఒ`h`*"@ *`@ *`">`>*` @  |#b! > h  h *`" *  *  " > h  h *`" *  *  $0P B>  =>>!А! ? ? ? ? (? 0? 8? @? H? P? X??!"''"" '' > c''''c'* @@>#,>a* @@file system full %s: write failed, file system is full 㿘'@` 02  Ā D   <  ( ` ̡, @& @ d$ 1> @@֖ " $26 2 `@p @>@L"  `>  `$`a$`'@> @@  >@ > ! ԰ dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevbad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim㿐\%` `<``(```̡, @ē @) d$ .` 2 >! `0`>!ؒ?T '= @@) "`V0@@`dH,@ >i!$W0$$c`$6 `'>`<`*@8`(@Β `̀@# >bȔ`$``<`(@'@ d`̀@`0 >b8`Ԑ  $`"h`>'">@T"$,`d,"`H@T@ `T&? @ "@<  $V$$<"$@֐ %':` @? U}`>@ > `԰  `|$   d  @HD:@@M- @H:@D 2 Ȕ@7o 2 @7g 2  * @*`@ @ ?0S s  <@2` *` * ?  `?"  0S? I@ <@>@!(9,` @ @""@``8@"T@!%@ T @ d,` H0@!:  d`@,"`H8@ @T T mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free 㿈   " |`Ȁ ] < @ 2@b``,@ђ: @--`2>@  T?    >`'''`' * @@3  | X`"  >! `>! >!8`$ >$ @>h  "@h"@@  $ Đ >`@ X>!h`԰ 㿘 , @   @  l p8:*  "ؓ*` 6   &  : @O 㿘 `\@ .? 2X`8`   @``@4 x`8.?   @`@@` `,@]`@`l`p8: *  "ؓ*`   6,$bԔ:  C `l`p8: *  "ؓ*`   6$bԔ: / `X +& ``* *  " `@0 `@ג `8`@Ғ `8 @`D@``|*"@ *`@ @Z*`?@V@㿘  0`, 6 @@6&@  .`,&@ `, @Ւ  ۲``,@"  㿐 plT>@* .@ "ؓ*` " :@4:8? 4°  @] @W.@  ? d Q, <@ "U@  >#Ԁ  > R  h$ @sT> @"U@ ,` :`c ` @ @ ` "@: ٘ 蒃@ 8" !@"U @ ,` :`c ` @ @ ` "@: "T 璃@ T>#*  4" 4#*`@`4 "`4T>3 @"U@ ,` :` ` @   "   * ** $?$ $̘ p$̑>@* l"ؒ.@ *`  ?"  ,R㿐 pl>@* .@ "ؓ*`   202  @ @.@ ?  d , P  <@ "U@ " #Ԁ   >0w> h$ 02 T@ؔQ08>  .`4 28`@ `8@O  R@@w8"@"U  ,`  :`c `  ` ` ?"@ +@*8撆 8 $"@ $ $p@ $̑>@* l"ؒ.@ *`   "  ,Е*4`QR"40T@Ė QJ 6! $@"U  ,`  :`c `  ` ` ?"@ +*@* $"$ $p"@$̑>@* l"ؒ.@ *` ,` @""  ,`4?"`4$@*`@`4 "`4Q@pos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cyl㿘  @` " 8`( @@`"U@c``@ `@ > @#X ѐ%P ͐ |@S@ @`"U@-``T@`T@  @`"U@"`X-` @%P@3@*  |@.@n  @@& @d@  @^%P@@ @ ,`R 4%P`@ %P@,` @ ,` R@ ,``@`,`U $j#X@2 @%@ | `@* %L,#\ %T%P@ڠ* R?2 %L>"Ȓ̖ >ߐ"耢?,`,#\ %T%P@* R@"U`c``@@ f 2* `%L?2%Xe`  >  `: >ߢ "Ȓ ># 8@]6&`(v ,@`"U `> c``@@ _@?`?&` Đ?& `  p l:* * "ؓ*` ?" |@X @@ @@J @@D @%P@=@ @bU* ` -` Ԑ@ `X@*@* ?4@`"U@-` T@`T@ @?"@ . ` @ ffs_clusteralloc: lost block㿐 T.` &  @ @.@   d , N?  <@"U@ Ԁ h.$   @ ``@ $@$@h`.?  @@ `4@T.`Y"@@G"8  @`: l:`* &  *  p@     "p ` *  `@  p@ @w$@ ``. @*@  3>"8xa@@N0O cg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in map㿐 pl>@* .@ "ؓ*`   2  @% @.@ ?  d , MJ  <@ "U@" #Ԁ >N  h$ @9 :`b \   &: W 0` `" : :` @"U@b \ @@` @"U@ " \ @2 @># 0> "  @"U@ \ *  " $ 0*> > 0 @"U@:b \  &   * @* ?$ p$ȑ>@* l"ؒ.@ *` < @ ?" ,  $ p`$>@* l"ؒ.@ *`  " M@Adev = 0x%x, bsize = %d, size = %ld, fs = %s blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockblkfree: freeing free frag㿐  0 >%@> @ >`"   @  0 > p@ $@ >  > @0͐@ڒ   @Ԓ, ?     d K, Mj0<@"U@  >Ԁ >M\ 0 h$ @ 0 } `>@@"U@`@ W " >   > @"U@"`ؒ@ @  $  p`% đ<*  l"ؒ, *`  " |@m @@ @@_ @@Y @%P@R@ @bU*  -` Ԑ X@?*  4@"U@-`T 8?.@  @"U@:c`   4? $ :@  8 #  :@ @ @  T >@ 6>$@"U@,`:`c`   :`*#;@ " >    > "`    ?# `@   @*@ +@$$$ ̖ p@% ̑<*  l"ؒ, *`  "  @"U@:c`   4  $ :@  8 #  :@ @ @  `<@"U@`@D "v $ 8" $$ ̐ 8 8"  p%  l< *, ؗ*@ `  #@#`  $  p`% đ<*  l"ؒ, *`  " |@Y @@ @@K @@E @%P@>@ @bU*  -` Ԑ X@+*  4@"U@-` TT @ "@ - Kpifree: range: dev = 0x%x, ino = %d, fs = %s dev = 0x%x, ino = %d, fs = %s ifree: freeing free inode㿐   |``,@ >!`@A`@ے`` @Ւ-  ?` `   `dI, Kk0w<@ "U@  >#Ԁ >K] 0i h$ `@t@ "U@4b \ : 2 >!0`L`Ҁ 2 >!P@"U@4b \   * *@* 0*$ 0  $ ``p`$`ȑ=* `l"ؒ- *`  " <  2  ?$ ``p$`=* `l"ؒ- *` ?"  ,`J start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in map㿘@h  `, & :  `,`: "`@"U@@``@> 8#  *@ ?" ?  * @e ,`@"U@ c``@> 8#  *@ ?" ?  * @D 2 > Ж > 0" *  8&`,@"U> ؇.>  `:`c@``@    & :   8 "@ : "  *  (  +` 8Ԁ > P > h 㿘e$ l h>`.`&  ()> . &  (.@)e$ p@@6`8 ` ('@(  (@ ` &e$@,?`8  ('@( 8@ ?'@@e$4. ` &.` &+ &e$( @? 4@ cT( uid %d on %s: %s 㿘> ah 8'``'Ѱ `P``@̔ PN` 40 *: ``8 ``20`d8``08@ L 01` -``0#\0@ : <``@s d, H:@ " ``!$`Hp ` I `  .` `0@x: ``8 `d ?GJV ")0``8@ L   ?GH0.`#\70-@6`: ``8 @2 0`d(0@L ֖`ޚ  IR 'd`* "H<@0" 4d.`H:@ " ` !$` @**  3'  0Ė 0I <d'0* @"HG" 400* " `!$`  Đ@?0F`<*  >` ` HB  G 0Nm@ 0H <d'0, @m"HG^" 4U `* %GTG 5.* `05 0H 'd`,"`H`<@3`0" 4``* %G'G#G`0?F\G00G0 0HT d', " H 㿘@*㿐  `` |  >w%  !# q "   % h  % l !"   % p   (% t`B = (   > h% x h *`" *  * % |   >% %, 4   5 \5 ^  @ @   @,@   @p @  x  ` 0 *  ? dEԓ, " xG@ @X X  <* ` F Flitrunc: newspaceи    > h | h 'P*`" *  * 'T 8 2`  `:` `d`2 ` 2 `d@?  T<`d>!$a'8'<P'@'DaN'H@0Ȑ @q3`2Fe8(Ce8e0 e4E e8`P@d     4" }<`@qP`E4>F4> !$'8'<P'@'D'H * @@8] 2`PB<`@+     4 D <``P * : `8 `2`0d8``0e8e@ `L @p4 <$@4G`E4`0F14`0:  EB?@`P?'`t$'`t @$'`0 <ܻ: ? 6"" @$ >," @?> !$'8'<P'@'D'H * @@8X < <<` (     W ?'`t$ ?'`t@2 $?'ఀ ?`d0?@- 20?`@$ఐ`0@? }? @, , "#` $`P`* : `8 `2`0d8``0e8e@ `L < @@ڦ J.  E 4`0`P * : `8 `2`0d8``0e8e@ `L <``P * : `8 `2`0d8``0e8e@ `L 2$ >#8  `T:  < @<`" $$ ?   @/A" ffs_indirtrunc: bad buffer sizep''ܬ     @ t@l 䀤@ 0 : E'Ԡ $"" >  `, "`, $ 0  ,$ $ $$ H>X#(>'' P`* @@G" <Dؐh  T0Ӕ 0, t@"@@*` $ $ $C2t?@ ?!&@, @" ??d~. 2Ԓ0?@ 䀠@", @ ?dY. 2֍ Tܰ 㿐  | `P @ 4`0*:  `8  `2`0 d8 ``0e8e@ `L  ?" BҘ" D>0 e8 < @    "@㿘>8 (` .`-(>> `` @:"8  @2 /`/@(&/`8 (8 ܰ ffs_isblock㿘 8"" >2>@ * >* >@*@   `?>@ *` @ `?2 ffs_clrblock㿘 8">">>>.@>*` *` @ * * .@ @* * .@ Ёffs_setblock㿘 8">">>> .@>* * @ * @ .@ @*  .@Ր!ffsffs_mountroot: can't setup bdevvp'sroot_device㿐>>"P>Ub  >> !>Uے! >"H!  ? @! >#H$ $!@ R  @ > 01>@$`$@ 2`"@">""D$  "`@Z /,`Ԑh Z>"p” Y~ Z@H"@ @OR@yN`  %s: file system not clean; please fsck(8)  ~֔ l%@@"&$ NҀ 2*`&@  R  @@   р  .ѐ@w R  .@0@NҀ B@?   2>c 'c ' * @@ >cX'h'l!'p'tcX'x * @@h >c8'hc8'l * @@h0c8'hc8'l * @@h.ђ .Б* . 2&$@Y @&(&&N~&, 8 " <Uː  >#@& U~   "0 !!>c 'hc 'l * @@h >cX'h'l'p'tcX'x * @@h>U0Tc8'hc8'l * @@h@@2@Z  U{ Uv03!d }d"Ԑ@("@ h Z’ Y}d Z@"@ NЀ  р .> h& > @  ffs_reload: dirty1ffs_reload: dirty2h      R >>!`4''  h'ؐ'ܐ '?'`4'* @@Ѐ " ( @<`  ??̰ <F%\!T@ 0@eg8 A\ TՐ0"  |"#T"#T h h#@ $@ " $A?%(@&   4?@& 6'%$ 8 0 4@$?  d@?*@ | `< *` <@b~ɔA 8%$ $ ,  #T%$ "@ ,``"Y U` `$UMT    R "`|>M! @ @/   @),@   @ @ x? ` 0+@  d ?K, a x@̒X  <*`~` @T'``2U` P<  ?W ;U >!2   Q (`   >c'''?''c*` @>`4''  h''Đ ''`4'* @@ " ('  @͕<`  >ј <F\!T@ 0@egL?!8   & @n!8 h %` h} <h#@ $@ " $@ '` , ђ ,Б* ,4@ $`,* @   (804@=%d@>i*@ ] <}`< *`@"b?˦8'$ $T, 6 &a$ "@,`&a&`<>O"@&`@(&`` &`%@%`%`t%` d%`$8`%`("`@ 6"`<`@?"0=a00   @$; 0B? 8 <0- 4 )<0& є  ?s  >c,''''c,'* @@` ` w t &a㿘  *  `&  %L?&  &%P%, %  0 :* * :>%0   t  @ɕ; %0 B >%0 H8  ;  L>%88  ; >%@ 㿀6` `@E@a` L Ҁ 2`@  2 ` р  , ѐ@Œ ` <` ?"`L Ҁ   >`c,'''?'c,'* @@Rn`"   $a`*@$`㿘>" " @! R`  ` " @+4  ` Rpffs_statfs㿘! F\!T@"6@> ! 4&`0&`(&` @8̢@ &`( d<@"@ @z d$"&`,@?&` Ȁ@ &` h`L|- Z ’`|) Z `<@@R  fs = %s update: rofs modxa JЀ  JҀ " *>" ﬒>"0>`h@I" ` 7>)>'> #'#' * @@ 2" $ | !# 0 " $QX  ސ''''' * @@؀ 2Q $ 2 >`''''`'* @@؀ 2@+㿐`@  &  >tN_"`& x  - .  @( " |$` $$$"` @6"` @  @ @   @,@   @Ӡ @o x`  `? 0+   d<7, " xQ =D&@X  <*`{G =>`0>@90"`Q*&$  `2 Ā 2%,>@>h  "@h"@@$`  2%, $%, \^$$ &㿘!`  `,@`   F@.  | 2@"`Đ "`㿘  T d @"      h =Ø `< hzڐ%L ?`<"P%, 4!08H H"@#@!0`:0 "% >"`=  @"  `@  d@" 02  ># >\c8#H>Xc8 -  e0:  B  28e48  `6  `:   B 4   6  c ܰ 6 `  `? @Z`Pe8`0 @  #  $` j <` B 8d < @ C <`@e @f) 4 : `P* : `8 `L2`0d8`L`0: "@`e8e@:    B  "& <: `0  `  A :쀦  "  !$  4  @       X 34X=>  `''?А''`'* @@ '@  : %  b"=  @>'Ȑ''Ԑ '> h'̐ h '*`" *  * '*` @Ȱx  ` L`?> h h '*`" *  * ' >  ''ܐ''`?'* @@؁㿘 @G " !  x -  | .̿ & | lfs: ifile read %dlfs_ialloc: inuse inode on the free list㿀` | ` |``  "``h@;```|` ?@ @ 9"`h>ܐ!X@* @ <*`  ">͐!p:\$` ` 2E`` |`@'  `@``  @ C <`@d @d`h``|$$ @`h$`    < ""?"  ">''`P`* @@谒>` @;6 | @VX>$\@>h  "@h"@@@$>">  @5`"@ " `  2` `(,a $`(MX`"㿘 >JD " &, ,!Ȕ "`|" "  "  ""\"7o""" ""` @ 6"` "0"D2X  :`" `0  "`0lfs: ifile read: %d㿈  |`` ` 0?& 0` >"`  |` "` h@=?  |  @ 8@ " h>ސ!X@* @ <*` "  "  "& %>'' P`* @@耤`"6   |` "`   $@@*  ?  | 2@ 7˒@ " >餐!`  $@@*  l < * "'' P`* @@  (.!?& ( cleaner㿘 $@\P ! `0`d ` @, ``,` P |  "PD >`#`,!2>x "`0803P | 2`0 $`0>a"" "` `,* "@$`,$ @$$$*@$$H /*%PK*H 08 lfs㿘>Д!((>p `+"( "p>"@"@ !D    X>a@  2 2!  2 `, @$`, X>" pbuffers㿘 8 , 3>`1>!: ?@``: " !?@>в!(!!2`$>0&`$>Z*>`:`"@! !Indirect block should not existH`|  @&  8 &`!X ( T -> 2H   8 $":>>   ` $`  @Q T@ d $@   $@ " $7   % `$""`$<@+0&4''P`* @@="ȶ & `P70L`$"I21 >   ` $`  @ T@b d $@  $@ " $7 0&  % `$""`$ @`<@`0$`4@$`H`$> $`$''`P`* @@9  㿘@Ylfs_ifind: dinode %u not found㿘 d*?  ?2 >緐"H㿘    = |!#8  ! "h  "l!"  "p  ("t`B :(  > h"x h *`" *  * "| ~` " ! `0 "`0 "`  @  lfs: ifile read: %dlfs_truncate: negative bytes in segment %d lfs_truncate: bread bno %dlfs: ifile read %d㾸'D > h'< h ?0*`" * < |* ''8 !<  $<d@   >`><!&a'X'\'`'da'h* @@X@a4`002d48><!&a'X'\'`'da'h* @@X0 @B?@%`?@CC?  @4 `',0.>`0@  @ La<?4TY0<>`@`T <$@T7>T'X'\`P`* @@X>  ,v?;>p'$PL<@ ,L (??"x"|"L`2K-  `@'P "@@“* @50? |` "`H|<@ 4@ "l>\#H? @<*  - @" >#M# a'X'\PaĐX*` @ - "  ?*` * `  'L% 4 %L ` L<@?47T "@> (L$*` * T *`<P@ @'P`@` "@@C* @50? |` "`H|<@ 4@ "l>ݐ#H? @<*  - @" >#Β# a'X'\PaĐX*` @ L$*` *  @ L$* @*`p ?"`T* <"@ @ aT'X'\ Pa`* @@X0)5!TL? h'LL O K,  `@'P "@@* @50? |` "`H|<@ 3@ "l>Z#H? @<*  - @" >#K# a'X'\PaĐX*` @ , "  $?p%&1? |` "`H|<@ 3<@ "l>#H? @<*  - @" >## >a'X'\PaĐX*` @025421 |` "`@6h?|T @2@ "h>ؐ H@T* @ <*`  " >'X'\ P`* @@X."@&$.@$$ <!&0 'TT$  THD@ T  'T$* $$ 0"&,+   $,02<4(< <D  E/ >a'X'`'d<'ha'\* @@X "㿘 a `  @ =@ ` 0   | @2  0 @/@ 2 0@? > " 0>В!(` "` 4  `  "`  4 ` "`@ِ 㿘` 7?# 2 8 0 2) $ 8 "% $@. 2  $ |`!#2` 0 "` " 0 @ٔ@= @@$ $ 2 lfs: ifile readsegs clean: %d lfs writer㿈! ` |  "`?`1 ">" <3Q@ >"䢒>ڸ#`, >(K r $`` `  `@`ܖ z4`|`@? -3>`?`1 "`l>"  < @ ?"@`a'a'`P`* @@`|?ڒ2`` #`F   0  |@4@FU@E  2`>@:>В!(` "` 4  `  "`  4 ` "`@ې lfs: ifile read %d㿐`$ @ `( @`(`?&`(` 2``$@| $`  |` "``@G h   |  ?@ @ 1" h>!`@* @ <*` 2p$`>@㸐>@Ȑ>@|`@ *  @&`  &`0`(` &`(`?2`lfs: ifile read: %d㿀!#   ` 2F`$ @ `( @ H   * @ & H`| @M`&`"&` d : ` ` <* "  d*``  &`    ,* "@& ,`$ " `(&`$` &`(@ d "@`*`"  " 0?& 0!" &> h&h!> h(&p`B >( " >> h&x >& >& d`` @'X  <* ot`` 2``  &` @ d "&`2  4 H1& 4 |` "` h@a ? |  @ 0*@ " h>!@*  <@*` H ">'' P`* @@耤`"H L@ H@$@  |` "`   $@@#*  ?  | 2@ /@ " >Ő"  $@@ *  l  < * " $ `?>'' P`* @@㿘`( @`$ @-  H 0 @``@`" `` | "``` 2``(? $`(H /* %& `$ &`$``$`"@` "* `D " `(`$?$`( "@$`$㿐&`H /* %'0 # $ 2  "  $2   20  H 0 @%&`lfs_updatemeta: ufs_bmaparray %dlfs_updatemeta: bread bno %dUpdatemeta allocating indirect block: shouldn't happen @   0@*  @"@ :`  4 ? @ ?` * 3> 0`& 0@`H @"`H`H@$`H@ ">ǐ! |  , <" * 8" ?`+ @ *`.Θ >ঐ!8`H?`$ 2 >ᄐ!X`2 @$``$2 "@$`$ <* "@a''Pa`* @@"?`L$9` |` "``` `"@* `?``| 2@`.@ ">["`` " `@* `l <` * "@ "a'' Pa`* @@  ^& 㿐 H D `  " "@ * @? >,#@~ D D  & H " @k* $ , `* $ $  |` "`   ,   |2@ @ ?.+" l>" ,? @<*`  ? H & H $ $ $/ H  "@7*@ $ , H D `"@ " * $ $ H& L$$  $ $   H | @" "@  <"@$   $ $  H @ & H " 2 2  `$ "`! $ ( $` $ 0>$ $lfs_nextseg: no clean segments㿈  |` "` @  "  @* ?   | 2@ -@ " @>ߌ"  "  @ғ*  l#> < *  aĒ`" "22 '' Pa`* @@  |  " ? - >]"<?"`"''Pa`* @@ D @ & < & D"  @*  t@`@2 >7" |` "`  ?  |<@ -K@ " l>$" @  <*`  .  2 t   & @*   & @>a( "a(lfs_writeseg: copyin failed㿀``" : `2 D  |`` "`  `,  |2@ @ ?-쒒" >" d l`, ? @$, + 2  `<%@ * @"  * @b"> h "@ 2  2`$>2` ''`PĮ*` @ -` +< `$@ @ j#  " >ޒ!p<$ >h*`% %  !%( +- $2  * " & $ |   >!* `@@`-?#4 @C |`H @ $`$&`8 &`$H /* %? 쀤? & `<F '`$ `@`0i  >,!p`<`0ko0$@@>a?"a `$ "`$`$ @? `$`< + + ?+  $ P" $??-쀤?2`P`4 "`4H 0&`@`<$@ &`0>a''2/>"aސa>Д!(`"?"  4 "  "  4    `" ?" 2  㿐 #>a |`*` a Œ!  & | @Z <jܔ"$ 8>!X$ L $?`T$ $ $! @$ $''H /* % P`4 "`4H 0 `D82 㿘`D  `p@?`?㿘`D   `p@? `?㿘`D   `p@? `?㿘 l + Ѡ @ l  +Ȕ & <>& ,& 0& D& H& (& 4>! & L $  P@& $㿘 @`? "``> < + +㿘> < + +㿘>@, /`@@(@$  &@&@@&& &캡`㿘!2 ? 㿘!> $ 0?$ 0㿐  |  @`` " *ږ?,F   ``< @# "@lfs seglock㿘 䀢 >   0@ !> & `402`4  #"  䀢 2  & >` 80 +  & & ܐ! + $ 4 4$ 6H /* %  & H 0 unlock to 0 with no summarylfs vflushSeglock not held㿘 䀢 L     4   H?& H >  <ߒ + ے + >  Ӓ +В +H /* %`  ? & 쀢   >@Ѫ H 0"& & R&   & 02?> P& lfs: ifile read %dh  ¨ 8@gk 0;i +) ` -, c`gU2    !ܺ @w`"`(`  ` 2 `(  &`(`@*  @&``( `(`?&`(` 2``&`` &`0"``"`"``2%4 |` "`@h?| @)@ "h>`!@ * @ <*`  *"c` ?@@   R &` |"M`"I`>d'''Ԑ''d'`* @@Ȁ 26`@21``@@Y ' +> `$" '@`<f9>''`P`* @@+V `7 ` `  ` 2 `( &`(ݐ&Ӓ0``? &``$ @ < j +`*K `?:j\ +p h ]@f, V:* +O ` - , $`f2 +0;??"0`+>??"#  @쀢 "?'cd'''''cd'* @@Ѐ 2'=j$ ??٢``- eߕ* + lfs: ifile read: %dlfs: ifile read㿀   @e  |9 2!u   D  "  @i* ` 2 g  |` "`  ?`  |2@((@ " l> p ? @ <*` ` " ,)C   *  & ,` @ӓ2` ` $@ & $` ?&` 3>a'' Pa`* @@  |  " ? ' >Đ < ""''Pa`* @@е , segment㿈 h X@e+  2P9) 2!>#  @` 8e  :Ӿ 3 H /* * > h h  'А"?''?/!'H 0 !2>А8@? Cleaned vnode VXLOCKED cleaned vnode locked 㿐`@ K "&\!> X |  > p    `  0`" 0  $   V$ є2O& |@ f`  $  Xd  0>`` ?' @ r$(-&`<` $ Xf+ (w>b >  @$$ ` $  $ ` `0 "`0   2&&㿘z " @" ," 0 $@ " $lfslfs_mountroot㿘>ة"ȁ  d* l!ذ @@"N&$H! @@=   5> c 'c '* @@ > cX'h'l!'p'tcX'x* @@h > c8'hc8'l* @@h0 c8'hc8'l* @@h,a 2&$ @?. @&(&&4&,|8 "<;Ts  >#@& ;Ji   "0 !!>c 'hc 'l* @@h >cX'h'l'p'tcX'x* @@h>;0?c8'hc8'l* @@h@@2 @0  ;   Yd ac$da@ Z@$@ he Z” Ycd`@$@  :P?=Ր< >!ʰ   8W `   >c'''?''c*` @>`4''  h''Đ ''`4'* @@ " (' @%f <@!b@^ `"~@W!8  "  $  <d" $@ " $&'$`$`$`$`$`䀥 ,a ,a<>` "&a7&`<&`@`&`` &`$$$$$` * $(`p$ " 6"<`"`   $` `:2 #   &   >c,''''c,'* @@    &alfs_unmount: still dirty blocks on ifile vnode 㿀`6`a`  :`T   " @ɔ   :@ ,` 4`0 >֝"9 :L < ` ?"` >c,'''?'c,'* @@9' $ $a`*@$`lfs_statfs: magic㿘! @!b@"6@>^#`&``&```2 &` `$`2 &`` d`T@7"@ @ d`$$ "&``: &``(`&`@)`d&` @  h`Lc} Z ’`cy Z `<@@  㿘`  O@lfs: ifile read %d㿐!@9 &m ` +`4` |` "``h@M`?`|` @`$@ "`h>!@* @ <*`  %v? 뗔27& |@, $ ?`#8%V"&`< Xb %J>b> @  $   `2 &8&㿘` @ F | 2@"`Đ "`㿈  |`X@8^ 2O ` \@W H ``@b C`B@ %`  <@k`?#\  (% 4%6< <r $` ' "$ &%s: nonsync dir writelfs_write%s: type`` `` 8 # |   $>€ "%>"`< @"`@  d@"0倎2 >!>a(!8>ܒa( -`X:  B Ͱ 2 8`\ 8 `"`:  B 4  2     X`7>@``` "  벒찒>< ` B 8d < @ C <`@Ni @N`4"@@& <Ĩ''P*` @  " !$ 4 `     X 34X<>``''?Ȑ''`' * @@%  :$ b"<>'''̐ '> h'Đ h '*`" *  * ' *` @x> h h '*`" *  * ' > ''ܐ''` @? '*` @؁lfs_dirop㿘  | ` `>Ò k   | ` "`  |  "` @ @j" `|`" `|``ʱ㿘  | ` `>Ò ;   | ` "`  |  "` @ @" `|`" `|``ʁ㿘  | ` `>Ò     | ` "`  |  "` @ @" `|`" `|``Q㿘  | ` `>Ò ۖ   | ` "`  |  "` @ @" `|`" `|``!㿘  | ` `>Ò ȫ   | ` "`  |  "` @ "@ @ @Y" `|`" `|``㿘  | ` `>Ò w   | ` "`  |  "` @ "@ @ @" `|`" `|``ɹ㿘  | ` `>Ò C   | ` "`  |  "` @ @$" `|`" `|``ɉ㿘  | ` `>Ò    | ` "`  |  "` @ "@ @ @" `|`" `|``U  |"`"`X2`Z2`"`"` "`D`:`h"`$l"`(p"`,t"`0x"`4|"`8"`@"`<8(2$"` * : :`H8"@( :`P P-|`)  "`>h"`h`>h`("`p@:`(`>h"`x`"` ` `0 0 㿘> 0 2 @t㿘 @ 2 |{ ,& | mfsmfs_mountroot: can't setup bdevvp'smfs_root㿐>>"P>3ْb  >> #>3ђa >ѥ"p!  5 @}! > 8$ $ $ .) a>`" |"  " x>$>h$ $ 0$ t$  0    .01>@$`$@ 2`"@">""D$  "`@8 /,`Ԑh^ Z>Ő"” Y\Ɩ Z@&"@ -0@W,  㿘\F!T@2  0@4 eg> >Ő""`>4"`@ $>"bh>P`"P>?#@"܁mfs_mount: dup dev\ t}@@(  N`Ҁ `@  0G g ᭔0c ]N`Ҁ T@2P.`S  >`0ܖ|K  |>P" 8 "P?c3 " $>!@ .S |# |$ $ $0 $ ߤ$ "|!x `[x"Ԑ@@}"@ h] Z” Y[ޖx Z@n"@  ?3$ mfsidl㿘! |` ?C`# @$`u` >`l>Ɣp ")` ` @$`_`  :1 "`  ((Ā" -? *@, &`?2`㿘6@ `<@@ mfs_ioctl not VBLK㿘  8 >   mfs_strategy: bad dev㿐 >  84 R 2|>!0 `2 0 $ H * @ < 0  < 0 ]1!א0 @2@ 0 & " 㿘 $ H * @ < 0[Y& ( < 0[Y& ( (  $(& $!   ``  mfs_close: ref count %d > 1 mfs_close㿘 |`$`ƛ` 2     0@ T`>n"T >` "?>y"$`y mfs_inactive: not inactive (mfs_buflist %p)㿘  | `>]# 㿘  | .$ | tag VT_MFS, pid %d, base %p, size %ld 㿘  | >* @ mfs_badop called 㿘>4 㿘 `  | "@      @  ``|` `'@$@?"Ѐ "̐@`,'̑.` $* &`" `` 4 @6 .`|( ` ` '@&| b0 '`*  m />`Œ c _  E $ $֘  $"2$,@$ H $ $ $'' P`* @@>  ,` H", <̓*$ `"" `"  @: @6  <.`(@ ?  @  '@ `@@ & < ̶ ? '̀ "$$,@`&?& 㿘 !& ` ` ?  `";  @ @`&@%@ ""@& "&& `   `@a@@&$$  @`"@2& 㿘>!H> Д>"aЁ> >Ѕ(2  @22㿘> @ >!Г*` 2  @2 2  "& G >  0x >ufs_ihashins: already locked㿘 > > @ @Г*`  " && "   ">>͐" "? 0& 4  &     㿘>aȀ  z"a@ 3ffs_inactive: pushing activep >"   |T  >ɐ#2`X 2 `!p 1l  T`Z `6$`   22`@Ð >??@ʖ >`''Ԙ  ?'?'`' * @@а`X$``>`4`X!$``'''`' * @@`!#>''Ԑ''> h' h '*`" *  * ' *` @>c8'c8' * @@T  `X 1>ufs_reclaim: pushing active㿘>" "  |V  >ʐ"25 |I   /$  `"`@ $ ``  mangled entryi_size too small('  ' ''' Ԩ?<'|`X  '? >cX'' @''cX'* @@ఒ,y "   ?4#>c8'c8' * @@/ -*  %>c 'c ' * @@/   2>  >c8'c8' * @@ >@԰ /1>  >c8'c8' * @@>c 'c ' * @@ఒ|  '̴  2  "  ?'! $?'`D  : ``  2 `D`d(`D $`H, "$`H :>@''?'@'* @@ఒ>0g $`P  `H@ " >b`  "` "`H ``aB @'ě2`* @ *`  `H`'`܀ "`H`H>@: '?@'''* @@ఒ$ `܀2 <?  <   >!Ѐ @6 `>`H@ ""@`H  S$`H`"' *  2   ?"@`$̀@` `H22?@ `H̀@2 `H " "`H 2`H@.  2`H  $  Y $`L $`P` $`H '` `H&j`ܺ `D\$`H  2`   2X "TT`Z O>cX'' ''cX'* @@ఒs``` "aB @2`* @ *` $`H`H$`< $`H! $`<%$`<$`<, >`$`@a$`( %>c8'c8'* @@8?@X* 2 >b` "`   ?@``    `d >`H@     `<``$` `H >$`D2O J>cX'' ''cX'* @@ఒ`H!$`<"$`<``L 2   4   ذ`X"`"`Ȁ@ | Ȁ -  ؀4 ?: 7>cX'' ''cX'* @@ఒ``L 2   ذ} (%t >c8'c8'* @@h 4>c8'c8'* @@`L  ذ >c 'c '* @@0G7 4>c 'c '* @@ఒ),01``L 2 4   ذ > 2 >c8'c8'* @@ @/ %s: bad dir ino %d at offset %d: %s bad dir㿘>ΐ P ` # h  >3 xFirst bad Second bad 㿘` `""  >ΐ ?  $@> Ȁ  @  @ J   `@ @ J    >ΐ  㾐 '/V7`  $/ X2 / @ufs_direnter2: newblkufs_direnter2: frag sizeufs_direnter2: compact1ufs_direnter2: compact20``|  ? <`C  H >ȶ":?ؐ"6`''''А ''''>`''' '`'`* @@`a@` a>ȏ"  ` "aB @2`* @ *`  = ` %  H :  `8 H2  H d H < : = ` H>@: ''?'Ȓ@'`* @@w ``  ?  < "@@ @4`@   "  U} <&@@  ``@;`  : 6`>"@66`>"X4`@UZ>''`P`* @@  !$%  @  :  ` 8  @ d  @>: ''? '''`* @@x`@ |`H>@: ''?'@' * @@؀ U >"@ ?*``<2 `H`H>@: ''?'@' * @@؀ 5>"?`P#Ĕ"  :>@''?'@' * @@؀ `P 2>''`P`* @@`a&`x H>@ : ''?'@' * @@؀ `"@   >`X2 *`''`P`* @@ a$ ` `    2H  d (D     #\ #`#d#h#l@  22 ܀ 2.  "* ( ` `4" L .2 `" L .2 "  ` @ D8ɐ 2  d  checkpath: .. not a directory ``` @'>  `: 486 4'#\ #`#d#h#l ܔ  ? $ 2! ?  2  @߀@ )   ܰ 8 ѐ   2>{!܀ )undefinedgroupuser㿘   ` ! Ȕ @J  2 $ 2  ̔ @; $   㿘`"V $ ?# " 6Ԓ   (,&(&(  6   4 2  " ` "  @M   `  " 6   (&(`6     %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too long㿘.  (  `" $  2X E @2S E>ѐ! >` `hC  $ C`"B  ( >  !.`h ,@$ 8 @20 >ѐ!>і >` Ż`h# > h 8@$   2 E @2 E>ѐ!>і> !`. Ş`h  4  E 㿘`"V $ ?# " 6   4,&4&4  6   4 2  " ` "  @@   `  " 6   4&4`6     %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too long㿘.  4 , `" 0  2X E @2S E>Ґ!0 >` `hC  0 C`"B  4 >  !.`h 4@$ < @20 >ѐ!>Җ` >` ݒ`h# > h <@$   2 E @2 E>ѐ!>Җx> !`. `h  4  E @ a  @''''<'ܰ.>c8'c8'* @@8  ` =Et #  ` =9h 'nY@d `< *`<` &` &$`@ 3` &N"&,&4@  2` 8 4&, < 4&4@  `V $&ݒ  2`|'!$2`2`2V `< ?*`<@ #vquotaoff: not busy㿘`@a>!. I `< *`<` . $&   |  @" &ݐ $@2`  @p " < . $ ?$  `< ?*`< `*@&`㿐 !@i  O @ p!O  2 @MԀ 6      (' 4'   8' <'܀ " (@  $ @ >.`h ,@'耢 " 4@  0 @ >.`h 4@'& & $& (& ,& 0 $& 4 (& 8􀢀 & < ?# @6  4 0@? #ߒ @6  0 2  $ 2  , 2   2   6 ?# @6   @2` p!Nv 2T @Ԁ K6 c   2  $`" 0 (   >.`h ,@& 8 0` 4  쀢 >.`h 4@& <& ( ( $& 4 ?# @6  4 0@? #ߒ @6   @2` qsync: not busy㿐 @!>†#@  `    ` 7 `3'>`$''`* @@ 2#%&   `|,   `"  ` " @v  $`|%^`$2 `Т`2`$ 㿘>!H> 0>"b>"""" dquotfree dquot isn'tP.  < >' <>a0 * @ '@>" 2  *   2  2   ` "` "  "@   4 ' 2 >" #>>!H>a* @a>a "a#>a>a䀢  > @ e @| @a &$a" ">ߐ ' D ?@" > Ȁ` "` "  "@`"  "` "@ >c 'c '* @@ $" $$  4 $ $ 4 .`     4 ?' ''?'''. >c''''c'* @@`  @|?  >c8'c8'* @@   Q 4 `"  "` @8"0' 0 2  $ 2   , 2   2  4   "' 8 2  <>.`h ,@$ 8 < 2 '>.`h 4@$ <'  2 㿘`` ?6`` @`?6`*   >&`b&` b"`"bdqsync: dquotdqsync: fileP`>ڐ!` 2`z `*    >ʐ! >c 'c ' * @@`  #>``6`> `  ِc8'c8' * @@I 2``  6`''Ԑ` ' ''`*  ?'''``*   >`''''`' * @@` " ` p`?# @ 6`>c8'c8' * @@dqflush: stray dquot㿘>!0>b* @ &>*    >6 ("""@"2>"?: 㿐     &@㿘  >`#&2  `  " `  L``H#5%!" 0>$%&$6 ( 02H,+ ' ݔEӖ$    &+0 㿐!&`@2 !  ` &|`X ``@"&" & F0 '4'@㿘  >a*    @  㿘  >@a`*     @   |`!"``D?2"`"c" 8#$ `|༄ ` `? P!|` "`>h"`h`>h`("`p@:`(`>h"`x`"` 㿘   `|`8`*`>ؐ!t@ a a a a a a a a a| 2`   @" X   X  ̗,` & 2 |`  "`>h"`h`>h`("`p@:`(`>h"`x`"``"`"`X2`Z2`"`" `"D``:`h"$`l"(`p",`t"0`x"4`|"8`"@`"<8(2$" `* : :H8"`( :Px     |T ?2Ӱ  ?2ϰ  ?2˰  ?2ǰ  D?2ð  H2  "   @$`@ ? @ $` @?# @ $`` $` @ @ ` @   ?  @r ?28 ?" $8 >d  `''?''`'* @@ذS $?| ,?"A `Ȁ@ " $ X =>cX''ܐ ''cX'* @@ذ- $?" ,` $` ,?>`!$`''ܐ $' ,' '* @@ذ  ?#@ @㿘 | Ȁ@ c ", " X 8 b"   O ; 2 Xd" X < @o@ 4 X $  "   X"2 @7 chown: lost quota㿘|`Ȁ"``Ȁ@@  `̀  2 `̐ ``ɐ@` 9$` @`$2$`$  `Ւ ?    '  $`$`2/$`̀@` $` @`$$`$ 2   1     '  $`$`m ?@` ݐ$` @`$֐$`$|  b Q0$N >ǐ#2`@` $` @ @`X 74`X   `X ;4`X    㿘 8   |  @2 `| ` "    @ Z ?4 Z`$ @0h  8  >b'''b`*`  `@ >b'''b`*` ~ @>c 'c '* @@ఒ >b''b'`* @e| Z#>b'''b`*` @ G@  @>b'''b`*` @ 4@4 Z > $ 'Ȑ''Ԑ '> h'̐ h '*`" *  * '*` @Ȱ"  Z ?4 Z`$  @ >c8'c8'* @ȟ@ߐ㾐       "`( $   $  & -' /  H /  ޒ  * &  $"  @   ;& ufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryrename: lost dir entryrename: mangled dir    `' 'Ā1"- >b''b'* @@TA >;>b''b'* @@=Ā  | ` ϰ | ` >9>8 > b''b'* @@  ? %>#X %H>''''* @@9c 'c '* @@Ȱ>|༐ @|  @"X>c8''c8*` @ d><  ' J .  >@2> @" @>c8'Đc8'*` @ <>$ ` | |Z>Đ 4Z`$''' '> h' h 'ؑ*`" *  * ' *` @>c8'c8'* @@` > X? ''X'`* @@>c8'c8'* @@ 2`%`# e`) ;a` @2> #xrS` | |`2M` @`># ` Z#@1 `4 Z>   $ '''''* @@`ؔ``> Z ?4 Z`$ '''' '* @@`w @>@>#`@2 X>#""`X  `" `X Ȁ@"`X`Ȁ հ `X<  `  N ǰ BT`Z À`  Đ `` ` Z ?4 Z`$ p`Z`?4`Z?4`Z*  >>S#    ?? '''`* @@``$`I ? %>0#XĀ ` | |>!#= @`S >#>`<   Z  4 Z`$ Ą #\#`   #d#h1#l %  ?  " ' >﨔  Ą #\#`   #d#h1#l "2 ``Z`?4`Z`$`` ?$` `Ґ`"($`` `> ?$c 'c '* @@Ȁ  Z4Z`$0ufs_mkdir: blksize@``|`Z#@` Ѱ  !>l''''Ēl'* @@2  |`% `̐% ̰2    "  > ?''`* @@V05 XԐ!%  "`8 5 Z@#>  % a'''>  h''ؐ h '*`" *  * a'*` @`Z` 5`Z`%`''''a'* @@J  >!>"@'`'`'` '`'`' '` 'Ԙ #\ #`  #d#h  0#l2`Z! !>Ӑ#8 "= ` % "``Z`?5`Z`%` " ` 5 ZԒ`% "@^ x   |`| J TZ ? B  a 2 6 B @1  @+朗'` Z 4 Z` $ Z>?4Z   `''? ''`' * @@ذ  `hf㿀     (@ܐ) @q`@  | D <` < `$   #\ #`  #d#h  0#l0ufs_readdir: lost in space㿀  !2b $"` > '''''*` @#@27 `"3   ">!??"@"  @ D#@`??"42 8"@<$  |` @  @2 d @8& &㿀  | d @ 2   2   > c''''c' * @@㿘  $(  㿘 & !" x 2 |  ` " ""` "` 㿘  | b" }"S   |@ ufs_strategy: spec㿀` P8? |>6 p H D2# H>cd'''' H'cd'* @@ఒ"  H$ ( $h" $l?2 H <@p 0$ 4 H? < $ 8>!* @@  tag VT_UFS, ino %d, on dev %d, %d%s (LOCKED) owner pid %d waiting pid %d 㿘  |  > ! 8 2 8  >!>!>!  4`>! 8`">>!>" 㿘 `|`">c>*` @㿘 `|a">`>*` @㿘 R `$ | 2!>!"> "> h"h!> h("p`B :( " >> h"x >">#,>b* @@㿘 `|`">c>*` @㿘 `|a">`>*` @㿘 R `$ | 2!>!"> "> h"h!> h("p`B :( " >> h"x >">#,>a* @@`)>(    `   `    ` $  ` "  `    㿐     | ` #\ ; 0㿐 |`X< >a2  `5$ 8>"*`@ ` ` ` ` ` \ `$ `" `#>c8'c8' * @@ |& |>b$ |$ $``$ ` 2`( $`(> <`(  *` * " *  * " * <`(& p`|'<@& @> l''''ܒl'`* @@а"  |$   $ Ȱ2   і "4 X > ?''`* @@;c @ 2` !$ >!@"8  Xd4 Z  2  Ғ " X ;4 X@>  $ 'А''>  h'' h 'ԑ*`" *  * '*` @а22@   &} ݐ 4 Z`$ > `` >  㿘4 * @*`>#@` `:>!@6>!@2>!耎 2Z @ >a* 2 ??>3>@??a?>#`@(;  $    % 2& # $, >" &  & & & &@&`@ &`@ @d @'   % $>&`& `"$`@Q㿘`"  "`>"#d "@  `"`$  @"2Ԓ %ђ $dev_pager_getpage: cannot handle multiple pages㿘"@>! ``,  *@ *`>㰒@ `  @@<$  $   " @#4"`@",?`"# @` 6`"?#ߐ @6`"@ >!@ 8& dev_pager_putpage called㿘 > Đ"@ 㿘>!  %!>!I !@o (>>&& `"" (>!`! "` " "@#6 "& $ 6 ">"   㿘@m` & & & & ?& & " 㿘>   耢@2#   T& "@`$ `$    " `        & @ V   >  & )`"@`$ `$  2  " `       "   & @ (   >  >㿘  ? &   ?&   "& &  & @ 㿘>   耢@"2 ( "@`$ `$  2  " `       "   & @ Ԕ   >  >  & 㿘 >`?$  `耢 2    2$     + $ @ Ɛ&  `!$ >"@  ? $   `? `       $ @    > 㿘   `& &   "& &  & @ >`耠2`` "`  `` "` >`耠" ``  `` "`㿘>   耢@2     $  $     $ ?  $  $ @    2$  lock_set_recursive: don't have write lock㿘  2>>!h  & lock_clear_recursive: wrong thread㿘>   耢@" >ݐ!Ȁ ?& >>H > PP > @"> pp > ``  >X> d"?d` "d" ؀@ >">ϒ > ""8 @&"">a4>> "a4>>2 &* a40 4 >> ("" ( #! *`(`` *`  swap_pager_alloc: bad object㿘> P@$ @d c>X#Ȁ  $`? V  %ޔ%>>!aa@ ` * @($@ @$@6` $` @m|?$`*  %   $` ђ %Β $( `@j*`4` 4`&>`T& `T"@"`T@@ @  & 4`&& & >"H& &  & & swpgdealloc㿘 ` `"  "`>" T "@` ?4`H /* %T`  !> `!4`g T` 2H 0@ ` ` '>" @` `` W %T %Q $㿘 @c㿘 @Ő   @?@S 㿘  *` @lϒ  @*`   @l >a2    >  swap_pager_cluster: bad offset㿘  >!*` 4@l&@ >I#@ 8 &&swpgiobufswpgio㿐@  `* `,`@l| B 6K @kӣ*  1>!5:@`"7  @A > ` 2+ H /* % @/H 0  >#9  $  6@" " H /* %>#  >#t% #> ``$ &`$d` >c`"cH 0% &`$>#&` &`<5 #>b@&`H "&`P8 !>< &`8!@l`$@&&`0&`T!@lb&`X`4 "`4H /* %   6 H 0?*>a85 * @$  23>> `` `"`""@ "" """"> `$&`L`@&`$H /* %">bt"bt ""btH 0>''`P`* @@  P H /* %`$"  #> ` `$"?ο ?6 ?ο`$"2 `$  @&`$>cc&`"c`P ߐ  @  * &  >`"`$4`€5`"H 0@"1%s: clean of page %lx failed swap_pager_clean㿘/>p?#H /* %p` ` " @@``"`%`@"@`2`H 0 `J ``0 ?#߀>!`,@"@`  >"> $vb8 "  4 " " $>4`€4 " "   4 " @4 "@`׀?4*  2`l`@!`$`$@> d$` d"@" d㿘H /* %>"p   "2  ?`" $(`"" `?2``  ?2`3?ο $" @& $>cc& "c P ?  @" >  * $ >" H 0vm_fault: active, inactive or !busy after main loopvm_fault: active or inactive before copy object handlingvm_fault: active or inactive before retrying lookupvm_fault: active or inactive before pmap_enter`>aX`'D "`#\#`#dD@z찒0M@p @`% @? "a $ >a4@4 " "   ?#?#/>X ``$` 4`@I"b`( " & 4 "@h`?`?@ 4`"  4" 4"@@`?2`D@ H % H@P` " "`"  "`>"  X"@? "# @4 "L?"`"L " " "`"  "`>" , "@? "# @4 "X`?"` " 4 "  䀢 @2`(@2`(`?@ Y4`"  N4"I  Z䀢 VD@N  8> ` % 8 cp "cp`(@  6  + "  4 " 4 "@@$`?@ 4`"  4" 4"@@`?2`D@@U @ "  4 " 4 "@֐@@ "`4`0@ `?4` @X``  "``? "! @ 4 "@ " `?4` ` "  ">!h@90@?"a @l4">` $€ ? "# @` 4 "?#ߐ @4 "@>`aX?4``$ "`$`@4`` 4` " ?'`4 " " ">B! $  " ?'`4`$" @@ ; " 6 6 "@`? "?# @` 4 "?#ߐ @4 "@3@W?$`@ ?4`" ` 4"?#ߐ @4"@@?`?2`D@?0 | @2=( "?# @` 4 "?#ߐ @4 "@@?$`@ ?4`" ` 4"?#ߐ @4"@@`?2`D@@x>@Ր" >!>`@ 耢 7D@ ,(@N@ 0@   "?# @` 6 "?#ߐ @6 "@@ΐ@HD  "?# @` 6 "?#ߐ @6 "@@ 2$@? "! @6 ">`$€ ? "c @6 "? "# @` 6 "?#ߐ @6 "@q?$? "# @4 " " >@!#\#`#dD@ ذ/? "# @` 4 "?#ߐ @4 "@D@h`?@ 4`" ` 4"?#ߐ @4"@1@S`?2`D@S@0@ 쀢@1 "?# @` 4 "?#ߐ @4 "@ @0`?@ 4`" ` 4"?#ߐ @4"@@`?2`D@@Ԓ  " ' '耊 ? "# @4 " " " $>"D>b@ 䀢 @=  "@z "@ "?# @` 4 "?#ߐ @4 "@`?@ 4`" ` 4"?#ߐ @4"@@`?2`D@ @0 㿘@ @g %>  "  @0  unwire: page not in pmap㿘@"%>>b|€2>1 h@ @>b" *` p* @@>!@@ >@ vm_fault_copy_wired: page missing㿘  @"@& &=,+>)>'>@ @b !В@ @@ >!8@i>"ؖ$@ @?"# @` 6"?#ߐ @6"@>!  ʢ@㿘  >!>8  @ @ !@  >bt` >! > * @* `?㿘  > >! 8   @   `?㿘> >! 8   @W 㿘> >! 8   @H vm_fork: no more kernel virtual memory㿘@ 1 &`   Ā H!>!@2>@ @ !@! &`cL&`b &`$ $5w!,@c c  H5r @5  :`0  88  @:`  8(> >*@   : P㿘>  !@@ H /* .N -  @G ( & (H 0& p>aX`( "`(scheduler㿘 > H  K - 2  ( 2  p tK Ґ *`" $    2K -@ >>#Ȓ >X ښ >!2 @ Κ Ho o>@ǐ" >`@ H o@ 㿘    > H / "-> (  2$  2  L -   p( &  4  t@ @@%(    2 (>>!>a* Е2   " @㿘>  !@$@  @=H /* . ( ?& (N -  @㖐H 0& p>aX`, "`,> thrd_block㿘Ho o>  耢 > ( H 0thrd_sleep㿘Ho o> " >  H 0㿘H` H 0 %:㿘'L'P'T>"x 'X7>X >7>`>"hL㿐@@@@@@@@㿐> , a'@   @.@  㿐>! @ .@    @8& 3>W;  c@@ c@yG"%>#@M p >!>`P #@?`"# @6`">!*# @@@ 㿘>!@8  @ @ kmem_suballoc: bad status return of %d. kmem_suballockmem_suballoc: cannot create submapkmem_suballoc: unable to change range to submap㿘 > , &@ . @ "@>А!>!8&@l@@t2@>Ԑ!H@s >ː!pkern_malloc_alloc: map != {kmem,mb}_mapkmem_malloc: entry not found or misaligned㿐>" >#؀">>"h>!  ,@ *@ *'   @^& 9>" ,#>a@E" a@  l @a@]􀦀)#>@k2?" a& @ @a@@ F 0?"# @2"a @  > @>4 " >8" "4%>#>@ $ bؘ @@>!   @ w㿐>! @.@   @&  0 ,"  ߒ   @ ې 㿘 t> @a& 8  @ @| Đ㿘>А >@i  W>"!   > " @ܘ㿘>" >"!x"(`"(>>!"` 8@a:$ ` 8$ 㿘  ) @_q Ȑ@D @S& & 㿘 ? &     , 0@& @  vm_map_create: out of maps㿘>"  >ax 2 (>Z#"ax   @&㿘 $& $& (& \& ` & h& d& ,& 0& |& x& p&   vm_map_entry_create: out of map entries㿘 |  8   >`  "` > 㿘 |  0>`&`"`  h" h㿘  h? & h   , 0@& @ 㿐`,*} `0 u @t o  `$@`` e`6`$3 /`d +  '  # 0  (  ,  4     ' @&    ``'  $``/$ e"" """"" "$`d  "0 "(","4`\ $`\" ""`" ``" @`x$`` @:$`x p$"(@  "  ( ( @  " "p2  ""p㿐 ,@ *  0@@   x $2    0Ĕ   0 $@ : @ " & p` :& p  & 㿘  ` $  "ߐ  Ԑ 㿘@"`"`"` " `"`"`"`"` " `$"$`("(`,",`0"0`4"4" ``&@&`&` \ & \@"@ ""`"` ` 0@ [㿘q@"`"`"` " `"`"`"`"` " `$"$`("(`,",`0"0`4"4&` "`& " \ & \"`""`"` ` _0@ 㿐    , @ &   08@8  `@ ^ '` `` ` `  `  "`"`"`  㿐   , @ &   08@8 `@  ߐ   ' $@"`:` 2 `,`@ 2` $@n>#P`i` ) `(&`, &`(&`(`( "R`` "@`? `` "```J` `` $`"@ & `:"``  ` " ` ` " `(  @ ` $@'`f `` `   @` $@2`P  㿐4A <    , @ &   08@8   @ X $  $  $ 0 2    㿐    , @ &   08@8  G @ $  4  @:    }  y  2 ې  $  * 4? $ 4  ~ 2 Ґ 0 $"X :S 4 2   2  $ "   (    @ "  $ $    @ "@$ $  @  4  @$ 4     $   4?$ 4 2 P M  2 >А @ B  V֐ @ 4? 2   א"  4 ?$ 4  $2 >А @   & @       㿐  ,@* 08@8    f  b `: $` ` (`` "  @"` ɰ 0H`*``=`&@` @ ` "` ʐ^ "*$ 힤 `(``(  @ ߘ  @ @`` Dz@킐  㿘`` N&`4㿘`4  \?& \`@"@@`"`` ` `"@ " & `` ` n`@ )`Q㿐    @n& p x  ; $7& x8     4  >#@>!@2  d $@ @  2  $@ l@ @ $2  㿘 쓐  , @ &   08@8ސ㿐 @  $@" `@*  `( 2 ` @ ` vm_map_copy_entry: copying over permanent data! 㿐 k g " 4  24>"P4 `d "@@5  4 " @ @ 4 >$ 2 d  h `?  > (#P   " @ @  #@ @   &$ &$& & @"@ @P" 0Jp'\'쀦 @  @  Ɛ`` `&`   & 뺐  ``& ` &``d !' d ,   ` #   '  " '``@@܀:`d` 9` 2` ``" `  '` ``" `  ` 2 ` ` 2 ` A` ```" ```좐`` ``+&  o#\`삐 #\& @싐 @2` 손`` ` ``d  d @Ґ|  d   @@܀@-`@"( vm_map_fork: encountered a submapvm_map_fork: copy in share_map region failed 㿐꬐  , 0  |&  Ȓ*[  $ (@Ƥ` "`0> s4` 2`` 5 ``  $ d@"`" `" ` " `" `" `" `" ` " `$" $`(" (`," ,`0" 0" 4 \ $`$ \" $`" "` "@ $``$`$`@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0 $ 0$ 4\$ $\$$ $ "` "` ` @" G`g@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0$ 4$ $ \$ $\$$ $ "  "` `  ` #\ "  >A `` $@2?` ` 3$`㿐`G``p`$ & @  @*  Δ 5&    &0 (" 4`f @ % ( `?   &@   2`B  $ 0     @ؔ" $ $g  ?  2  鼐`0  @W"@$ $ M  %@ '@ 'h `?\#d #㿘` `闐 镐 㿐0  & < ` $[ W d S O K  G  C0 0@>( (@9, ,@44 4@/  @*$ $@% @ " @@  x "& x \& p?& \`@"@`"` " @`)& 㿘>@L,%s map 0x%lx: pmap=0x%lx,ref=%d,nentries=%d,version=%d TaskSharemap entry 0x%lx: start=0x%lx, end=0x%lx, donate_copynonecopyshareprot=%x/%x/%s, wired, share=0x%lx, offset=0x%lx object=0x%lx, offset=0x%lx, copy (%s)neededdone 㿐 d > >!>! h \#\ #``>>"x }x $ (  r"x>"  >!Ȑ> a  d "  0 (*  ,>ƀ!p 4 >ƀ!     > ƀ!@ bx` " ` @"7 bx Q$bx,bx> ƀ!  > $ ">>!ؒ!ƀ>ƀ!@" ` 2` @"  bx @5$bxbx?$bx >bx?"bx㿘> h@Sw  2>>@"P>">2  <: @<;?㿘> H J- &  2  Ѐ 8t 82J->" @W("@@W*` 4 & h`"    ->P("   @  0㿘@T 0>"( ?# 22> Hi>">"("2_J- 7*  ( "t Ѐ 8t  6 : t  6 :t  6 t:6 ( "  6 6 J- "&  ( $  2 2 `" ` 2`  2 "  6 2(>"(=>!>!   2 @&  &  "    2 @&  &  $  $ 2 @&  & $ "   ( 2 @&  & (2>!& , - -㿈`` `@>! `' $@@ 8 `@  "@  '@>@@ Z     *';?+ @`2V` B 2? `  8  28  8 2 ` <@u `  `#  "  ` 2 `  2     #\#`@ݒ&㿐@>!` @ $@ * @  )  敐)s`  "@  h `" ``      㿘@>!` $   >@  ` ?    ( 㿘@>!`` @ #@    @        - -㿘@>!` $ *  @> !2 >!>"@ @(  #~ "  ٖ `  㿘@>!` $ *  @:  ~ "   `  h\ `# >!耍@ 2 `2@@  *  &@   @@?  8  <  @ Ҙ   @@S@ #\@(Y@ ӐȀ 8 `#\@@   #\@ݚ7@  ~ @z ݐ   & @  @ @ V 0 @ K  @q @ݐ  '#\ @`@ӐY ` 4`@ #\?`# @4`' @#\#`#d6@@@ (    @ @ @ @  `  @^@@@             㿘>"!!" >""("(" >"#h > "" `` >>ϒb("#@>!>Р#"!> @O@Tg @㿘 @ w @"@"` "`"` "` 2`2`"`$"`("`,"`0"`4"`>,"` ,> ` ,h>"h>Xd2  d  " 㿘 "#>%> ? &   & 8a& <a 8"@$a`@%$@> @u ( 0@2 㿘 0`"  `$""`$       2    @7 ` >!X@=  \ $ \` ( " @ ? `"  "` >"",  >"h w"h%s: pager_put error vm_object_page_clean㿘      ( 2 @^ ( ?   @  @  ( 2      2 >!X?#@"  " * :  "!2   >`@ $ ? "# @4 "  " 4> "  `"  "`>" , "@? "# @4 " ?$ `"  "`>"  "@? "# @4 "??$>` $€  " 24  4 "  (@6   >"8>bP "  4 "  ? 6 `"  "@c "@ "   r4 "?#ߐ @4 "-k  s@㿘   "  @2 "vm_object_deactivate: I'm sooo confused.㿘>>@'>)>  @ (Ր!@ r b@ሁ㿘  !> @8  :    $€  " 6 "  2 㿘  !> @8  :   $€   2 vm_object_copy: copy/shadow inconsistency㿘 2 (&j' "     `& @`@8 `:``" 2`"``2`&' J'@@ $``  `( ` "`&5'  $``0>`4 >@#0 ?& "`0 ""0"4   & `& $`8 ` :``" 2`"``2`&&@ ''@vm_object_shadow: no object for shadowing㿘2"`0>!(@"`4&@&" (" ,㿘@P * >` `!>!>` (2@  2  8` <"`<" < 8"@?"  & `2` 㿘  @Ps   !, > tO "  `6 " "  "@$ 㿘@PZ * >`   (2`"`"  !u?"02vm_object_cache_clear: I'm sooo confused.㿘>! %>~ (r`@ a vm_object_collapse: we collapsed a copy-object!㿘>" ?#    (  0?@* @0 " 4 $  4 a `,?#` " @ "" @c "  4 " 4 "2@T@`2`( "0& (,& ,$(0 4& 04@ 0  & 4 $ ">#`"  "` >"", >"h t"h>b "b( .`"0` ": `@} ""``2`0o& 0 44 & 4$"$$>?$`Q"㿘  #> @  :  $`€ @Ԑ 2 㿘`2" " $  4  ( 2  0 2  $   @Ȕ @8&  㿘>@5,Object 0x%lx: size=0x%lx, res=%d, ref=%d, pager=0x%lx+0x%lx, shadow=(0x%lx)+0x%lx cache: next=0x%lx, prev=0x%lx memory:= ...,(off=0x%x,page=0x%x)㿘 G > `( X ( , 0> 4ƀ X 8> <ƀ `1>bx   !"bx``>;` 2 >>ƀ >0` ƀ  > $ƀ   ``>ƀ >bx?"bxvm_set_page_size: page size not a power of two㿘>a a"aa> "a>"> "! a "a* a㿘>" @ @" >" ( (" >"  " !>>!b *@@C$!>"b@Lv!!>" >@- @  $"b*  "b!>">?"@&* >"`H""  2"#>Аa!>@a#a>! 8 #$a $#&#&@pmap_steal_memory㿐!>%>! ? !@!>! 8 $! $!>!$! * '>%>@ >1 ؖ @ >! pmap_startup: can't get first pagepmap_startup: bad i=0x%x㿐@֪ >!@N@NS (>"b* @*`>"ap@֫ >!@>"b >*@ !p*` "2 "" 2 @*" $@֑ >@ֱ>b>b" *>>!0ђ !&>#&@vm_page_insert: already inserted㿘 " @"& >"h& >>!>b6@ H* @H /* '& `& `" "`H 0 & `& `" &` " @6 "`  &` "@<>>2>`H(H(  "  "`  H "    ?"2" >> H2>(H(@ 2 2 H 2H 㿘 L㿘H /* '> @   @H 0 4 ` "`" "@>aX`x?"`xH 0 "`6 " 6 & 6 >!Д!@ >@  @>" 㿘2 "  `"  "`>" , "@? "# @6 ">aX`?"` " " "`"  "`>"  "@? "# @6 ">aX`?"` "!H /* '&>D>& DaX"`x"D "`xH 0  2<  ""   > ,  >X ? "2 " ">"   >   >X ? "2 ">X| | 2 ` 2` (>"@ ,>"` ,X " , `"2`"| |㿘 "  `"  "`>" , "@? "# @6 ">aX`?"`)&>`& `""`> "aX 6 "` "`>a@ $>`@ $ ? "# @6 " "`?# @`6 "vm_page_activate: already active㿘 " " `"  "`>"  "@? "# @6 ">aX`?"`  " "&>">`,& `,""`,> "aX 6 "` "`㿘?c ">#  $6 " 㿘?`"# @>!D6`"`$€ $㿘>!X`P $`PH /* '`xH 0 `p>@H> N `xH /* '>!БH 0 9>aܐ $ $@ " "q L %$Ԁ  >` $€ b X $ " < `$@.-` `"  >  >!ܐ! "@`" ` %>( `(pageout㿘>` $€  " 6 "`( >w>`!В`6``( ? ` @   @S   4> ", @ & '$ 'x & 'x 'T>aX`D "`D? "# @6 "? "c $ >a4@6 ">> <!> #  >ː>aX`L "`L>a@ $ ? "# @ @` 6 "?#ߐ 6 "挐`?6`㿘H / )>!̀ ! @J %!?!>"@J$"!>"@J$"%!!̀ 8%!!>!Ȁ !` @J* $!!` `$!!>" 2`@Ju $">" >`(    @Jh  p $ `$  x p@   @@>&!>no default pager㿘>>>c ! >"bp>>Ԡbȑ* >  "Ԡ * *>"؀ > ΐ!㿘?>"ȓ. @>"؀`2` vm_pager_deallocate: null pager㿘 2 > " @㿘2  @ `0   vm_pager_put_pages: null pager㿘 > t#x 㿘'HH Ȗ㿘'HH vm_pager_has_page: null pager㿘2 > L `€㿘>>Ԡbȑ*  ` Ԑ `   Ԡ * *vm_pager_cluster: null pager㿘 >   vm_pager_nullcluster called㿘> !Hpager_map㿐>!@I!>"pق`"p`%> "`"p 贖  "pА 2 "p$ʐ  > "pt "pa "p`  5>ppٳ %>#>p ؘ $@ a㿘>a@I3>bp@8bp, bp 9" >!܀ "bpbpbp{ vm_pager_atop㿘>"p>b|€ > {#X@M>b>" * p.   2  㿘 ` "   6 ?# @6  swapinitswapvpWARNING: no swap space found WARNING: primary swap device not configured swfree errno %d swapinit swfree 0㿘>"#\>"#>  >"耢>##\ >cВ` "#\#cИ ?> >'>\  >  X #>c>a4?@Cz@H$c!>#@H\>$#Ѐ`  ">>  h>#Ѐ > Đ p>@4 ``>   >">>  > Ő "#>  ? 6 !P#! l$ @ $`$\$ $`$\!P#!$$swstrategy㿐 0a,c:  H>#А ) >#\>!4@C @C@C@C@Hf& H ,>ʔ @  2 @  & ( $h" $V? & 8  8 " > \" ` "` $@2 P P`" `4@? "`4 4 "@E`4 `4 "`4 P "  >& P'' P`* @@㿘> #>{  @l㿘> #>{   @lP p˒ E @'''@''ܰ:`8 "`<2 ># ` `  ( $ 0 > 䀢    2 "@" @/:`  ?` swfreeswapswfree miniroot sizeswfree miniroot savePreserved %d blocks of miniroot leaving %d pages of swap 㿀.`>ʐ @ >!> c'' ''c' * @@ "    3$  * "@*`> @``@>>!> c,'' ''c,' * @@ # #>@Ac\4$  >!> c,'' ''c,' * @@  ?l$ 6=>/>+>->$4@G>Ϡc\@G>cР > "4  > >cȖ!p* 2& 4 c * &  4̰$>!* >!  `&a (@Fғ:` #>> ">` #Ȓ, "$ `, "> > ϐ""$ :  sbrk: grow failed, return = %d sbrk: shrink failed, return = %d 㿐@>! @ *@ '" ` :6 2 `$@:  3>`*>a  * " '@Ӗ ">>"p `  ԓ:@  6  @ߔ>"  > `  ԓ:@ " $ ԰ 㿘 䀦@:) > >+ @ >  @"2 " :   :` 0@ B @@ 4  2؀@  ذ $؁ p  d m ((  $b =#->  2V 2R( "NI 8`䀠 >` *@>!% *@8    ( * H?#' #\#`#d#h#l!   @ D #\#`#d#h#l @ D&$2㿘  " > ,!*@">!   +@ 䘚㿘   >!@8  @ 肔  㿘\g >@*@&@ }*@ >!X``  "`   ` "` ?` 4`#`> @4`>!Xd6 " "d@ؐ $   @@Q 0F  0  >   >`) `< M  $g   %g > c''''c'`* @@  h %h $* >!@ k*  ۖ ` 4`$$$&>`& `""`&  & & >"& & $`<Đ㿘   "" < "`"  "`>"   %hN"hK $㿘 @  㿘   @ 7>@`" 2`"@4 $@`2@p > c 'c '* @@ @ > c8'c8'* @@(    $@C>d''''ܐ'd' * @@>8 '8'*` @ 2 86 vnode_pager_cluster: bad offset㿘  @ > >!@  * 8&&㿘  8  <   @  @ :$ S$ ﳐ㿐> 耢`$'>%>`@    ' ' * @@@8'8' * @@`2`㿐 < & > `8'8' *` $  @G >c 'c ' * @@ vnode_pager_io: cannot handle multiple pagesP> >#0@  `,  |>u  c 'c '* @@ @ > c8'c8'* @@Ȑ X >!@  "''Ԑ''ܒ ?'''耧 '`> c'''' c`> `''''`'* @@> c8'c8'* @@`蔦>  !   @?"@ W`  obiovmelvmes㿘>#䀢   `@? `?[%s at %s] addr %p vec 0x%x㿘  >!& ">> !> 4">#䀢  >"  J J J J Jinterruptauxiocountereeprom unsupported could not find %s amongst obio devices namezs㽈>#   4>>p#>!@Y@h>#䀢   >>]"0}Z#"  >@?#a 2'" ''!4% 0!% 4@  >bbN&@ʒ2>#4H@ " @& '>$  N :+>>@c0>bb@>ْ  @ >@>Œc8 2` %`@&W '>$o @̐㿘>#䀢 >` >>ѐ"0ΐ#!>!d  >$ Tdo $!d@>$>!`~@㿘>#䀢 >` >>"0#!>!d  >$ TdJ $!d@>$>!~@ indirect devices not supported 㽈2  >#䀢 2 ` >#耢 "><@2w >#耢 ""  ` <@"l    >a"b ?'` ''  `'ؐ @9 '`  `'`  ?' '` '  >@>a  >@=a  2'>@=a 2' '''@ "' `@'>~$ 㿘o 㿘g 㿘_ vme: spurious interrupt 㿘>#`.  *`8 @$@>>̐!0!d*@  `" @   2vmeintr_establish: not supported on cpu-type %dvmeintr_establish: uninitialized vec vme_addirq㿘>#䀢`?>"X2>>"!d. @ 2"@  2 & >Ð T.`@  >!   2  Tc 2>"@=\ >!&& @K㿘>Ð + @? > `2```" >"  >> %@> @ ? # ?#҃@@ " @ @2@ @ " @@  @\㿘!>>Ð .` >@ "ؔ. >Д  ?@@  ?@㿘>>`  ?@@ۦ audio|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" 㿘>#䀢  `@<2 `?: expected 1 interrupt, got %d pri %d, softpri %d intraudio: could not attach to audio pseudo-device driver 㿘4`>:#09># 3 `2  N0  @g  N.`t&` .`v.`w.`x .`y@  >`"`>@4c> &`4&`8 @`4>c}`># ># !* *  E** *  C*  * >㼐  * 2@     @ D |  㿘@@ސ& @@@ `  #@@@ `  #@MU-Law@  >`"``2` *`  "`` `   ` `   ` `    `4 `& * y  y `    `w`H(((0> `vV `x( ( 2`h` 2`n>V*!2`l2`j>V* 2`l2`j `y -*-H( i* ,*  c* *  0*  f*&* &0*  d*"* "0*  e*$* $0*  j* -* H   D2 "   !( ( " D" " " @ "   D2 " |  !( ( " D" |" " @ "    !( (" D   !( (" D   㿘>c 1 0  `2 `2 @ 6 ` " `   " `  * v* w* x `2 `2 @ 6 w" v  " x *` *` *`  micvolumespeakerheadphonesmonitorInputsOutputs@j>L( _d _ _ ` `h ` "` "`?"` "`$>-"` "` "`?"` "`$>"` "` "`?"` "`$>"`"`2`  *` "` "`?"`$"` >"`"` "`<>"`(2`, *`."` "`?"`$"` >"`2`*` "` "`?"`$"` > "` "`  㿘  H /* %  @(`  |`"` H 0  @ H /* % ` `@ ` H 0  @ 0H 0 auxregauxiliary-ioauxioauxregmatch㿘>#䀢 "    >" >>!>"@9`?~" 㿘0?8 @ߖ >?8 "c>"H?8  * (Hoclockeepromclocktimer㿘>#䀢  >#?߀ > @99 "   t 8@  delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d 㿘> " 0  > @w $a>#(   *`*@ * @ @ > "L>"a@># a *a *`      :# a *` @`>>#ؔ#~0 @ 4> &@!@>~#㿘>#䀢  V` >#?߀ > @8 "    8@  㿘>~ΐ!0  @%>"`>" ܁㿘>#䀢 >#?݀ >!@8 "    8@  >@8s#8`?mk48t02model: %s (eeprom) mk48t08㿘># `>" >>@.b>"~>@8Jb؀ `00  @!>Р  #>a   a   @@(>А >᜔  >#䀢 >>#?݀ c(>" > "`  * *` *   >"`L>" |counter-timercounter㿘>#䀢 >#?݀ >@7#H    % 8@  > x"` > @7`?delay calibration delay constant %d 㿐 '>  ?  +` *  @0?  @ >?"" >? "b" 䀢  ?0 @ ? ? >ϒ "!>"@# '$@ ސ d@`6> >|!@ :` d@6>@ $@!@>}!X㿘Ho o  >#X`"#X` @? >cX?"cX`?H 0  >>>` >|  ᜐ  >|>䀠>(** * * * * cannot get %d Hz clock; using 100 Hz cannot get %d Hz statclock; using 100 Hz 㿘> > d"!0>"!@4̐"@>"a4 !>! * ! *`!  x ! *`0k%>Ц"@0@5[  >#} d$0@4 d>"a4#>b b0$bb@5C > | d$bb>@4"2: >  d@ $ !> `:  "`!>#䀢  >!4>b  * "@>bБ* "@#䀢  >!4? * "`* "` > >#: "`"x #䀢   㿐Ho o>  >!  '   0>#䀢``>" '`? 'H 0G># @  >#䀢    0 ǐ  oldclk statintr㿐> ">>{x#x#䀢 >>">! ' >"" >"   "`0$#䀢 ? 'I> ? !>>bx @ >"А* "@䀢 ?* "`  ;Zx0N8`((`:`(( `:(( :(( ; (( ;`(( `D`E?  F+   2!m!n >+ P?  4 * ( ("* * ( (*` (㿘Ta> h E@3W@3  @3N  @3, & & &  `? >   R 6   &&  & ,R %`& 4& T@3a@3.& @3.@3  <& @3 <&@3  @3, &  @2 @3, &   @2 @3, &   @2 @3, &   @2א @3|, &   @2ː @3p, & WARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! 㿘> |`?Y!  >z  ư!@ > @>I   @-  `-:>"`h!> h  >zÐ $ h2$>@& > h, `"@ h> >!>! T@2;az>z!x>  >`h ->! )`h@2> h !> |   ' ,',',',',',',',' ' `,'㿈@@㿈'@B@">H  *` @( `> (H >H  *`*@ `> (H 㿘#Ta@1@2Ka@1..`@2D.@1 <.`@2= <.` @29 .`'!lP2>>!l!mP.`>> "aH>!@`  `& > "!H.` .` ? ;  7 ' 2mn 8   >@    * (* (* ("@㿘> 0?Ho o> h& h & H 0 >#\ #\ >4>\>t@&\t@А"?@ &   &?/!@& >"c\ c\"`㿘>#䀢  B ` > `%"8@v31> Ѐ %%  XĔ 2` #    , `dАhZ ` @  Y @^㿘> Ѐ  6 , > ܀ #F  @N* :  ,@>!0>@0h 2 >m{8 @N* :  ۢ` > ܀  㿘>`Ԁ  #>  $`ؐ >!8mU  $` Ԁ 2$`> "`ԁ㿘>"`>؀ `"n power㿘>#䀢  >@2L#`? 㿘0  @ >"b>xl#P>(cpu㿘`@2, `?noSUN-4/100 series (%s FPU)SUN-4/200 series (%s FPU)SUN-4/300 series (%s FPU)SUN-4/400 series (%s FPU): %s clock-frequency%s (%s @ %s MHz, %s FPU)name%s @ %s MHz, %s FPUcache-physical?icache-line-sizebad icache line size %dicache-nlinesicache-associativitydcache-line-sizebad dcache line size %ddcache-nlinesdcache-associativityecache-line-sizebad ecache line size %decache-nlinesecache-associativityWarning, guessing on HyperSPARC cache... bad cache line size %dwarning: couldn't identify cache vac-sizevac_hwflushvac-hwflushvac-linesizebuserr-type%s: cache chip bug; trap page uncached %s: %d byte write-%s, %d bytes/line, %cw flush throughback %s: physical%s%dK instruction (%d b/l), %s%dK data (%d b/l)%s%dK external (%d b/l)%s: physical %dK combined cache (%d bytes/line) @'pwp :  H2`:` > "ah@ϖ>#>#䀢 V!> >#耢 "$! " # !>C> " $0>=> >ϐ!>cx۔$!>"#(#(" " ." !>cxΔ>"c(c("` "`  >ϐ!> `x >"c(c("` "`  !> `8x>"c(c("` "`  "`>  X>va#>c? t> ``@  c@`@ c䀢 > `#>Ϣa!> @ p@@xs> > `#>Ϣa!> @f @xa>  X>va>#䀢 !>#( $`> @`>`?>#쀢 "   !>> > !>#( $ > `@? $ $@    `*  * !>>  u!>#($ (> `@ @> a@ @3]@3[$ > a@  $ 4    `*  * !>> !0uQ!>#($ 8> aH@ > aX@ @3*@3($ ,> ap@ٔ $ D    `*  * )>> !u)>#($H> a@ > a@ @2@2(8@ $< $4$,$  `%#(> uߐ!$` Ҁ@"$#(>#(`#(o:` "   `* &` * >> !tҒ8"#8u">3"#(#($`> b8@f@$#(> bH@` > bX@Z $`> bh@S $`   `* &` * >> !t"#8>"!> bx@7  `? > @b > "ur`>#(U#(` %> >!` > "> "> ">#4 s`#4 huR06` *> "uI`` > #`$u@: > #(>#T > #0`4u4: > #(>#d> #H`Du(: u&0 > #``` u: @$W8601/8701 or MB86903MN10501TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55B5010RT620RT611RT601 or L64811 v2RT601 or L64811 v1MB86900/1A or L64801MB86904IU impl 0x%x vers 0x%x㿘> !Ȁ`!Ȱ ? 2 ? 2  ?     >#vlaB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version %x㿘> "0`"0? 2? 2?    >#vcmemregmemory-error㿘>#䀢 2    ` >##@.`?memregattach 㿘>#䀢  >"Ā 2& >$sF ( 5> 0  @d &>$t" 8mem err: ser=%b sva=%x WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3mem err: ser=? sva=? parity error register not mapped yet! memory error%ssync mem err: ser=%b sva=%x aer=%b ava=%x aWBINVALTIMEOUTDVMAERR㿐>#䀢 (   1>0C? 0@"Ā  >$ >$s >$!">$@s0 >$>$s!`>$s!x>$r! >$!>$!>$!>$!#\#` >$s>"Ā`" >$>$!@>$s0>$r! @E mem err: sfsr=%b sfaddr=%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWasync (HS) mem err: afsr=%b afaddr=%x physaddr=%x%xSYSERR UNCORR TIMEOUT BUSERRAFOUnknown mem err: if sync, fsr=%b fva=%x; if async, fsr=%b fa=%x pa=%x%x㿈   2#\`>$#X>$r>x`>$#>$ `3 r4 `2 #`#d>% >$x >$r(cHyperSPARC async cache memory failure at phys 0x%x%x. Ignoring. store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. ERROR: got NMI with sfsr=0x%b, sfva=0x%x, afsr=0x%b, afaddr=0x%x. Retrying... memerr4m: unknown fatal memory error. type=%d, sfsr=%b, sfva=%x, afsr=%b, afaddr=%x㿐>% 6 r>"؀ >>"܀? j>?"b>"">^"b܀ + >%!@r>" +>"؀> M> +"b>""؄ Ѐ$Р0? ` >%rp!x7> 23& 2-&>$#\>%!>$x>$rXc>" >"؀> >"">""ؐ##\#`>%">$xqPzs㿘.3>c䀢 X c Q 㿘.3>c䀢 F .c䀢 ? slave㿘` @+װ "$ >#䀢  >&>>#䀢  >>&` @?V`  `?   & 48@ zsattach: expected 1 interrupt, got %d pri %d, softpri %d broken zs interrupt scheme㿘>`#x,`@$ 2 0 "0>&pĐ!>&!q0>&! q>ch >"ch"#l>@c >@}c &`(#l"&`(>&p",``,`&`,&`4>&`@'"&`d&`0@۔  l"`l>,""`>-!"`Ȁ`&  >(`8>(8" " #@"  .3 @"А &X*` P &\``&@&8&@ l"`l>,""`>-!"`Ȁ`&  >(`8>(8" " #@"  @" &X*` P &\zsconsole㿘`>'p >`>Π#x*>`"#$@7 &>΀`"t`"t>>'!"b8>"# >- p&>"#p㿘>΀ #t Ho o>#䀢  H 0,  #>c䀢   c, >#䀢 ݐ H 0inputoutput%s%c: console %s i/o㿘>#p >#  >'">#$ >'"`2 n 2 n* `*  & l>-!& 8& & #J& >,"& Ā`>'"`  a >'"p]  .6.4㿘   * @' 㿘@<  (& p㿘z "& p㿘 >c:c*@  * @*``, L`6 "`  H /* & p    #"$  $ "$ %$ `8$ $ @ ͐ $    H 0U @p `>c ` 2 pL`2 ` p $ p`'  @# p "$ p >! א p  @A  p }g" pH 00H 0  > h*`@ €@  㿘. > a . *   ,@ > `h"*€`@`p "  @  >>0d  H /*, %    . % /. H 02 㿘. > a .  *   8> hb* 㿘. > a .  *   8> hb*  * > * b@(8㿘>"`g ``XΒ 8.` `T  @   `\* "@ @Ԓ   `\* "@ @   `\* "@$`T".```d ` ``@[   `* "@ ``@   `* "@ ``@ɒ   `* "@$````2` "/ >#? >@ /%>`ؐ "`ؑH 0&>! ?8 *  * @>#䀢    ǐ  㿘>#` "L 3 L 3  >c *cJc  *c  ,  M . L   @, , .    0.@!>#䀢`a  8.@#䀢 ". Y .   0.@!>#䀢  8M  8.@#䀢  E  㿘 < ? (.@1>#䀢  84  8.@#䀢  ,   @& <`& @ @1>.`#䀢  8  8.@#䀢    㿘!>#@     .@#䀢  8  8.@#䀢 ` `"   @@`   `  .  `",`N 4 >c䀢 @   #䀢 ΐ @ #@ 0,` stopping on keyboard abort 㿘>*m"@dzs%d%c: %s overrun 㿘@>h@ h>*c> &@  maringfifozs%d%c: bad ZRING_TYPE (%x) 㿘>"Ƕ 9>XPT" % > h"*` @H>*Ĕx%?,$P \* @ ` 0   "<` "u 1 ` L>*`@<`@`@Nv?@p? €k? 0 "<pH /* ,# @ `  ` # ,# G @H 0D`,0p!2p@$<`$@ @.`#䀢 v 0rp `$p $p@PH"  @?<`@  4`  € 2,1@9 ,1>*c= al<?b C$P2?X㿘. >  . "*   , > h"+`@`@ 6X &ڰ ]@"NN 2 y@"Ő x@ÐȰ  z@+ {@   k@"  j@  \@"2  H /* , %    . %. 0H /* , %     . %  @ 2`  2`}&Q "v  p l H /* , N 6   /. 2    . / .   /. 2  . /.    $   /   . / .  #    . # .  @  /   . / .  #    . # .  @*@$ H 0  @0   @,    㿘 l>*` `*` * @  ,@H /* & pF V  H 4  H & pa Hs}  Hn $ p & p PH 0, !   , !5,  *`>#䀢  x  $ @$ ( !(b(,H(p" <p"pH 㿘`(> l *` `*` * @  ,@`$ 2  ,@ { @",  q @"z`& & & H /* ,,`,< ,`- ,`!c! !"      @     @  `@@ ` 2 >#䀢 ",`#Ԑ ,`#?,`%d D L@" @2 ,`$ ,`),`* P,`+ ,`. `0`,`/`  p  `<,`0$`D $`<` `۔ `@;H 0 㿘` ? ?}H /* , %  0 `. %  p   <. 0& D & <    (. H 0㿘 0.!>#䀢 c #  #\ #  #U #  N ` `  `  `  ` `  `  ` ߒ ` ے `ג `Ӓ `ϒ `˒ fdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo㿘>#䀢 ) > # >#䀢 >  >#䀢 2>.>.!!@#@      ?   drive %d㿘`>.i" 㿘@%  @  " d@ @ o@@  [version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c 㿈 08 @ &`@$ \$ |$ T T$ X> p" `>7 $ `a@b>3"X$ ($ , @( ( @ @ @ $ p`$ t$ x    7 * x " 2`72 @ ` $ `$ x @$ p $ t@   X@  X   X>#( " X>.i#X X$ lo `  @ @f >.h#h>.cdה >.# h' (>#䀢 >.>.!!@" 2'  "  '   8'  @2'  @"''>#L!>.'"c?   ' @ fdprobe: %d stati: %x 㿘$ `g    x *@ *&   & @ @  ## p Ѐ 2 a"@  >@ِ  > > >#(  >/"hZ  >/#>/b `hPb>/hJ"    `? `   x*@ 衒 : %s %d cyl, %d head, %d sec : density unknown 㿘   0  >0h h?>0h ?&`&`&`,`" D`&`0> &``(e2&>7!t@>1!X &`@֒ `` `"@``   *` ( (> fdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld 㿘 ;>`ԕ:#`*@ "  H &  02 E,  $:`  $ `7& 46*`  /& (& 0  H@5`>#( & 4 H 0>0 g!ȑH /* % Ȓcz >1!3 @H 00 $(& $t㿘 $T & & X& X`" "X@ 㿘  $ Đ  &  `&  "` $ X  "` " & &  X&  X" $ X &`4& `8& >1>a0!*3 $ \fdc reset 㿘 `   x*@  p *B p*>#( >1g 㿘 `   T      D " ` "`+ `` x*0  D "` 2 ``     A㿘H /*% ?&  $H 0㿘 $H /* % ?& T \ @ H 0fdcresult: overrun fdcresult: timeout 㿘a"  p Ѐ  $ 2  >1fb? t  *`2 p >1fbȐ?$ ? pa ⠀ $? t (㿘  >`ԕ:`*@ *"``  *` *  * >c  `2 2  "$  "$ ) ? $  <` $ @   a& *@" 4  8 8 $ 8 $ 4 8 4  $ <  >ć8(("`"` ("`4 `8`8("`8("`4`8`4 "`<㿘>0">{  @Gi㿘>0">{   @G]㿘@%s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltdrv_chckdrive_rdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam㿈>2 $"H \  ej >2  >/0 " 0e\"0"` >2 eUx0>2 >2 (#\ "#` >2#d x#h>2eB"timeout㿘 TH /* % >3 8 "& \ \ & \@pH 0㿘H o*@e@]H 0fdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interrupt㿐 | >3 \d! \? -& |>3c!@ T`2`& \ 2 \``$``"``& X``"@$``}>3#*`@ X \ D ф 8 א ר  p& d$`>1! 0$` H0x$``   [& \-` *  D " ` 0a ?$ ``C$`  ``& \>!0>1"40:3 ` ?$`, ` "` 4E$` 4@A  2' `     & |    `  ` 4@! `( ` ? Z& \$` & \& `X`(BaU<`X>3>a0 @/ĕ* ``@*` $!: 8> !: 8$`, $`@b@ ǒ <` $@ & `%@ p& ,*>c(`  >3!p>3!>3! ``c#\ & \ & |  & / 怢  : ' ŀ 3`-@  ` ,  ` %  ` `               & \``(>3>a0 @/)*H >3 @/Y  ``& \>!0 2!>3@۠ /3 `(`  > 2 >` 4 (@ , @ >#(  >33$` ㄒ C   0>3 @/ 0 4`(`"  > >?@=>#( "  $@">3>3!Ȕ!ؐ ``>3 b!   l `4 h  @>#( & l>3"bВ ;& h h  & h  & \ d >.`!>3 " !?; _ >/b"& d h??& h l`  @>#( & l>3"b & h``` `$``@ `$`" $```@`P% 4( Ts dW&  & | & \>3>a0 @2 .A:` >3 @.qА & \ & |&     `  & \>3>a0 @*. = >3 @.N  ``& \>!0 !>3@Р . (   > >?  >#(  >30@u T$`` " `  >3H hard error㿈 T d`  & h 6 "  ``    `   .& \,& \*& \>.!>6 !!?; ^E >2" >2 >2 (#\ x#` >2#d "a#h $ ( $"`$g d & d? 㿘 : >*  Ē`m@ @   p@1E e@-   q@  E g@"  ! @? 2   @ "  >0 @Db@o floppyfictitiousdefault label㿘 : >`đ* @ ! @P@M" 4"$(  $8 $,  $4 >6cp $0.@4H>6cx@Ɣ  4J84@6$$, 4 !W$$]i4>0b@[ >6c@   `$ 8@4$,$ , ``  4㿘 m ,  h Insert filesystem floppy and press return.㿘!>/>7`!H@z  `"/>=%/>d%d/> 4$ 4   -'   @2 $ J$ *@  , ,2 @$ $ -> - ?$ $ -- $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ />M-/>@̀iommu%s at %s㿘@>7 `c# 㿘>#䀢  `@& `? unsupported cache-coherence?page-sizebad iommu range: %d : version %x/%x, page-size %d, range %dMB name㽈  >`"!Ȁ`>7`%#008 0@[ &`(>7@dc&`<>"a#>>8` @ǒ``(&`,@ 2 @*@`(&`0 `,> "*@`&`8` @]* @H@  Ѓ@('> @ @У@'> @G* `8?@`0@@* ? #?  `8&@ё: `( 0"`Є&`8? @&`0?`0&`4텐? * >8 ^ǒ Ho o`(" `(+  ?  >a"`(2` |" `(" H 0 `,`(>8`0 8@3 2 `_2  >7@Rcx 2' ''@=>8@`h@[ '>7Y @0>2@>*`>``4>"08( ( 0 >`>48"0 ( 4 8"0 (ؠ( 0 ,@sbus%s at %s slot %d offset 0x%x㿘@"">9 _ ">9" _  㿘>#䀢  `@ `? unsupported clock-frequency: clock = %s MHz burst-sizesname㽈 >9^!@0F>9aP_^@@$(!>9@!`^ѐ>9ax@ $8  >9@` 2' ''4$0@{$4>9@Za@  @ '>9Y) @j 42&`0`4= 0"b?(@"b "b  `0>`"b( @4"`4` 4`  4`@ 0( `4"b`@""b   4 `0  0 2  4 4 # 4 0 # 0``@` sbus_establish: can't find sbus parent for %s㿘`$>:    >9 >: H]>`@Ɣ  "& $ ,& $ ,reset %s: %s㿘>!. >:@ ^   , #>: `"  @`]   2 getxscannot allocate scsi xs 㿘H /* %   1>:`:  !P, R  ` ?, > `"  "` "@H 0`H 0 h =[``@m>:]!X  H 0 & 㿘 > ?&  &" "&  ` ` *` *`S 0` €` could not get size p@d  %/" #\#`h#d  @'   . * *`  @>:]M#P 㿀@: / ##\#`#d   @ x@&  @/ /a"#\#`#d   @ 㿀@  / ,/ ##\#`#d  ,@К 㿀@  //##\#`#d   @ 㿀@  ///`!0 ##\#`#d   @ 㿘   @!4  € ?"#  0 RՐ0$@ ?2  @ "      & , €  scsi_scsi_cmdscsi_execute_xs: invalid return code㿘 & , $ ?& & (  @ "9   " 04>;"# 00>; 2/?H /* %    !>; "Q    H 0 0 ?@B ?" & ,[S"㿘\d`F2$`  `Y臔$`$`$` $`$$`$`$`0   ?}0 scbusyunknown error category from scsi driver 㿘 ,`:*`><!H@ ` h 3 @ǐ?" ,  ?    "@   > < ><P  ??$ $ , ? ? $   @ ><[ @㿘 0`" "($"(0("$"4 ("4 unknown error keyverify miscomparevolume overflowsearch returned equalcommand abortedcopy abortedvendor uniqueno data foundreadonly deviceunit attentionillegal requestnon-media hardware failuremedium errornot readysoft error (corrected) DELAYED ERROR, key = 0x%x %s, requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data = %02x error code %d at block no. %d (decimal)㿘 `4@? @  p q@֐ `><#[ ` @   ` ` `* *` * `  `  ` I>=!X*`@ ` ` @ H ` ` P H X($@"+$(0   , @  # !     ,`~?  z` x     ?   i@o>!,, @><Z# @ "+ `?` ">="̓*`@ H 8 8 H H H 8 8 ><# ><Z#>=  @Z `>= Z{ ` >=Zu 8 ` 6 >=%>=@ ZkH ` @>=Zc P0@!>= @ XZ[ ` @ " >= `>= ` h `*`*@ ZM@ >=ZJ P %s(%s:%d:%d): probe㿘>> ` `>> (    Z1㿘! T9Ԕ @!H /* %> &" "& H 0 㿘H /* %  " "@H 0 : TH(>   @  HUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code 㿘 0`i >>Y!0@2*`^ >>Y"05 X*` ,`%a>>#*@  4 T x h p $ (" $ $, [ , Y 4 Xג ( 7 >> "     . >>"HYi , [juser_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistr㿈 W2 0>>YA#U ` a >>Y6#J ``2 `D  ( ` >>Y&#: 2(  ` < #\#`#dҚ 2& (H /* % $"  !>?  M  $"H 00& ( $h" $㿘!"v !w! t r  !"` !"A e 0!2`  `& >?   x&&&x &|&>& &&   :3* &,&D&8&@&(F0 `|0' `.  . ``  . `  @. "   .  @A & &  & scsibus  㿘>?`#.XS&`({ ?`@D?㿘`   2   " " 㿘?>! !>!!.  "`@` ! @㿘  >aa. @ 2 (5    `    !  @4 @"`4`@!,: "``@뀦@  @ "`"`   ""$ \ @_\* @ 00* @ 800* @ 0*2** * `*02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE CP150 CALIPER 6027MK538FB TOSHIBA ST296N ST296 ST157N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S QUANTUM 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR A00MD21/S2 ESDIEMULEX RZ55 (C) DECDEC 3.08OMD-5010 EPSON 1.04CD-ROM DM-3x1SShinaKen1.10CD-ROM DM-XX24 KTEXEL 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-55S CD-ROM CDU-541 SONY CD-ROM DRIVE:841CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.31CDR-H93MV MEDIAVIS2.06CDD521/10 IMS VDRD-25X DENON CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixed@>BUy"  ` `  @2 @ `  >B>B >B >B>B !">BTm" !>B"H`OВ `H>C *`@                      >B""X>B"`>B"p>B"x>B">B">B">B ">B ">B">BT">B"А= 8 p 3  ` #\#`#d>B">B# >B#0#h#l Tߔ  not configured 㿈.`.@`,   4v  (@$`$ `$ ` $ `$ `!$ , , >pn$ >΢#@ ,  2 ` `*$* >>ΐ# *$*>΢#>a 5 @f쀢`  ` ,  `     ,   2>ΐ !,*@.!,> c c  ,   @: @ `  "  `/` ` > #   !'>ΐ#'>@ N/ ..`@"`, >BO80  >CT-!4 㿘  '72 @@2.@`2*@@ ` `@8 2 @` @ ¤  ` @- 2@`@  `@" 2 @$@'@β@cd㿐>b̔   㿘>"&`"` ` "`  *`>"&``&`0`(PƐ@ɡ  2>D` &`>DS!Ёcdlck㿘 1>D $ !"hHV "       $ 㿘 `& & I㿘 >b:b*@ 2 s Ȑn <  ` ' b  !] s!W  `!T,`2E < ` 2  ,`@J 5 @   !&  `6' . @      8  8*@$ 8 4*@$ 4 8 4@ " < ` ,` <  ! ` ,`t㿘  >":`*`*`& H "%    8  8**@$ 8 4**@$ 4 8 4  $ <  є!@ ` *`< 㿘 ;  : >" 0,@` (@  ,& (`   $& (%,$  ` @Ɏ@ $ 0H /*%`N@H 00 $(& $ 0" 4%s: not queuedp  /   - H0| `y`&  2   $`(`$h" $df (`H@4 `;` ` !"@ "`0*  `0?@ ?, @ @ . `$  /4 /4 /// @  `$ * (/4 /4 /4 //4// Os (`<`0!0#\#``$( #dȚ  " >E# Q   2 㿘 `   0  ( 0 4Oj"  㿘 ;: >b* @ "  ( 0* "@ 4& 0  @㿘>E">F !3\㿘>E">F  !3P : >"(@ `  p" ?#"ǐ#"# "# "oג #"ː0ɐ #"  # #" #    q" / #"}# "#Ґ E eF  # " #    m" ~  E f":  #"{ #[k   h" d 0#" E g W 0#"pP  P!Y  &( *   @O&M 7H     @h$   B" 09ؒ@ 3 @/氒*@#"@ ƒ @/ư@"#\@  @/@ +@>*   8'  x@L Аx 7xɰ "hð @7`h?8lH@1 /\/^/`f/b(@  =.?.A.C .@  // ///!B/#@ s / //3/Ȓ@ f /ܐ //&/@ X////²@Ԕ L /// /h@Ȕ @ /|/~//@6  @d/    Ӕ %      @ *` @Z` ` !"@ 2  SCSI CD-ROMfictitious㿘 !@  @ "  $ ($ 0 d$ , @  d  0$ 4 ,@ ~ $ 8 >Hb@   4  >Hb@   ($ <!,4 H 4 J$ X$ 2`  <@ d$ $   (,  <@ ]2` $ ,  4  !W$$ K4 p@ >  %/`'вh  #\#`#d   * *` *  a$($`* *` *    c"$`㿀@  @   // /    #\#`(#dŔ 㿀@  / /   /.@  #\#`#d x@В  E/6`/6`/6`//6// Ô@   #\#`#d x@  /6`/6`/6`//6/6/6//     #\#`#dg x@  H/////     #\#`#dN x\@t  G///////'Ж    #\#`#d3 x@Z  K// 'Ж   #\#`#d 㿈 'Д    #\#`"#d x@6  B`/ / @///7`//  #\#`(#d x@  C`/ //7 //  #\#`(#dΔ 㿘@? ? ch㿐>c  Ƙ %s: offline %s: %d slot%s, %d drive%s, %d picker%ss, %d portal%s㿐>J!>c&`(""  M*@m  >J!M`4`0`D>J!`>J!>J!``L >J!>J!``@#\`@ $>J>J!А!`#`M`H` `>J!>J!>J!`M >JM!`0&`,㿘>b b. @ 2 (  `   *` (' 2  (@ 2 ( ` *` >* ( (㿘 >*  c@ R@ #@"?,#@"+,I( #@"(@B( #@" #@5( #@.(@2 .@| *@ &0" ""?@$0   ,0" "@"D"H" L "@ x@4I ``4E *`@`?4= *`@` ? 3  P: , `0 0@@  /, 4 /,`4`/4  ,4`///2 ``/ / (a   #\#`#de x@4g ``4c `4_ *@`?4W *`@` ?4O * @`?@ E  T:  T: 9 0 0 0@@T  /, 4 /,`4`/,4/4 4` ,4////2`` / /`  / (a   #\#`#d x@ * . `@`?% `0 @  +/, 4 / ,4 //2 ``/ / (a   #\#`#dĔ %s: warning, READ ELEMENT STATUS avail != count 㿘.`@`@  S $ + `0 @J$<``@ ` ` *  @ΐ ,  +n `0`@@0"` ` ``@*  >L!PK +U ` , `@C`,Y ,T x@  /6`//6//7 /7 // (a #\#`#d8 %s: could not sense element address page %s: could not sense capabilities page h@H ؐ@D  / / /   p / (h#\#`#d>LE#xސߒ * $ 0* $ @* $ 4* $ D* $ 8* $ H+  $ <* @$ L@ / //   / ( #\#`#d>L#J 0 P@  T@ݒ   *`P *`T ( `  *`sd㿐>c\   %s: drive offline %ldMB, %d cyl, %d head, %d sec, %d bytes/sec 㿘>#L&`"` ` "`  *`>#H&``&`0`(G@|  2>M` &`>MJ">M" J` 횔!  >M@Z  >MJ}"(0!>M`"8@@````Jmsdlck㿘 1>M $ !#? "       $ 㿘 `& & @]㿘 >cD:cD*@ 2 s Ȑn <  ` ' b ؒ!] +!W  `! ,`2E < ` 2  ,`@ܒ 5 @M   !&  `6' . @      8  8*@$ 8 4*@$ 4 8 4@ " < ` ,` <  ! ` ,`t㿘  >#4:`*`*`& H "%    8  8**@$ 8 4**@$ 4 8 4  $ <  쉔!@ ` *`< 㿘 ;  : >#4 0,@` (@:  ,& (`   $& (%,$  ` @F@ $ 0H /*%`ED@H 00 $(& $ 0D" 4%s: not queued, error %d p  /   - ?@0| `y`&  2   $`(`$h" $f (`H@q4 `;` ` !"@ "`0*  `0?@] ?, @ @ `$  /4 /4 /// @ђ `$ * (/4 /4 /4 //4// F( (`< `0##\#``$( #d} " >O @H   2 㿘 `   0  ( 0 4F"  㿘 ;: >c4* @ "  ( 0* "@ 4& 0  @㿘>N# >O "*㿘>N# >O  "*㿘 ` : >#4(@ `   q@"p E e@"% p@kp `  m@P i ` E f@"   h@" \ ` E g@ U ` }!a  &("*   @W&U P     @$ 2  E g@2 `4` *  a  >N @c   " 0-2*    ?$ !  ג@    ` ` !"@     SCSI diskfictitious%s: %s 㿘 !@ @" $ ( $ 0  0$ ,  ,@$ 4 $ 8 d$ 8 >Pb8@#  4  >PbH@   ($ <.4 H 4 J$ X$  <@2` $ ,  4  !W$$ C4 >Nc   * @ >P"XGl x@Z @V  // /6`/6`/6`//   #\#`#d %s: could not mode sense (4); using fictitious geometry %s: mode sense (4) returned nonsenseX@  / / / pȘ $ #\#`h#dڔ   >Q G  >QG  @ 锒 @,@ ,`4 4`"$`,$` .  *  6 Ҁӓ*`* @@ &  `>Q֐ `2 "&  i  @& @6.  㿘   ? : >* c4* @ "`* @ ` ?`  ?㿈'> 2l  $   >cD:*&#cD*@ (@L N @.` @.  ``@ @ < : >4#@[  */6`/6`/6`//6//@L h ` & &  &  & &  @F& & (& ,& 0& & $ @  $  263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st㿐>cp   %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled㿘>#`&`@$ $  , @C>RE"@`L` >R"H>R"P>R!E 4  >R@ >R>REp"X&a`XEk"h`T`>R>REd"`(E`"`( >R">R">R"ET &a&``&`㿐>c  L ` & L& \& ,@" 8㿘 `  L h  @!  * \ " ?$  *  ,@  * `  %s: already open 㿘 >c\:c\*@ 2 @=  `  : >S!D 1   睐# ` ,`!  <2`2 (@Œ  ((`@M$ <`    ( $ (@ ` ,`㿘6 >cL <@ ( !   @   " @    @ 2 @   2  @  @ @ ` *` %s: cannot set selected mode 㿘 > >cL* @>  ( ( @b  @$ (,`* `  \  @$ ,Q  , @F@: A@c < ,`*  h X, 4 ( ?$ (  ,`@H 0!*  d $ 0 ( $ (@z >S !@ ( ?($ (   ,#D 㿐 (( @ @G @ @ @ !@` @Z @ ( 7& (  ,  D" 4 H2 4 ( D" (F" 0%>T؇( R R R R$ R$ RP RP RP RP RP RP RP RP RP R$ R$ R$ R$ R ( T" ("" 0"" 0`" ( ,  T2 ( T (" ( T" 0 (" 0" ( 4 4  (& ( ( (" ( %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d 㿘 ;>cL 0: * =@`(  `0@ >T#`CZ `D >T`H   >T#@`HCJ` & (H /*%& `& `"@ @" H 00 $(& $ 0." 4%s: not queued 㿀 @ `   `  ,`9/0 쀤  ` "`&  " (h" ` `  ` ` `,` $" (3`"! ( $@2 0  @ " ($ ( $h" $S `$ ( $$ 4 w$ $ (   0$ ( $$ 4h$ $ ( & (: `@  $@   / (% > & (/( (   / 0@D 02  02 /2 //  <a 0b#\#`#d] " `>U B  ` 2q `㿘>T2>L `< #l@  $㿘>T2>L `< #l@  $ 㿐 !@ :>cL* @  0: 4 @ !@!@ 0 !@"T@ @. 8 4@ 0$` 4$` d$` p$` |$`  $`$ h$`( t$`, $`0 $`4``>V Г*`@ Y Y, Y( Yp Yl Y Y [ Y ZP Y Z Z( Z< Zh Zܐ@  @@ &@ @  @/  @lВ 0 @; @5~ @ v  ϖ (*@9$ ( ( 4$ (@Hb`2 D ( ?`@  H  @ S  H@$ (M  ( $ ( ($ 0 $ (`B  , 4  <  @訔6@ے >S#A~ , 4$ 0 ( %$ ( ( ?!$ (   T@   ,0,*  0" d `  *  4* h ` *` 㿀1 @>  / (  / 0`@Ԑ: 2`/2`//6/6// @a #\#`#d x`@  % @  /##\#`h#d  ƚ  *`@$`D * *`  $`H0 8  @@٠  //##\#`h#d 䛚  "$* *`  & P*`* @@ & T. X " 8 ( & ( 8   ,0 8  @@  //@ / `/ 4/ (@// ( "  8 02 /2 // 8 ܒ##\#`@#d 8 㿀@`  `/  / @   #\#`#d 㿀"$ ( "9 (B` ("0=`3 =8`     " (H (""& ? =  `4 ?߀`6 ( ?& ( (  ?& ( ("` =& ( `   ?& ("  ?& (`@  //6`/6`//   @n# #\#`#d㹘  㿀`( `  (!"! ?& ( ( =ϐ =& (@ʒ  /6`/6`// @a   #\#`#d㉔ 㿘 ( %$"  %  & &` 2  N x`  ٖ " , , 2 @~  //   @$# #\#`#dA x   (  @]& ( //` @#$##\#`#d    %s: block wrong size, %d blocks residual %s: %d-byte record too big 㿘  4 0 4    7 8 9* *` * :   $  p2? ( "L $ 0@& (  @ ` ( $ ( ($`4  ` ( $ ( ($`4   ` ( $ ( ($`4 "  ,  2 ,>X# > , "  (  2 ( 0>$ 0 ( $@&.  ( 2G  &`2?$`4@ & (  @2;  `6 0`0 `  2+ >Y  $ >"# & ($`4   2? , "  (  2 ( 0>$ 0&2 ?"$ ( $`& ($`4 ?㿘$ T; 6  #$$ 0 02 ( (    ?$ (̒    ' T0 ` 0@4 0 T  dmaledma[%s at %s] slot 0x%x offset 0x%x㿘@"">Y >=#">Z" >8  espdma㿘`@   >Z@ ` "   >   *& 48@  cable-selectiontpeauiburst-sizes: rev 011+2unknown nameesp㽈 0, 2  08 @~# &  >Y&`<@c #>>Z@q`>Z@a >Z@a 2 `<`<*@"`<@ "" >#䀢 />Z>Za@qi??&`L 8 " &`L`<*@"`L  `<@"@>Z"`< >Z@a`` 2>Z`<@ ">Z=! `<< @$@&`D@( @" >Z>Z@ `2 >Z>Z !( !0>Z!8>Z!@!H=c>Z=`!P` >@#@2>^>] !T&`p>[#&`h>[#&`l>[!&`d>\ T&`t>\#0&`x>#䀢 J&`H 2`( >Z@`` >Y@c耢 >Y@c 2' ''@p`H">Z@paX@l  u '>Z 7 @pΐ0>Y@ɒc耢  `>Z@tc!` &`4" tCSR = %lx DMAWAITDMAWAIT1㿘! ? <$  ? 4 < 2  D <>[<͐!>[;!'#@ <! @? @"@ <   ? 4 < 2  <>[<!>[;! <! @? ="@ <  ǐ ? 4 < 2  < <>[<!>[;!@ Ȕ"@ʲ! ? <  ʨ ? 4 < 2  < <>[[;!@ ?"@ <@ "@ D @(& @ <@ "& @ <  < %s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address㿘! ? <$ X ? 4 < 2  D <>[[;4!'#@ <! @? @"@ <  7 ? 4 < 2  <>[<!>[;!! ? <   ? 4 < 2  <>[;!>[:! <! @? "@ <   ? 4 < 2 & \ <>[;̐!>[:ߐ!& `!>#Ȁ  >[#  \;@  \?*@@"@ 8 & X'#Ȁ >\ X; >#䀢 2 \ X   \ X@^& T& P>\: 0 <"  < \ <"` <" ~a <`"  <  " @%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activedmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d %s: xfer (%d) > req (%d) dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d 㿘 <>#Ȁ  >\#P >\;#p>\# <  # <>\@p #@0 @ 2>\:#! ? <$ $ ? 4 < 2  D <>[:!>[:!'#@ <! @? @"@ <   ? 4 < 2  <>[:̐!>[9ߐ!! ? <   ? 4 < 2  <>[:!>[9ǐ! <! @? "@ <  ϐ ? 4 <   <>[:!>[9! }" X & @>#Ȁ "  4 p >\ # *`  :~z   4 p  !>#Ȁ >] :l#Ȁ!>] (:e  4 *" 4 p*  4 `~ 2 X`p `y `@*  8* @@ `2  X X@@2 X 4 y @"  X >>] 8 :6 X>#Ȁ  4 y p`@ >]  X 8 : > \@sZ>#䀢 2  ` P " ` T@} X `@""@ \@ "@Lance DMA error, see your doctor! 㿘 < >^9!0 <>\@p ="@ <>\#` " 9 esp%s: scsibus 㿘@>^9Ӑ! 㿘`@     >   &88@  dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequencyespattach: no dma found: ESP100: ESP100A: ESP200 %dMhz, target %d intr㿘 >^bP@& 4`?`>^9|"X0>^"x9v&c$ 2 &`p08 @y &`p$#   >^b@m $#(#>^b@m?$# $#(["$# #  $ ($# # @b@`$# $ t& 4 >^@p"P $ t" 4>^8N" , y #(, z , x y p* , p , ?_ >^9&"   , y p* ,, z p* 0 , z p* 0 p 0 " y>^9"  , z @, y p* 0>^9"ؐ $#,# @##,`$#0```"@# "@# $#4 $#0@$#4@ $#0$#4#  @| , { 2#  , {# *"@ *`" *  {* @j*` , |," {  @, {# >^#(8Đ">_#$ 0 2 >j` ( $>j $ 4$ 8#$@s 4>^c4 @$ l>#$ h>#$ ` #(, \, [  (>^@ca #   @0 >^@Oa  ?   @ @f`  X>^2  @fW %s: unknown revision code, assuming ESP100 㿘 t d@!>#Ȁ!>_#8J  ." p*` #Ȁ!".">_#8> ." p* d!#, " y  " x >_ >_ z p* 0 y p* , x#8!  x p*  { p* $ p*  | p* esp: resetting SCSI bus 㿘 t <>` }"8>#Ȁ!>_#7  ." p* [ESP_INIT(%d)] 㿘>#Ȁ >`!h7" % &  & &  & &  & &  @ɒ!`  $ " "& @ ? "@`, ,"@ 0"."  ."  @",&     @"`, 2 O!&"&" "#0  `  ; @? ; !*``#0*`*`"` ." .">#Ȁ!>_#7u  ." p* 0 ."@regs[intr=%02x,stat=%02x,step=%02x] 㿘 p  p. ~ `  p.  ` . } ~ !&">#Ȁ >` } ~ 7C#㿘# @>@Ԓ @& 㿘.`"* # @Ñ* [espselect(t%d,l%d,cmd:%x)] 㿘`*`" * "#>cȀ >a 7 ."cȀ!>_#7  ." p*  p*     p *   p*` *  p*    p*    >#Ȁ!>_#6ܒ C C   # p* &>#Ȁ!>_#6Œ B B." p* [esp_scsi_cmd] [0x%x, %d]->%d TRY_AGAIN_LATERSUCCESSFULLY_QUEUED㿘 !>#Ȁ `>a6"8#Ȁ "     `>a6"H H /* %` @``"`$`@"@` ?$` H 0`2 $`>#Ȁ >a6p"XG   ǒ` $` $`  $$`$,`(H /* %$@$` "$` ? $` !>n >a0@L#\@# @H 0 @  >#Ȁ  >a6*"h [esp_poll] [esp_poll: rescheduling] esp_poll: timeout㿘``*` *  * >#Ȁ  >b6 "  t l@ "`@`   " 2 ?>#Ȁ >b5 @3?2 t  >#Ȁ >b5ې @ e [esp_sched] esp_sched: not IDLE (state=%d)esp: busy entry on ready listesp: message queue not empty: %x! %d:%d busy 㿘>#Ȁ "">b5!"`"">b4!耊 Q M  ` `,"*  ": 5>  b>b4"` "`&  "@ ?$ & ."!&" &" $&" ` * @2"`>b5h"(."." ` C 0 #Ȁ >b"P5X 2 [esp_done(error:%x)] requesting sense %s: esp_sched: floating ecb %perr=0x%02x sense=%2x; esp_done: resid=%d esp_done: error=%d %s: floating ecb%s: dequeue: busy ecb on free list%s: dequeue: unknown queue %d㿘  ``*`" * "@%>Ȁ >b ,4#>n#\ , 2d    \$ , X$ , ( > 2R $Ȁ  >c4  $$ ( ( @, X .  .  &  4&   & $ & `"`>c `3ٔ &`" $`$``&  ? & `  *@ *  5  %  >a0!>n@#\@=#v` $`,b0$ ( >cȐ `$ >c ,4 @ , 2 ( 4>c4 P (`> , >#Ȁ  `" ,>c4r ` ,`>c4l x  "=>c  " `9>c ""3>c"$`>c 3i` ,b `  *@ * 5 &`` "`$` "@` "`$` "@ `  * *@ 5  3?`  `3: ` &`" $`$``&  & `?%[esp_msgin(curmsglen:%d)] %s: msgin: no msg byte available esp_sched_msgout %d gotmsg(%x)cmdcomplete esp: %d extra bytes from %d:%d %s: our msg rejected by target MSG_MESSAGE_REJECT>>noop disconnect save datapointer restore datapointer %s: no DATAPOINTERs to restore %s:target%d: MSG_PARITY_ERROR extended(%x) SDTR period %d, offset %d %s:%d: async renegotiated max sync rate %d.%02dMb/s ident unknown %s: unimplemented message: %d searching esp: invalid reselect (idbit=0x%2x) ... found ecb%s: bogus reselect (no IDENTIFY) %0x2x %s: unexpected message in; will send DEV_RESET 㿘#>cȀ >d#3P  p  2">d!3G 0̀ " p"&# ." p cȀ >d!@36#*#" cȀ!>_#3)  ." p*` cȀ!>_#3  ." p* >d# c3!X0#  cȀ >d!p3 cȀ!>_#3  ." p* " ."" #."  &## `  '!>`$!>#`# ` ># >#  @!>>#Ȁ!>_#2͒  ." p* 0O!>#Ȁ">d#2!"   #  *`" * "h>e"*@ h l ( D>#Ȁ""">d2!"䀣 6 " `>d `!2 &""$$"`(" ."!>#Ȁ"">d!2z 8 >d2t!" " ",," ."  ," >#Ȁ >d!p2] #Ȁ!" >_#2U  ." p*` "Ő >#Ȁ">d2G">>#Ȁ">d2>" $" ."  >>#Ȁ">d2+""$$"$ !>#Ȁ">d2"02 #Ȁ >d!p2 #Ȁ!>_#2   ." p* " .">d"H2 y>&"$t&"` >d `"h1 l>#>cȀ">d# 1"# cȀ">d# # 1"# ,# ,#0 `2 ` >d `">^1Βa," }." |! ` >d `">^1a,cȀ >d!p1 @cȀ!>_#1  ." p*` " @[."@>!@9,`**W" b,O " /   ,>d1" p*  p*  #0 &,   ,!>#Ȁ >d!p1l @#Ȁ!>_#1e  ." p*` " @ ."."  p*  p*   ,>d"ؒ1N  ,!>#Ȁ">d1C"# >#Ȁ >d19#>d##14 #Ȁ!>_#1-  ." p* >>d# z #Ȁ >d1#0# "    ` 2 `"+@2`"`& "@ ?" 22 `!>#Ȁ >d!p0 #Ȁ!>_#0  ." p* " .">d"0ڐ#@Q>&  &"$&" ` `*`" *  "*@  2"+ " * "    p * {  p*`>*  p* >#Ȁ >d0#h !.">d#x"0 #Ȑ#0 #Ȁ >d!p0 #Ȁ!>_#0  ." p*` " .">#Ȁ!>_#0  ." p*` " ."&#[esp_msgout(priq:%x, prevphase:%x)]esp at line %d: no nexus㿐>#Ȁ >g""0\#X"쀢 "#"  ." "`?&#>h *`@                            h                                 ` *`" * " ." ."." ." ." 1&#" " >g#/$ ` "  "."  ."` *`" * "   *   "." ."   .""&###4 8 '## t  t@ p* p2 *` y @ p* 8!>#Ȁ!>_#/  ." p*` #Ȁ!  >_# /   ."    p*  t x@[espintr]%s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: !TC [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! disconnect withoutwarning %s: DISCONNECT in IDLE state! NO nexus: target put in SYNC mode %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>[[esp: BUMMER]]backoff selector %s: RESELECT: %d bytes in FIFO! selid=0x%2x %s: identify failed esp: not nexus at sc->sc_nexus%s: select timeout/no disconnect %s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: ICCS: expected 2, got %d : [intr %x, stat %x, step %x] %s: STATUS_PHASE: msg %d %s: invalid state: %desp no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%d] DATA_IN_PHASE STATUS_PHASE esp: bogus bus phase esp: should not get here..㿈!>#Ȁ >h.#@  )>_# t l@ 9@  L } '& L p   Ȁ!"."#- ." p*  " >h#P- ْ  " >h#h, ." |0@?  ~ @@ p  Ȁ! #-  ." p*  "     ",>h"""#"-  p  Ȁ!" #-  ." p*    t@ "# ~p@  t @ ""  2 ~ ~2 ~`>h }#  " `$?#\-l ~ 0>i -e "쀢 Ȁ >d!p-[ Ȁ!" #-T  ." p*` "  >d!p-G Ȁ!#-A  ." p*` " ." }` Ȁ >i ~ (-/  p  Ȁ! #-$  ." p* I Ȁ!#- D D." p*` " V>i" `">i` >i- P" ."` *`" * *"` *`" *  " `*"."" ."" 2 ``Ҥ >i, p` "`,  $@ " & &  $`` ? $` &  ."" `*"  0 0 , "쀢 2+""耢 "'"" @2"" 2"` *`" *  "``*"`[ >i>i, >i, ""*@.".""?`>k#(*`@  \  D>i ,x  "耢 >ig!>i,m!0m"" @" }>i,d!H }^ " , Ȁ >i,V!X   *`" * ""  "` &   &  "` ` ? "`  -@*@4 &  "耢`.">i"! p `   >i `!p ,  `#(."-@*@."Ȁ >i,!" =>i!,    0< 2>i `2`>i+!  *`" * "n>l!*@ ( >i!+   2">i"+ג  >i" +ϒ #0 @,  , "." A." p ` =    `>i }"0 ~ #\  +#`Ȁ!#+  ." p* " ."Ȁ >d!p+ Ȁ!#+  ." p*` "  ."Ȁ!#+  ." p* ." ."!&"` &"`$&"  -@@w4 " ~ +q Ȁ!" #+j  ." p*`  @" ` >i"+Y  " @T  }.">i" ~ +I  p `  >i } ~ `#  +; Ȁ!#+5  ." p* @ie  `,`( p Ȁ @>i#P+!  >i"" ."`$`$" (#`+ Ȁ!#+   ." p* 8>i#"* " >i`2">i* #    " @^ @  @>j !  >j! >j @>i*Ԑ#n&"Ȁ @" }>i*ɐ# }Ȁ!#*  ." p* " ."Ȁ!#*  ." p*  >j" 2 ">i# ~ * " `D."   ~ *  &"` `>j`* P p  Ȁ! #*  ." p*  `    p *``& Ȁ!#*e  ." p*`  &">j"*Y pȀ!#*S  ." p* #4"䀢 8 '"" t  t@"&">j*< #, 2 "Ȁ!#*2  ." p* "#4 8 '"" t  t@&" p* p2 *` y @ p* 8Ȁ!#*   ." p*` Ȁ!   )   ."    p*  t x@ 0% @>j) " @."Ȁ!#)ߒ  ." p*  &""  ."( # @f 2 t㿘 @"  3>" ."cȀ >d!p) cȀ!>_#)  ." p*` " ." %s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], DMA active AGAIN xH /* %   *   $ b (#\`#`b#db#hb#l b#p b#t`t @` >n">n#8>n#H#x )H  >n>n)A#PQ 0-);#X $, n&   >n>a0#\*0!@`t l@ "   B ?2`t " H 0bwtwo㿘>#䀢 V` 26 `@  2/ ` &` 2 &  ? >#䀢 2  2 @E  E"`4 @" `4  ?䀢  `@ &` bwtwo/p4model: %s, %d x %d (console) cgfourcgeightunknown%s: %s overlay plane 㿘  > 0 `4` &`X&`\ &`8`@@ &``0  @hі &`d &`Ȑ0 @hȖ &`&`d &`   6. >30,/0#䀢 %@  ,@  0>o2  Eb2   E @ E &` &`&` &`ܪ >o!>o@[b(0&`4 &`8$&`#&`ؘ $ @C՘  @6$ $ >o "0 (->#䀢 >>  , *    >#$@ >#?  >  >#$@   $ 0`ܒ @h=$ @ђ " >o>o'"@@DX`'"P``(ɴ ,@@>`   >o>o>o"X"`"h>o"p'ђ`>#䀢 >  ,@@`  @B>, ,*    㿘 >. `"@@@"@ 0 "@" 8&<&@&D& H&L &@: &@Q   㿘@H bwtwommap㿘>  > . @@>p&u#xL@?>#܀`А@* >ؒ`*   㿘>#䀢 2  ؀ 2  `@@@D 4@6  6  㿘>#䀢 ` ؀ ` `@@ 4@C0`Њ@ Ъ@0 Њ@ ?Ъ@0  ` @ ` *`cgtwo㿘` &`  `@   >#䀢 V` 4 ː  8@ cgtwoattach: impossible bustype: %s, %d x %d (console) 㿘> h&`L&`P ` &`,`&`T  >q! >q%͐! &`8`( $#@BJ!&`<> A` !@>@㤒&`@>q`4!`0&>#䀢 20> Ѐ ">   >#$@ 0&`4&`8&`&`  &`D`0  @f &`D0  $@f &`̐  @@f#` &`>q&a!@BĐ`(>>q&Z"> >#䀢 `(@AH>d d*    㿘 >. `T"@/@@ "@H"@",P  "@"9  "@"<C  "@( < &0&4&8& <&@/&,&&,&0& 4&8&<&@&& ,?&$&(,&H&L@@l   &  `  *   (㼘@` !G   Б,  @@  *  ,  А" @@  *~  ,  А$ @@  *} `: ` 2 " `)  㼘@` a$`G @ 2@` @ 28`@ . Б,  @  ?2@ `,  А" @  >2@ `* А$ @  =2@ ` cgtwommap㿘> T > . @@>s$/ @@?># @* > Đ@ cgthree㿘`` &``@    >   &88@  model: %s, %d x %d (console) 㿘 > &`X` &`\  &`` &`8   6  >  " #䀢    >s! >sa@XZ &`D`4 $#@@B`<@`T>` ?@6@ᜒ!&`H&`L>s!`@`<$ >  >#$@   &`P`0  @d&`P0 @d &`0&`4&`8 &``&`$ "``@  $ s$  $ $ `" >s>s$P!@@`4$J!`(> `4@?8> *    㿘 >. `"@/@@ "@R"@" 8U  "@": "@"EH  "@(A & <& @& D&  H& L4& 8&& 8& <&  @& D& H& L&&  8?&$&( 8&H&L @! @9! "@%  @&@   㿘@ ` @( 2  :`((ܖ@ :*  Ԓ " " cgthreemmap㿘>  > . @@>t""#@? @#@?@ L@?>#̀  @@* >ؒ`*   cgfour㿘`@   `>c `&`  P ?"  @? @  `@ &`%s: ignoring; not a pfour : cgfour/p4, %d x %d 㿘> &`L&`P ` &`, &`T `(@@0>u x# `0Q   @cB &`X&`8 $#@> !&`<&`@`4>u`0" >#䀢  > Ѐ ">  0>#$@ 0 ?@c &`0&`4&`8&` `&`"2 *`"""?">u" @=>Ԑ *    㿘 >. `Đ"@/@@ "@R"@" ,U  "@": "@"EH  "@(A & 0& 4& 8&  <& @4& ,&& ,& 0&  4& 8& <& @&&  ,?&$&( ,&H&L @! @! "@e  @V&@W  cgfourmap㿘> İ > . @@>v!? P#@ 3? 4@! 0@&&@#@#@   4@ 0 @ ?@># @ * > ̒`*  @ 㿘@  㿘@> (㿘 (@>:`((Ж@ :*  Ȓ *`" " (" (" (" <cgsix㿘`@ۋ  ) ` &``>  #䀢  `4  ?"  @>H `  `@ &`cgsix/p4modelcgsix on mainbus? : %s, %d x %d, rev %d (console) 㿘 >!&`X&`\ &`8`  ` &``00&`4&`8 &`&`@a &`ؐ  @a &`ܐ  @a*&` @a &` `/`4>w T*`@ h ܰ ܰ Ĥ  ,@@ >v">v"(>#䀢 2$ 0  >v "(>vc@T>v!#0z$ 0 $  $#@< @ !$ $ >v #(  >#䀢 > > ,@  Ж ">   >#$@ >#? 8 `>  >#$@ `>v@#8:` ` 6`@~%  2 *b`h$"h">v>v #H0  @`&`P@=`4` #X``(n>#䀢 > `4@;>  *   㿘 > . @5 㿐 >.  `"@@@"@"5 8 "@d"@  "@0 "@"X   "@"=  "@ "@8  "@0 "@N  & <& @& D&  H& L& 8&& 8& <&  @& D& H& L&&  8?&$&( 8&H&L"@B!İ"@s! 2@ V & "V @0 2   6 h ;"h 6 6 6 6 6 6  $6  `6"V !|* 2 (y 2   !@  x v&  q&V   !'" @' 2d   8] "* 2` :`U $v! (v  F   6  6 6 6  6 @S &!@&" &  6 "6 V"!@`*(Ĕ!|$@K  6  66 @(2  66 ??    R 耠4   ܀@@"@ " " R`쀠`R`R`R`"R`*  ???"R ?28    "i!|"i` :`((@ :*  ؒ *`" " (" (" (" < @ ! *` *`  *` " *` R ꀠ 2  cgsixmmap㿘>  > . @@>yɐ"(>!$` %># >Þ @* `&@`L : `̐@`* `ԑ* @   ?cgeight㿘`@O   `>c `&`   ?"  @; E  `@ &`%s: ignoring; not a pfour : cgeight/p4, %d x %d 㿘>!&`L&`P ` &`,`&`T `(@@0>y#:`0R   @^r &`X &`8 $#@9Ƙ !&`<&`@`4>y`0!#>#䀢  > Ѐ ">  0>#$@ 0 ?@^G &`0&`4&`8 &``&`"@`" "@ s"` "@ "`>y#`(@8>ᤐ *    㿘 >. a"@/@@ "@R"@" ,U  "@": "@"EH  "@(A & 0& 4& 8&  <& @4& ,&& ,& 0&  4& 8& <& @&&  ,?&$&( ,&H&L @! @! "@  @}&@~  cgeightmap㿘>! > . @@>zo##@3? 4@Q 0* @@ &@ :@#@4@#@ -@ 4@8 0* @@@ !@#@  @ >3? @ @*` @ @ !@@&@ "   ?># @ * > ̒`*  @ 㿘@  㿘@9 (㿘 (@9:`((Ж@ :*  Ȓ " " 㿘@ @( + sH  sB  s< ,`  @` @*@  *@   `*@   㿘@ @( + s  s   s ,`  @@`  .@ *  `*`@  㿘!T`< z d !P00!P0㿘>#䀢 !T` X" `<@ " "`<*@"X" 㿘`@       - 8@ sbus: expected 1 interrupt, got %d pri %dif_le: Lance buffer crosses 16MB boundary㿘 >|`@՛ 4`?`>| 0>|!0  @\# &aP 6`a@ ?,@ @*&a>|!&af`>+b&`>+# &`&`&`>+#H&`>{#&`>{#&`>| &`6 2>' ܀&a@&aTa8 &aT& 8a8aT?< " l )>!@k $>(   @ >( `@>($   >!@O >(` @"$ >(!>c䀢`&aD>{#&aD&aH@VUaDaT  h@Unknown3e/vmeonboardmultibus/vmeie㿘`@    `>#䀢  ` R 8@ L ?  㿘 @ 4(@Z d4(@ @(@2(@(@?Ȅ(2(@ @@0@㿘 @ d,? , @ (( @(ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s 㿘`D  "p&a>}&a>} &`>} &`>}!&`>$"&a>R!&a@&`<0  @Z &`@>Ф !?`< u`>"!>}!0`<s= &`8>}!8> `< @2 '> `8  @ "`8>}!H`<a€&`4`8`8`8&a>|€&a>}!h  >a>bؒ8 @ `8? &a`<@ &a " P&a$>} `&`>} &`>} &`>ِ#\&a>ِ#&a@&`<0  @Z(H&`@`<  4?(@ `+` @Z|"&`8&`4 ?(D !4(D@ 4 `c 4'`8a€`<`8`8#&a`8&a`8 &ad`<&a <&a$!x0[`@U `>} !0O`f $@>"$`|>#0$`>~"\$`? "4`0Ѿ!>}֠!>a!З* `( –   >~"&`(&`,@Tƒ`( 4 >~"&`(&`,1`(  >|@ӕc؀ ` @"$ %s: device timeout 㿘 >~bHK  `@Y" %s: parity error (ctrl %x @ %02x%04x) %s: receiver not ready 㿘!!` @(@" >~"(D (D(F (D!4(D! @ `@i `P`@``@` >~"i  `@& !` 㿘%>!!,`!( ` :`  & `-$  2* * 2 2 *` * 2   2`* @*`2`   2 *` * 2  @ & 4  4  4 $ $4 @Ē  $@% 8!("@*`2 *` 2!( 8" *2* 4  @ 0 @7`ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions 㿘6 r t", 6 t*`@"@  >!x     & 4  @'& >! > ! >!  >!   &  >!    & `& !  ",*`@"@@(&! " &$ D ", `& 2 " @& %s: receive descriptors out of sync at %d .`@a('%2a(`' 2`# * !(`?# @2@| !!&@t  7&"   *% @ *% 2* @R@  ?>c @?"*`@#@ !!""  l#!/ lÖ  l 耠@ `' 䀢@  倢@  怢@  瀢@   耢@  逢@  @ 耠@ ' 䀢@  倢@  怢@  瀢@   耢@  逢@   v   %耊 h    g "0  @ @  @  @  @   @  @    2<%; Ԛ`3 耠@ `(' 䀢@  倢@  怢@  瀢@   耢@  逢@       % @ '  @K ??&  >c ' 2H /* '>a` 2`H 0 """ 2 F '䀢  0H@? D$ d$ $'ܨ>!/>܀ ' >c~  4H /* '` 4`H 0 $$$4 F ɐ l$ (= H /* '쀢   F 쀢$>!x" > 2`  * ` ?$` %H 0 " $($$$  4 ($ 6 ܀ 2 $ >! 4$  $$  $% ܒ"W #   "- @@2 *` ! ""@ $!@ 3@ $!@ @$ !@ - @e2e` 2`@Y &* %ت ?# @2 @H &-  `  #& 䀢 !> ( "G $ (   'd'`'X lX  D$ (3㿘"  "*%@ @  >c^ @o0 @` 2`* %2 @ &*`@e?# @2@  &%s: tbuf overflow 㿐 0`@"$@ dU6 0"( `Ѐ I   $`$`& `ؐ?$`؀ = @"*`@@, 2  %  Ē   >"[`Fv,2 @* @"2@**@ 2@@?$@`2`@ ?"@@ $@"$@ w" @ q`l ",@*"" 2* *2b,@ * @ 2@@ * ?2 @ "`4*`@@@ "@ * '***@ "*  2 @ *  $2`@ *  2@ `8*" *2`* @ 2@  a*  `8 #@ +`3 +` 0@ $@ 4`r㿐H /* & ! !€! !€! !€, 4$@',, ,  ,@ 8$, 2 , 4` 8 4" ',`,`,` @ @ d @  ! @i `H 0  H 0 %s: reset %s: abort commands timed out %s: disable commands timed out 㿘H /* &># E  D%  t @6 t` @& >#0 ` @ >#$ t @6 tH 0 "㿐'!` 4   @> !> !0@˖* ϒ> > 0@   %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status %x 㿘6@%6`?6`  8 !&@ +`3 +` 06` 23@@ 2`3@! @  ``&@@>!`@>! 0` >! ?@ `>" ?@ >"@ jie: bogus buffer calc 㿐! !$!€ ?#< !$3@ &>b#!,!,& " `* & "  ?         "a( ?  `    6  , !( @Z* !( 8"@*`2 *` 4`,    * !$b 2"  ?         "eؐ ?  `    6  , %ؠ @* % 8"@*`2 *` 4`,    * %Ԓb 2"  ?  ",&"(&" &"$ &    #  "2  4ؐ$'* * ?* !&"&  a?&   !( 8?& "@ *`2 *`! 2% 8!("@*`2 *` 2%s: multicast address setup command failed 㿘6@#6`?6`"0!  `* !* * *2*  6` 8!&@ + 2+  3` >@ 2 >#   %s: configure command failed %s: individual address setup command failed 㿘  ! ? 8 @!$ + 2+  4`4"4 4 ! ,  , ,  ., ,  `, ,  , @ , , ,  ,  >  > Ӓ 0H 8 $ *2* 4`4!4 4 !   > > ! @  `J t !( 8 @6 t#@+`3 +`! 0 ! @  ` `@ 㿘  s 㿘 H /* & !@# @ ! @" 0F  !1@/ !2@, ;  6 0  N Du0- 0 #$! 0@  2 0 0 ?6 0  @10 !1@T D D`4@  H 0㿘   &   "- "0   D @/    D a t }6 t  *@ *`@M   &  2 &! xdcxdxddummystrat㿘 0"">>! 0 <," $"& $ $ ?& $%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘>" 0`""`(`>`a`* @ؐ >"`/ `6"@>4`" ```4>`D"H 4`*2` 4`4``D`4``0`,` ``,,`@r `4` `""`(㿘`@4   >#䀢    j ? . а"@  ?w     pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=%x.%02x.%02x %s: controller config error: %s intrx0  @PH & $`L>`*` >$`` ($`d` " P? 6" P#`l@ $`p$`l@#&L  `l $`p $`h> 0@Ғ&L  = `l*`h "@ @ * `l@ ` 4 *``l * `l`d * $`l ,a,a,a ,a#,a",a!$`$``$`#\ 0#`    @˚ 2`l> @0Ǔ,  S+,* `h* @` " >!>@ h> p a!``,a!a! a ,a* `h"  a a0>  o a!``,a!a! a ,a* ,* `h* @"` a 2#\na#\#`    @j 2 a! ``,a!Ya!,@*`@`h*` a  ,a*`h "  a  Ca  !>@A  `0A>!$`($`,{`(>` `4"@۔ ' 0' ' "' ?2 ' `@2' @< '  }   '"@Ӕ @<֒ >>a0 *ڵ `  `?xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐 `(@K h>"H&``&`0  6`6`&`&` * " P ! H /* %`  !>` ! ` `>"``! 6`    ` #\@3#` 2!! ``.!!"!!, @*`@ h*`!  .!* h " ! `B !`B`> "6` !>@"( 6`> ې"@   ` #\@#` 2!! ``.!!ߐ!!, @*`@ h*`!  .!* h " ! `ɐ!`!>J"X   ` #\@#` ,  l  2!! ``.!!!!, @*`@ h*`!  .!* h " ! `!`!>" 6`6`6` .`.`6` ?2 2   }    ` #\@w#` 2!! ``.!!f!!, @*`@ h*`!  .!* h " ! `P!`!>Ѡ"  `  #\@E#` 2!! ``.!!4!!, @*`@ h*`!  .!* h " ! `!`!>"Ъ .` `(J 26`>"`` ``@`@&"#\>#:  ך   ` #\@#` 2!! ``.!!ې!!, @*`@ h*`!  .!* h " ! `Ő!`"`!>E#P`` ` @ɝ?@ɚ@ɕ  `  #\@#` 2!! ``.!!!!, @*`@ h*`!  .!* h " ! `!` !>#@ } \`G6` ?#  2 " `@ ~ `2  `  ~  } ~># 3``"  @:  >!@ `(` @"$ `(@6`  (`H 0  8>4(("   `8 `8(("`8`4(("`4`8`4 "`<%s%c: crash dump not supported (yet) 㿘  >bD: bD*& *>!@ a ` 㿘  >bD:bD*@` E  f@"O  m@"XE e@"4`   h@"2`   n@" E g@M{ 0 e@"l t r H /*%`͔"H 0_ ”!Z  &*"* ` @P& ``@ߔ G` C A4`?  "`` 4`?# @4`2`. `@ '` 2`< 4``<  $`<4  *  a `>`@c|`8`4@  $`< @㿀  >bD:5bD*@"H  *&" @~'' ''"@~ǔ  )  `6! . @     8 8*@$84*@$484  $<㿘>#|>{  @@㿘>#|>{   @4㿘   ? : >* b4* @ "`* @ ` ?` o ?㿀 ;>bD:bD*@  H    0@`( " j& ( 2" @~'' ''"@~$ "  " 0 ;` ` !"@  @& ( 0 ?@  $9 0H /* % !     @  ! 2 !  & `& `" "`@ H 00 $(& $ 0Z" 4㿘 @`@u& @@4  !   @q ! 2  " "  " " " " " " \" $" ,`" (" 0㿘@ .@@*`@ `  .@@  .@.``.`.`   ` `  ` .`e"1 0"C 0` .`  0  ` ` `  .` `* P*  *  * >#䀢 >#耢 # * 0u* 0s 0.`   `.`  ?*` `*` *`   ?2`   ?*` 0Y 0.`   `.` * *  *  * "2 * *0A` .`  0   `` `  .` $6`   2 6` .` ` .`  (@Ր.`   @n@ .`   @f6`  ( ` &` $ =`* @@@8 .`xdnfreexdsubwaitxdcmd nfree㿘` \ 02g ! 23! @}  2\ ! &! %> #> t 2K ! ! !! ag 2> !! !!! 2 2!! 2?>!.! J  h, * * @@. P "`"` "` "`"`"`"`"` "`$"`,"`("`0  Ɩ@xdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space 㿘 ! 2?>n#h,! J  h,`* * @@ 2>Y#`"`$ ";: *  P;` ` !"@`H`*`   <0@{ 2"0>#  ! ,!* ,`*  h* @"` ! 2& !& &  "%$ `&a& &  &  & & & & & :` & $& ,& (& 0 $@2 - @`(@  xdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq㿘 L  h .`* * ,P2!#` * !# @ .!#!  .! 0N >"C ><  @= ! * L2 *` L2 *` L2 *` L =*`  L *` !  .! 0 >P>    @  @ p!㿘!  ; L! B ?v   `  ? @Ԙ G ``.`: ?  @Ø 2! 3 @! 8! ( @w ! B! B.`:`*` *   h* !@`    2! 2 %s: off-line: %s xdc_resetx lD  l@ْ  l @  *@ l`  `  * p Lb@* L2 *` L2 *` L2 *` L =*`  L *`  L  ?  4 L  l "! L l!> @ʠ!` Р"@ L *`  L  ?ǐ  4 L 4>!x *`  l %s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE 㿘 `!>#c в"@ L *`  L  ` `4 L` ? `   h` 0  2i !?.!"U!"&` l/   * 2` *`  *  h  7 0 "`0F "1!!B  "`(`0`$("`$`$`0* "`4`0`,<@zw0 h 0`0 `4 (" W`0!`.!@*` h" ! 2 ! !! .!!` ? @ &` ? .!" * !  .!    4@, 2 ! ! "! !! !!!!   ` >#   > >#P >#xxdc_start㿘`"!  J@ސ .!"! .! ̔ P ">" !  L "!"%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD㿘 L ` @ ` #>c8@z W ? >#XK>^#p `  *`    h` Ɛ @Õ-  l @ !?.! 2  ` $`$` @  " `  ` @ ` Q2P`? 8L``$` ?$`$``($` `"$`( `$ <$`,$`$` , *` `  ,`$$`4`` @|`4 ` `` @v@, ` ` a >"@, `( $!" ? .!" * !  .! I ` ` "5 ?`0`= 5 ?9  `0  $$ (($ $`$* $ 4$ 4`, <@y  0` 0 4 (" !`.!@*` h" ! !U  @$`!!`.!!  @$`!! .!!  4`4 %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] 㿘> #p` `  G  0` > `;#x  a" 9`a@  @  @  >#>#># ` ` ` !>@7#p!> @.#   2> >#>#㿘` ``?`  ?@&`!!?.!!`&`!!?.!!? X` V `$@" `"@ ` &`$ &` `(*  &`(``  @h @c@ @ @{?-` &` .2`*`  .2  . 6``` ?6 `   "@4. ` @ِ. !" /?-   `` 3 `&`@2( ` 4$  &` .2`*`  .2  .&`!" ? .!" *  !  *!  %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout 0  H /* %!  ! !!!s  o H 0 ] #\>#ؒ @ > `>->   ? ?߀`*?> (>)>  ?ڢ  ?  @*`>͐#   ? 2` h> l,` @ 0 @@ ` 2#\ h 03 #``` 40 >#P H /* %    h `  @" `` ?"`  h  " ``4 > x~  ?  H 0>>a0 *@ 㿈'`  >#ē*`@WX4X4Z@Z@Z@X`XXZ@ 2  2  2  2 r 2  }* t  2  2  2ܰ  2ذ   6?`!a> ؓ*`@Y`YZ@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@ZZ 2 @ 2 , @2  " &6 "  2 @ 2  "~  2z @ 2t  2n  @u ``   JS  H /*%  #\#``,`. *  h* @`. h . !!``,!!!! ! ,!*  h"  ! 2!   H 0 @u9Software fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown error >* ehHhHhHhHhHhHhHhHhHhHhHhHhHhHhHeeeefff f,f8fDfPf\fhftfffhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHffffhHhHhHhHhHhHhHhHhHhHhHhHffffgghHhHgg(g4g@hHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHgLgXgdgpg|hHhHhHhHhHhHhHhHhHhHhHghHhHhHhHhHhHhHhHhHhHhHhHhHhHhHghHhHhHhHhHhHhHhHhHhHhHhHhHhHhHghHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHhHghHgggggghHhHhHhHhHhHhHhh hh$hHh0h<hHhHhHhHhHhHhHhHe> > > 0> P> h> > > > > > >!>! >|!8>y!P>v!p>s!>p!>m!>j">g">d"(>a"H>^"`>["p>X">U">R">O">L">I">F#>C#>@#(>=#8>:#P>7#h>4#>1#>.#>+#>(#>%#>" > @> p> > > >!> !(> !H>!X>!>!xycxyxydummystrat㿘 0"">>= h 8 <" $"& $ $ ?& $%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘>" 8`""`(`>``x`* @t, > `/ `6"@>4` Р`ߒ``4>`D  4`*ԕ2` 4`4``D`4``0`,` ``,,`@ƒ `4` `""`(㿘`@   >#䀢    ?@b@    pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrp0  @= & $`L>`*` >$`X"<$`\$``" P? 6" P Hܒ@p '?  H @'ؐ H@p  H@qؒ  H @>"`0@ H$`d$`h  ܱ  $``>"@    "x`d`` "@ `d @  *@ `d @  *@ `d @  *@ `d@ ` *``d`@ `` @*``d 4@ `  *`$"x$`t    `` 0`dh$`l`0$`p#\#`@6 `p ` 2  `l"``l` !>@ F">"0f># ` ">>#8>#H  !>@ ,#P`0N`L   >>#``>#>#0> $`($`,x۔`(>cY`4"@p; ''' "' ?2 ' `@2' @*J ' ߖ   '"@p5 @*8 >>a0"* `  `?xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`(@ h>"&``&`0  6`6`&`&`&`Ȑ`&`*` *   `* @&`&` * " P ! H /* %`  !>`  hB a` `> x`` 6`    ` #\@#`` l"` l```>h 46`" !>@  \(6`>W 6`6`6` .`.`6` ?2!&2!$  } &`  `  #\@#` l"` lM````  &``!> > `! .` `( 26`>!````@ `@ &"#\>!(:  P"" " `@2 ` ੀ@ >`ऀ@>` ਀@  >!` `ؖ>! ۔``@Β`@ @Ɛ @Ē   ` #\@.#` l"` l``"`!>+!`` ` @?@@  `  #\@#` l"` l`` !>!@ {`G6` ?#  2 " `@ ~ `2  `  ~  } ~>!R`a"  @(5  > `@ `(` @"$ `(@p6`  G`H 0  8>|(("   `8 `8(("`8`4(("`4`8`4 "`<%s%c: crash dump not supported (yet) 㿘  >b: b*& *>!0@ a` 㿘  >b:b*@` E  f@"O  m@"XE e@"4`   h@"2`   n@" E g@M{ 0 e@"l t r H /*%a"H 0_ !Z  &*"* ` @P& ``@o G` C A4`?  "`` 4`?# @4`2`. `@oߔ '` 2`< 4``<  $`<4  *  a `>`@pb`8`4@  $`< @㿀  >b:5b*@"H  *&" @l'' '';"@l  )  `6! . @     8 8*@$84*@$484  $<㿘>">{  @`㿘>">{   @T㿘   ? : >* b|* @ "`* @ ` ?` p ?㿀 ;>b:b*@  H    0@=`( " K& ( 2" @l4'' ''"@lD "  " 0 ;` ` !"@  !& ( 0  @o*  $ 0H /*%(@T H 00 $(& $ 0I'" 4㿘 @`@r& @@;  " "  " " " " " " \" $" ,`" (" 0㿘   0@ `*`  .`` .`.`` .`` .`   ` `  .`  `*` ? ` .`` ?.`   2 6`.``.` $@.`  @&@ .`  @6` $6`  (`@6` 6`06` 2  6`.`㿘    ʐ  @? xyc_cmd%s: stole control iopb 㿘\ l` p `     >. ` +    "@$ >"l . P $ $  $ $ $ $ $ $ $ $$ ,$ ($ 0P@ xyc_startbuf null buf%s: warning: out of DVMA space 㿘`>K ;` ` !"@`H`*`   <0@j 20>  ! `&a$ $  $  $ $ $ $ $ :` $ $$ ,$ ($ 0 $@2  Y`( xyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed! xyc_submit_iorq wrap upxyc_submit_iorq㿘 L ` -P f  0_ > >0U @  Q` ` b@ >>!`! !@>2 $P"4 >!@ L *` L2 *` L2 *` L2 *@ L *` 0 >P>   @   `@bu!؁㿘 x@N ` ``x 0 ` d 3 "`h`  & x@ ` *`<@ t  @| & t, *` `*   2 d*`  2$`x  *"  x`t ` *`2```   @O Ӡ` @㿘@  4  LBSa     ? @ '   ?  @ 2@ @0@  2@@@  " L`@ %s: off-line: %s xyc_reset㿀 p  p  *  2`  *  ` *` ߐ * p ` *` p `  *` p`"@  `  * p L * L2 *` L2 *` L2 *@ L *` L    ? 4 L  p  " L p!> @" h  L b@ 2>s"8 *` p %s: soft reset 㿘` >#I  L b@  ?    `` 0  2J 4"E 4&` d@ ` *` ` `2  *`` - 0 "`0- 4"'`) 4 "`(`0`$("`$`$`0* "`4`0`,<@in0`0` "` ` 0`0 `4 (t" E`0&`` ? @&` 4 h @ 㿘`  P`"``Ȁ" ``  2```  P%s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD㿘 L ` >"8  ? K >"P>"h ` @ @*` `  *` -  x`` "  @" @  "   2  ` $`$` @ " `  ` @ ` E2D`? 8@``$` ?$`$``($` `"$`( `$ 0$`,$`$`  ,  ` *`  ,`$$`4 `` @`4` `` @@b,` ` a >"@,`( 4 2  49 ` ` "+ ?`0`- ( ?)  `0  $$ (($ $`$* $ 4$ 4`, <@h] 0` "`` 0 4 (g" $`D   @$`  @$`  P-  %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]㿘> !` `    0` > `;!  a" `a`  `  `  >">">" ```!>@!y!> @ "    2> >"@g>d#H㿘`@W` ?`` ?`@&`&` R` P  `$@" `"@ ` &`$ &` `(*  &`(``  @ΐ @ɒ@q @m!@kO?'` &` .2`  . . 6 ``` ?6`   "@.` @A.'  `` = `&`@ `   &` .2`  . . &`%s: watchdog timeout 㿘 H /* %    ` `  @" ` ?"`  `  " 4  >!  ? P H 0>>a0"*g 㿈' - 6 2v  2r  2n  2j  2f  "`  ]  Y*  U 2O  @f! `  |9 H /*% #\#` 2 l  . l . l" ; l  |H 0`@eSoftware fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown error [>* (4@LXdp|>U!>R! >O!0>L!H>I!`>F!p>C!>@!>=!>:!>7!>4">1"(>."H>+"h>(">%">"">">">">">#>#> #(> #H>#X>#p># "<   "7   "2 40 @ - 0+ ( "' 04% " @    ! " `4   @  ! %   0    @ ` sisw%s: scsibus 㿘@>ﻐ"  㿘`@  B>#䀢 2> ?2 &  22 >@kb 2+ >#耢 "2 $ >@]b 2 >#耢 "2   { ?>` @Jb 2    {(?   si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p 㿘 >">"&c , c  $c@/j ($ < , +>b$ 8>b$ 0$ @$ D$ H$ L$ P$ T$ X$ \><"l$ `><#$ d>"$ h> ,$ l> $ x``'>>!$ p>"$ t>!$ |$ c >!$ >!$ > X$ p> $ t>#$ |$ > $ > @$ #$ c  $ c    $  $ $cؐ!@  k$c耢 $c>ѐ#  c" `$c$c> $c$c  " >@)c >kc !@$c>#c>#ؒ >>" > >" .@ @, .`@> ?  @ @O  (>0  @F si_minphys len = %x. 㿘 0!8 >" >#B& 0si_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC 㿘 # #``"@> @`@> X` #  & !# .> psi_reset_adapter 㿘>" #>!P#耤``2 \4 |   4 |  4 4 4 4 4 #4 4  \$ { $ $ $ {   $  \ si_dma_alloc: misaligned. si_dma_alloc: xlen=0x%x si_dma_alloc: excessive xlen=0x%x si: no free DMA handles.si_dma_alloc: can't remap %p/%x, doing PIO 㿘 # F  >툐" 0:!8>"@엒 >"`{ &  #  ``>쁐" &  $ $ $  @  &  @a  $  > Q"&$ si_dma_free: free while in progress㿘   >O  " $   @a & &$ %s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x 㿘   '##0#P耢 @@? >{( d    % >" > 㿘@#  4 #? 0#? 2  2 ? 2   2 2 2 2 2 2 2 si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x 㿘   @#>"0룒 >"  &#>"P쀖? # @4   4    4  ?# @4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  >"x M " L L* \  D *@ H @ *@  T *@ \  D* H @ *@ \* >b 4  ` & >#"si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! 㿘  #ؤ  >ݐ 0 ?& ?`# @4``@ >`͐  "`, `&  o``  '>#& '> "@> 몔4  >! 룒  M& $ >ꯐ!8 & "@☀ & >!X덒 7` 3> 낐!x` `%?` "? @0?`c 2 ,?`,?` 2 ,?`# @2`,?`,?`?# @2`,?4`4` 4` 4`4` 4` H `* D*㿘@ #  $ # #   si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d 㿘  ` @#>"0 >" &#>"P@     ?%   >"  > x <$`% $% @   L* `" > ʖ \  D *@ H @ *@ T L *@ `U>  ꮖ \  D* H @ *@ \* >b %  ` & >ꗐ"sw: DMA error, csr=0x%x, reset sw: short transfer 㿘  #آ  >{ 0 ?&   ?$  @ > m" "`, `s&  X> b`$>!XW`4  >Q#  D& @$ >]!8 & "@&  5     !>0'&> 2 * ?2 * c 2 *>c  "c  2 * >2 *c  "c >2 *c "cc "c$ $  H @ *@ D*>" >!X>ρ"xstdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. keyboarddevice_typeserialstdout-pathconsinit: bogus stdout path %s. displayunknown console input source %d; using rom unknown console output sink %d; using rom >>!P"c>Ϭ"x%l !%%>!>c%` ?`@?>a``€ `>鈐!p0Ax` `@ " >`@>!q0*>`€a " >@a>@0a Ox? `J@ 2`J@ :  ` *`: ?@>a`€ >9!pK x` @ " >@>!"0>a@ǒ>@b  >&" @>@ݒa Ox? `J@ 2`J@ :? `  *`: ?`HJ`LJ    >0>   wϖ  @  "#>"(ϒ >>>   >w@0"#$> %>>  "X譒>"%>>!"`@screen-#rowsscreen-#columns㿘>#( >^"x $۔  ($ה  H$Ӕ >#? 9> x>@&b K   * * *:` K?Ѐ` >*2 "c,> x>@ b K   * * *:` K?Ѐ` >*2 "c0>#䀢  >> Ѐ> Q"#, P>"#0>"#( p  $%>  " h%  #"$  $ %$ "$  ($ p ȟ€  >#,>#04 4 > h*`@ €㿘!>Ϡ"x> hb* € 㿘>ϐ"x> hb* 㿘># `>`p ( (>ϒ"x `h *>b  㿘  b@>1>#  > ͖ 2 &#  "x> h"+`@ `@ &   㿘6  * 㿐 H /* & p!3 ># `$  T    HH/` /` / 0 H 0& H  p  ?& pq Hc H 0㿘>`@€ 㿘H /* & p% V  H   & pH H:  H   p  & pH 0!@%0>!L H 0H( p a`" pH 㿘H /* & p " ? ?& pH 0 . h& pH 0  H Pڒ ?   *>#   H`€ H h  * >b  @0h㿐>#4  >#      >X> "#4 㿘H /* *>c4?"c4H 0 ,>Ϙ"x c"2>@@ >#XJ@   >#XJ@  > h*`@ ` € 㿐>   Ho o #  #H 0$H/` /1>#䀢 >  $ * P#䀢`>  $*H 0 " 㿐  Ho o>#  / 0T@H 0㿘&   &{ & @㿘 Ƌ firm_event㿘` c (H /* & @  %>;, ! W ; @󀎠  ! " H 0` 2 4.$@ * א@ ``#$`  0H 0 #H 00 4 .Ա$㿘H /* &` ` 0 @ H 0  / H 0 㿘> P$@(%s: /dev/fb already full %s: forcefully replacing %s %s: replacing %s %s: attached to /dev/fb 㿘>`L  > P > (H "`L , `3>`P> ( (`&`P>ϒ " H>," L3>`P> ( (`ؔ&`P>ϐ "`H>`H  > P > ( "`H3>`P> ( (`仔&`P> P>`( 䳒`㿘> P $ 㿘>`P$㿘>P$ @㿘> P $ ?widthheightlinebytesfb_setsize: inappropriate bustype㿐```">>#䀢`x`& &  (i `2f > ,@ A  0 "\ '2  E"U 2  E"O 2  E2  `"D 2  `=> *`@ф$& -#*$%& '$&@& #%"& ! "  "$   $   %  & #&@& %%& &  @ & : & >@cX& >c`@&  >@Ѳh&@:& >ڐ#xJ   * J(JЁ㿘   @ screen-#columnsscreen-#rows㿘>#8&   4 & D & @ & 4& 8 >#䀢 & <> Ѐ`2 `P P& L "& L `Q& H1>#䀢 !>> x@b P$`> x@b "$`#䀢 " $`$` @`$ ">$`$$` >"x$`@ct>>""b8@#``#dd"@@d`?"@0 d0E Ed0# 02   0#dd` 0 #>(  "! mouse input parity or framing error (0x%x) ms_rint㿘!>"(   >◒`ؐ?4"( (4"("( * : `-*`>!@@լ  68 .    6* : @&  6* : @& ?6* : @& >Ր! N  4N   *@'@> > !> h  ?""UJ @ *@ # 3 h# `#    4 @   "   ?"!#3 # > h#  h #    4 &     ?"#3 # > h#  h #   & . & X $N 0 "N 1. 0] N 1  ,Ό 㿘>bT bT "bTY?>#䀢 2??$"`"`?@? &? 㿘!>"($ O  @ $ , 㿘>"DM - ~@0  @" }@"$  v@ @" >(@ (1>T @  " ` 㿘>"Dx>Ё lkeyboard-click?true㿘>Р!l$ $ >#䀢 $ > x>@\b >@|b(  , #kbdattach㿘>!0 @7>"a@2 >>l"x`l@ Ӓ & >"@Unknown keyboard type %d 㿘 2  ׌>#H&>#& &   " N   ".  " N   2.  " .  @C . >L#0. kbd_translate㿘``(6   @ $ ?`*`> p@܄܌ܠܔ .`  .` 6` .` .`>6 V` "@`&`?"?N`   2 6  ?  >( 㿘H /* & H   D ` >>bx!,H 0keyboard input parity or framing error (0x%x) keyboard event queue overflow 㿘#>Рal H >$ H!,ʒ>!ි   $  , $, %4  \    ğ@L?, $P, & 8 K, $  O Bal`? $ H$ D>>a!,W021 , @*  ? ("   >a00 6   # > h#  h # $ ,j 0L < "L =, <o (L =  8̞ 㿘>a a6 ?"a ??П@ H /* &?䀢   vğ@?ܒ!>>0֔X #" H 0 >>=! "!㿘!>а!l& ? (!l 2& 8 @ & 8 㿘>А!9 -㿘 "~@ >]!l@ &# @" % Z#@#@K ð  Z#@"| %#@"s &  "}@"   v@" 8 #@"X #@"  # @"O 0#@" # @" 0# @"&  ~ -| &y vv - .  >l >#H#?#b _*@  >X >#H# @ N6@V J  G$  D& ", ' H /* & H x  > < > H 0  6 , '.: z &  @ '  . @ , = ` @ 㿘>А!㿘>!p !pD  " `! 4<  &9 `" `!3     *` "+ *`' `H /* & H x  > < >ӈ H 0   ğ@ fpu_cleanup 1fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=%x fpu errorbogus fpu queuefpu_cleanup 3 `: `9*`>#(@@L>ݐ"(>>݊"8`g o %'` 2!'>|"X>y"h >b  0>" 0ݑ S?H&`>"M >`"` 6<&`> g`0   >~ h@j@>F"'@' " `  "`>" > ` @  `  `&" ̢`&`㿈>@!2 ! <  42L@ `8 @ ?& &   2  >!, @htppppppppppppLxppppddppppppppppppppppppppp찑, , @, *@- $  $ @@ɐ @  ,@ @ߖ  ,@ږ 0`& 0@b @͖  ,@Ȗ0K @–  ,@@`I @  ,@  @  ,@ @    @p*@ $J bF$`B  @  ,@~`@  @s @]  :`   p*@ > GJ $*@$`-  $ `"""  㿘  ,@,``2   @}@Oy` 2    o&   k&  g $L   L$T$X6  $T  @" $X $`   2    $`   $`   $`  @ #5$`@p ` .$`  @  @  @  c@#   2$`$@`?$`$` @ @ @ c@$`$`$`#$`@㿘   , ,` & ; 2"6 2- 2* &4"  c    "    ( & 㿘  ,`  , ` ,@8 `2  @2@j 0  ,`& & `2  & |&   $ ( < @ D Hc@     4   4?" &  C@ c@ &0@ 0$  C@ c@ &0@ 0$  C@ c@ &0@ 0$  C@ c@ &0@ 0@ $  $ 㿘`  & `&  & & & & @t 㿘6`?.@2`*?  & & & & & @]  2 ?2&  & & &  ?& & & & &  㿘?.@2*6`6@g.<  & & & & & @, '2 <2&  & & &  ?& & & & &  㿘?#@*6`#6@.6.7 @ / ?#  & & & & & @ @  ?2&  & & &  ? @& @& & & &  fpu_explode㿘.@3`&`&` @" >"`>5 D `k  ``  ِ"2 &@` 2&@ &` & ?&@㿘````6/`7`/ 7 .` @26  0+& "``!` ` &`  &``2&`  @F&`&`&`&` &`&`&`&`  0"     `?㿘@ ` "`  4  r@"@ "`  $ ` $@`2 0 1#@ ? $ 㿘@``* @ [E `=`2`D  Z@"@^  `@2`1 ``@$``$@ YC @`@"   ~"  "1 1 4. `?*@㿘`@`* @i >L'``@2`&I  =@U"@  `@2 &5@   @& ! @: < `@"'  $"  ?&1@&1  4@`1?&, `@*@㿘`@`* @  V#``@2`& &&V#@ ! @"@  @`@2 & &&=@   @& $  `@" #  "  ?& &&1@& &&1 4@`&`, &`@ & ?`#@fpu_implode㿘 >>& &&o&׫"@㿘   ,@ ,   ` @ 2 @`  `  &   ` ` ` `  3 +`@3`(@0(@ 0@@   2    3 +`@3`(@0(@ 0@@       3 +`@3`(@0(@ 0@@     3 +`@3`(@0(@ 0@@*  `#  3 +`@3`(@0(@0`  & & & & & & & 㿘 ` `"  `@C"   $   ( B : & " B @  " *`@ B 2``@ $   b   ` B  b   *` B 2`` $   b     B  b   *` B 2`` $   b B &   @ b   *`@ B 2``@ $  $ `r """" " 2 `_  @    `?@    `$`    ` +@3@ *2 +3 (@0@ """"" 㿘 ` ?    ?`8#  ? 7 @  6`@ )1(@0@// @ .`@ & 0@@(@1)7@/@##### " ?" L" P" \" h" d" ` LWARNING: matchbyname not valid on sun4!%s 㿘>#䀢  >`@1  `?]#X` >X#  9 Ff  (  9F<("@bootstrap: sun4 machine type %2x unknown! mmu-npmgmmu-nctx/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter properties㽐  >#䀢 Z !>Р!А!>  @# > ($ H,$ L$ T\$ `$ X$ P$ `$ d$ l$! $ $ t>`"#>ِ!"@!>#(^b >`""#耢`"`#`!" "> `$" $>!  !  @!> "a #)>C `@ '>䀢  @>’`@ >’`@ 䀢  >H2 "c>Є2  "c쀢 # @!@%h>Ò >#䀢 u">@ =  @>@`2> >@` 2> !  >!8 >!p?, ~ 0Ԃ`  ", >!?P@@9 ?`, = 0Ԃ`  "?p>ِ!@%b ?p" >@"8 @1>@bH2>"P>@bH >ӹ">"bБ* =>"" kernel not compiled with KGDB 㿘!>#H@!#>c` ` @@Ac   xL -t#>0P` 9'>L /4 L" ** L`@ `/ *L @? L , : L :2 `  L?$` $@`  t  $t,>@#H>#   `)L - #> L b"`H d  a `H  s`H  $`H $`H>"  $`Htwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown cpumod %dfdsbuslecdx>#䀢 2'>͐!H0''N` (>`pJ@ ,>`hJ@ ,>``>#䀢 N@ x> iN` d2>>!X&!X!`&!` >. ?& & & at  "at>N`<ah@L?& !>& & !t `$!tN@>N`)ap@9!t&  $!t& %&  l2&N@N` e2"N@>Ĥ!x?&!x !>. & & & !t `$!tN@>N`ap@& & !t&  $!t sN` d t r>#耢 ""> # !" >O>3 $K>>Ę?!`>&!` >. & & & a t6a?!x>&!x >. & & & a t6a ` "t. & & & t   "t>!x?&!x >. & & &  t>!`"t&& `"t& &  #>!>  LJ 1:  :  N@>N`zap@& v&  f2N@N` d2N@>!6! . & >t&  "td&  l2#N@N` e2N@>Ę?!>&! >. & & & aа t6a ` "t. & & t&  @"t s=N` d t r5>!Ș?&! >. & & &  t>!`"t&& `"t& & N`r > a>N@ap@& & >at&  "atbootpath: /%s%x/%s@%x,%x:%c 㿘>8 N >Ơ ? >>Ɛ ?* (?$`>Ɛ 8`a N  > @>π X XWARNING: %s map is bogus, using default 㿘>#䀢 . >#  ) > x@">@  >Ɛ!  "?` @&@&`  L ?Ѐ "``0 "?sd-targets㿘!>  >>>ϐ"`\ $ >ϐ \. @st-targets㿘!>  >>>ϐ"p`| $ >ϐ |. @configure: no memreg found!configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU) mainbusmainbus not configuredx>" 4>#䀢 N  >">#<>#X )%  ?" " ># R` *`" *   "  ז 2 >C"' > ''Mǔ >瀢 "b>2">#䀢 >@>@c>@ܒc >>Ɛ#(#䀢 >@|>Ơ#P>>x"'˟'쀢 >#XH / @@>" PROM sync command㿘>!%d㿘@g##>Ϣ>@`q@#耢  #@sc .,%s at %s %saddr 0x%xio㿘@> П"p 4  0 >">">ǒ" Ў 4 no PROM root device㿘> Ȁ 2 " @K 2>>ώ#" ȁname㿘 " !>ǐ@#`@8 @1 property lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intr%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector ranges㾘@!>ǒcД@!?>Ƣc@M  @>@Ȓc؀ " @ >ǐ#>ǔ p >Ȑ V>  >Ȑ >ǔ֘ & &@4 &  ,\)>Ȓ`@ @J ? &   >Ȑ H>ǔϷ < & (>Ȓ`x @2 @?"  >Ȑ >ǔϡ < &!0? >#, ` ?` "`>#䀢 2&!>Ȓ`ؔ!4@ Ƞ?" @ޒ &! 㿘`@A `?X`$H$@$0$ $$#####virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-errorx$$#$####eccmemctlSUNW,sx: %sobio missingNone of the CPUs found fbno options in OPENPROMcould not find %s in OPENPROM audiozs㽈#>c䀢 2 >>ǒc`!>@ > @c䀢 7 @">Ɛ# '%>Ǣl @Ԓ">#H''>Đ!x'] 2>> #| #|''bK  2'0>> X#>#䀢 @r%>!>@Q@t# `@m`2'>ͭ '>Ɛ# '''ؐ>ǔ >#   >ɒ`@7 >"`@?>c>р "`x>͆ ش>#HL`$'2'>ɐ ^rE  >ǔږ 2aL V>ƨ#'>>#䀢 @  @ޒ>@c <>@Ԓc` @    % >@ݒa>@ْa  $ $ 'H 0+'>ǔ~ @>>#䀢 [C findzs: unknown zs device %dfindzs: no obio nodeslavefindzs: zs%d not mapped by PROMfindzs: cannot find zs%d㿈>#䀢 &!> "<  <@ >8> '''!̿ '>`  JE' !>:#? 2>@W#䀢` >ax>̝!@I>a>ʒa@2? >Ȓ`@@+ 2>ʐ!̂@7>ʐ"zpre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory 8>#䀢  > >> $  $ $ #s >#  " & %>ʀ "`0$" > #Ȁ`N P>`$` $ @` A >ʐ#Ւ`>ː ϒ Ȳ H@>Vc>א 0">>> X#ʐ#Ȑ @3)`@    > $ $   >ˬ h̔ WARNING: getprop not valid on sun4! %s node %x property %s length %d > %d 㿘>#䀢 >ː"t ># `€>ː` 0#[ 㿘>ϰ`Ԗ ?" *㿈Ȗ  㿘>#  @㿘># @search_prom: null nodeiommu㿘 >ƒc!> #ؒ@  Ԑ>>  #`>Ơ#@ђ #@I >@Ēc؀  >@` ƒ 2ې WARNING: opennode not valid on sun4! %s 㿘!>#` >̐!ƒ `@# @  㿘># `€8@ 㿘>#  8 |@Y |€0@' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !0>#` `  @>b>̒c&@&  @  PROM exit failed㿘>#? ># x"># tPROM boot failed㿘>#? ># x"># d@>@ 0㿘># l㿘> 䀢& > ` `*`" *  `@@?" >`@$>$> : * $`@? @ stxdsdxy㿘  '>@@@ ``?use one of: %s[a-h] %s㿘@( >ʿ!>!H >5>3>  ʱ  2 bʪ   2>ʣ @parsedisk㿘`;   ,`: ?.,&>!H "(,  @M  2 6 >ɉ"* *`@ & 2  @6  ڐ?  2,no memory for mountroot_hook㿘   2>`#@= $ $ >`4`4 $`4" "`4$ root device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right ?>!t  'p* >#(@   > ؀  >` H>`H "`H> H >Ϊ `x> P` >@ ` a > p@  `@`@ J? *?*?x tt t>΢ @ B>Φ ``>Ψ#>ɪ x` >@   bɟ>ɜ px@ x`"@  * ;p;p;;h;p;pvt*`` @'p p>@ >ʐ?'p>ʒ?"`t>" p>" &"> ؀ h>v>`*  >ʓ,@" ܑ2` *   ` ">ʐ?"`'p>ʒp?"`"@  >>>M!"`>ϐ`G"c>>"|"`>>`ܐ `2 $a ?  02 " "@ଖ?> 䀢  `>ʔ?2 ? >`>> "`> 4` `"` @`2` %c㿘 )> "*  @   "  0 @  #    Ƚ @,>ϰ?ȵ!0԰ Ȱ @0π@>π >>Ȧ!0Ő!Ȣ,config_attach: device name too longx>!H>ǒa6@?@< >ǒ"Ȑ@:@Y @B؀     *`:`J   㿐/>%/>d%d/> %    ,%+> `-`   ,% +> `-`/>@̀cache_enable: can't handle 4M with hw-flush cachecache enabled cache NOT enabled for %x/%x cpu/mmu combination Unknown MMU architecture...cache disabled. 㿘>#4>c#4`o Ҁ>#쀢 "   />T>H P>Ѐ@>"a>|"a>"cԒ  @  ڢA@ @  Ѐ%Р>#( " >  J"a>̐ # ` @>>А ǭ 0?"!>"#Ԛ  ڠ ڠ ģF ģFЃ@#У@ "$*" ģFڠЀ#Р "$ "Ǎ!(>#(>> *@">"# # @ ڢ@@@ @ Ј@ Ш@> "c,>n > >c0 c0>>:   ֢ 0`8 `>䀠 ֢`֢ >! >" *`*`8>#48 #4>䀠 ԢB@Ԣ@@>! >" **`*8*`>00>?>:   ֢@@ 0? 8  >䀠 ֢B ֢A@ >a>#0"a#0 ֢0>  8  >䀠 ֢֢㿘>#䀢  >>#쀢   ֣0[>! W> >@> a2`> "`>` ((@~46#  .? : ֢@?@03%,? . >#䀢   آB?֢A?@ 0c @ 2  ?6 6 R `?0c @ 2   >#䀢 6 02 >L $   2 >L  `? 2 >H@6 ?>„T*`( ?㿘 `v ?r` "j@` -" 2  ` *  ``   `쀠``  ` ` `` `"@ 2 ``@*  `? 2 * ? 2 8"stray interrupt ipl %x pc=%x npc=%x psr=%b EC EFSPSETcrazy interrupts㿘 > " >zc>h>А"  >`Ԑ   "`>Ā#h>ϐ "`"Ё㿘>#  >޳ >>l ,Jl #>Ho o>#"#H 0 *l ¶>>Jam *am intr_establish: level %d interrupt tied to fast vector㿘Ho o> ؑ: ". >Ӑ >Ð T@@2"@&`H 0 intr_fasttrap: already handling level %d interrupts㿘>. a6`  c@Ho o'>ؑ:  >>Ð T. @ >Ӑ!pܒ!>Р  #>a  %@ q8@$(R$ a  ؑ*@$ؑH 0setrunqueue㿘  `2 >ë"+ >"&>  * @" & ""remrq㿘 >b 2 ; 2>Ë#( "` "@& *>"@@  * +#b real mem = %d startup: no room for tablesstartup: table size inconsistencystartup: cannot allocate buffersunable to create DVMA mapunable to allocate from DVMA mapdvmamapavail mem = %ld using %d buffers containing %d bytes of memory 㿐>>` h>"`>ah>>`# * @ >!%>@ *@ >#@")>> #!'> , 1>&"@!,'  ">>  @{j@|# %  +>ᤑ, @` ` @ @"@! "@'>  ꀤ'> >"a>?#䀢 !>?$!؀ ?#>?$b >А 9 >" >— 0b !ؐ {" !ؚ@ ">>Š P>!`xb >"@ >>`@ 2@ 2 Ƣ!> #>А': !   `$`g:` @}Fa>ax f >"c>">>!P "b"?   >",  "?>a>>a +* >> !>` >@# >А ?H >"ؖ @ >#䀢 >?L?H@."`㿘>"">>!Pat* >"#>!D> * "p* >>!d"L* * >at" L*" * > "!h* * > @"| ?>>"`X>1>à"aT * >" *` * >" *` *  *  `>!h@zK & >`  > "` "`> 2>> 2  :  ?!"!">>"> >ϑ*`" * " * >" >*`" * " * >`"!``:`D ?". 㿘  ` %>xOy$x$ *& @|R P$`D ?$ =#$  $ H$ ,$ &`  -h> $`H    *@ $ ?Р ?''̐ '''''`'`'@'`'`0L'@1C ?ȒL 0  ?M !  (*@  >"!>"`" =c"@$`$` $`$`H㿘L@1  @`23  ^ ", ` `  $ <* `< @"` "`"`"`"0`"H@  $a a ?"a?`?" @$ āhalted rebooting 㿘> >"Ji> " H>  >` >#"`(>"FH/` /  !>w"%@>l"  >ϐ  s*   @>ϐ  d* ->*  *>* > 㿘>> "`> !>  >  @2@  # @-!> @> .$ 2 * "@*`> @``"@ >>` `: @ #``> " *` > @  :@ ?$ * " #`>   dumping to dev %x, offset %ld dump area unavailable %d device bad device not ready area improper i/o error succeeded error %d 㿘>L_#@#>`? > '>sഀ>`!H`2  *"@ *`>@`@>!h?>>!p0ര!`> ȓ2` `*`" *  A 5 #  > <` @:- ->Ϡ"8`@>א!t4`@@) > @> @ @2  4 @@ ڠ" ǰ @,D2>ؐ -@```````|````````````````>+!0>'!0>#!0 >!0 >!0>א!Frame pointer is at %p Call traceback: pc = %x args = (%x, %x, %x, %x, %x, %x, %x) fp = %p 㿈JS>ؐ >! > 44@@ <  $ ( 0 ,#\ 4#` 8>#d 8!#h 8 >mapdev: zero sizemapiodev㿘>䀢 >?x">!8@`>Ȑ" @?@@">" >!@*@>#>  @@ * >Ð / @%>#>!>`  ؟@ !@&㿘@h` curproc = %p, pid %d no curproc cnt: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = %lx stop at %lx %x(%x, %x, %x, %x, %x, %x, %x) fp %p end of stack trace 㿈> `">>`08#X>4#p>aX`aX#\``` >`(#I#>>ؐ#">ؐ#` ? `    > <  $ ( 0 ,#\ 4#` 8>#d 8##h 8  >> ? " <> g0 panicw: case 4 w: unknown case %ld w: arg not allowed 㿘N@  t>0``>>>ߐ!x !Ő!0 0!warning: ldcontrolb called in sun4m 㿘>#䀢 >"H H/` /> `2`> ` JȒ$` H p@` * ( 22"  *@ `  `*`0*@2@  `*@㿘 J P 㿘 !<@ P*J@<  "@ `    `  㿘> 􀢠 ؐ J! 㿘 `Jy!    mmrw㿘 >`   #>ڐ !`   $   >ϐ "`` р Ѐ - 7>>Ю +>'>@`  ``&@? &`> >ڐ!j jklLlLlLlLlLlLlLlLkk` @ΐ 2` >a at ,   ؟@ ``>  "@ 8  at at @F@ u`` ?G#  ?H `> >"0  ``  " @8 `@@8 ` @?Ŕ S (` "&`J >#䀢 4 D0` !>` 2 ` T   @w9$ ` @8 $  @`@$@"$``< @ B `>`"&``  "=@ !>  0$  ->䀠@?  㿘>#  "  @ " @ 㿘#  T &G, ?㿐#@2> x  &`'>@> x@"'Ho o6H p@  $'' >0#c@  @   #@P0#@Ӱ 0#@0#@nȰ `ð 2Ho o€H 0 @` $  T  'Ho o H 0Tc` Zt SmHo o H 0 @2T S7`Z .2HHo o€H 0@u @ $$  F("2 Ho o`% ! Ho o@H 0>" & " T  TVA2PA: Asked to translate unmapped VA %p2`((2` :`  ` 2`((2` :`  ` 㿘>! >>#䀢 >"҃" ҋ@"*` 6 * @*`6    0 آ`> @ "@㿘 @  @  $@ `@ $@  H#*$$ `@>X">p"@>>>Ȑ?  `?`>0>>!T؅*  >आ2>>Ȁ#!T ( ">`#@`>  "`>Ș > > * @*  @0 `>"2>> @* ` ` mmu_reservemon called on Sun4M machine㿘 >#䀢` >!``#?>" )?>""02 @#?>" )?>""0@@L7>/>->#4` *` @* @@`Д@`>`Ԥ &>!?  >А㼠? >!2 @4` ,   2 >㐐 * 㐠? @> Є@Ф@?@ @ >&@&mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry type㿘  !Ѓ* H@ %>Є(    У@%>c ,`>@/ 0" &@@?@vy* @w>"&@*`F^ ` "@  ">~>" >z> >ݐ# "@ #ؐ# <$&@@s"@ 0҂` `  *  /% $أ@`҂` `  *` ҂` `  *`? @҂` ` >ܐ * "(Ԓ> 2 "@& $ 0҂` `  *  /% $أ@`҂` ` 2 *` ҂` ` 2 *`? @҂` ` 2>ܐ * "(& (@`  mmu_setup4m_L1: unknown pagetable entry type㿐'?. # c"+D    >&@`  @sI ># ?a&@s>"@@s;"$%` p҂` `  *  o) $¡`҂` ` 2  * c @ ҂` ` 2  *  ?# @ ҂` ` 2>ܐ * "((2  &@ ?  `  -` a& ?@r"@ 0҂` `  *  /) $Ƞ@`҂` ` 2  *  #  ҂` ` 2  * ?c  ҂` ` 2>ܐ * "(2  %$ ,  * ?   `+ "? W`  @r>c ?a&@r"@@r"$%` p҂` `  *  o) $Ƞ@`҂` ` 2  *  # @ ҂` ` 2  * ?c @ ҂` ` 2>ܐ * "(}2  &@@`p#H`   `mmu_setup4m_L2: unknown pagetable entry type㿘?. #?#-?  "\  " >$ .  ?!&@r"@ 0҂` `  *  /% $@`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>ܐ * "( 2  $'    * ?   `+ "I .  ?!&@qȒ"@ 0҂` `  *  /% $@`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>ܐ * "(2  $$@@( `@,`# `W mmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry type㿘 ?. `І `" > `"  > &@&@v"t#(`@   me_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptes㿘>!Ѐ !` "`" "@&& "">"耦 "># `2>># @2> ` "`" "@&& "" *` ` * @`2 > 8* @ @> h>#䀢 - "@@䍀@@ )`>A>#䀢 `"ꥀ>- ꭀ@>! >  >#䀢   *` *`:`* @>A\>#䀢  "ꥀ>- ꭀ@>#䀢   Э@`  е` >#'# >#??#փ@   >!̓*@ >""@ @ 2@ >"h*` : @" $ > @@  >#䀢    >* : *` `>>!  *`  *`:`* @@`>!5  ` "` $`  "@>#䀢 - "@& 䭀@& `& `" &`.` * @ . 2 & 6 6 me_free: no segments in pmap㿘>ϑ.`"cx* @ +  * @>#䀢 + + :`* @>#䀢  Ь`  д` #>#>!>!>"##>"h! > ҃ @2 @*" 2* :` ` " `` "` &  "@2>>  >!*`  2``2 > ""`""`>"""@"">!"!"@"!ԁ㿘 0 6`*  * @`6` ?*@@;  >a  3 І@+.@??@H /f * ' >"!>c䀢` Ю@`>ж@`>#> ڦ@`@H 0 㿘 >#䀢   , 0H /f>* '>    >""#/: >0>( >!@"0?"0?`>ϐ "0"(>!0>",`>! >#@  ` " `,&`04#&+>c䀢 D&  / "⥀0@H 0 [  > >#2 `,,: $*` *  L  ?` ```Ъ```в`?ڰ 02 0!> D  $#c@נ D? ` +@ђk> ,` *@ (>`:  c䀢`" "⥀/ @ "`H 0ctx_free㿘`2>>l##䀢 &"҂> ҋ@>! %!> @ >>#䀢  "0@>#䀢   "֣` "֣> ֫@>#䀢 ` "֣``>>#䀢  "֣> ֫@>b$@>#䀢  "b > , "> *pv_changepte 1pv_changepte: no segmentspv_changepte 2㿘>H /f4 * '   >#䀢  "쀀 @ )>`2>ؐ!P4`*` ` * @4` ?>ː!`*   >! 2#>! 2<` <`  | *k$@ / >#@ >! @*\ #@ #@(Q#䀢 `"Ġ0 Ĩ@@>! +@) 슐% #䀢  "Ġ  Ĩ@#䀢   Ш`# а`#䀢 2<` <` >` >` ?* @ <  @*@" #䀢 2<` <`  | "2g>#䀢 & "저0 @H 0pv_syncflags: no segments㿘=ΨH /f4 * '    H 0 >#䀢  " @ c'>/>4`*`  * @`4` ?> ȑ* @ >!@"G 䀢 "֣0 ֫@@>! '@%ܐ!  "֣  ֫@䀢 2  Ҫ`ҳ`䀢 2<` <`   ?* @"  6 <  ,@2>#䀢 % "0 @H 0pv_unlink㿘  >c  "c& &   #& & >ϒ#>` "`g#P2    #" # <>#x>!``   2  " 5㿘   >>ϒc`  "`$$ :$ # `"   &1 #># x<@2 1>!@" 1  $  >  # """$㿘<H /f4 * '   >#䀢  " @@ />2>!P4 * @ *` 2>!` - ># >! *e` #@(\>#䀢 "أ@ 0 ث@@ 0`>! `@ `ꐐ `4  !<  ` ` @<` @`%*>! >u>#䀢  "ЃЋ@@⌑* @4 * @*`4    0 آ`<  @ 4 * @*` 4  < @ "@2}>#䀢 & "@0 @H 0㿘;ҢH /f4`* '`   H 0a >#䀢  "䀀` @` `C  2*`  * @`2 ?> ȑ* @ ", >#䀢  "Ġ  Ĩ@  Ģ`2* @*` 2 !: @ @ ` 2 ``":`  #@  2 >#䀢 $` "0 䨀@H 0㿘  >c  "c& &   #& & >ϒ#>` "`#P2    #", # <>#x>!``   2  " v 㿘  >ϐ#  `" $$  $  @$ # `"   & #># x<@2  >!@"     9$  >  #  "" ""  " $㿘:H /f * '  `)>#䀢  "#>@#>@ "c䀢 `"Ԣ0 Ԫ@  > #䀢  "ࢀ0@H 0㿘> >"!>"!> >: >c䀢`"@3`@ pmap_bootstrap: no kernel memory?! 㿐''H>#䀢`'L` >> "!>#耢 $> "a>  >"!>>!"a4>>""a>>"X"aD>> "b>>!"b|>>""`>>#"a>>"P"`>>#"cP>>!"c>>#8"a>>!"`>>"D"`>В`  "`"``"`>!"` +># TL>Ð?"`'L>"a" ?, @ * 2 >?HAL>#@>"#xL*"@ *`@>"b>"` (`@ @h&@>"!А!" >"""" >"""" !>!ؐ >-> +> @ * @ %b'>$i!؀ >א">#!hb>"`?* >@" >  h@ 2@  "h >>"b b@"`@>"at@>""h>?"ap>А $@>`"b>b> >a" 2 >a*  * @ >" X>! 6 $@``  $@$@>"!0>ђ?>"(>#? #@  2 >`  >` ? 3>>#   9>>Ю 4> @ ++? 6` `   6 %@ %"$""'"$ >$ " %4`$4? &4@* @2`>#?`  ?&* @*` @ -@@> * ># @ >`  Ȧ@@ L>> 2`%Ԧ"@Ԓ`""L >! 3>>Д!>#>!Ā`2 "@ @  >`   ?38  ?`2®@`ȶ@`@ ꀣ >! ڀ`>#䀢  "¡> ©@> >_#@ + #> І@ Ц@@ @ pmap_bootstrap4m: botch in memory-saver (if this doesn't work, fix pmap_bootstrap4m in pmap.c)Unimplemented MMU architecture %d㿐   >>#"a4>> "a>>!L"aD>>""b>> $"b|>> "`>>!"a>>""`>>"t"cP>>#"c>>!"a>>#x"`>>""`>В`  "`#>a"` "`$"`(k@g `!>#@g k.$@$` ?,@ * ">#@'!>А ͒ >#>a""$ *`@ '@f"@!>a$  @f'  *@$@iR#@i$?#@2 * " #@'` ?'!>$" '@f̒"@" " $@g!> ?'$ ('@f"@ " $@c!># <'$"$'@f"@"" $@`6>#2 * '>"" ҂` `  %* $Ġ`҂` `  *` ҂` `  *`? @҂` ` >ܐ *  "( >"!@@>"'@fb"@ > ?'"`('@fU"@> ?'"b '@fG"@ !>># <'"b$'@f:"@!>!ؐ>/>` ->  * ' % %>$!؀ >'">#!h>"`?* >@" >  h@ 2@  "h >> "b 'b"` '>"at ''>"bh>?"p>В` %@>`">>`>"@ 2@ >*`@ *@  '>"`X'>! 6 %@`` %@%@>"!0>ђ?>D 9"(>""D ҂` `  *  % $Ġ`҂` `  *` ?҂` `  *`?*@҂` ` >ܐ *  "( >А " ( $@e$?#>@R?#?#->4` ?T4`O!>Б-`@* >* @e^ 0҂` `  *  /% $Ġ`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>ܐ * "(Q4`>Г*`2 D "  % *` >#@%䀢 >#<`  #<` ?@c` 2M4` ?G!  - ,>* * @d ҂` `  *  % $Ġ`҂` `  *   ҂` `  *   ҂` ` >ܐ * "(4`  2``"&>@`. >#@ 䀢 2<` <`  |  pЂ`"@> @ ?>_#@; p҂` `  *  o% $Ġ`҂` `  *  @ ҂` `  *  @ ҂` ` >ܐ * "(䀢 2<` <`  | 2; p҂` `  *  o% $Ġ`҂` `  *  @ ҂` `  *  @ ҂` ` >ܐ * "(]䀢 2<` <`  | 2 "@> @@ 4` #?#   #+>А`@ `@ D@> !.`@d 0҂` `  *  /% $Ġ`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>ܐ * "(>Б2 `D "@ % >#%    2D! > - ,* @c ҂` `  *  % $Ơ`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>ܐ * "( 2  "@&? @`"```c >!   >>    "@ `>#䀢  "Ơ0 ƨ@ >#쀢 ">  ">>">># @>@ Р$R#0 > Р  I#0 #>Y#h$Ġ`> ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` ` 2 *`?*@҂` ` 2>ܐ *  "(' 2  ?!Р $Ơ`>#쀢 +Ѐ('>Ð "` #>`%> @a:: >"@ޒ@(`( @a/:> @Ӓ@$`$ @a$:>"@Ȓ@pmap_init: CLSIZE!=1pmap_init: unmanaged address: 0x%lxpmap_init: sva(%lx) < eva(%lx)㿘>!> @ >̐!Ю  > Ȥ > M!9>5>3>7>@>"@ ` " >!耢@ 2 * > @*"@ >!2 "h* , @ a@@ >"   * $@->А  ؟@ a @bZ$`  >!>! >|€>">"!> >" "b㿘>@!%>#>В@ؐ` @ @ 㿘    < "Ԕ @b <@㿘+ "Ȕ & 4n+ & >#䀢 & &  E& $ " >`Ѐ` > @dec@& $ 0҂` `  *  /% $֣`҂` ` 2 *` ?҂` ` 2 *`?,@҂` ` 2>ܐ * "(& (4 $ & 0㿘   ? & @} "pmap_release: segment list not emptypmap_release: releasing kernel㿘H /f4>* '>#䀢    ">"X    >"'H 0  ">: ">#䀢  "  $  >~"  $& "& $& (  " 㿘 M>А > 2> >#䀢  "@0@@H /f@* '@ >#6` 6` ?**:` * @ @@ >H 0>#䀢  "@0@@㿘. *  ` `/ @ `>#䀢   "أ@>  ث@@> &2  >!   Ò@!@ @4'>#@ * 2#>>! * >!>"" >2 "h* <   " 6 ئ@ @@ -  ->#䀢 ../ : /  >! >#>А!` "ԣ@`ԫ@`2ڮ@`ض@``o ` ?-` 㿘. *  ` `/ @ `>#䀢  "ģ@> ī@@> &2  >!   .@!@ @Y+>)>p`  ` K@<2"> >I>!4 >!̓*@ >""@ >2 "h* <   " v>! *>#䀢  "Ѐ"Ћ@@"* @6`* @*`6`   p Ģ`` >` @  "@@ p, >#䀢 ../ : /  ./  ! ڢ`> X@:,2!pmap_rmu: no segmentspmap_rmu: no pages㿘. *  ` $ / >"  `2>"0>!H >#䀢 2>` >`  | @'##> >2>! * >!>"" 2 bh* &> @@ - Ր$ "% ` ?-` @ "%@ ">#䀢 > &2  "ģ@   ī@@  >!   *!@ %#䀢  "ģ@> ī@@>#䀢 2  `>@`>#䀢 2>` >` >` >` ?*  @?#@ 5>2#>>! * >!>"" >2 "h* <   m"  Ĥ@>#䀢 2<` <`  | "> @@ Ƣ@- 9>#䀢 ../ : /    >#䀢 >!ڮ@`!Ķ@`o "% ` ?-` @a "%@>#䀢   ,@"& , 0"& 0㿘. *  `  / >"  `2>"0  >#䀢  "أ@> ث@@>! > &2  <R@O M p` آ` 6`* @*` 6` >` @ @  3><2" >K>!4 >!̓*@ >""@ >2 "h* <   " x6`* @*` 6` >` @ "@> @@*-  ,./  ! ڢ` "`/ " % ` ?,` @ "$@` " $."@>#䀢   ,@"& , 0"& 0pmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V㿀>#䀢   {B!>!>b& ;`9.b` >!>&2 h* 0'>!>a&2 h* @H /f4'* ''  >#䀢  "ڃ@'؋@'7> ;>А ?' 5 -`*  5  ?>u!* @ `2>k"`,`a@2 䀢 @= b |_= @ "&@ ?-  "$ 䀢  "ڣ> ګ@>! %@0!  "ڣ  ګ@䀢 ` Ы@` г`䀢 2= = >` >` ?* І &: >"8 􀥠@' ئ@`_䀢 2> >  | @U">А 2%>!? 䀢` "У@`Ы@`2>>Кa@ڭ`?!ص`?쀢``캐 ?-- " @䀢 aaڮ`@ض`@o "$@`죐 ?- a "%䀢   ,`@"$ , 0@"$ 0M #"' '>#䀢 ' "أ@0 ث@@H 0쁊 pmap_protect: last segment㿘 π̀0->#䀢  "ꀀ0@@H /f@* '@ %>/#)>6` 6` ?* * @**:`* @ ><#8 *  2s>a 2䀢  >`  |>` @b@@ "@ @@`Y@ +䀢  "ģ@@ ī@@@J@>Ϣ#ֆ@`    $`` >a `$` Ц@ @@耦@0,  "ģ@  ī@@䀢  Ш` г@`䀢 2>` >` >` >` ?@ *  Ђ@ Т@@ @@ @ iH 0>#䀢  "ꠀ0@@pmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! 㿘,9> >А  @  !!`  @6`6` ?H / * ' *`  *  2 >P"02>>I#0c+ `  "` >!@>#䀢  >`  |>` @@ ~*"@#䀢  "􀀀@@ +>#䀢  "ģ@0 ī@@@>>#䀢  "V>@@S>! A ;7#䀢  "ģ@> ī@@>#䀢   Ш`> г@`>#䀢 2>` >` >` >` ?* @>#䀢  ">@@>ϐ.@>#䀢  "0@@0>ϐ# `" H 0㿘!>!>b& ꀎ`+S` >!>&2 h*  0>!>a&2 h* @H /f4* '` >#䀢  "@@ ` 4`,* @ 4` ?>k!@ - `2>a"-`@ >#䀢 `"أ@ p ث@@ p`>!  R ؤ`  `  <` @ @  "> >8"8 4`* @*`` 4` <` @ E"@>А @2@,- ! ڢ`> X@ 6@,R!1 ,- ! آ` -"@@ "%@ ?-  "%  "`$,"@>#䀢  `,@"&`,`0"&`0 #"&a&>#䀢 & "@0 @H 0㿘 ՀӀP0*_>#䀢 9 "0@H /f@* '@ )>>Ϣ##6` 6` ?* * @**:`* @ >#8 *  2z M#䀢  "Ƨ@9 Ư@@l@< '>%>pԂ``   `,$`` ᐐ `$` ^᐀ X#䀢 29 "ЀЏ@* @6`* @*`6`   p Ƣ`>` @ "@> @@ʐp-@  "@ @@!@> 6`*` *  6` a >` ` `  $``  $`   @ @ "@ @ b#H 0>#䀢  "0@㿘)> >А  @     >ϒc` "`H /f4>* '>#䀢  " @@ >#䀢  "أ@p ث@@p`>! <׭6`*` *  6` a>`  @2>#䀢  "F>@@C>π (>! ׅ>#䀢 >"҃" ҋ@@"*` 6`* @*`6`   p آ`>` @ "@6`*` *  6` a>`  "@>#䀢  "@0@0# `" H 0㿘 [>!Ā >`  R>#䀢 . *   >#䀢 2 >!>"&  >!>bh3* @ >!耊6 ?*@>#䀢  ">@>А @ >@Ϛ>#䀢  "0@㿘6`6` ?,` * @@.@H /f * '  >a "J ֆ@E # @@H 0>ᜒ0t2 ?>!* >!̓*@ >""@  >3 h*  >#䀢  "Ġ> Ĩ@>!    ,  =@ >a />"" 4   - >!>#䀢 "ҠҨ@ Ю@`ж@`񀢠?@>#>  Ģ`@H 0pmap_enter: segment filled during sleep pmap_enter: pte filled during sleep 㿘'6`6` ?+   * @H /f4>* '>#䀢   0 ," 2  :  & & 0    & , 2" "|u ` >Đ ؐ} ")"$,  ?>!4``, @@2` "># * |O@` >!}^ "@($@ ,`  , >!@ >#䀢 2>` >`  | 5@ >#䀢  "Ġ0 Ĩ@@% #䀢  "Ġ> Ĩ@>#䀢 2  Ҩ`>Ұ`>#䀢 2>` >` >` >` ?* 6B `# @@H 0 8 & 8?}& 8, ?>!, >!̓*@ >""@  >3 h* 颐>!  )  ,` 8 & 8 @`>!@4>  >#䀢  "Ġ0& Ĩ@0##䀢  "Ġ> Ĩ@>#䀢 2  Ҩ`>Ұ`>#䀢 2>` >` >` >` ?* @>#䀢 2>` >`  | $H 0pmap_enter4m: attempt to use 36-bit iospace on MicroSPARC㿘 T@?x >#耢 2*`>"x@>#䀢 ` <@ >!>"&  >!>bh3* @ >!耊6* @`>#䀢  "􀀀>@>А @+`>@ƒ>#䀢  "0@pmap_enk4m: missing kernel region table for va %lxpmap_enk4m: missing segment table for va 0x%lx㿘6`6`*`  * @@  H /f4* '  > &p`  2A ` ?@<H 0>᜔0h. >!2`>!̓*@ >""@  >3 h* E >#䀢  "Ġ> Ĩ@>!    ,` ꃔ/@@ >> PВ! >Ӑ>#䀢 >"Ҁ" ҈@"*` 6`* @*`6`   p Ģ`>` @ "@H 0㿘%H6`6` ?, * @H /f * '  2" "z `{. "&"$, $ 2Q! "z `{ "> Ѐ > @Q`@4$&! 0҂` `  *  /% $Ġ`҂` ` 2 *` ?҂` ` 2 *`?,@҂` ` 2>ܐ * "(, $,2  " -`@@ 2Z! "y @` >!z "@> Ѐ > @Q`@ې&@!$@ ,` 0 , ҂` `  *  /% $Ġ`҂` ` 2 *` ?҂` ` 2 *`?,@҂` ` 2>ܐ * "(Β-`2  g"  >#䀢  "Ġp Ĩ@p` 6`*` *  6` a>`  @  2> ` ?@<H 0 8 y& 8?v& 8* >!2`>!̓*@ >""@  >3 h* Ő>!   u  ,` 8 & 8 /@ />#䀢  "Ġ> Ĩ@>! >P>#䀢 >"Ҁ" ҈@"*` 6`* @*`6`   p Ģ` >` 6`*` *  6` a>`  "@H 0>φ pmap_extract: null pmap pmap_extract: invalid segment (%d) pmap_extract: invalid segment pmap_extract: invalid pte 㿘 6`>!H*  * @6` ?>!hƒ  *   >a W>#䀢  "@@ ` @#f>#䀢  "أ@0 ث@@Ԇ@,>>#U>#䀢  "أ@> ث@@>#䀢   Ы`> г@`>#䀢 2>` >` >` >` ?* Ԃ>#䀢  "@@ `2>>!#䀢 2>` >`  | @ >?*> > * @@!F 㿘 2>=!HF *>#䀢  " @ p">#䀢  "֣p ֫@pԂ`>#䀢  ">@>6`*` *  6` a>`  @>#䀢 >!2* ?.@o>䀠 $Ƣ`㿘>#䀢   {>!>"&  >!>bh6* 侐 ?$ 㿘>#䀢   {2 >!>"& >!>bh6* @` 2 䜐   㿘>#䀢   {>!>"&  >!>bh6* ~ ?$ 㿘>#䀢   {2 >!>"& >!>bh6* @` 2 \   㿘>#䀢   {>!>"&  >!>bh6* : ?$ 㿘>#䀢   {2 >!>"& >!>bh6* @` 2    㿘>#䀢   {>!>"&  >!>bh6*  ?$ 㿘>#䀢   {2 >!>"& >!>bh6* @` 2 ؐ   㿘>#䀢   {>>!>"& >>!  >>!bh2* ې@>!?6* <@>"Ҥ> # ֤㿘>!>"& >! 2 >>!>bh2* 洐@>!>>&@ "6 ?*@(  >! 2 >bh* 朐@>!?6@* <@>"" Ҧ@>` "Ē>!  ϐ ئئ@㿘>#䀢   {>>!>"&  >!  >!>bh2* b@>!>`!>6* b b>#䀢 >"҃" ҋ@"*` 6 * @*`6    0 آ`> @ >` "u" >! >9>#䀢 >"҃" ҋ@"*` 6 * @*`6    0 آ`> @ "@㿘>!>"& >! 2 >>!>bh2* @>!>>"&@ 6 *   >! >2 bh* @>!>!耢6@ >"*`" `ߐ>#䀢 >"҃@" ҋ@@"*` 6 * @*`6    0 ڢ`>! > @ "@λ>#䀢 >"҃@" ҋ@@"*` 6`* @*`6`   p ڢ`>`  `" >` !Œ!>!  >Α! >΋>#䀢 >"҃@" ҋ@@"*` 6 * @*`6    0 ڢ`>! > @ "@g>#䀢 >"҃@" ҋ@@"*` 6`* @*`6`   p ڢ`>` @ "@kvm_uncache: table entry not ptekvm_uncache !pg_v㿘>#䀢 ? X%>#>0`  ">  ?>#䀢  "ЃbЋ@b* @6 * @*`6    0 آ` > @ "@>> ɰ0  &> Ƞ>!  >>ܐ> kvm_iocache: 4m iocache not implementedkvm_iocache !pg_v㿘>#䀢 2>"`  > І  Ц> >Є 2     ((@ "4>Ā@:88>䀠@>Ԁ" "@㿘!>#䀢  >! #b>#䀢 >"҂" Ҋ@"*`   >+Ԣ`" >Ԣ㿘>#䀢  > !>c@Q * >a >` 2㽘>#䀢 m   ī@@>! )->ʦ >#䀢  `>`>#Є"@`@ @"I`> `>!>>#䀢 >! ī@`>! ij@`>!ؒ!$>'>>' '>#"@`@  @"``4@ > @" trapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallcp exceptioncp disabledlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=%x npc=%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_FIXALIGN T_INTOF 㿘>aX` @ "` c>> ^>&&> 2 ># $  쀦 &  i c : ) c  )03  ̀ #>) ) $ڀ ߐ" ) > > ܀  > ) 0  )0(?" ?"h` ) >!>b >Ð!. @>"'>"  0  Ĕ@;$ >      >! *q >Ò`H!$ >!h 2   R #>`x  $`x &@ "   >` >ϐ"HH` V @ Β ` "k$`>"Xd@Ґ  H` ? @  `X``6 @  ` ?>"hF$` A `x>"x $`x 6  0 >" )  &    ">"  "& &"  &&}C `  (( Ā@ ~5 " ~ >, `   "` (@*@ $ (%>#$ ", (H 0.r `D j"`DH o@ `  (( Ā@ } " (~  " >*c@> x*@&㿘 ` `   xm @ 2??  @$` 㿘u " text fault: pc=%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=%x addr=%x ser=%b 㿘>!X >` " >#Ȁ  >!Ā >  p @ @  >!耏 @2. 2 Ho o>"h>[>n"Ȁ " > >$ @"M > 2H =#@ >!⇖ 9 $  @    ڳ&) @I @n  䀤@ > >@> "@ ؓ2@ @8& "  @ ڋ $ @" 쀢` ` 2'`Ho o>"ؒ>">"Ȑ t'` { @n `  (( Ā@ |Ր " }i >, `   "` (@*@ $ (Ő>#$ ", (H 0. `D  "`DH o@ `  (( Ā@ | " (})  " >*c@@> x*@'@text fault: pc=%x sfsr=%b sfva=%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=%x addr=%x sfsr=%b 㿘>!X >` " ># ` @ +  `` `Ȁ @ŀ >#쀢  ># @ `2 `>#쀢 2 ``  @` >>`|"`$Ђ`  v @0!耎`@8 `` ` @2i >#쀢  `>! @  . `   @3`@ 2 Ho o>#`>Θ>"Ȁ " > >$ @"9 > 24 =# >! & $    䀦 > >@> "@ ؓ2@ @8& " % @ @" 쀢` ` 2'`Ho o>#>v#>"Ȑ t'` zm @n `  (( Ā@ {\ " { >, `   "` (@*@ $ (L>#$ ", (H 0.ə `D "`DH o@ `  (( Ā@ { " ({  " >*c@@> x*@'@syscall nargsp>X`0> `"   $  ,3  > `0`4   Ѐ@ `4`8   .   * )@@T`2 > Ր!H,@ `H"*Y \   @`2<  T`f\5 *   @`2' T`fI'А`4'`Ц&`0Ԁ &`4``,"&`  @`*@$   `,@&`0@` &@&`&` `  (( Ā@ zY " z >, `   "` (@*@ $ (I>#$ ", (H 0.Ȗ `D "`DH o@ `  (( Ā@ z " (z  " >*#   @`2@ e۔@@> x*@&@㿘   `  (( Ā@ yܐ " zp >. `   "` (@*@ & (̐>#$ ", (H 0. `D "`DH o@ `  (( Ā@ y " (z0   >*#   @`   (   B e[ pagemove 1pagemove 2㿘> ?2> 2> @> w#X '>>Т %>|€2> g#h >"ؖ @ @㿘>!@7㿘 >!.k֐>&@!@"  lߒ  㿘>a@ @.@ lВ physiodvma_mapin: null page frame㿘> .@ @ >!.>  >! :@ ؓ: H /* ' %>`@ ` >  `H 0: H 0??> >!ؓ*@ @(7>%>|€2>> Ő!!>#䀢 * ,J  ?>А  ؟@ ?>!?ޢ@㿘>#> `.>! .,>0>А &H /*'>#> > >ؓ:@ a`&  2  |a`H 0>! ėvmapbufvmapbuf: null page frame㿘 $@2>> W#! <'>%>   0  @@*@/& @@& <->  4??%>#>|€2>> -# ? b؟@ >!?@vunmapbuf㿘 $@ <> !>!>a 0>`8       @& <>! & @ 0 4 <"" 㿘 `H$`2"  `> x!ߐ ! *jq &` !&`c &`@  P $"& 0 & & 0 & 4cP> !$  "`>##$ $ $  ?$ P># " "" ""㿘  #>`x2$`xkA * >! B"!G& 86 6!X&(  P `> xp  !"@DH!"!H''  ( ' #\#`#d#hD#l !X #\#`#d#h3#l &sdcd㿘   => `@C   > @C  .``>#䀢 `$N` s >` # , >  >#䀢 2 *`N` s2*`+ *`@,  ,  "$`disk label read errorNetBSD disk label corruptedno disk label㿘<  #&< `6#&(u&$ 8$ H$ 4($ 0`$ $@|2 <" $ $G 1>$!6"@2@@’ !W@@Ɛ 1> !ؐٔ! @Co"1>!㿘`8 "; `( !25 @, !W@2- ` 2)  " ! * `@ .* @    @2 @  @ ! 㿘@Ò( <"$ 8$ H$ 4($ 0$ $@㿘 8 0 H *  @a`:` `  @ $@2  H2 H $ ( H`@ $ H@ "  0 $ 4 +   $ ($ 0 H` @EE`8$ 4  $?($ $SunOS disk label, bad checksum㿘"  @`@ *  1>O!А!W&@&`&` &` &`  &`$"&`(!&`,!&`0!&`4!@E!&`8@E!&`<! 6`B! &`D!!6`H>Ī ! 6`J6`&`&`@E@$   &@ ,  , $$  ,  4 `6`6` 㿘 ("" F &@ &` &` $&`  H6a 4 D 6a B6a J6a 46a D 6a 0 6a ,!a6a* @EJ2  @D צ@@D&@```$6"6a b@ 6a@`@ 6a 㿘 @"- @"+ `>?  @29?@B & ` 46 ` D6 ` 06 ` ,6  ` J6  ` B6 ` H6 ``4`D 6@A   8` .  @C  "@D@&& *`*@ @    (@  &?} ?㿈`d >\ `>Ē`*  44  4"@ 4"@`    @ 4"@  4"@ $ "#\;`@%!`?   @ 4"@  4"@   @J㿀\`` d 3?` @DJ * @ :* @D> @ * @`:* @#\`#``:`*`"" #d#h#l#p  ; + ""   " /`/` /` @  @D* @ :*@D * @C  *@C & : * @ؖ>Ĉ >Ġ"P  ``4`` `ư?Q°?$r + +`@?8`*      `    4N $K + +`@`*      `    4' $% + +` ` @ `*      `    4  * @*`@v G   " A?@CS *@CL &:* @CC   *@C< & : * #\`*#`. `:`*`" " #d#h#l#p *  ; + " " @ 㿘  ¢` @C @ * @`< , `@:/ ""@B  * />ĒaP.`> !Г.@j8 `"``"a?" ]?  @ ( @$ $ * 䀤`J >Đ!P.`@>Đ!Г.@8 =8?/ ``"``"+?" '?  @ ( @$ $ `" `` ?  ?#  2#8#  2  2#`"``"?" ? + @# # * Ұ  @BK *@BD &`?` :`*  , ,  ,  `.`. :." "@B' * 0>ĒaP.`> !Г.@8 `"``"?" ?  @ + @"   " * 〤`x >Đ!P.`@>Đ!Г.@8 k8 . `"``"Z?" V?  @ + @"   "``"@``@??@;?#@`@2#@@8#@`@2@`@2#@`"@``"@?" @?  #@@.@  @#@ *   㿀\'`l 'd p& @Al'* @` @Af*  / @ @@ h) @ @'/ ??@h@) ?  @@ @ @,`&@@A6'* @@A1*   䀤-h 0>>ĒaP. !Г(`@@8 ,`. " "?" ?@ @  /@@ @ @&@@ !Г(`@>Đ!P.@8y8 @" h`)  " "y?" u?@ @  /@@ @ @&` "@ @\?@X?`8#@`@``@ #@`@ `#@`@2` "@ "/?" +?@/@ @  @#@,`@.@ @" h) &` " "@?" @?/@ @  @& "@ @?@?8#@@@ #@@ #@@2 "@ "@?" @? @  /@ @ @#@,`@.@  d"h a>>ĒaP. !(`@+8 @" ,`. "@ "@?"@{?* @  /** @ @&@@e @"b ,`. "@ "@V?"@R?2 @  /22 @ @&@@< >Đ!Г(`@>Đ!P.@8,8 @"- h) @`* `2% " "?" ?@3 @  /@@3@3 @ @#@+` "@ @?(@?'`38#@+`@``@3 #@+`@ `3#@+`@2`# " "?"?@2/@ @ #@@22@  @#@,`@.@n h) 쀡&@2 2`& " "|?"x?@+/@ @ #@@++@  @#@3 "@ @W?(@S?'+8#@3@@+ #@3@ +#@3@2" " "!?"?@* @  /@@*@* @ @#@,`@.@n 㿐@;#\@㿈   \%@ 8%%,= %@>=@ 45    0 .  +@*` *   `, `,  4      ` ` ܦ 0@*` *    ``  #\#`-#d ? #\#`#d & ?` ` Ԧ  㿐 2/>! >b >!  @S0H /* & p!8  & pH 0 Hd d>! @2H /* & p ? H  & p`& p>!L\ V  H   p  ?& pv H 0㿈 (    P    #\#`#d  H/` / 0   & 0  & 0H 0 0& ,H 0  @ > !>!0@7Р pL 㿘H/` / , "  0& ,?& 0H 0  @  >!0 !>@7 p$`,H 0 `@ > !>!0@7 pKrcons_init: linebytes assumption botched (0x%x) 㿘>ϔa& P"a " "> `"! >֐!`0i:`"  " \ & X@7e` @ 4&  \@7\@ @ 4& >#$ 2` 2`2` 2` \ @<@ \"@2`@:`  & H@<  \"@2`@:` & L@<  & @  H ?@ @$& @ \ @<` `& D $ 2 (>ϐ& >ϐa& $"a  @"@> & (>#$>"L"`ā㿘 ( 2(      "? `  @ @&  ( @Ԑ@],G (@ 2  ( & < (& 8# 37& (  @0?@? ^ # $ "@@4  @ ^(   &@@?@&@M` ( @㿐 $ \@;   H @;  (  2` ` L  8  P 8  P \#\ $@"@ $ @& " @ "@  @@В 㿘`=>"*`@g0fg<ffff $." $  '?%&  $"@@_"0 @ "@  @@ 00  $` " $@ ?"@㿘`[`; ( 73$2 ( ;-(   ($! >& (& 8 8*` * ?А& 8(" =& (& < <*` * ?А & < @̐@ ( ?& (㿘`3> *`@i\iliiiikdkdjkdjjjjkdkdjkdkdkdkdkdkdkdkdkdkdkdkdkdkdkdkdkdkdkdkdkdjkdkdkdkdkdkdjkdkdkTkkk8 8@0  8" "  $ 8 " $@  $ 8" " $ &f&0d $"  8 " @ X?V"@ < $?"@ $@6 "@?"@ 8 ?"@ @6 <"@9?7"@@w03@00 8@0, 8@)0( 8@0$ (!2& 8 8  ( & ( ?& (  (!2& 8 8 & 4 ( ?& ( ( & 4 @&㿈 $ \@:k  H @:c  L P #\#`#d   ( & (㿈 ( `2 P0` P    #\#`#d X (8 & X`& (㿈 $      P X  #\#`#d@  \`@:  P H L @ D X#\#`#d L㿈 $ \@9  H P@9  L @ X#\#`#d "-㿈 @4 "@" @ &"@ \ @9Ւ P H L @ D#\ H #` L# #d P H L D @ X#\#`#d" 㿈 $ "@@ 4  \@@9@9` @9 @9 P H L  @#\  H@ #` L"@#d P @ H L \"@ @  X @ #\#`#d㿈  "@@ 4  \`@9i@9e@9a P H L @  D#\ H #` L#@#d P H D L @ X#\#`#d" 㿈 $ "@@ 4  \@@94@9/` @9)  P H L  @#\  H @#` L"Z#d \ H L@ @9  P X #\#`G#d㿈  "@@ 4  \`@8@8 P H L @  D#\ H@ #` L###d \ L @8٠  P H @ X #\#`#d/emul/svr4㿘?` 㿐N  >@B 2$8  \f T>Đ#&`T&  &>* s$s,s4s<sDsdsTs\sdsdsdsdsdsdsL           ? 2 @2 2 2"2$2(  @2 `2 2!2"2$R "   ? ?2@ 2`"` "`"`  "`R"   ? ?2` 2` 8:@ 8:` "`㿀 >0, # =`" '@@A@'v`'`'" 㿀 >0, # =`" '@@A@'`'&'㿈 >0, # =`" '@@A@'`0'@@'`` d'>"*`@w w w w8wpxhxhwww`'`H1'F%&A `'H!7 0 , $"="`" ?'``'$< G쀢 ߔ   `ܔ $ N㿘 @7 >ĸ#* @   "$` 4>Ĭ# T@@   "  @` @  4  `.&&svr4_poll㿐 T` `* Y@`  2```?;@1h#'* "@*`@*`$ *`" *  * 's v H /* * > h h  'А"?''?/!'Eِ"; 09 (>ᘔ@$(`_ 2F(Ho o >`h  `h @(`h & (H 0%((`@>! H 0Đ$(>ѐ L!>hnH 0 (? ?$(  #" @ 2Y T㿐` "`.&""" ""5  "{ "}" "| "~# @  *@ @ ?*@  2 "| 2 㿘 @` `@*@";  ?5 # @"/  #@@>=$ !@">,"@> @2 >> !!0>2" p" @` "`  2` 2` 2@ 2` 2`2`   "` "@"` "` "`  "`"`㿘   &`,6`0 &`< &`4 $&`8&`@㿘Β` 0 <&`6` 4&`  8&` @&`&`$ `0,'`"@ '="`" ?` ` 'T>  8*`@````` `"h'``"c'b`^['`# U'`# L'`# C' 'T`8'T# 2:X@ 8 1u` T' ''T T"8`{'T 2Xl@u 8 2 ] 㿈`'`'` 'Œ㿈`'`'` 'g㿘@ 0  0 ? 㿘  &`, &`0 &`4 &`8 $&`< (&`@ ,&`D 0&`H 4&`L 8&`P <&`T @&`X&`\ D6`` F6`b㿘ʒ , 0&` 4&` 8&` <&` @&`  D&`$ H&`( L&`, P&`0 T&`4 X&`8 \&`< `&`@ b6`D6`F㿈`'`'` '`'O㿀`'`'` '`'`'㿐`'`'m㾸 ` 0 ,'"@="`" ?`''' X`` ''` >` ` 2;  ' 22  T *x_`  p  ''` xx p 2 ms T 2  㿘@ 0 m x 㿘6`4&`D&`L &`T &`\ $&`,&`8 &`P ,&`" t*`@ 'Ĕ 2@ 0 8Hv`  p. ` "' " '` "'` '` H p 2m 0 2  㿘@ N0   N0^ g lu㿀''@`2 '  0 ,"@="`" ? ''?'L < 㿀 >0, # =`" '@@<@'`'Hu'㿐 >0, # =`" '@@ '' 'l*` @ 'Ԑ'ؐ '''t''?' >l0''?'d'0'* @@B> t7 `.l` "@>"s#@ ``@ `  ?6''7Ȑ@.`q@%%@`4` "':  |"">c8'c8'* @@lUm TtUj Tx`?"'$ `'`  *'`'@'` :?>!耊 `@*@ *'ؐxp  ZI @@: >c 'c '`* @@`8   >cX''Ԑ @''cX'`* @@а>c8'c8'`* @@Ѐ  ` 6`` "$` h$`  x'L  0> ,#@ ="`# ?'L@; <@0@2 ''L='0'Lu'؁㿘@``Β㿘``` Œ @!^>$((4DTdt 6">D2">L."„*"> &" #" < " ">">t">""  ">">"  㿐@   2@ &@@ 2@ &@@'`'@8㿐@   2@ &@@ 2@ &@@'`'@8sbrk: grow failed, return = %d sbrk: shrink failed, return = %d 㿐@>! @ *@ '" ` >`62 `$@:  1> *>a  * " `'s ">>$#  @  ԓ:@  6  >% r6  >  @  ԓ:@ " $ ԰ ( 0,# =`" H''[' [w H T#>@/a0'a0@*d@@*aa0@/'a0@*X@@*U'?'[ 2O H ,@/a0a0@*=@@*:a0@/'a0@*1@@*.'@/a0a0@*#@@* &@( x@ "`  "  @ N3 "9 : N "@) &3  *`  0:`, ?" =b`"@ ` '?耢 2 ''Ys "      `  &  &㿘U> "   0  2 0 㿈@`F>& *`@,d|''V "$ 1` " "(     0 V` "  2      &`'`V' 㿀` " ` N А"@&  ` 7А"@'''`V 㿘@  0    N  N'Hx@+  'x ' 0'N - 2   '  ' 'H`:' >ő:>Œ`*  '     *`@'  '|x svr4_wait㿘@ "    " P ?   &`&` P  `" L - 0 " L -   @2w HL - V` "SL -& ` 2` 2  T "4 Tj2m$ T4   Z$ H QĒ   T? `? "` V Q * T `"  "`   "@ H`" L L"`L L H )Q">`  ?F"` L - 2 H (@ 2 Hh` " H` 2&@ $ (& `*`$`) 2}`2` ! @ &` `  G\ f  ! >&e@ "U P㿘  &@ : &` < `$   &`&`  &` &`&` &`&`   &`4 &`4  `4 &`4 &`8`< `\@*N @ >0, # =`" !'@@7=@'' ֔!  H`є  0,# =`" !@''' !  H` p `0`, " =b`"@  '''@''  '''hf 2|  "   ' &㿐@   @@f  㿈X  U ?倢` ->("*`@((((((                   $ -? 2  2 >Ēc" @"  &X@*?"@ 㿘 @ xP 1y㿘 " V "   x 2>Đ#&   1N  `@?&& $ x㿘@)"   >Ś  : *`  +@  ?@+@&@㿘@)   >ń  +@  ?: * @ +@@&@  㿘 `&@  &` &`  ` &`` &` ` &`` &`㿘`&`  `&@ &@``@ &@`@ &@`@ &@@ &@"` "@  "` "` `"`"` "@  "` "` `"`P `` 0 ,"@="`" ?'`'   ؒ  ' 25q "( >@* ''W' 2Ȑ 2oܔ  h ` 0 ,@"@="`" ?'̐`'  `̔  ' 2/c "'" ''ԐXʔ 2`ؐ 2T  0>` *  0 ,`"@="`" ? '@?! ?& @ ?b"M  h`a"`y NRhdC p N@dk N 2 ' '* '8'Ԓ ̢' ' `'@'''ؐ2 2L V?&B  ; а 7&'* 'Đ' * 'W'`'''' ' @'M' 2 V `  @  ė* + W'㿀`  `Ġ$`֔ :` 4 Ĕ .H/` /@```?  "`Ĕ @  $``Đ*@$`?" @$`ēH o@㿀@  % ` 2   Ē '@&͒   : *  +@& `n 㿀@ _  Wk'㿐@>'``*  'W &@  "` N $a Ē@ `2!x&!x "@8>!`  x> ((  "! >( " 2  | t 2 | x ""  | 2 㿘` >  `x>"!(!("   ">!(!(2| 2||`"`"|"@ L T02㿐>a   >"!(!("  "a  TK $  $ t h$ x$hLǒ T0 , >, a(a( $ |a( |"` |">"!(!($   2 2 2  2 @2 @2 2!2" 2(H0 !`I&!W >P 0!I  ' ` '` `'2  4 2)А@% @ W7 "  2 @` unknown㿘@%V &@ &` < @0@ &` &` &` &`  &`$ 0&`0 &`8 &`< &`@ $&`D (&`H ,&`L @&`P 8&`T>,#&`X# &`\㿈 '@'`'@㿈 '@'`'@T㿈 '@'`'@㾠 >0, # =`" '`@1``' `'ٹ' 2$  ` "z< @0@``r  㾠 >0, # =`" '`@1``' `'ٔ' 2$ B ` "7< @0@`i`/  㾠 0,# =`" `''`'9' 2  ` " `  㿀@$E ` " 㺐@$7%>ʒ`P@#Ȕ!/>Вb@#”!/>ʒ`X@#!/>ʒ`h@#!/>a@#!/@ǔ%0unsupported㿈@ 5` ! "(>  - >d N!  >>=!  ! ">!"" Q N! A">I N="; X9 h>6!>.3 >0 P.#,!>.) O 2- '   `Z#\! O 2 '   `Z#\  @#c 8`J㿈``` N`@L' `'@5'p >0, # =`" '@@0l@'` 2'ܐ     ''''`''܀ "0㿐 >0, # =`" '@@07? '>/x(             ?㿐 >0, # =`" '@@/`?&` "&&  㿘`?&` "&&  8D   0 ," =b`"@ @"|' @ ''`']' "$ט 2 G ` 2 <  2 2  օ'    ``2`2 "   ``2 ` *  ? (㿘`@"^  .@@`. `6 & 㿘`@"N j@ @  . .    i  * ".㿘   &@R@ "      &`  &`&`  &`&` &`&` &`&`h  " .   2'ɒȀ   N 'ܐ j''ؒ ' "'̀ 2' '''' ذ㿈  㾈2  o 2' '쀢 2 &  h ," + S , 2%m耢   N '̐ j''Ȓ '쀢`' ''''' 4 ,㿘?"@` &>0#H*`@pÄØìU  hȐ@!J ,  "    ''̐ 'А?'?ؐ?'' ''' ,& ٔ ,  ې  x’ 2[x "@U   P N 8 ༰x . jOz (-z "20,"@ =`" `  'd  2'h'l'ph` 22  x@ ǒ!'| ' 'x px  㿘       Pz N  'p3 ~@  x N'`h j'``0,` "@ =`" 'd` `  `'d 2[ "'@ "'PN N I  DB N'T'XP 'D'H@Δ "/`ޒ 2)`ה  2"@   Nh`hh`hp'Ő 2   㿐' b    && 㿈  2'?c !@@ S "  "q 㿘? `!8">2"\*`@    " 㽸 @`*@@ 2`   "`v?'`   i?' ܀]  2W  2Q N܀ 2M NȐҒ @ @ `  j:  `0`," =b`"@ `  'Tǒ 2(؀ $ "'  N@@'@'D'H'$'( ','0'8''@` | &㽨@ *@`@ے!@ *@`2`1 v "`0'?''` i 0?''q ?Ȁ?  N    j0', "@ =`" `  `'  >   "o    <  ڰ '' '?'̐ '@'''ǐ '' ' 'Đ ' '  2 N˒ (ϒ ('y?@''6'ఒ ?''Đ ('Ȑ '  2 N ( ('O? $ # $'j  d N'''' '''И''@GA ''  29 NT X- N''% ` "`o`h ``_  ` `V &#212 (unimplemented lwp_alarm)#211 (unimplemented lwp_sigredirect)#210 (unimplemented signotifywait)#209 (unimplemented)#208 (unimplemented)#207 (unimplemented)#206 (unimplemented)#205 (unimplemented)#204 (unimplemented)#203 (unimplemented setregid)#202 (unimplemented setreuid)#201 (unimplemented door)#200 (unimplemented facl)#199 (unimplemented nanosleep)#198 (unimplemented timer_getoverrun)#197 (unimplemented timer_gettime)#196 (unimplemented timer_settime)#195 (unimplemented timer_delete)#194 (unimplemented timer_create)#193 (unimplemented clock_getres)#192 (unimplemented clock_settime)#191 (unimplemented clock_gettime)#190 (unimplemented sigqueue)#189 (unimplemented p_online)#188 (unimplemented processor_info)#187 (unimplemented processor_bind)#186 (unimplemented auditsys)#185 (unimplemented acl)#184 (unimplemented tsolsys)#183 (unimplemented)#182 (unimplemented)#181 (unimplemented)#180 (unimplemented)#179 (unimplemented)#178 (unimplemented kaio)#177 (unimplemented)#176 (unimplemented inst_sync)#175 (unimplemented llseek)#174 (unimplemented pwrite)#173 (unimplemented pread)#172 (unimplemented lwp_cond_broadcast)#171 (unimplemented lwp_cond_signal)#170 (unimplemented lwp_cond_wait)#169 (unimplemented lwp_mutex_lock)#168 (unimplemented lwp_mutex_unlock)#167 (unimplemented lwp_wait)#166 (unimplemented lwp_setprivate)#165 (unimplemented lwp_getprivate)#164 (unimplemented lwp_self)#163 (unimplemented lwp_kill)#162 (unimplemented lwp_continue)#161 (unimplemented lwp_suspend)#160 (unimplemented lwp_exit)#159 (unimplemented lwp_create)setitimergetitimergettimeofdayvhanguputimesfchroot#152 (unimplemented modctl)#151 (unimplemented)#150 (unimplemented)#149 (unimplemented)#148 (unimplemented lwp_sema_post)#147 (unimplemented lwp_sema_wait)#146 (unimplemented yield)#145 (unimplemented lwp_info)#144 (unimplemented sigtimedwait)#143 (unimplemented fork1)#142 (unimplemented vtrace)seteuid#140 (unimplemented)systeminfoadjtimesysconfigsetegidunamerename#133 (unimplemented putpmsg)#132 (unimplemented getpmsg)#131 (unimplemented memcntl)#130 (unimplemented lchown)getrlimitsetrlimit#127 (unimplemented clocal)xmknodfxstatlxstatxstatwritevreadvfchdirvforkfpathconfmunmapmprotectmmap#114 (unimplemented mincore)pathconf#112 (unimplemented priocntlsys)#111 (unimplemented async)#110 (unimplemented acancel)hrtsys#108 (unimplemented sigsendsys)waitsys#106 (unimplemented nfssvc)#105 (unimplemented)fstatvfsstatvfs#102 (unimplemented evtrapret)#101 (unimplemented evsys)contextsigpendingsigactionsigaltstacksigsuspendsigprocmaskfchownfchmodsetgroupsgetgroupsreadlinksymlinklstatpollputmsggetmsg#84 (unimplemented sysfs)#83 (obsolete libdetach)#82 (obsolete libattach)getdentsmkdirrmdir#78 (unimplemented rfsys)#77 (obsolete rfstop)#76 (obsolete rdebug)#75 (obsolete sigret)#74 (obsolete rfstart)#73 (obsolete rumount)#72 (obsolete rmount)#71 (obsolete unadvfs)#70 (obsolete advfs)#69 (unimplemented reserved for unix/pc)#68 (unimplemented reserved for unix/pc)#67 (unimplemented reserved for unix/pc)#66 (unimplemented reserved for unix/pc)#65 (unimplemented reserved for unix/pc)#64 (unimplemented reserved for unix/pc)ulimitfcntlchrootumaskexecvefsyncutssys#56 (unimplemented exch)#55 (unimplemented uadmin)ioctlsemsysshmsys#51 (unimplemented acct)sysarchmsgsyssignalgetgidsetgid#45 (unimplemented plock)#44 (unimplemented profil)timespipedup#40 (unimplemented xenix)pgrpsys#38 (unimplemented fstatfs)killsync#35 (unimplemented statfs)#34 (unimplemented nice)access#32 (unimplemented was gtty)#31 (unimplemented was stty)utime#29 (unimplemented pause)fstatalarm#26 (unimplemented ptrace)#25 (unimplemented stime)getuidsetuid#22 (unimplemented System V umount)#21 (unimplemented old_mount)getpidlseekstatbreakchownchmodmknodtimechdirexecvunlinklinkcreatwaitcloseopenwritereadforkexitsyscall"X"` n"`( 2` " ` %"`8` 2``* ` 2``2  A>9( (08@HPX`ht) ' 2% K# n!   !,"X$')`" #% "8!p" !㿘  " .`   " .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&`  ǐ&`( 0`  <&`    @  2  !"#&`  @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` o `&`$`  ` ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘 2.`.` ! 2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.`  2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&``  ( &``@ |  #!&`!  0 "#` `` &` $` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&`` $* &``@ &``  ` ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&`  "@"`"`"` @   (*` 2@2` 2`2`@  (   `!"  "    g" -  h `Ȕ@ 2@ $  b ] $`ȟ@ 2z  #    : $ 2c 0  2Yc R ?#`>=#X*`@      ȟ@&`h@  x  2 `g@  *@*` *` *` *`*`  *@*` *` *` *`*` *@ *` *` *`2` *@ *` *`R *`"`  *@*` *` *` *`*`  *@*` *` *` *`*` ?# `wI&>>!̓*@8$$h444`w@ 2°  2  2 `v`ct`@ %k Ȓɔ  2      {А`@ vB 㠔  2fǒ `X`t@ S }  2CԒ `u5@ 1 i*]  2# ~"  }     }  ~@ 㿘 N'LǼ F @|!x&`( &`, &`0 &`4 &`8 &`< &`@ &`D $&`H (&`L ,&`P 0&`T 4&`X 8&`\ <&`` @&`d D&`h HL&`l L``l&`p ? &`&`G&`  &@pc or npc are not multiples of 4! 㿐 $!o `FZ @ 9 `,`0 >?X0#@ <* `(< @"`,"`0"`4" `8"`<"`@"`D" `H"$`L"(`P",`T"0`X"4`\"8``"<`d"@`h"D`l"H`p"L@ U@  `ǒ?" @& İ?>ń*`@"" " " >@*         "   "  "  " " 㽐> `$`H    *@  " = ?x5!' ''x'l'> ?᱔"  ? "$E $>"b>"!"@=#" $ $$HT_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR 㿈>`#@`< ?``88 >A!*`@(<H\\>AU!x!`>AU!`@&`0>AU!`1&`0*`" *  * &&`0&`4` &` &`(sparc) svr4_sysarch(%d) 㿘>A@V" 㿘/emul/sunos㿘` `   `!" ! !       >ǐ#&`T @2"@ 2"` 0"!"   @ 0"#@"@22  @"`>ɄЇ("`("`$ ( 2@22 2@2 0  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " *`"`   `*` `   `*`!㿘  @ @ @ @ @ @@ @ @d @@ @&@  `@&`  !"  "   "#" 0 2`@2`2a2b2d 2h@ @&` 2 `` @`2` 2`@&`2a@2b 2d2h @@&`  (>xa@& ` &`  ` .`  ` .`  ` .`  ` .`  ` .`  ` .`  ` .`.`  ` .`  ` .`  ` .`  ` .`  ` .`  ` .`  ` .`  ` .`  " ` .`! !2.` .` !.`.`㿘6@ 6` 6` ` 6`  .`Ȑ 㿘&@ &` &` `&`   .`ැ 㺰 @` @*@`" ` 2`  `!6`  "%`L"&# "  !#"` "j $' !{  "Y  d  I!!"    Aʐ!0  "Z`&  e"     !"`s  %"   f  &_ ! "Z   (  "%`N !"IF !0! "o`B !2"= - !("7 -  ! !"`( !,"& -8  ^!)\!1  "`      "`  ! "0!"`0!"`"0!" -0!"1`0!"e`0!"I`ސ0!"~`א0!."հ -0!0 !-0 !"Ő0!/"° -0!!"` &`ݲ  2 "'   `Ā`ݛ '`ݚ ' `bĀ`hĀ 2`|  2y `gؖ7Ā7m`hПĀ eА''`c [ vT&` wQ&` aN&` `Ā 2Ip1` @ X#`> 6`9 $1`,  2) `(Ā 2``Ā  ` $ 2`` Ā `  2 `fĀ  2ް`_ĀְhҔ 2ϰĀ ǰ`ɔ Hܽ 2Ā `ܴ `(ܧ 2 aĀܘ 20a~Ā `܎ ܂ 20a#Ā v`x p`Ȓk 2h aĀ`\ 2Y0aĀ P`R JF 2C aĀ;h7 240aĀ +`- %`H  2 aĀ@  2Ā ` "aĀ 0 '0'4'8'<'@'D'H'L'P'T'X'\'`'d'h'l'p'H/b'\''''t'x'|' ''''' ''$/'('''`۵  ۪ 2 '(','0'4'8'<'@'D'H'L'P'T'X'\'`''?'' '$'(d',h'l'p't'x'|'''' ''P`'W `/2   /` `/2   /0"aĀ "C?a Ā7'`8 0`'```"'   ' ' `Ā`  ' - b}ĀVH㿘`    4 # -` >ɖ@@ *@ @&``` >ɒb@` @. 㿘@ ?"@&㿀 >A0, # =`" '@@@'&'`'㿐 >A0, # =`" '@@|㿐 >A0, # =`" '@@Ҙ@7㿐 >A0, # =`" '@@@A㿀 >A0, # =`" '@@@'`'"'㿐`  @'`'  㿐@''>4.2ffsnfs`     ` @@&`@ Ŗ 2>Hc(@  >H`0#0`, " =b`"@ &@ "eg>Hc8@  \`  8 2Yؔ  2QHۍ  /H`0`, "@="`" ?&`  'X` > H'\ '` 'd ?h 'p'tt 'tt'x`'|@'t'\HĔ ''ٛ' 2X` ٔ H 2㿐 '';㿐  Đ @ '@w sunos_getdents' P'|` 2`  8    8  T.U 't:`'l*` T.K > '' *` @ 'Ԑ'ؐ '''t''?' >l0''?''0'* @@E> t: `1'd "@>IMu" ``   ?6''7Ȑ @7ʒd%%@`4 "':  |"">c8'c8'* @@. Tt. Tx`?2H ` ` B *@'@`'؀ >! `@*@ *'`'`'`'`: ? `*@@`R` ` `8 2`< ?' 'Δ㿘`  9㿐  @?`2` } " " $ `  *` 2 ` >ɐ"*`@&`` l `  }ޒ 2`  7 (`"`~X0 $ `` p  3F @@: >c 'c '`* @@`8   >cX''Ԑ @''cX'`* @@а>c8'c8'`* @@Ѐ  ` 6`` "$` e$`   10@ e>ʐ P} >А"x />ʐ Xr >K m >!h @׮ e㿘`  @ 0101Ր㿐 0>A,#@ ="`# ?'@@ך `  K  `2`2` 2`&`     (  @* @R`    `a  N㿀@ `A "  㿘     ` `|`x  8g j   " &   "& &  X@] @' ' ' ' ' ' ' ' $' @H >A0, # =`" '@@8'Ԑ @''@''܀ d     4 `㿐 @¨    `   4 ` 㿐 >A0, # =`" '@@`< @@0@0N@)>L(2 22(242@2P2\2d">D" <" ">L "  ""„"  㿘@   "@@A㿘@   "@@S㿈@`>#@6 >ɐ"ԓ*`@" '`'`'` 'S 㿘 @7 >ɸ#$* @   "$` 4>ɬ# T@@   "  @` @  4  `.&&sunos_poll㿐 T` `* *ː@ս`  2```?;@#'* "@*`@*`$ *`" *  * 'DH v H /* * > h h  'А"?''?/!'"; 09 (>ᘔ@$(`^ 2F(Ho o >`h  `h @(`h & (H 0%((`@>! H 0Đ$(>ѐ L!>M?<H 0 (? ?$(  #" @ 2+0 T㿘 0<  >#0#0` @@" @ 㿈@ ; $` 8`"? ` $,`   '''* 2'  '  '+@ '`Ɣ 2` Է " ?!   $ 3Д  㿐@a㿘@W   *  @ *   "@ @b  88  b   㿘  `  `  @4 0%@/  & &@*&& @@ "   ` 㿘?c @ 6 @q6` `B  & $ @*&@$@@Y@U2  *   , "@@ 4 "  "  ,`@@ 4`   ,@@ 4  @@*  㿐  `  ` @` ?2   2@  *2  ?*@   *  2@*@  㿘  `  ` @1  `  &  4 @ *    ?: : 2@  *:  ?*@   *  2@*@    B 'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@; ) @  ` (  2 "" 2     * " @@ @   `@ @ "`" ?* ?*  @(`  (02 @  "J@J`2J@  J " @(` @ *  J@   J@J`  H" @ J2  @*`  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J@  "  J@J`   8  *  8  *  4  &  4  & @'Ā >#`@  0.? 耦 Ā 2;  0 ؘ'7477477477ܑ477`A ڸ? 28```@@`*  @@ `*  @@`*  @Ā  @Ĕ ;--`2 @- ,`̑2 @ ĺ` `"` '``? '8  . ?2 ? '`" * #@'.`@ '  @`@?  ``77@, @9@@ΐ ,  ( ?#   . ?@, @@ "@"@4@6`#?# "6` 5 . * @? @ @ 4@6`5`5 @  Ā '   " . ? * :@ @2. 4@đ*  *`@;Α*  Г*`@ +     ( 8 2+ ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@`@ "`  " `2  (, '`'` '`S;''`'` T'`'`'` UK'`R''İ`@````" `- `" `' '`'` W'`'`'` X'`WR' '`'` Y>'аX@ "  " `8  "&`2 '`'` M''`'`Nz'`'`'` '`O2''`'` '`'`Pw'Ȱ> "x@'`'>V`!8 `J@''` '`  '`   '` ! '` ( '`'` :`?Ô2@ "` 2` 2`  2`  2` 2` 0? 0"`"` "` "`  ("`( @"`0 8"`4 D"`8 H"`<㾰'4 D'8'@'r'< u  X’`( @P'Ԑ ''@'P'ܰD`8 ĀF %0+;v q08/j ?h*@( B77p??Аp`֔ @ofstat@`*@@ 2R  ``"   >W K@ XA `˥ @㿈@'` :`? 㿈@'` :`?x@'`: ?`'!&㿈@'`'&' N㾨@I ` 2`  `8  `'` ''''''`>'c 'c '`* @@`?`  ' >`0'p't?x''0'`* @@pF:`; ???'?А'` '`  T' >0'p't?x''0'`* @@p :`Ȓ"@   * * /ذ  T>c8'c8'`* @@ z`@V>``X 2O`8> c'p't'x'|c'`* @@pP  * 0 >c'p't 'x'|c' * @@p>c8'c8' * @@ 02   " :Ė'$`8`耢@ @  `` ` `  `4`" : `8 ` \ `"@ &㿈 2` ?  2 7`<   㿈 `#   7`   㿈 `   7`   p''ܐ' '`'` ''` '@㿘`   "` 8`ϔ 5䀢  #0 (*  ̔ `  'ɷ*'`@쀢`   ` ɦ` p''ܐ' '`'`'''@` f8`| &䀢  #! (*  y h*  ''@`>w CLGET: returning %x 0 t@" . c@"h | b@"T  @"X e?@"9 h_? @"C  |@R? @" K?  @"   }@"   @"'8?  ~@" 1?  @"2   @", $?  @}  u@"?>b cl?  . > acl?" ,`, `@, 4 ' ' ' ' ' ' ' ' ' ' 'N`4 '쀢`>' *`@'N`4 '`>' *`@'/@/? ?V  @.& t  @    . . . . . .. . . . . . N?2  . . . . . . . . . . . . x.' ' ' ' ' ' ' ' ' ' @i' `~@ @   }@ ?  @" # *` * * *& t@ `#@<: &>#h ->Y=X"p*  #&  `& `bX#  & "    2 0 & getflags: %x 㿘``` $@ !``  "  @  "2  2 "   " `t #2 ` 2`@2,@@ @((0(0  >ch`>[ <@` t` ` "  " ,"      @"  * *  #  " <" "@"`"` "`@``  t` ""*@*""@2 (0(     "  ?   "@"`"` "`H ?"@ Ē @ " ćH H "?@" ćH 㿐 $!'! '``{  2@  j  ! $!$!$! ! ` $!㿈@?  $  2`?  *,    '''* 2'  '  ' (  '+@ '`* 2`  " `%9" 㿘``@&  㿐@   * @'#'@ * @`'#' 㿀`ٔ    :`? :`?@"e㿐 ?2' `?' y' 㿐 ?2' `?' ' 9 >L8" >L "㿈 ' ` @'#\+ ` j @?# @c"L ea" b`+  ->  --efd)  -0!@"8`ݰ -''` '`'`  '` i7#\' `'`  ' ' ܘ ` #\ ' ܘ ` +I#\``X> P>! X>ʐ X >!>  h>" '~ $'>!$|Ĭ}>ϐ!$| $'Ġq ' (''>ʐ P$>ah|>` + '>a''$'ąV>ʐ X$| $'yJ#' '>ʐ h$| $'g8 '' @'Đ P'|>Р >a0">a''>c$c`''В$'G| X $ y'ܰ0  &``k 㿘   @>" L㿈     '@ ` *#\㿈 ' ` @'#\*o 㿈 a    '@ ` *\#\sparcX>ʒ`P x>Вb >ʒ`X >J h h` J (J  (J:J*J  ) J`#"JJ  J: **J  : *>^c@ X@є 㿀 0,# =`" '''?''q'쀢 í ($ T ' ,` @  ,$$` "  z C L / `J?`/?N /2.'Ԑ @'ؐ '''j /F.'Ԧ @'ض '''[''?h'hO5>`'''''`* @@:x`'''''`* @@)@ `@` `' "@@ @ &@' * T` x0x Tsun4c compatible0 0 f8000000 15c6a0 map-pagesspurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(Z$  <<d d@@((1v @-|uEHID@@HG5wF  0 0 45678WXOPQR012TU)*%&01+(3m Rm P(m :m P([[ B[ [,B[@[LB[[B[[P:\\B\\P:]] B]] P:]] @:\\:\\:] ],B] ],P:] ],:\\@:\\H:]]P:]]B^^B^^P:^^X:^^`:^^B^^P:^^h:^^p:^^B^^P:^^x:^^:^^:_,_8B_,_8P:``.``BaaBaaFaaffP>ffP>g(g4P>k@kLP>kk:kkP(kkP(kkP(kk:kkP(kk4kkP(kkllP(ll:ll:ll:llP(lHlTJllP(llP(ll:ll:llP(ll:ll:llP(mm:mm:mm:mm:mmJmmJmm(JmmJnnNnnNnn4NnnNn(n4nPn\JnPn\Jnpn|"nnJnn:Z@( ^ڤpH!4`XPH@80(-PaPX9:XTF?APNA RRACEBSTBNM<>CL?0PL?0RE?t@RRACEBSTBSL:RRACEBSTBERBCEBSTBIKpQQR<RRSSSYX1("P"|&"h"h#Y#,Y#XY#Y#h#[D$h)HA$4]$`]$]$q$]%h%De%|h%h%h&e\&0_&\c&e&2&3' e'8fL'd&@)f'g'g'h(h(@0(lh(h(h)h)"P"|""##,x#XY#Y#h#X$p)Hq$4t$``$$$%%D%|%%&&0&\&&2&3' e'8fL'd)'g'g' ((@(l((q)h)X"P"|bP"j"j#b`#,h#XY#Y#h#e$f)Hq$4gX$`h$j$q$j%j%Dj%|j%j%j&j&0j&\j&j&2&3' e'8fL'dh)j'g'g'j (j(@j(lj(j(q)h)d`@y< h4ur@Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. netbsdX|WhXH8d q u<  ]d  | ! $ :  ]8d|H v rxvp l P ~xh (l TZT[<}Pk  4  l xG:d\  :D X\uY  ,dd  Y@ <   dd h C<| 5HAuzhuxd  |Pd/H  k oL bHe\cY lP{ld rTqq\ q dd ed>0L|Pd s@ v> &8#,d8ut0 ]|]Hr{lp35x'd@| buz0st@s` ^( cldddd ^0dd ddddddV0XW(ddd۠ۨdddd0H    `@Pd7 d`+-"H  h)dddLLLLLLLLLL h $     @80( ޸ްިޠޘސވހp`XH8( ݰݨݘݐ݈݀p`P@0 ܸܰܠܐ܀p`XP@0  0 B@KPK8K(4ttyclsttyopnttybgttyinttyoutX(td Tqqqq qqdX(td Tqqqq qqd` a`qqbke@dpxt`Tqqqq qqd   \D \DL @6T \netionetconnetclsOHHHX8S+2X18/85(h9PRPS+/ 8UhVX(YIKHL-32L9t17LX:2lockf@` ph`XPH@80B|CFdGH8HXH`"t Hp" H" H" H#$ H#P H#| H# H#H$I$,I$XI $ I0$I@$IP% I`%8 Ip%h I% I% I% I&( I&T I&I&I&J'J'0J '\ J0'J@'JP'J`( Jp(8J(d J(J(J(J)J)@ J)lJ)K)"P))"|""##,#X###$$4$`$$$%%D%|%%&&0&\&&&' '8'd'''((@(l((())H)t"P"|K"M"M#K #,q#XMp#Mp#Mp#K8$K$4K$`K$M$q$q%M%DM%|M%M%M&M&0Mp&\Mp&M&q&q' L'8q'dL)L'MX'q'Mp(Mp(@M(lM(M(q)q)q*MMNNO|OOPPPPP"P"|S$"b "b #V#,q#Xq#Y#Z#_ $_\$4_$`_$b $q$q%b %Da\%|b %b %b &a&0[&\^&a&`&`(' q'8q'db8)b8'a<'q'`p(b (@b (lb (aT(b )b )b ,0R R S SR"P"|bP"j"j#b`#,h#Xj#j#j#e$f)Hq$4gX$`h$j$q$j%j%Dj%|j%j%j&j&0j&\j&j&q&q' h'8h'dh)j'i'q'j (j(@j(lj(j(q)q)q-fifokkllmDmmnn$n,n4jnmnmn$ n$n/n0$n5$nY$np$nhAh$n`(G$nP/0G$nH$n@(h$"P"|p"x"x#r#,q#Xr#r#t8#t@$t$4x$`x$x$q$q%x%Dx%|x%x%x&xH&0uh&\x&x&v&v' q'8q'dx)x'w'q'w (x(@x(lx(w(x)x)x0T|~~Dx"P#&(&0'' <'8'"|)|)1x ((0p"P"|("|"|#<#,q#Xq#X#X#|$|$4|$`|$|$q$q%|%D%||%|%|&&0p&\|&H&x&' q'8q'd)''q'(|(@|(l|((|)|)|<2  x p h `XPH@80( 08H(Ph`XPHx@80(  "P"|""#l#,#Xx#8#p#$$4$`$$$%%DT%|%%&&0&\&&&(' q'8q'd)'$'q'<((@(l(q()qA6devopndeviodevwaitdevindevoutdeviocdevcls"P"|""##,x#X###X$p)Hq$4t$``$$$%%D%|%%&&0&\&&q&q' L'8T'd)''q' ((@(l((q)q)7H Τ  4<"P#֜&&'%|ٜ)8)؈89,HP`,4<DH"P"|"P)tD"##,4#X# # # $ )H`$4$`$,$p$t%%DX%|%%&H&0&\h&@&(&\' p'8('d) ''x'( hX920123456789abcdef^^0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef > LPh@@t=> ,2@Uabll@@ 4LT@\@M\Uh@"@\! *,(@\J>@ @2(@AAA==(A*E@ 8@ @@@@@@@@@$<' @rlwpl (P `-84pSvx|pxOV DD@      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''FFFF,F@FLF^FpFFFFFGG.GVGxGGGGG@ ) = C A0 Bh C * B C C C"P"| m" " # I#, LH#X DH# L# Q<# {$)Hq$4q$`$ 0$ 0$q% %D ͨ%| ,% % & &0 l&\ |&<&9&:\' ;'8;'d /) /' 7'<' 7,( 74(@ 7(l 7(q( 7( 8) 8) 8H"P"|""##, <#X :d# L# Q<# ;$$ ;)Hq$4t$``$$ 0$%%D%|%%&&0&\&&9&:\' ;'8;'d)' 7'<' ((@(l(((q) 8)I"P"|bP"j"j#b`#, ><#X :d# L# Q<# =\$ =)Hq$4gX$`h$j$ 0$j%j%Dj%|j%j%j&j&0j&\j&j&9&:\' ;'8;'dh)j' 7'<'j (j(@j(lj(j(j(q) 8)KP0123456789abcdef?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@M M M N @ D ] d ] ]D , D h }"P"| *" _)t nT" _# `\#, `#X a4# a# c\# $ T)HA$4 j$` j$ j$ \$ j% k%D k%| p % {L% ~& 8&0 ,&\ & t& '& ' '8 'd ) ' ' T' `( (@ (l I( F( ml( L) }$)DtO"P"|""##, H#X a4# a# c\# $ )Hq$4t$``$$ \$%%D%|%%&&0&\&& '& ' '8 'd)' ' T' ((@(l(( ml(q) }$)D0P"P"|bP"j"j#b`#, #X a4# a# c\# $ T)Hq$4gX$`h$j$ \$j%j%Dj%|j%j%j&j&0j&\j&j& '& ' '8 'dh)j' ' T'j (j(@j(lj(j( ml(q) }$)=RX ] 8 ] ]D   ,  L 0"P"| *" _)t nT" _# `\#, 8#X a4# L# c\# p$ D)HA$4 j$` j$ j$ $ j% k%D k%| p % {L% ~& 8&0 ,&\ & t& & ,' '8 'd ) ' ' T' `( (@ p(l ( t( \) ) T"P"|""##, H#X a4# L# c\# $ )Hq$4t$``$$$%%D%|%%&&0&\&& & ,' '8 'd)' ' T' ((@(l( t(q) ) Up"P"|bP"j"j#b`#, #X a4# L# c\# $ T)Hq$4gX$`h$j$q$j%j%Dj%|j%j%j&j&0j&\j&j& & ,' '8 'dh)j' ' T'j (j(@j(lj( t(q) ) @ V h T x d ] ]D  D h  "P"| " " # #, #X # # # $ $4 $$` $ $$ % %D %| % % & &0 &\ & & & ' q'8q'd ) H' h'q' ( (@ (l ( ( ) )`Xp C Cx Ch ... ...Z x l 8 \ -d 0  $ h  h ` X H\d@ZHZZ  A( A< B C C@ C D< I K< I< I NP I< I M I W X0 UPamd7930xaudio Yp Y Z Z( Z4 ZP Zh Z Z Z Z Z Z [ [ [0 [8 [H [P \ \ ]$ ]p ] ] ] ] ] ] ^h _(( b b a ( cP d c0( ep e c8( f, f c@( h il cH (  T sparc(     h P H @ 8                h H     ( < ޭޭ  X $lP @ TP ` #P( *P( *PP #PP *P( 8  @ ߰ p x<  x X H 8 (   0     p h X @ 8 (                p   X   @   (               x p ` H  8                      h   P  @ (                  p  ` H  ` 0  `             h   P H  0 (   (              h `  H @  (       0 d   \ )d ) )X )` )` )` 5 6h 5 ; <\ > 5 5 5 5 5 5 5 5 5 5 5 5 J I I I I I  I I I I Ip I I` IH I I8 I I I I I  H H I H H I H H I H H I H Hp Hh@ J J J d< T I I I| hh id g| id g8 y { y |@   \ T  ˜ Ä (   @ H ̜ ( 8 D Ѐ Ј  Դ ` X ֔ ֜ \ 0 \ (  < 4p`ppppp p@0pP 0p`$  @ X 4 ( $ %'7|j<khX p8rh`~P P  o8?? oU@*U@*U@*U@*U@*U@ pDDD|DDD p|@@x@@@ p8D@@@D8  @ qh@@@@@@| q#aaq: rH rDddTLLD s(DDD(( s t tx t uX u v8 v w w w xh x yH y z(xx zpp {?111` {x@ 0`@ { 000>|? ?1 |X | }8 } ~000` 3ff ~?ff`f>``f`? ~8`DDE9  2 2 a h>wc`aaa?`    H 0  0 (f`vvf`     x   X` 00` 00000000 86? ?a@ 0   @````@``@?  !?  ?1```@```0 h 00`gop``````p@? ?`@@ H000  000  ``````p?```< (       `xx` x `88` X9  ?0```g ollg`0? 8 ? @@`@` ````a`````````` ` `````` 0 @ a``````````````````@a 0@0@000?00000 0  h0@0@000?000000x ` ````a`` `0`` H``````````````````````  (80 acflxx|ngca`p x00000000000 0  xp`pppY`Y`Y`M`N`N`D`D` p` p x X L F G C A@@@`0 X ````````````` @0@ 00`0`0`07000000x 8 `````````````0@8@# a````|ngca`p 0`` ` p<@`@`` F  p` ` ` ` ` ` ` ` ` ` p@? h`@000  f f f v w@3@7@;; Hp` 0@8   @` p` 0@  (?   ?  ``00  x|| || 1` X  80009  ```gop````````p`xO 1 ````p@0 `````1 ````````p9`p 0``````0` h    1```1?`? `@ @ ? H0p00790000000y  ( 08 ````acf|x|ngc  xnf`f`f`f`f`f`f`p 'y0000000y X ````````p@8 q``````````@p```` 8  ````````p`8```` s48000000x 00@8 0?   @ y00000009` hp` 0@0@  pf f f 7@;@;@ Hp@8  ` 0@0@  xp (`A8 p`   x8    8  >`6gC XUPUPUPUPUPUPUPUPUPUPUP  8     h  H  (   x  X  8     h  H  (   x  X  8 7%dlhx90  000>|? ?1 ` w@;008.@` p` 0@ ?? h `0 8 1`p`8A@a H  @/@YYX X YY/@ @ (1??  @3 ` ```` x  @?@YY_[ [ Y9 @ X?? #aaq: 8     y00000009>`0000` h>~~~>  H   ( 008? f3 "D 88 `?@ 2dG x0pp0 0`013`2``A 8|L  `L};@ 2dG X 000@9  ? @@`@` 8 ? @@`@` è ? @@`@`  3 ? @@`@` Ĉ ? @@`@`  ? @@`@` h  @'&@>&FFF ` `````` 0 @  H0@0@000?00000 0  Ƹ0@0@000?00000 0  (0@0@000?00000 0  ǘ0@0@000?00000 0   x  X a````````````````@a 8 3p` p x X L F G C A@@@`0 ʨ ````````````` @0@  ````````````` @0@ ˈ ````````````` @0@  3 ````````````` @0@ h ````````````` @0@ ``00`` H`!!c`c`f`l`l`x`8@0@8o ͸p` ` ` ` ` ` ` ` ` ` p@? (p` ` ` ` ` ` ` ` ` ` p@? Θp` ` ` ` ` ` ` ` ` ` p@? p` ` ` ` ` ` ` ` ` ` p@? xp` 0@  x00?00`0`0`0`0?00x X1136663104`6`w 0009 80009 Ѩ0009  30009 ҈0009 0009 h6@&``?fffg`? 1 ````p@0  H0``````0` Ը0``````0` (0``````0` ՘0``````0`  x  X 01 ``````p@8 8 3'y0000000y ب ````````p@8  ````````p@8 و ````````p@8  3 ````````p@8 h ````````p@8  H!c`f`f`l`x@8 ۸y00000009` (y00000009` ܘy00000009` y00000009` x` 0@0@  xp ````oq``````````@p```` X` 0@0@  xp  o p pp p qP q r0 r s s s t` t u@ u v v w wp w xP x y0 y z z z {` { |@ | } } ~ ~p ~ P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @ °  Ð  p  P  0 Ơ  ǀ  `  @ ɰ  ʐ  p  P  0 ͠  ΀  `  @ а  ѐ  p  P  0 Ԡ  Հ  `  @ װ  ؐ  p  P  0 ۠  ܀  `  @ ް  1234567890-=` qwertyuiop[]asdfghjkl;'\ zxcvbnm,./ !@#$%^&*()_+~ QWERTYUIOP{}ASDFGHJKL:"| ZXCVBNM<>? (#X%P555x 5p qqqqqqqqqqqqqqq|x~yyX~Xqq 3qqqqqqqqqqqq 8, :< ; ? F ElH%%@L( 8t517|2816 M NL Sl W gqqqqqqqqqqqqqqqqqqqq < X P Hqqqqq    h )L )Dhqqqqhqqqqhqqqqhqqqqhqqqqhqqqq `qqqqqqqqqLqqhhhhqqlqqqqqqqqqqqqqqqqqqqqqqq 4 5qqqqqqqqqqq|x}~(yqqqqqqqqqqqqqqqq \  t p qHظqqqqqqqqqqqqqqqqYYYq\dq[0q 8, :< ?4 ?d ?qq M NL W WX Wqq + +qq +qqq0$4(q(q\qpδqqqqL0 qqqqqqqqqqqqqqqqqqqqqqq T qq ˜qq Äqqqqqqq8X`qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq X ֔qq ֜qq \qqqqqqqqqqqqqq516x628qqPqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq <  Xqq D Ѐqq Јqq qqqqqqqqqqqqqq    8 hqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq qq qq qqqqqqqqqqqqqq qq <qq 4qqqqqqq`qqlmqqmqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq$%H%'(q/qqqqqqqqqqqqqqqqqqqqqqqqqqqqqlpqq8XqĸqqqPqqqhqqqqqqhqqqqqqhqqqqqqhqqqqqqhqqqqqqhqqqqqqw  np oK H 0 <x`P@0 p`P@0 p`P@0 ޭ @ @ @ @ ???? -  !" _`abcxyz{|}~ZN]Y^YBYYYYY.YYYYsvr4`$prWhA  xph`XPH(xX80`@80( xph8xH0߸ߠ߈h`XH(ްޠސވހp`P@0(ݸݘݐphH(ܸܰܠܘܐ܈܀xph`@0 ۠ۘېۈxp`H@ ڸژpH0ٸ٨٘xX0ؠxX0׸אpP0֨֐x`@ հՐpH ԨԀX0ӰӐx`H0ҰҐd q u< uHPu  (! $4x ]8dd|dd0d ddvHddltd d}Pxdd4d }dd/H D:D X v8ddddddddddddddd5x3 ddd`( yt\ #, &8 D$x  lddddddddd  , | s@ v    ,Lddddd0 0x@| dHdddddddddddLpA C<ddddddddddddddddddddddddddddddddddddddddddddddddddddddsunosXP|Whd q u< -t  "H d 1,! $ :d ]8dd|d3dddddd!(ddl T!d!}Pdkddddd) 7d\  :D X\dY  ",dd  ( <   .d h-  C<d 5HAuzhuxd |Pd/H  k oL bHe\cd lP*8ld 8qq\ q dd ed>0L|Pd s@ v> &8#,d8ut0 ]|]Hdr{lp35x'@| bud22sddd cldd 4d.7/0#% zzd.1$#<.V0XW(,d &` |+Xddddd%dP1,2Kn,X  `  % K2Kn,X `%K@  @@ @  !"#AK%  `   X,nK22Kn,X `%KNetBSD1.2 @(#)NetBSD 1.2 (GENERIC) #4: Fri Sep 27 22:03:25 MET DST 1996 pk@kwik:/usr/src1/sys/arch/sparc/compile/GENERIC  !)190 |8!n._3; ?D HS`[l =0vA} =4 |W4lD| =8" p =<h' /J`4o C =Z =g =p @ =܌!cGP, p ;$ %%1X< DJ ) X p` =i7{ 7X ] =1,Q4   <x =  |$gt/ =F =V:dbCp@ =%@G@ ] =Zm'hn h = 8*1 G |DS Fd >t P}  @     Xo > Z!^.8,IkW Tg74 !tx8 !dwO >$ƌ 84 >(1 >h? >pP\(eq:D| >xs@&$Zt ?X $4% ?\-H9 ?`DHVh0 t E^('  fLB8 B<\ >/5B0K\Z -lQl{ ?d, ?P Te@] ?h3  ?p  H //h ;H HZ \ hV0 ~ P@ ?x < 7p 4 7` $  X  <   ? x + * @vx NQ X[ a ? i r Z ? q Y   A ? $ Q 8  h L " 0>X ;ۼ C[, L, Y ? i x 0 7 ( ?  u  0 ? /<  )L  (  $ 3O E R _ k@ w ? L  f ?      ?  [0 @ x X  $ -xH =f| F @ OX [ { f : r d z .  {L 9( b8 ۈ  w 0  j @lD"2,;LK R^ @ l|@t+  ?p  sH(=2(=EO$` i$s @ 5P:x @ M (P~(0 ? $/ ;,FQ @\qdn@tk _hx! 8 ]p @h% <3D1$X 0gFwK! Sl (  @ Zt @\:0  %P3W(I_ m xx k*`  $ HDP@#X- @p8 @xBcVe\jvL 0_l, 5x kl @, 5? M L_ m@tw< @#!lI0aP1P H j&<0=XEO p [ Am Ax A 8 4 Ј  tx +B/\>K$`j zgL A?*< #hL"p-rT9 A F A(Q ^ ow  AXԀ\   vp 5( A\ A` \+=(7B N_l1}U0 Q  AdZ AhR4 * Al5|Bz0[\j/tt(lq4T  j AT H $ TD&0-?07ADLΤY)r&&T%%h%8$     #.p9B<I XLc[nw] An &P Aq  A+0ANp4`6xhk`sH A BM  }$ B{H  C,K 7 xDN C] ; i Du U` :< C C %h ݜ D( D,"/n; &0H \] D0kD [@jP D46 A D8[Lל-< L\W D@k #|~ X> '  DH(h DL@ O  %* 4|P D TA c< p4 {@    DP 0 7   0  ! Dt! =\!L!)e!42!B Dx!OϜ![ D!f !o !x!h!)l!'!#!#!#|"""P"(H"8""I Z"_"jf"u "$"A"'" " "0" ""3# 4# m##&0#7f#B9#P#b#m #u W#} ]D#!#4# D##x#i#@D# (#5$$ &$$$+n$38$E'$O>$[^X$f 0$t$ l$ 4$n$ @$$V $ 8$*X$ 8$ <% ^h% [%0K%=b%G @%S%]0%f D%zH% %HD%H%R$%%5%% l% H%l&9&  ,&1&.&7 T&B P&O]&Yl&e(&q `&{ &&&Kp&u&Ԩ& & d&&L' h't'# T'-'6GD'Cx'P'X 'i '{0' H''Hh'%' p'px'' ' DH(`((&)(=)(T((m( ('0('($(#P("( x))()),)9)C))P@)Z)j |)r)|&)%) [P)W)m) ) )?) y* 4*H4*=*.*? *I *X/*cF*x* $**ٴ**7h*R* *l*C*F0+ H+ +&H+. +9 1+OH+YJ+lH0+t6+ + +=T+T+ +8+ +Z+ +  , C, t,ol,),6 ,@T,O ,X,kn,} -d,d,"|,, ],Z,Z, B- /- -h-)t-4u-O =-^-o(-f- -:\-T-\-  - WX- - 4- $- (-. A.$.!.) .3 h.I `.X I.bX8.n.|.l. .,. d.... h.&(.%/%/($,/>;/Rz/oz/^/// L/ l/K// A0//~0 )060#00-409 30H 0Yb 0ik0 p0 x0 00 0^0 0 00 81 11$rT1:N 1D `1Q1[^1f 1to$1l111 h 1 ]1 |1 !11d81%|2]@2g\2)f26 2F 2Wr2f2sl2~2 p2X22222 62Ԭ23s3 g3),3=E3OO 3X3`L3n 3@3O3 3h3|33lH3(33p39(4 d4 !,4"lT4, Ѐ4: ,4G :4X C4dn4t{4x4 4m4 4H4 \4 4V5RX55$`5;5D 5N 5VE5c $5p 5 555 5K85)@5(5#$606;6 C65 p6A,6I(6W7\6lnD6~ L66 6 86 6 6 6$6 LH6S6)7X7 r7 7'71L7@57H 7W7_ 7i 7q 7}  7(7a,77uh77 7 \7A7g7 8 8t888) 81,8BB8T<8a T8i^p8w yT8 8D88e\88 >8Ҡ88 X82\9 9# l92A9C|9PD9fh9t 49`9 99@9 89 9'9$98:> : :c4:/h:C[:L X:_2:p:x?p: T:: :Y::[ : Zh:Xp:Up;T;#P;7O;LKP;fI;H;;9;9,;7;6;2<1<*0T]> Y>>&L>1 >=S>L >V7|>b >o  > > >F> 8>  > )>x>P> (>?? ? d?%?5P?Dn,?S 8?\8?r(? ? nT?? g? }?g? t?A?@??d,@  `@@#@1 @>D@N@@]%@m>@x|@ @ @H@ @7@ @ @ @~x@wpAA 8A A/4A:^AD 0AO @@AZ AepAxA<`AxA(XA$TA XA uA.A*8B B8B{B+$B;BS;B]rBg Bv B B hB8BvBFdBPB ͨBB!B XC 8C ,C# lC0PC= CH CR 0C]`Ci2Cz]4CC`CpCC(C(dC&D%D$D0D:DB2DWDk ĤDv 5D DDt@DrD(DlD HD$`DD TE  EflE% ֜E2 E>EOmE`|Ely<E E E EE E\EfE 4E tE E<F $F 'tF+F9_FG b8FU 2Fg1Fo xF}TFUFpF XFF%FF6F-F]HGG \GG* npG5 G@GP 4Ga -GuPGh\G xG0G |GCGDG G G 0HHHu\H/ 74H< HG|pHW Hd xHl H} H]PHHclH~xH2 HH CHH:IkI \II% I2IEIT"0IbImoI  I*IlIGXI"IvHI /I I'J "J"hJ.TtJ9 JC 0JSmJaJJmblJwpJ dJ JJKJ$JpJJ8K ZKVK& K3tKG KRK\ dKkKy KKK *K4K!KK KAKAKEL L-L' L0PL> HLHB|LQ$LZ MLbkpLo(LwH0L_PLlL LnHL LXlLdL+L M M  M \M# M- BhM7HMFLMTlM^ MkXM{ M _xMMbMpM1TM [HM MM NXN rNZN% N0 N= NQNZ]NcNmNuN~(Nn$N (N QN8tNoNİN |NdN N N4OO+`O%O/`O@D8OTkOeMOqO|O00OOxOOyXO Z O OtOߠO ? OP P% \P2 |P@ 4PK PUa8P_Ph Pp P{P P`PP P P PTPxP QQ #Q Q#>xQ1 Q;A@QD `QMQXQh\Qt<Q7QQQ8Q)Q`QQ1Q"@QRR]R R. {R8 hRCRQ pR` aRm,Ry-RGRRRRRRRR $`R xR0R ]S J$S S' S5HSA OtSK SW\Sb SpS} S SSS SdS@S S SkTT TT(tT1hT< u8TF\(TQkT[ T_ Tk,XT| $TT6TXTTT %T Q@T:XTLTTUA\UAXU#^U3 UD UU U^Uj`UwDU |U U U U`UU Z(UTU~UV BV_lV%LV3 V?VCVL [8Va Vm =VxVNVVV VCVV ?4VVlVTVW W QW* W> WN WVڤWaZWw \WW(W?WWW W ÄW W̼W lW X X XHX24XC DXM XU]X_|XgXs X~XXlX  X EXƀXX X] X xX"XY Y"YY4 YCYLXY`Yh YsXY|Y<Y U(YYLYHYyY pY YZ aZZ& Z3 ZCZP ZZ (ZjkZu &Z \Z@ZZZ"PZ 0Z 0Z Z<[[D[ [1 [: 4[D7@[L7[_^0[|[t[ >[ ۘ[ D[[[([I\ \\# 4\3P\?}$\L\Ts\ju\}s\ 8\A\$\_\ @\ \ 7\ \\]t]=] T]'#]6 ]G]W H]c&]w]7]T]]] @] ]ED]] |]9^[^  ֔^ L^!^4^< P^E^PB^c>^qW8^~^(^ ^^ Ì^ ^^ K<^A^^ p_0_ t__ x_)_4:_?_I ]_S`___o_{ _T_ \@_0_X(_S_&8__@_`0`ڈ` |`' `48`@ `W `n e`{ `%`l`` ``@`a` aa a! <a- CaA@aT ta]/pak4aQ`a` a{laaaaYaaZhaB aCb mlbb=b(=b7bCfbThdbabk\bt b~4pbQb 'brbTb bYb b!(bĸb Pb c<c cc'7`c5 cAhcJ c]%clAcv\c c Q<c cc Wc c cc Tc xc |d  5d d+|d9 F$dCdSd` dn d{Pdod d md ldPddC|d deAeAe!|e/ZPe;eG eb 7ej `ey @e eF4e e0e eAxenPeef؈f Lf 8f*\f6f?HpfMn\fUuHfd fo jfydf fZ@fHf fi$f f;\f:fhfgg t@gZg+B g:gOog^,glgtQg~ 8g|g l4gg gg ^gg4g ghphXh h,/0h9O|hE idhP`h\ hj:ht $h h h Šh1h O8h DhQhh#,h iTi i { i!(i3pi> iKHiV^iaillPiv 'iri ii)i i iiAiXi i \j`j \j'Hj7LjFjR:jj7Lj1j9tj2Lj3j-jLkKHk1IkIYk_VktUhk8k/ k+kRPkPkXll+ 0l5`l?lQ l\lf lsl|l,l ll xll l-dll jlrlm pm Pm&  m3wm;s8mC$mM mXm` lmt0mmpmpm mmjm m m Фn_ n  FnKn#Y,n3pnCZlnL\nW0`ndlnq`nzGnn]nnbnn\nA n+n9ooPoo)ao4 >o< @oH_(oS oaolou4oX0o L\ofo o"Ho ]o$o op$p#,p&hp/p@^pGp`appqpz p pp p \pLp(p^pllp p ?tq qq,dq9(qG,(qV>tqc 5Hqo ˜q{ Jq,qq \qPqq q qVq q'8qqer\r B`r$ "r4 rFrS4rc:rrer \rKruxrxrm r1r 8r#s8s ss)(s?rxsLvsY `snLs}AHshtss s s.8sYs ps@ttt tht"&\t5)tHtV`t`ltj=tu ttj<t t t xt)Xtt )t]<t4tt8thu Lu Zu) |u< ʀuO= uWkuc Cupqpu ʄu Su `\uu uu ʈuuu(uv v [v, v= ,vGvXvh Z4v| vvviv>va\vv0vw w w Cw$Dw9g(w@èwNPwY֜wgXww]ww}w 0w(wwlwwg4wyw ʰx ʸx 5x x. ʼx:$xC xSCx]4xg xrkx~ Wx xXx"Hx`xbPx xo`x SPx x yyy+0y4yF]PyOxy^7|yj`yt1(yyy yyyMyyPy 8,yiyzz ~XzCxz$ z- `z:zAPzNBz_xzn zu *\zxzXzJz Zz Zz z{<4{2{{+\}k~ ~ %~ c\~#~* ~4 ~?@|~LB~\!~j(~u ~X~0~8~/H~ 4~ ~C~~|~1lP-7 tC ?S,]Xem(  V  NL x' x@ 0( $2 <ǘIZ[d pn- x   hZx  LLU  4h 3?elKY/h 'r 8z @ytg XGl(S$! `+G8 dI lRZ hd=o|H!l p3 \@b   Bx" +|3pE 0P 8W 8g ,sY( ]  a4t  L  ;+ 6pBMnYpe Tw  8 |  umT d(  7ND P[ gv XHnp=( |q\&@ A-7%@4M]|en|l Iv 40 }PR H kq;( % / >M WXbYogzCP $Nn`  `/ \9,8%I;0`iڀu F0 ZPZ@<^g28 (&X2:LvX aa<n`y @} _(xT&9X1 _;i`N^`h Ts<} m[#<m 0x   j $#I,6,B N[Ԅf(y8 L  ( H[2   7~H#Ƹ9 HJTc`lm wn(~ /h w ݬ Pad7`n4 X `*;G Z]ku h~ -fp=. phHH ̜ EL4G6TG_Ci>q@&K$ ( d  p T  G -/Y JSYXbn {  %E p8׬ k@L8H8o&g\- ߌ: ?dC L)t_"oxkL  X$.  ,SZpn`_\?Gl, 4n;Max3Ha < %D h  X0'D3a<!M X )g;s`( ' 8 00<Wh  dhld  ! ~,9  @UPYSf $t  (^o(NDFh LZH $D1<'H V@aO0heddR P ,@H`8 <[0(/L7E \QZ\a Tjsap Z /8 X@< o p \]pa L S'4'dC M]W g pu 8|bP]h J 8$r4 B 'P] f `vM~p4DZ h_t cXJ0%ga/8GOHSukxZ"8j$#  `[D]m \aT*Y9FOδX +aTn{ DFy h  lp"'=1A <\JUHb o"hvhjPF , p] ]T  t x |9H#/,6JA bJ0Q \Knl JS 8HT+\  F   ]$+Y5 ? L;dVU4c(sD#X Yp 0  lEp&T8ELMrYi q(z 'x l<! 3:Tr0 j , 7p@9O mZ`dHt@ o 6h  E$pG`8  1CaO ] ><lhx$4` MR<oL H ި L& T- 8G LO\Ttr l{[  8;8# < ]D|P Ae( P3<FS][Ib:l# XZL\\p o Xk?] X  - 5=F XO \Y,ct |  t pT &\  t Z'b$/`:|PF[P  (flny  0[  4h   8 #X,: D OXo4` |i \t̠{o  <  @ٜ hk8u%@  Yh t/h<PFq^ 3jDzDp0 ʠ  D kF !  H  L#s4 x?/H SfZ.k  Pr}E,  h  & A| nhf3v  p  t# .FB$Ob mz:  x(` 4[v2 4 ^wH  |* [3j@$KTa :ppc|G A@   DB@ 4#/? X0N@@\(@oZ9p _Ktt}  (4 ܨ  )I6 hApHZ  h'tu9 -   *T   + 7  ,p-ø= lR!(Z bGlsHf   YXAhto t, t/Df 4&Z 6 7,D  M  Z  f3\q  ,}@ d<   l  * [< & 0m? /M!,\xdm +v%Hxa`&  L ( C<  % 2)C)T P\  d s\~#8H f  @ Ҹ\: 82X)Xx9  DK  HT_zhzp Q` D  g|`  P PY)07LA  TJ- ]mʤy\dV4  X  h >  lT$\  pq  t*E7[`C +W5`en K| `>0W D v' Ƽ4  x;F HT b8qp X , 0  |  A`n$ x9gX 3xC0<P 9^۠k   >pj    ߰ 8>P >H$p, +4 >KJxQ hh[ i @o˄yY@  ``p[    DR` #0`0 ݸ;mJ;xUk]Jct~D50 y s0 O$]n$k,ظ  C4q+`6m=DgHP I\ f Dm :d}B|$ P PmL mDa H# )D+819 A7XLDX Q|h ;n w_t `>T` ,]8 hx%d3tC] MJS L_MXkr@{+X +  ],@  @ U( Fx= LJRZ b)r  } ِ )d PT $  * Dx@+4q;)xBJ tUXir GyHG8r (GXMp ,h %D08!a- 6> <GhTt@a/0k 0p(y aZG(] ;@|I [<)X1@: 4O\ 8eMt b@l9=`Je'Ō# TUh)T5 X:n4I XKTi(hr{  7,XYtXx 0  ͐  q<u<)-t9ATG hXۨe_Lo pz 8 .8K8< À ` p d#D+3 T@=IhT8b rN @ "DT xk = + B<R7xZ_jG(q }M1`_, b`Y  a4 l+5_8=JHB R _ f 9p :py7 >_kbd_serial_nfs_readlinkrpc_kernfs_sync_log_copyin_sdioctl_scsi_scsi_cmd_addlog_proc_trampoline_ctx_kick_isbad_dmmax_ffs_oldfscompat_ipintr_ncr5380_pio_out_nv3tov_type_nfsm_srvpostopattr_nfs_iodwant_doforce_vndread_iommu_attach_locked_queue_count_cdevvp_cd9660_vfsops_nswbuf_max_sw_3_leftover_kernel_iopte_table_pa_kmem_object_timerok_vm_map_entry_unwire_ffs_fifoop_p_spec_ebadf_ttychars_doshutdownhooks_cold_cd9660_readlink_htonl_bsd_to_svr4_sig_ctx_free_kbd_repeat_dayyr_nfsspec_read_nfs_getnickauth_sys_shmget_spec_read_sd_get_parms_cd_get_parms_cdlock_devctty_sunos_sys_reboot_union_write_devopn_getnewfsid_iso_uiodir_isohash_dvma_mapin_xdc_error_ieattach_fdcattach_nfsspec_close_spec_close_buf_bootstrap_getidprom_fdprint_bgetvp_rcons_esc_swap_pager_maxcluster_nfsd_head_flag_sys_revoke_in_pcbdetach_in_pcbconnect_zeroin_addr_procfs_symlink_vndsize_audiowrite_htons_amd7930_setfd_arp_allocated_fdesc_setattr_ccpu_le_ca_ttydebug_si_debug_cdioctl_cpu_model_vm_map_protect_getfp_scsi_test_unit_ready_eeprom_uio_ffs_reallocblks_nfsnodehashtbl_vmmeter_nprocs_cgtwoclose_mfs_close_nfs_readdirplusrpc_unp_detach_ttyclose_le_cd_scsibusattach_vm_map_submap_catq_fork1_ffree_sw_1_leftover_timerreg_4m_boot_iso_shipdirlshldi3.o_sunos_sys_uname_rcons_invert_sbus_establish_mountroot_hook_establish_vmapbuf_shutdownhook_establish_mmu_reservemon4m_vm_page_deactivate_kernfs_print_fdesc_statfs_needbuffer_spec_strategy_cnrom_vm_map_clean_cnputc_kernel_object_store_mfs_rootsize_vnode_free_list_vattr_null_m_copym_sys_setgid_sys_umask_cons_getsock_bdevsw_acct_process_sys_readv_vop_symlink_desc_vop_fsync_descmax.o_cexp_unp_scan_intstack_cons_ocount_lfs_rmdir_encode_comp_t_vop_ioctl_desc_nswdev_isofntrans_ccd_softc_svr4_find_socket_svr4_sys_context_getpropint_vnode_pager_umount_soo_write_compat_43_sys_quota_vop_lock_desc_cnstop_sys_munlock_cd9660_unlock_bootpath_store.rem_ffs_realloccg_writedisklabel_scsi_free_xs_sys_settimeofdaymin.o_fpu_compare_semlock_pv_unlink4_4c_vm_pager_cluster_fdesc_allocvp_kinfo_vgetfailed_sysctl_file_sys_getgroups_bdevvp___adddi3_ufsfifo_write_rtrequest_slstart_tablefull_tickdelta_cd9660_reclaim_region_freelist_msselect_vfs_unmountall_fill_eproc_sys_seteuid_compat_43_sys_stat_net_sysctl_compat_10_sys_semsys_sys_wait4.urem_mmusegments_umapfs_vptofh_devin_groupmember_devio_sys_semop_eintstack_kbdwrite_nfs_mknodrpc_nfs_islocked_am7990_config_calltodo_svr4_sys_times_vm_pager_deallocate_nfsrv_statfs_sorflush_vmel_ca_nptesg_zsabort_amd7930_get_channels_pager_sva_enosys_cd9660_getattr_vm_object_cache_clear_tcp_do_rfc1323_mrtstat_vop_mmap_desc_cd9660_unmount_ccddump_uiomove_copystr_fpu_implode_si_dma_alloc_arpt_down_getvfs_vmel_cd_si_dma_free_nfsbootdevname_spec_pathconf_nfsrv_slpderef_devioc_ptyattach_nswap_ttymalloc_compat_43_sys_gethostid_sys_getfsstat_null_reclaim_cache_alias_dist_getprop_cddump_cd_read_subchannel_findroot_pmap_pageable_nqnfsrv_getlease_umapfs_init_reassignbuf_pfctlinput_inetdomain_mb_map_spec_lock_lfs_segwait_cddkdriver_acctp_svr4_sys_systeminfo_cnwrite_fdwrite_bcopy_pmap_stats_amd7930_get_out_port_ipaddr_lf_findoverlap_sendsig_copyout_xyc_cmd_kernfs_symlink_sbflush_ccddevs_switchexit_espattach_sys_obreak_cddone_vm_pager_unmap_pages_ufs_mkdir_umap_bug_bypass_fdesc_badop_ttyflushmuldi3.o_kernfs_pathconf_donice_semexit_fifo_pathconf_msqids_spec_advlock_vndclose.mul_svr4_sys_uname_ev_read_intr_establish_vmeintr_establish_lfs_fifoop_p_compat_43_sys_wait_union_abortop_kernfs_write_sysctl_struct_sys_mincore_svr4_sys_statvfs_pmap_rmu4m_pmap_collect_lock_read_acctresume.div_seminfo_ffs_clusteracct_union_start___divdi3_ttylclose_calcrulshrdi3.o_procfs_dostatus_safepri_vndclear_audio_softc_sdmatch_fdesc_vptofh_mi_switch_seminit_mclrefcnt_kbdselect_ufsfifo_read_dead_badopnotdi2.o_scsi_execute_xs_ostype_xywrite_portal_statfs_vm_deallocate_finishdup_sys_nfssvc_sys_vforksaveregs.o_unp_gcing_enodev_me_alloc_si_obio_intr_off_unp_shutdown_xycattach_ufs_mknod_process_read_fpregs_iftovt_tab_pv_unlink4m_nfs_update_sys_setlogin_amd7930_halt_output_vm_page_queue_free_lock_fifo_lock_sys_ovadvise_audio_init_play_sunos_sys_exportfs_sc_print_addr_link_rtrequest_dead_ioctl_sunos_sys_stat_ststrategy_sys_fchflags_write_user_windows_cnrint_kernel_pmap_store_readbuffers_union_readdir_ipintrq___muldi3_audio_init_ring_cdmatch_evcnt_attach_compat_10_sys_shmsys_pmap_is_referenced4m_iommu_remove_lock_init_ufs_remove_igmp_fasttimo_mswrite_sys_shmat_cnread_fdread_pmap_steal_memory_lfs_vunref_null_getattr_timeout_svr4_sys_execve_pmap_page_protect4_4c_ip_forwsrcrt_getdevvp_unp_defer_logsoftc_compat_43_sys_recv_compat_43_sys_send_sys_execve_spec_bmap_kbd_reset_rn_inithead_union_print_ipcperm_esp_stp2cpb_sbappend_trapsignal_lfs_update_union_remove_sys_shmdt_sys_rmdir_rtable_init_rcons_cursor_ctxbusyvector_zsioctl_ttyinput_ienab_bic_4m_pmap_copy_page4m_ufsspec_read_icmpmask_null_lock_filedesc0_spec_open_vop_getattr_desc_bpfilterattach_ip_sysctl_in_pcbhashlookup_getblk_stackdump_roundrobin_cpu_startup_svr4_sys_xstat_fdsize_ufs_ioctl_unp_mark_sys_fstatfs_cfdata_cnselect_ufs_rename_procfs_vnodeop_p_rootvnode_virtual_space_start_ufs_symlink_pdevinit_cgthreeioctl_esp_scsi_reset_fd_mountroot_hook_union_vn_close_msread_postsig_svr4_sys_sysarch_vm_pager_get_pages_ifa_ifwithdstaddr_socantrcvmore_sys_sysarch_svr4_sys_sigsuspend_ptcwrite_sys_sigsuspend_ccdopen_sd_switch_union_rename_ttclos_cache_alias_bits_xdc_startbuf_findzs_sys_setgroups_bounds_check_with_label_ienab_bic_4c_vm_pageout_scan_process_sstep_pppattach_getptesw4m_zshardscope_lfs_stats_umapfs_vget_vm_map_pageable_ptytty_execsigs_pidhashtbl_mixer_open_eeprom_ca_cdopen_scsi_do_ioctl_sys_recvfrom_matchbyname_nfs_sillyrename_procfs_vfsops_tk_nin_nfssvc_sockhead_flag_sys_mkfifo_eeprom_cd_in_pcbinit_intrnames_sbus_print_si_obio_dma_eop_union_rmdir_null_bug_bypass_vflushbuf_selscan.umul_vmeintr_vm_map_entry_create_tcp_ctloutput_ip_ctloutput_portal_vptofh_vmeints_dfltpagerops_physmem.udiv_sunos_sys_poll_vndopenucmpdi2.o_kbd_softc_pmap_prefer_compat_43_sys_sethostid_union_reclaim_pagemove_vop_valloc_desc_rcons_insertline_nullfs_fhtovp_soo_stat_bt_getcmap_ufs_select_region_lru_ttymodem_cgtwoioctl_mfs_ioctl_rip_input_ufs_islocked_nfsrv_dorec_vop_readdir_desc___anddi3_udbhashsize_ttopen_umapfs_root_vop_strategy_vp_offsets_vop_reclaim_vp_offsets_vop_readlink_vp_offsets_vop_symlink_vp_offsets_vop_rename_vp_offsets_vop_link_vp_offsets_vop_fsync_vp_offsets_vm_map_delete_vm_object_collapse_vm_page_copy_tun_ioctl_ifa_ifwithaddr_union_getattr_dead_bmap_soqinsque_vfsinit_cd9660_ioctl_seginval_si_options_vm_pageout_page_ip_setmoptions_union_select_union_unmount_unp_drop_nfs_cltpsock_compat_43_sys_sigstack_svr4_syscallnames_vm_alloc_lock_vfs_opv_init_default_endtrapcode_rcons_insertchar_xdread_st_switch_ip_mforward_sys_getpriority_pmap_clear_reference4_4c_promvecdat_pmap_enter_p_fragtbl124_ffs_update_nfsrvw_coalesce_hostname_compat_09_sys_uname_nfs_quotactl_nullfs_quotactl_dead_open_lfs_vcreate_rtalloc1_exec_maxhdrsz_sdstrategy_lfs_gather_nfs_invaldir_ether_ifattach_am7990_ioctlstrncpy.o_sdclose_auxio_reg_kmem_object_store_ufs_ihashlookup_findnode_lock_sleepable_getnewvnode_ctx_kickdir_numvnodes_lkmdispatch_xydkdriver_cd_play_big_amd7930_get_silence_ffs_specop_p_cluster_collectbufs_ienab_bic_si_obio_intr_on_umapfs_start_vmes_ca_sbdroprecord_eintrnames_mrh_list_ev_init_xdsize_nfsrv_fhtovp_lease_check_shm_committed_vmes_cd_pmap_protect4_4c_pmap_dumpsize_nfssvc_addsock_eeprom_va_vm_page_queue_free_vm_page_zero_fill_krpc_call___ashldi3_cd_play_msf_shutdownhooks_done_nfs_getattrcache_nfs_getreq_nfs_loadattrcache_tcp_respond_selwait_xyc_startbuf_fdesc_quotactl_getnewbuf_sysctl_string_sys_getsockopt_ncr5380_pio_in_tcp_keepintvl_nfs_abortop_vndattach_kernel_text_cdclose_xdr_string_encode_udpstat_semundo_adjust_cpu_exit_emul_netbsd_xyc_rqinit_sunos_sys_fstatfs_vm_page_free_ffs_vnodeop_p_nfsfifo_read_dead_lock_fifo_read_rominterpret_optionsnode_fb_setsize_tcp_debug_geteblk_domains_ienab_bis_nfs_receive_vop_whiteout_vp_offsets_vop_islocked_vp_offsets_vop_read_vp_offsets_vop_setattr_vp_offsets_vop_getattr_vp_offsets_vop_mknod_vp_offsets_socketops_ktrsetchildren_vop_create_desc_amd7930_set_channels_tcp_close_ip_rtaddr_kernel_map_tcp_setpersist_multicast_encap_iphdr_vop_pathconf_desc_bt2pmt_vm_map_simplify_tcp_template_rtstat_audiosetinfo_tsleep_fd_motor_on_ip_mrouter_set_seltrue_svr4_term_ioctl_cd_switch_union_vfsops_cluster_callback_vndiodone_vslock_stread_ufs_quotactl_shutdownhook_disestablish_callrom_lfs_write_umap_inactive_portal_inactive_fifo_print_vn_writechk_allevents_vunmapbuf_vop_inactive_desc_vop_seek_desc_xdc_ca_sunos_sys_sigvec_xdattach_in_pcbbind_soreserve_auzero_block_cttyselect_nfs_readdir_nfsrvhashtbl_xdc_cd_nfs_removeit_ureadc_nqnfsrv_vacated_ip_protox_igmp_leavegroup_umap_vnodeop_p_portal_vnodeop_p_amd7930_get_port_amd7930_set_out_port_dead_lookup_sltioctl_buffer_map_vndioctl_ccdread_vm_page_queue_lock_in_cksum_vm_map_check_protection_chrtoblk_strcat_dkcksum_pgofset_cpu_fork_portal_fhtovp_lock_try_read_hostnamelen_cgthree_ca___subdi3_netaddr_match_sunos_sys_sysconf_me_free_mfs_mount_averunnable_sowakeup_cgthree_cd_rt_missmsg_tk_cancc_sys_quotactl_cache_enter_svr4_setcontext_cd9660_mount_mmu_reservemon4_4c_ms_serial_ufs_unlock_rpc_msgdenied_rwindow_save_union_diruncache_kmemlimit_ccdsize_intrhandmoddi3.o_in_rtchange_nullfs_inithtonl.o_vm_object_print__vm_object_print_pmap_change_wiring_ufsspec_close_clrbits_strcmp_vnddump_swap_pager_inuse_nfsrv_commit_ev_fini_vm_map_lookup_entry_nfs_access_sbinsertoob_ncr5380_reset_scsibus_vop_bwrite_vp_offsets_vop_update_vp_offsets_vop_truncate_vp_offsets_vop_advlock_vp_offsets_vop_unlock_vp_offsets_vop_lock_vp_offsets_vop_write_vp_offsets_vop_access_vp_offsets_vop_create_vp_offsets_nswitchexit_pmap_enter4m_union_unlock_union_freevp_umapfs_sync_ptsclose_sys_futimes_vn_close_ip_getmoptions_MPFail_soo_read_vop_abortop_desc_m_freem_amd7930_commit_settings_cpu_sysctl_exec_aout_prep_omagic_vm_object_setpager_vm_mem_init_strchr_espmatch_lock_done_nfsd_waiting_resetpriority_sys_setpriority_callfree_vm_page_count_bpfselect_cd9660_rrip_analyze_xyc_start_cd_get_modescanc.o_tcp_output_rt_maskedcopy_devwait_sosetopt_scsi_probedev_sys_listen_raster_op_noclip_cache_flush_vm_set_page_size_kernel_iopte_table_strlen_esp_reset_ch_usergetelemstatus_unp_bind_config_rootsearch_strcpy_parsedisk_lfs_specop_p_viftable_in_pcballoc_setsigvec_cd9660_vnodeop_p_tickadj_unp_ino_vm_page_free_min_min_virtual_space_end_tunctl_nfs_null_nfs_readdirrpc_mrt_ioctl_dosetrlimit_filehead_ether_sprintf_callout_svr4_sys_fstatvfs_si_dma_intr_timo_vm_pager_clusternull_ktrcanset_vop_lookup_desc_si_vme_intr_off_amd7930_cont_input_vm_page_free_min_max_lockcount_ufs_checkpath_nfs_bmap_nfs_udpsock_route_usrreq_ppptioctl_compat_43_sys_getkerninfo_nfsfifo_write_sl_compress_tcp_union_inactive_fifo_write_ctx_freelist_nfs_reclaim_enterpgrp_inferior_whichqs_stwrite_scsi_probe_busses_swread_tickfix_ms_softc_procfs_readdir_mrtdebug_pfslowtimo_suword_waittime_vm_object_page_clean_mfs_vnodeop_p_nfs_open_mfs_vfsops_filedescopen_nfsrv_initcache_nfsrv3_access_sb_max_dupfdopen_savacctp_sys_semconfig_sunos_sys_nfssvc_pv_table_vop_readdir_vp_offsets_vop_rmdir_vp_offsets_vop_mkdir_vp_offsets_vop_ioctl_vp_offsets_etherbroadcastaddr_compat_09_sys_setdomainname_compat_09_sys_getdomainname_tprintf_close_pgsignal_ienab_bis_4m_nfs_getattr_nwindows_soft01intr_cnpollc_nfs_unmount_nfs_realign_nullfs_unmount_igmp_joingroup_socreate_eintrcnt_mmu_pagein_ch_get_params_lfs_writevnodes_fdesc_enotsupp_exec_aout_prep_nmagic_nqtimerhead_bclnlist_vm_page_wire_procfs_quotactl_vm_map_lookup_done_memreg_ca_xyc_rqtopb_nfs_renameit_ppppktin_scsibusprint_mfs_reclaim_procfs_abortop_compat_43_sys_sigvec_fragtbl8_nfs_readrpc_ktrwrite_memreg_cd_cgtwogetcmap_fbconstty_cgfour_ca_svr4_esigcode_esigcode_dmaprint_st_mode_sense_pmap_extract_p_nfssvc_iod_proc_reparent_compat_43_sys_recvfrom_vop_rename_desc_timerblurb_sd_patterns_cd_patterns_dead_vnodeop_p_nfsv2_vnodeop_p_kernfs_access_pffindproto_cgfour_cd_fpu_execute_scsi_start_audio_silence_copyout_ienab_bis_4c_sunos_sys_getrlimit_svr4_sys_getrlimit_swfree_rn_delete_sys_getrlimit_compat_43_sys_getrlimit_sprintf_sunos_sys_auditsys_cache_flush_page_fragtbl_ttyrub_sys_lkmnosys_igmp_timers_are_running_subyte_xdc_perror_ctxinfo_ip_forward_nullfs_mount_pppread_cgtwo_ca_xyc_piodriver_rtredirect_audioattach___xordi3_fd_dev_to_type_ufs_bmaparray_cgtwo_cd_cgthreeclose_lfs_reclaim_nfs_decode_args_nfs_fhtovp_ip_mrouter_get_pppsioctl_kernfs_abortop_bufqueues_ie_hardware_names_lfs_match_dindir_union_mkwhiteout_esp_sched_vm_map_copy_entry_lfs_fifoop_entries_ffs_fifoop_entries_nullfs_vget_cd9660_fifoop_entries_iereset_tcp_debx_stathz_strncasecmp_nfs_getauth_fdesc_vnodeop_p_spec_vnodeop_p_tunwrite_sysent_vm_page_hash_mask_nqsrv_waitfor_expiry_vop_lease_vp_offsets_vop_vfree_vp_offsets_vop_close_vp_offsets_ptsopen_vn_open_cache_flush_context_chiptotime_rtinit_unp_connect2_cd9660_tstamp_conv7_ttcompatsetflags_lfs_getattr_rtfree_par_err_reg_lfs_unmount_fdcresult_power_reg_nswitchdiff_fpu_newnan_nfs_close_nfsrv_readdirplus_nfs_doio_char_type_timetochip_lfs_balloc_cttyread_config_attach_xdopen_counterreg_4m_vprint_fdcretry_qtable_cdstrategy_lfs_fhtovp_procfs_reclaim_printfbcmp.o_kernfs_readdirmul.o_esp_poll_scsi_change_def_nqnfsstarttime_ch_patterns_thread_wakeup_null_vnodeop_p_ttread_cpu_switch_b_to_q_svr4_sys_fxstat_nqsrv_writeslack_portal_open_swapin_tprintf_open_ledmaintr_lfs_seglock_nullfs_root_vfs_busy_cd9660_symlink_vfinddev_ufs_dirremove_nfsrv_cleancache_procfs_unmount_vm_mmap_node_has_property_pmap_is_referenced_p_vm_page_alloc_nqsrv_clockskew_savefpstate_svr4_sys_sigprocmask_sys_undelete_sys_sigprocmask_fb_pfour_get_video_vmspace_fork_nfs_adv_raw_attach_useracc_profhz_vop_print_desc_sunos_exec_aout_makecmds_nfs_nget_routedomain_tk_nout_cpu_exec_aout_makecmds_exec_aout_makecmds_obio_ca_sl_uncompress_tcp_cd9660_inactiveulmax.o___builtin_saveregs_ststart_nfs_connect_page_mask_cd9660_close_curproc_obio_cd_amd7930_query_encoding_mfs_vnodeop_entries_lfs_specop_entries_lfs_vnodeop_entries_ffs_specop_entries_ffs_vnodeop_entries_fifo_nfsv2nodeop_entries_spec_nfsv2nodeop_entries_nfsv2_vnodeop_entries_nfs_init_union_vnodeop_entries_umap_vnodeop_entries_spec_vnodeop_entries_procfs_vnodeop_entries_portal_vnodeop_entries_null_vnodeop_entries_kernfs_vnodeop_entries_fifo_vnodeop_entries_fdesc_vnodeop_entries_dead_vnodeop_entries_ttyretype_cd9660_specop_entries_cd9660_vnodeop_entries_mclfree_initfpstate_lfs_vnodeop_p_nfsrv_getstream_kernfs_vnodeop_p_fifo_vnodeop_p_kentry_data_size_nextvnodeidxordi3.o_vop_blkatoff_vp_offsets_vop_pathconf_vp_offsets_vop_bmap_vp_offsets_vop_abortop_vp_offsets_vop_mmap_vp_offsets_vop_select_vp_offsets_vop_lookup_vp_offsets_cd9660_lookup_vm_coredumpulmin.o_dumpsys_amd7930_close_nfs_msg_tcp_drain_swapdev_vp_cd9660_fhtovp_dumpsize_bpf_filter_avail_start_vm_pages_needed_kmem_map_nchstats_itimerdecr_vmspace0_region_locked_nfs_commit_audio_hardware_attach_nfsrv_mkdir_cacheinfo_portal_link_vfs_lock_clockfreq_lfs_segunlock_tcp_disconnect_procfs_statfs_kernfs_fhtovp_vm_fork_cd9660_tstamp_conv17_ccdstrategy_fd_motor_off_ufs_whiteout_susword_stdump_ffs_init_process_read_regs_bswlist_ip_mrouter_ip_defttl_elf_probe_funcs_oldmon_w_trace_nfsrv_setcred_tcp_init_am7990_reset_bucket_lock_in_setsockaddr_sysctl_rtable_vop_mkdir_desc___ashrdi3_fuibyte_scsi_inqmatch_nqfhhash_procfs_start_vm_fault_unwire_nfs_hash_rttrash_domainname_dk_busy_vmcmd_map_zero_nfsrv_setattr_nfs_request_procfs_getattr_vm_object_cached_bpfattach_slattach_nfs_flush_ffs_alloc_nfs_false_xdr_string_decode_rip_ctloutput_rqinit_kernfs_enotsupp_osrelease_vndshutdown_lfs_supercallback_ffs_balloc_sunos_sys_quotactl_sunos_sys_setsockopt_cgeightclose_lf_advlock_sys_setsockopt_pmap_extract4m_pmap_is_referenced4_4c_nfs_lock_setpte4m_fdcpseudointr_lock_try_read_to_write_lock_read_to_write_ffs_fhtovp_tunread_kernfs_reclaim_vn_ioctl_ncallout_nfs_link_nfsrv_mknod_vttoif_tab_sys_chroot_sys_getpid_ufs_readdir_nfssvc_nfsd_fdcloseexec_avail_end_numdquot_nfs_fsync_domaininit_cd9660_ihashrem_reserve_dumppages_rt_ifmsg_pppstart_svr4_sysent_tcp_drop_vop_reallocblks_vp_offsets_vop_valloc_vp_offsets_vop_inactive_vp_offsets_vop_remove_vp_offsets_vop_seek_vp_offsets_tty_inithtons.o_sunos_sys_setrlimit_svr4_sys_setrlimit_fdc_reset_swwrite_nfs_bufq_sys_setrlimit_compat_43_sys_setrlimit_kernfs_getattr_dumpdev_kernfs_unmount_nchrdev_vop_select_desc_procfs_rw_bwtwoopen_krpc_portmap_rcons_pctrl_cgfourioctl_bt_putcmap_umapfs_quotactl_kernfs_quotactl_sys_getuid_exec_script_makecmds_dumpmag_sbus_match_fd_do_eject_ip_output_ppp_softc_socantsendmore_ttcompat_lfs_segwrite_ufs_abortop_nfs_disconnect_m_copyback_procfs_print_nfs_savenickauth_autoconf_nzs_fdesc_select_st_check_eod_ch_getelemstatus_xddump_vmspace_free_icmp_send_ip_init_portal_init_union_vnodeop_p_portal_badop_vop_rmdir_descimax.o_in_ifscrub_sys_ftruncate_compat_43_sys_ftruncate_nullfs_sync_session0_ccdattach_clockintr_nfs_mkdir_union_dircache_swapout_threads_vm_pager_map_pages_ttspeedtab_process_set_pc_uihashtbl_cd9660_blkatoff_clockreg_xdc_piodriver_nfsv3_procid_arp_intimer_vm_object_deactivate_pages_nfs_mmapimin.o_svr4_getcontext_pmap_pa_exists_nfs_advlock_vnd_softc_svr4_fil_ioctl_ffs_reclaim_si_get_unpdg_recvspace_unpdg_sendspace_sb_lock_ttyout_compat_43_sys_getsockname_sys_getsockname_cd9660_ihashinsstrncmp.o_nfs_vgetashrdi3.o_xdc_rqinit_esp_dev_ffs_fsync_checkdirs_sys_madvise_svr4_sys_getdents_procfs_vptofh_kinfo_vdebug_ccdiodone_ttcompatsetlflags_scsi_probe_bus_m_copydata_sys_accept_strncpy_sunos_sys_omsync_svr4_sys_access_vm_pager_lookup_arcbroadcastaddr_vop_print_vp_offsets_vop_open_vp_offsets_sys_access_disk_init_nfs_reqq_revarpwhoarewe_rcons_scroll_icmp_error_ip_drain_svr4_to_bsd_sigset_ffs_unmount_mfchash_ip_freemoptions_dead_select_sysctl_clockrate_svr4_to_bsd_sigaction_pmap_changeprot4m_console_font_object_collapses_disk_busy_prom_vstart_fb_pfour_set_video_nfs_mknod_cttyopen_nfs_removerpc_nfsrv_access_lfs_gatherblock_pmap_map_fpu_add_ufs_reclaim_umapfs_fhtovp_m_reclaim_pmap_redzone_scsistrategy_tcp_recvspace_tcp_sendspace_ifaof_ifpforaddr_ffs_vget_nfsrv_rmdir_max_hdr_union_create_vm_fault_vn_read_ptsread_stopen_st_patterns_swdevt_nuidhash_max_sbrelease_bwtwo_ca_avail_next_xddkdriver_pmap_is_modified_p_mfs_pri_tcp_attach_fdesc_vfsops_kernel_segtable_store_lematch_esp_done_vm_object_copy_initproc_nfs_root_union_symlink_ttycheckoutq_bwtwo_cd_ffs_isblock_portal_setattr_zombproc_st_erase_tcp_dooptions_ip_dooptions_union_lock_cd9660_ihashget_amd7930_get_in_port_speclisth_trapbase_has_iocache_union_link_xyattach_vnodepagerops_nfsrvhash_masterpaddr_lock_write_to_read_pppopen_machine_suswintrntohl.oadddi3.o_null_inactive_rminit_kmem_alloc_wait_setuse_sofree_rmfree_ktrsysret_nfs_readlink_nullmodem_mmu_has_hole_kernacc_nfs_bioread_raw_ctlinput_sysctl_rdstringumoddi3.o_svr4_sys_getmsg_cache_flush_region_nqsrv_locklease_icmp_input_tcp_input_sys_dup_nfs_boot_init_vfs_mountedon_snapshot_nfs_send_xydump_amd7930_set_in_sr_psratio_pmap_page_index_vwakeup_mountnfs_bsd_to_svr4_sigaction_vm_first_phys_esp_timeout_esp_scsi_cmd_kmem_init_ihashtbl_ip_freef_fpu_mul_zsread_kmem_free_svr4_sock_ioctl_pmap_release_nfs_sndunlock_portal_pathconf_unp_rights_fpu_div_swap_pager_npendingio_tcp_notify_pppwrite_fdexpandiordi3.o_cd_size_zsconsole_arpinit_done_pt_softc_vn_rdwr_dvmamap_xyc_reset_raw_disconnect_rn_addmask_sodisconnect_solisten_gsignal_nfs_rcvlock_umap_strategy_vfs_op_descs_ttywflush_am7990_copytobuf_contig_opennode_igmp_input_raw_detach_portal_vget_sbwait_lock_set_recursive_nfs_read_nfsd_head_portal_mount_vm_page_array_ufs_getattr_union_mmap_child_return_strncmp_nfs_sigintr_sys_getgidntohs.o_vfs_findname_ether_input_pv_link4_4c_ufs_getlbns_dk_time_search_prom_amd7930_cont_output_busprint_mfs_statfs_ufs_readlink_union_init_setquota_lfs_newseg_untimeout_ffs_clrblock_rn_walktree_nselcoll_lfs_writesuper_procfs_domem_audio_hardware_detach_ffs_read_nfs_nameistart_vm_page_insert_pmap_changeprot_p_ledma_ca_fuiword_procfs_doctl_portal_root_nchinit_lkmenodev_inittodr_soqremque_ledma_cd_i7_nfs_create_sysctl_rdstruct_lfs_writefile_vfs_shutdown_xdwrite_soisconnected_vgoneall_svr4_sys_hrtsys_cd_play_obio_scan_xdc_rqtopb_cttywrite_vcountrem.o_rip_recvspace_rip_sendspace_fdesc_readlink_unpst_recvspace_unpst_sendspace_dk_seek_sys_msgrcv_spec_select_vn_stat_nfs_lookitup_dk_wpms_lfs_segclean_cgeightioctl_pmap_copy_lf_setlock_amd7930_get_in_sr_tcp_pulloutofband_nullfs_start_pv_changepte4_4c_nfs_sync_ttyprintf_lo_microtime_page_shift_u0_fpu_shr_amd7930_set_in_port_lfs_create_nfs_mount_ptsstop_config_make_softclmax.o_xyc_error_vm_fault_wire_nqsrv_cmpnamcmpdi2.o_sdread_sys_msgsnd_openpromopen_tun_output_pmap_is_modified4m_scsibussubmatch_vmel_scan_dev_pager_fakelist_union_strategy_rootvp_kbdattach_vm_page_bucket_count_vm_fault_copy_entry_tunopen_tcp_canceltimers_hexatoi_emul_sunoslmin.o_xdcattach_bwtwommap_nullioctl_ttioctl_esp_cpb2stp_scsibusmatch_nfs_prog_max_keylen_audio_alloc_auzero_svr4_sys_msgsys_ffs_sync_MCFail_clock_ca_xyopen_xyc_unbusy_nfs_ticks_ip_optcopy_umapfs_unmount_cluster_rbuild_dvma_end_sdsize_rn_refines_kvm_iocache_sc_err1_clock_cd_esp_init_vndsetcred_svr4_to_bsd_sigaltstack_espselect_soisdisconnected_vm_map_insert_ndflush_audio_calc_blksize_setjmp_esp_msgin_pppintr_sys_readlink_copywords_bus_untmp_procfs_badop_sys_getrusage_am7990_zerobuf_contig_sparc_interrupt4m_zsstop_vm_map_create_tcp_slowtimo_ip_slowtimo_acctsuspend_vm_num_phys_vm_object_init_nfs_sndlock_tcbtable_vm_object_list_esp_debug_cd_play_tracks_vm_object_pmap_copy_ip_nhops_union_lookup_vn_bwrite_vop_default_desc_pager_cache_numcache_doingcache_union_fhtovp_vflush_cache_flush_segment_svr4_sys_sigaction_iestart_fdcstart_sobind_sys_getdirentries_compat_43_sys_getdirentries_sys_sigaction_xdgetdisklabel_sdminphys_fdgetdisklabel_ffs_mount_nfsrv_updatecache_pmap_count_ptes_vop_vfree_desc_cd9660_mountroot_bwtwoclose_union_pathconf_umap_node_hash_fdesc_sync_kill_vmcmds_unputc_compat_43_sys_killpg_exec_elf_makecmds_pmap_virtual_space_nfs_true_udp_in_arpresolve_sbappendrecord_mountlist_fdattach_nfs_vfree_arpintr_procfs_readlink_mainbus_ca_svr4_sys_kill_xdc_cmd_sys_kill_vop_read_desc_svr4_sys_lxstat_union_mkshadow_bufhashtbl_sunos_sys_getdents_pv_syncflags4_4c_nfs_nhinit_disk_find_mainbus_cd_fpu_explode_scsi_error_nfs_renamerpc_nfsv2_procid_union_bmap_sys_fchdir_wakeup_dumpconf_cgfourclose_rootfs_vfs_export_lookup_vclean_dk_xfer_copyright_nqsrv_maxnumlease_bpf_validate_disk_unbusy_portal_sync_hw_sysctl_audio_blk_ms_union_open_kmem_alloc_sys_munmap_nblkdev_quotaon_tcp_backoff_procfs_close_timedelta_hz_rpc_vers_sys_link_kbd_repeat_step_nfs_timer_ifqmaxlen_fpu_ftoi_ufs_root_udp_output_unp_disconnect_sys_msgget_lfs_fakebuf_spec_unlock_dqflush_bpf_tap_lfs_fifoop_opv_desc_ffs_fifoop_opv_desc_sys_fchown_cd9660_fifoop_opv_desc_suibyte_fpu_ftod_memname_ttywait_mask_rnhead_segm_locked_getphysbuf_kernel_regtable_store_kernel_pagtable_store_ffs_blkfree_numnfsrvcache_sunos_sys_sigpending_svr4_sys_sigpending_killpg1_sys_sigpending_nfs_rephead_nfsm_reqh_fdesc_symlink_first_page_audio_open_bsd_to_svr4_sigset_cgsixioctl_sd_reassign_blocks_procfs_findtextvp_swapout_kern_targets_vfs_opv_init_explicit_soshutdown_slopen_sys_shutdown_sys_ktrace__main.o_fpu_norm_cd9660_access_fpu_ftox_avefree_nqnfs_piggy_in_pcbdisconnect_ffs_vfree_udp_init_raw_recvspace_raw_sendspace_initclocks_cd9660_strategy_rcons_doesc_fpu_dtof_statvar_fdfinish_nfsrv_readdir_cd9660_start_cd_reset_pppdealloc_xdc_tick_invalhash_logopen_qs_sunos_sys_access_tunselect_swapdev_kernel_object_tz_fpu_ftos_xyc_submit_iorq_cpu_coredump_sys_msgctl_mmclose_rom_console_input_nfs_vinvalbuf_tbfdebug_sys_symlink_vm_init_limits_nfs_setattr_free_msghdrs_svr4_sys_mmap_stioctl_ufs_makeinode_sys_mmap_sys_exit_bus_tmp_lfs_newbuf_ffs_mountroot_nfs_mountroot_in_interfaces_am7990_start_chkdqchg_nfsrv_pathconf_nfsrv_write_lfs_callback_curpriority_fusword_sw_2_leftover_ufs_advlock_nfs_lookup_vm_page_lookup_fdesc_vget_pv_syncflags4m_nonidempotent_rpc_msgaccepted_copyinstr_udp_recvspace_udp_sendspace_nfsrv_fsinfo_sonewconn1_checkalias_am7990_copyfrombuf_contig_sdlock_amd7930swintr_kmem_alloc_pageable_fdhashtbl_in_pcbnotifyall_promvec_pmap_init_lfs_allclean_wakeup_tcp_mssdflt_xyc_ca_pmap_destroy_nfs_reply_umap_bwrite_ffs_truncate_nfs_truncate_rip_usrreq_ptcopen_in_pcbrehash_xyc_cd_svr4_sys_open_esp_abort_ufs_seek_nqnfs_clientd_sys_open_loopattach_desiredvnodes_sys_mprotect_xygetdisklabel_cdminphys_setdisklabel_if_index_cd9660_pathconf_cd9660_print_pmap_next_page_vm_cache_max_nqsrv_addhost_union_removed_upper_sw_0_leftover_igmp_sendpkt_pgfind_disksort_ufs_dirbadentry_null_strategy_cpu_initclocks_sys_fork_semmap__insque_st_mode_select_limfree_statclock_swapmap_vfs_export_fb_unblank_soisconnecting_free_msgmaps_in_socktrim_fdesc_root_dmaattach_fddkdriver_vm_map_print_soaccept_vm_object_terminate_nfs_rmdir_tty_count_kmem_suballoc_bpf_mtap_st_mount_tape_vm_map_copy_icmp_reflect_lkmopen_sys_fchmod_utsname_nmbclusters_ttypend_microtime_vop_advlock_desc_configure_zsshortcuts_tcp_reass_sbreserve_audioopen_sys_bind_cd_pause_ip_mrouter_done_mmuregions_union_updatevp_sysctl_int_zeropage_union_newsize_nfsm_srvwcc_tcp_keepidle_tunioctl_slpque_zsopen_iommu_ca_st_read_block_limits_portal_abortop_dead_strategy_sys_statfs_union_vnodeop_opv_desc_procfs_vnodeop_opv_desc_kernfs_vnodeop_opv_desc_umap_vnodeop_opv_desc_null_vnodeop_opv_desc_portal_vnodeop_opv_desc_fdesc_vnodeop_opv_desc_fifo_nfsv2nodeop_opv_desc_spec_nfsv2nodeop_opv_desc_nfsv2_vnodeop_opv_desc_mfs_vnodeop_opv_desc_lfs_specop_opv_desc_lfs_vnodeop_opv_desc_spec_vnodeop_opv_desc_fifo_vnodeop_opv_desc_dead_vnodeop_opv_desc_ffs_specop_opv_desc_ffs_vnodeop_opv_desc_cd9660_specop_opv_desc_cd9660_vnodeop_opv_desc_lfs_init_iommu_cd_mem_access_fault_arp_inuse_sys_acct_max_datalensubdi3.o_sl_compress_init_union_sync_vm_map_find_vm_map_lookup_svr4_add_socket_vm_object_allocate_m_pullup_Lfsbail_clk_wenable_nfsrv_getattr_procfs_setattr_st_unmount_scsi_strvis_recvit_sendit_ktrnamei_profprocs_unixsw_vm_object_coalesce_nfsrv_rcv_rn_insert_kernfs_lookup_pppclose_uihash_sys_getlogin_fifo_advlock_tk_rawcc_vm_page_startup_initialized_vm_map_findspace_fdesc_read_sddump_nqnfs_serverd_nqnfs_getlease_portal_readdir_maxdmap_auxreg_ca_nextsibling_pmap_create_ifafree_if_slowtimo_svr4_stream_ioctl_nqnfs_vacated_portal_vfree_compat_43_sys_accept_sys_dup2_auxreg_cd_ip_mrtproto_sys_truncate_xdcintr_random_tcp_trace_si_vme_dma_eop_xdc_e2str_sddone_fdctimeout_fdc_debug_lfs_fastvget_insmntque_limcopy_ncr5380_cmd_timeout_ether_delmulti_st_loadquirks_sbdrop_shm_nused_sys___sysctl_amd7930_halt_input_nfsrv_wakenfsd_nfs_writerpc_count_lock_queue_m_free_vop_close_desc_psignal_am7990_setladrf_zs_ca_bsd_to_svr4_sigaltstack_nqnfs_callback_pppalloc_dk_ndrive_bpf_dtab_rtioctl_iommu_sc_amd7930_start_output_nfs_numasync_procfs_allocvp_zs_cd_rcons_clear2eop_segm_freelist_vm_allocate_with_pager_lfs_link_umap_bypass_lf_wakelock_nfsrv_create_igmp_slowtimo_useloopback_sys_swapon_bwtwoioctl_stmatch_rn_init_suser_lfs_truncate_fdesc_init_unp_gc_dvma_base_union_read_sogetopt_sys_sstk_vop_unlock_desc_kbdopen_cd9660_lock_xyc_perror_sdgetdisklabel_cdgetdisklabel_pager_map_wanted_procfs_vget_cd9660_defattr_readdisklabel_cd9660_link_memerr4m_xdc_remove_iorq_compat_43_sys_getdtablesize_svr4_sys_sysconfig_rcons_clear2eol_xdclose_nfs_bwrite_vop_open_desc_pmap_changeprot4_4c_ncontext_fpu_itof_vop_reallocblks_desc_sys_sendmsg_sys_recvmsg_vm_map_entry_delete_revarprequest_ripsrc_ip_stripoptions_union_newupper_vfs_opv_numops_swtab_in_localaddr_soisdisconnecting_nfree_msgmaps_xdr_inaddr_decode_union_seek_nlinesw_sys_getpgrp_vop_readlink_desc_vop_strategy_desc_procfs_ioctl_killproc_sys_sync_route_src_disk_count_xycmatch_vm_object_page_remove_ufs_bmap_statmin_syscallqdivrem.o_chattach_ip_reass_union_vget_kernfs_setattr_semtot_ffs_blkpref_vm_object_collapse_allowed_umap_node_hashtbl_null_node_hashtbl_sosend_sys_profil_getinoquota_elf_check_header_zslist_bus_map_ufs_open_procfs_dofpregs_lfs_bwrite_pv_changepte4m_tcp_saveti_oldpvec_umap_reclaim_procfs_root_portal_reclaim_mbtypes_amd7930_round_blocksize_nfs_clearcommit_lfs_vget_union_vn_create_cluster_wbuild_amd7930_set_out_sr_lock_clear_recursive_umap_print_ttstart_exec_aout_prep_zmagic_getdevunit_fdesc_link_softclock_audio_initbufs_si_vme_intr_on_scsi_prevent_mfs_bmap_nfs_start_nqsrv_send_eviction_sd_ca_ktrgetheader_vinvalbuf_umap_getattr_portal_getattr_cd9660_mmap_am7990_intr_xyread_nfs_fsinfo_portal_unmount_pffindtype_addupc_intr_ncr5380_scsi_cmd_sd_cd_sparc_interrupt44c_vpage_dqhashtbl_cd9660_deftstamp_vmspace_alloc_bpf_iflist_bpfopen_null_node_hash_vn_write_ptswrite_cgtwoopen_esp_switch_amd7930match_mfs_open_ttyopen_sunos_sys_execv_union_root_fifo_lookup_audio_backlog_rcons_delline_qsync_nfsrvw_sort_sl_uncompress_tcp_coreudiv.o_sunos_emul_path_ieioctl_sysctl_dumpentry_loioctl_svr4_sys_stat_xdstrategy_sys_stat_cd9660_init_physio_audio_rint_audio_blocksize_m_clalloc_proc0paddr_chkvnlock_ptcread_svr4_netopen_sdopen_fifo_printinfo_xldcontrolbidle_xysize_desirednfsrvcache_nexpire_vm_map_init_vrele_am7990_init_xdc_submit_iorq_procfs_access_proc0_vm_pager_allocate_procfs_validregs_compat_10_sys_msgsys___qdivrem_amd7930_get_precision_amd7930_set_precision_thread_sleep_spec_print_soconnect2_nfs_boot_getfh_ip_pcbopts_in_delmulti_npmemarr_lfs_mountroot_bufhash_semu_list_rpc_call_nfsrv_errmap_null_node_create_vop_lease_desc_qzero_sunos_sys_creat_svr4_sys_sigaltstack_ruadd_sys_sigaltstack_fpu_sqrt_mono_time_m_retryhdr_dqinit_cpumod_svr4_delete_socket_kentry_free_pmap_page_protect_p_nfs_print_uprintf_si_ca_vnode_pager_list_union_copyup_vmcmd_map_pagedvn_want_ast_fpu_stof_cgsixclose_pppinput_audio_pint_fdcstatus_nfs_getcookie_umap_reverse_findid_audio_silence_fill_si_cd_svr4_sigcode_sdunlock_cluster_write_cttyioctl_ptyioctl_ttybg_sys_getppid_esp_ca_sunos_sys_mknod_spec_nfsv2nodeop_p_fifo_nfsv2nodeop_p_union_islocked_maxproc_lfs_shellsort_bufinit_ncr5380_wait_nrq_timo_arpintrq_esp_cd_dumplo_xdmatch_ufs_setattrumul.o_kmembase_sys_mlock_sys_adjtime_nqsrv_maxlease_revarpwhoami_mountroot_isohashtbl_fscale_dvma_free_procfs_mount_sys_fsync_leattach_ufsfifo_close_nfsrv3_procs_nfs_rcvunlock_portal_enotsupp_null_vfsops_audio_ioctl_startprofclock_svr4_sys_wait_ktrgenio_espdmaintr_ufs_dirrewrite_issignal_mbinit_mmumod_nfsrv_writegather_udbtable_rn_mkfreelist_fdesc_open_cachestats_si_vme_dma_setup_stclose_powerdown_kernfs_badop_vop_islocked_desc_scsi_user_done_minphys__vm_map_print_dqhash_mfs_doio_sys_sbrk_audiostartp_svr4_sys_utssys_sa_hw_if_lfs_read_bpf_setf_audio_drain_ietint_vm_page_remove_indent_vm_object_lookup_nfs_remove_rn_lookup_ttyin_audiostartr_pmap_is_modified4_4c_allocsys_pmap_clear_modify_p_malloc_process_write_regs_audio_read_rcons_text_pmap_dumpmmu_getpropstring_ufs_init_nfiles_sunos_sys_ioctl_holdrele_iso_nchstats_svr4_sys_execv_svr4_sys_poll_wzero_fdcswintr_if_qflush_union_access_cgsix_ca_xyc_chain_portal_quotactl_fdesc_lookup_pgrphash_config_init_cd9660_fifoop_p_si_find_incore_foundfpu_route_dst_procfs_sync_procfs_donote_maxlockdepth_cgsix_cd_kernel_regmap_store_sys_mkdir_iewatchdog_ipsendredirects_sloutput_munmapfd_cdunlock_lfs_writeseg_nfsrvw_procrastinate_va_null_fubyte_svr4_sys_vhangup_prom_vend_zdmap_vm_page_rename_nfs_rename_unp_attach_logread_svr4_sys_putmsg_amd7930_set_port_lfs_remove_ufs_access_nfsrv_lookup_pppioctl_ierint_fd_set_motor_ttyinfo_ttyoutput_lfs_vref_nfsspec_write_null_unlock_nclruhead_spec_write_ev_select_sw_options_vfs_unbusy_vm_object_shadow_mfs_init_ptsstart_ttylist_v_putc_vm_sysctl_svr4_ustat_si_free_ttyfree_ncr5380_wait_req_timo_swbuf_svr4_sys_creat_addupc_task_msgbufmapped_ttwrite_longjmp_vm_object_pmap_remove_fdesc_start_raw_usrreq_nfs_write_dqfreelist_procfs_fhtovp_log_open_svr4_sys_time_si_obio_dma_setup_ifunit_xy_casdiv.o_tundebug_svr4_sys_mknod_lfs_rename_compat_43_sys_sigsetmask_sys_mknod_cd9660_bmap_lfs_writeinode_tcbhashsize_tunclose_bpfread_umap_mapids_compat_43_sys_truncate_xy_cd_chkiqchg_ufs_lock_svr4_sys_break_pmap_enu4_4c_lfs_sync_sys_pipe_cd9660_statfs_fb_pfour_id_kvm_uncache_iszerodev_ufs_link_dounmount_sys_read_ether_ipmulticast_min_iematch_fdcmatch_mfs_mountroot_procfs_doregs_disklist_acctwatch_cd9660_open_ch_switch_rip_init_ifa_ifwithnet_sunos_sysent_pmap_zero_page_p_tty_attach_setrunqueue_rcons_delchar_espintr_tcp_newtcpcb_vm_map_remove_sunos_sys_statfs_ufs_vinit_nfs_inactive_ktrsyscall_vop_remove_desc_ether_ipmulticast_max_ms_rint_vfs_unlock_kernel_segmap_store_cd9660_rrip_getname_am7990_watchdog_amd7930_get_out_sr_lock_wait_time_ipip_input_sockargs_tprintf_cd9660_islocked_xdioctl_arpioctl_portal_lookup_lf_getlock_bwrite_si_vme_dma_start_sys_writev_si_head_fdesc_print_audioread_svr4_sys_fstat_nfsrv_null_xdr_inaddr_encode_vfs_getuserstr_portal_start_sys_fstat_memcpy_svr4_sys_ioctl_xyc_remove_iorq_amd7930_query_devinfo_sys_ioctl_kmeminit_isodirino_st_space_nqnfs_clientlease_union_quotactl_procinit_ffs_write_consintr_boottime_cgeight_ca_pmap_clear_modify4m_kbd_rint_fdesc_readdir_sunos_sys_mount_cgeight_cdstrcat.o_ch_position_ifnet_addrs_sys_getegid_ufs_mmap_rpc_reply_ifioctludivdi3.o_makememarr_esp_msgout_procfs_bmap_lkmexists_vop_truncate_desc_kbdread_cgthreemmap_raw_input_ptcclose_memerr_cputyp_idprom_bootpath_amd7930_device_m_devget_zstty_ffs_blkatoff_nfs_blkatoff_pppoutput_sys_ptrace_suiword_svr4_stream_ti_ioctl_vm_page_buckets_consinit_rcons_puts_procfs_open_hashinit_xd_ca_vm_pager_atop_ffs_cgupdate_fpu_xtof_reset_vif_sun_noname_ttrstrt_swap_pager_list_fdesc_abortop_sbcompress_sleep_selwakeup_xd_cd_virtual_avail_swap_pager_free_ifa_ifwithroute_pmap_enu4m_amd7930_get_encoding_tcp_ctlinput_allocbuf_runtime_ch_move_ldcontrolb_route_proto_portal_print_probeset_sunos_sys_vhangup_pmap_enter4_4c_ipforward_rt_rtalloc_process_write_fpregs_nfs_vfsops_cgtwommap_vnode_pager_setsize_si_obio_dma_start_cpu_set_kpc_xdc_reset_nfsrtton_inetsw_rt_newaddrmsg_union_ioctl_m_prepend_strayintr_cd_read_toc_scsi_size_vm_object_hashtable_total_pmap_clear_reference_p_nfsm_uiotombuf_buffers_espreadregs_iskmemdev_fdesc_targets_compat_43_sys_getpagesize_intrcnt_cd9660_vptofh_audioioctl_am7990_stop_mmu_3l_ufs_ihashinit_realitexpire_xymatch_nfsm_rpchead_procfs_validfile_dk_wds_st_ca_svr4_sys_xmknod_nfsrv_link_rip_output_vn_closefile_exec_aout_setup_stack_wcopy_iommu_print_sdwrite_tcp_now_vop_whiteout_desc_vop_mknod_desc_vaccess_st_cd_pmemarr_vm_object_enter_rt_setgate_in_canforward_rawcb_ffs_reload_lfs_vfsops_pgshift_maxsmap_sw_ca_union_lease_fdesc_write_lkmclose_amd7930_trap_in_pcblookup_nchash_sw_cd_umap_node_create_svr4_sys_fpathconf_pmap_clear_modify4_4c_romgetcursoraddr_soo_ioctl_sys_fpathconf_sbus_ca_kentry_data___moddi3_cd_set_mode_union_advlock_acctchkfreq_spec_lookup_scsi_inquire_lfs_inactive_lfs_no_inactive_nfsrv_noop_sbus_cd_sunos_sys_lstat_trap_type_vm_pager_init_nfs_unlock_fdesc_reclaim_vm_pageout_cdwrite_swapinit_vgone_firstchild_udp_sysctl_setregs_sigcode_segm_lru_cp_time_sys_mount_vhold_ptcwakeup_sys_nosys_pgrp0_cgeightopen_ufs_rmdir_null_bwrite_ticks_ether_addmultianddi3.o_cd9660_sync_want_resched_sbusreset_igmpstat_rcons_cnputc_emul_svr4_slioctl_bpfioctl_fdesc_unmount_cache_purgevfs_itimerfix_shmsegs_svr4_sys_utimes_pmap_rmk4_4c_swappagerops_nfsrv_zapsock_nv2tov_type_udp_input_sys_utimes_ffs_fragacct_ipqmaxlen_remrq_compat_43_sys_sendmsg_compat_43_sys_recvmsg_cd9660_quotactl_pmap_protect_p_vm_pager_has_page_tcp_timers_fdesc_inactive_unp_connect_setroot_lfs_match_tindir_semundo_clear_logselect_pfind_inside_udp_ctlinput_unixdomain_ktrpsig_qcopy_tcp_iss_fdavail_probe_switch_dqsync_nfsrv_init_kernfs_vfsops_cd9660_specop_p_if_attach_dma_isintr_vm_map_reference_udp_usrreq_naudio_power_ca_probeget_kprintf_mem_no_nfs_setattrrpc_sys_unmount_vop_bmap_desc_ccdioctl_power_cd_vm_map_inherit_lfs_blkatoff_procfs_init_lfs_close_sysctl_iflist_compat_43_sys_getpeername_sys_getpeername_compat_43_sys_creat_cd9660_enotsupp_stopprofclock_sys_getfh_ulmin_loadav_rn_search_m_svr4_emul_path_mfs_inactive_ufs_inactive_union_mount_fdmatch_dev_pager_list_ifconf_nullfs_statfs_elf_copyargs_romboot_object_bypasses_sys_geteuid_vm_object_count_idle_u_rcons_bell_st_rewind_ulmax_async_daemon_st_quirk_patterns_scsi_quirk_patterns_tcp_mss_null_islocked_ffs_vfsops_compat_43_sys_setreuid_audio_close_npagers_vnops_nqnfs_lease_updatetime_fuswintrskpc.o_m_gethdr_brelvp_lock_write_nfsrv_symlink_breada_linesw_cd9660_read_panic_openpromclose_cgfourmmap_fdesc_vfree_fdesc_getattr_mixer_ioctlstrcmp.o_fbclose_chclose_unp_dispose_audio_clear_cgthreeopen_cd9660_rrip_getsymname_xyioctl_ttysleep_kbd_ascii_breadn_vm_object_remove_pmap_removeashldi3.o_mmopen_vm_page_unwire_nfsrtt_union_fsync_prtactive___iordi3_svr4_sys_lstat_sdstart_sys_lstat_vndstrategy_assert_wait_m_get_fifo_select_fifo_badop_ncr5380_abort_in_losing_siginit_virtual_end_cd9660_seek_amd7930_getdev_tty_detach_vfssw_nexecs_vmmap_kmap_free_rpc_auth_kerb___umoddi3_putphysbuf_m_adj_xdc_start_st_load_raise_lfs_check_config_rootfound_ttcompatgetflags_stattach_cd9660_vget_nfs_writebp_procfs_link_m_cat_sys___semctl_compat_43_sys_fstat_kbd_repeat_start_mfchashtbl_scanc_max_linkhdr_msioctl_amd7930_start_input_logclose_panicstr_sbus_attach_getvnode_disk_attach_am7990_meminit_nfsrv_remove_tcp_usrclosed_lf_addblock_cache_lookup_mainbus_match_amd7930_open_brelse_pmap_enk4m_cdstart_fdstrategy_vm_object_cache_trim_rn_search_stop_in_pcbnotify_union_dowhiteout_null_bypass_crcopy_sys_sendto_tcp_xmit_timer_mbstat__remque_ufs_ihashrem_nfsrv_read_nqsrv_unlocklease_igmp_init_netisr_sys_flock_romhalt_in_addmulti_union_mkdir_kernfs_open_bdwrite_ttselect_sys_rename_fifo_ebadf_pffasttimo_sys_msync_biowait___one_cmpldi2_dma_reset_pgdelete_svr4_netattach_svr4_ttold_ioctl_sun_dkioctl_dma_enintr_sdattach_nfsm_srvfattr_limit0_vput_etext_lfs_flush_ifa_ifwithaf_kernfs_xwrite_vn_select_logpri_lfs_bmapv_cache_purge_sunos_sys_fcntl_pmap_extract4_4c_rcons_init_ffs_setblock_nfsfifo_close_fifo_close_spec_fsync_nfsrv_rename_vndthrottle_swapconf_kbdioctl_quotaoff_cd9660_root_vref_sys_connect_netcon_boothowto_pmap_phys_address_pmap_page_protect4m_pmap_startup_dqget_lfs_fsync_nfsm_strtmbuf_hostid_sys_setpgid_cd9660_vget_internal_m_retry_nullfs_vptofh_ncr5380_intr_raster_textn_vm_page_bootstrap_ufs_dirbad_ppp_compressors_m_getclr_q_to_b_trap_ufs_start_soreceive_exit1_sys_getitimer_oldmon_w_cmd_kmemusage_nam2blk_xyc_tick_union_mknod_cpu_ca_bzero___negdi2_sunos_sys_unmount_cgfouropen_maxslp_around_rn_addroute_ptcselect_ttydefchars_fuword_statintr_putc_execsw_swcleanlist_null_print_kernfs_mount_ifinit_cpu_cd_msgpool_cgeightmmap_netcls_crfree_cnioctl_fdioctl_nfsstats_relookup_procfs_inactive_ieintr_bucket_compat_43_sys_setregid_dma_setup_ufs_ihashins_union_copyfile_lfs_markv_vn_default_error_ncr5380_init_pmap_zero_page4_4c_scsi_get_xs_amd7930_set_encoding_mapdev_sys_lseek_sys_select_audio_ca_vm_page_queue_active_mmmmap_sys_close_vndstartstrlen.o_sysvshm_map_audio_rpint_audio_cd_shutdownhook_list_sys_semget_svr4_sys_waitsys_ufsspec_write_nfs_xdrneg1_union_statfs_portal_symlink_vop_access_descstrncasecmp.o_cdattach_scsi_donestrcpy.o_cn_rxc_out_fdc_lfs_mkdir_nameiurem.o_kernfs_xread_lbolt_ieinit_nextgennumber_umap_rename_lfs_ifind_slinput_sigexit_unsleep_compat_43_sys_gethostname_nfs_getcacheblk_dqrele_ufs_print_nfs_reconnect_fifo_unlock_lkmioctl_compat_43_sys_sigblock_swstrateg ... . ..boot[0bootxxbinstall  ...@; ) @  ` (  2 "" 2     * " @@ @   `@ @ "`" ?* ?*  @(`  (02 @  "J@J`2J@  J " @(` @ *  J@   J@J`  H" @ J2  @*`  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J@  "  J@J`   8  *  8  *  4  &  4  & @'Ā  "@  /-? 耦 Ā 2;  0ؘ'7477477477ܑ477`A ڸ? 28```@@`*  @@ `*  @@`*  @Ā  @Ĕ ;--`2 @- ,`ˑ2 @ ĺ` `"` '``? '8  . ?2 ? '`" * #@'.`@ '  @`@?  ``'7@, @7@@͒,  ( ?#   . ?@, @@ "@"@4@6`#?# "6` 5 . * @? @ @ 4@6`5`5 @  Ā '   " . ? * :@ @2. 4@đ*  *`@;Α*  Г*`@ +     ( 8 2+ ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@44 44 444 l44 44444444   4&`4)4*44*4*4+l444h4 $4 ,4 4@` 4y0123456789abcdef/p84 `@# ` !Ф" $@` `T@ " a@"@  "c0  0  " 8 " D * " > NetBSD BOOT [%s] netbsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@@` !x @   ` L@ %   % + / -   c@{ @M 2%c @r!@M 2@   @   a@_ $ ! @V@@-Bad format %d+%d+[%d+%d]=0x%x boot: short read x%@/ < ?@ ?# @!2?3 a/?@ ?# @!% a!?@ ?# @!  a ?@ ?# @ 2   `"  "p @"?@ ?# @! "` a ` @ ג܀ 2 @?@?# @! a ?@ ?# @!" a  @" .@`@2.@ "@@  2b @@  .@  `耢 8@ ` @"@ 耢 2? @# b,@ x  5 @ה b,   ?`@ g2$ @ "@e ` ?> " "@[@   8  #0     Āb00"@E  promprom0㿘  8  @ #0 (*  "# @" "`K` -  * K     J  8*   b"K  *K ) K  * #0` ` " @ `&J@ -" @   *:  d` d s aJ@ J@  #` @"J@  @Can't open device `%s' Can't open network device `%s' 㿘@   `8 ` @w  $  !` #0`  #`#`$@2$   $   l$   # @| 0+% @ː $ &  2  !X a@ɔ @]  @a 0!@ a@   `8` H $$ 㿘# c0   ` ༟* `c0   '@`20,6 * '@ 㿘  @ߒ& & $& (`   €@ " '@ 㿘 ` @@  #0` (`(`@0@ 㿘   @@  & ? $  P*@ 㿘 #0  4㿘 #0  8` @xmit: not a network device 㿘 `,  @ ?@a`@i`?㿘  ,@K €@T㿐 0`  #0  #0O`P/O O /O㿐 #0     O ?X/O O /O㿐 #0  / 0T@㿘  㿘 #0 t㿘@ @`t㿐 #0    X #0 p%x mac-address drop swap 6 cmoveX  8 #   b耢  b  Њ@*@` "@< 0c0` `€0  c@c0 |@ielefdxyxdstsddevice_typeblocknetworkbyte㿘 #0` ! `@ @X`Ȱ @S`؀ '  @K`   @C`耢    x` xN@J2N`J@" 2 node %x property %s length %d > %d 㿘 #0 `€  `  !@N 㿘 cޖ ??" *Invalid controller number prom_iopen: "%s" error=%d 㿘)  T ?C   @ #@ 8$ $  $ $`  @"* @ *`@`@G $0` "`@$4` " @ $ @ &  T  % T@"ذ 㿘# `T    @ 4 "$`T@ & 4$`Tprom_mapin: length=%d prom_mapin: invalid maptype %d 㿘  <* @  x@. !0          @     !4  <<  D@;@ ?*@Ԣ &@ `  @ !4 @  H 0?( , H L\ T ` X` P d l  t$ p   P*?  8Ĉ`Ī` Đ`IJ`  dvma_mapin㿘? #@(1? @ "1?dvma_mapout㿘 #@(1 @ "1㿘@ " ْ㿘 @ 㿘  X  @   "a8   @0 `X "`X㿘 `X ? "`X @z!8boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' @08?7 ! !x @ *'@ @8 )   @ @ a8 `X# b 8@b  ! b `@ '@ b8@%'      2   㿘     @W   `" $    "`?    ?   㿘 ;  < 㿘  `t @.2  '" ?$Revision: 1.4 $pؐ@ @ 8 $@`@ y    #\ $#`ab  @`?    H 2 "`@ Y  "`?㽠Px@Ȓ @ H @ 8 `$@ >$`      h#\#`ab  @ƚ`$?   4  2  @   $0@  D nfsread: short packet, %d < %ld 0ȴ @  $'$&`$&`( L#\$L#`ab  @ ,?  `"" " H@L@ ݔ0   @ x  H"`?㿘@   "`!"!6 & 5@ 2 ? "0""0 "`0!"`4"`8 ?nfs_open: must mount first. 㿘 "0  @ <"x @ x "0$  < "0<@ x0&` 㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' # ! % @    W? `   @ H ;  @ B > & @ 2&       D": 0 0  @C :  ` : ??0  04 (2`:2` <"` @"`D :`0 㿐` @z0@ z`@ย@༠,@@|@:@x`* d` , 00@ @ x*`  @>  ?*```" ?% Ȑ@U0㿘 ` .` 8Z& , @&@,J G&F @ h`, &, @`0$ @   d,@``  ,@ `0  2 , `0@ӑ," ,  @  @1 ,`& 㿐   < @ /P 40P* :  8  20 8 0< @D@L @ Ȁ(r 2: @0$  " @  d   *   Ā 0@$ $  &@$@&   b 8   @   " & 㿐`@0  +<@ 1 "  2  @)  2 & * @@ B <@`@@8Ԑ@2 ``@̐ 㻀  @" Ц@% &`@@ $` `  찒`@2 %\F!T@  0@eg`0 @   @ t,   "  'g` @ ~7<`/2L@`L@ /"`L@ "q   Ӓ  ``d `L@  /,@Q谒W,@5R` ( 2GL@@q $C  @`@ $%(`8@ 0 U䰒)`@ ` d ` *  0ఒ@O /' '`L@  @ `@x 0 @s Ё㿘  &  .  "  @b`0  .  "  @W`0 @T@Q Ё 㿐% `@@8 ``@N@ @@ B <@߲@2&     ":0 " 0 @C : ` :??0 2`"` "`:`0 㿘  * &  * & %L?2%, &%P%, %  0 :* * ?: >%0 t:   @   %0@ C >%0 H8: >%8 L8: >%@bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p(0ФXa"'А ''ؐ 'ܐ' !x'@В S? a?"a4 ?$#\!#`ab  @#@  @ 7?# `! @ 4 `'ab@    @i?'  " a@{ ?  " a@p ? @``  4''  a@G 2B?@ Ӑ@= 28? a?"a6   &#@#\"#`ab  @a   H"`?' '@$ ?@F  ?#'@` 㿘 `&"@ &@G 㿘`&@  @&@4.@& @"  #d d  e  f g  #" ?+d +e+f+gd"@ #rarp: bad socket. %d No response for RARP request   !@E?@ h .Ɛ 7Ɛ(7Ȑ /ʐ /ː 7̠@ܔ @ؔ  4#\ b . "@H~  @g! ?! !x@ !x   ? !x0   ??"b !x$ 㿘 0 @L 5㿐@[ "   5@2?@ 2?`(2?`&2?` ` ? @ $  ?callrpc: error = %d 㿐`@?;6 '?'??@ Ւ  '?ܐ '?? b( "b('?'?Ȑ '?'?'?'?\@"#\ b $   @? @`` `2 `"@ɐ#p  H"`?recvrpc: reject, astat=%d, errno=%d 㿘 " @ $?@ "(@2?``2 ?`` ` "  @ ??"@?2  (  ( 2  2 2 *?      ( @""@" " " getport: %s㾐a"@1 o'?' ''''p#\ #`ab  -   p'0 ! @a  @!"H H$ ?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorUnknown error: code %d㿘`V  *`@4:l4:x4:4:4:4:`4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:$4:04:<4:H4:T1 ,#81 )#P1 &#h1 ##1  #1 #1 #1 #1 #1  1  1   H1  `1  p @(`x p㿘@       2  2  ᬄ` ` "  " ᨝㿐. *  ! @@ 2  $"` "'@       "`    "`&?㿐  ! " `     ?"`$$ $ '23$   * "J    $" @$  !p@` !' .`* @€`p@.``" $ " ?㿘  - ` ".` 0.".,.&```""#..* 0?$ "   0 @̠L  0İ 0  0sendudp: bad write (%d != %d)x@  <* @*@@ &6 . . &&@ 6 6 66'''''@ܒ 6@6&&&&&`  "  @ @   'ܐ@ܖ@(@? "@Dreadudp: huge packet, udp len %d x@טް?} {ހ( (` u?@zp?2n?@<  2g?` 2c?@.\@| 2X?V`&T? `` 2L? @@ה& 6` &` @2=?` "5`T` %  @b/?@'`'`'` '`'@/ `6` @>  &@&`&`&` &`&@&`&`&` &`` ??sendrecv: short write! (%d < %d)㿘\   )  <+  % (?@@b@, 4 2     $@$Ӧ`l *`Є  * (Ї8  *`J. 64 "2/?`"8" ?#   `(?`(d(  `(d(h( ?#㿘@㿘1  .  . ?@ /  0.@ Ȓ ?@ %  0.@   0?.?.`4 "@  Ї((*8"@  Є (@㿐 1 N -* N # .! Ւ* ? N  . ƒ*`?# @N  .    J@?   `&     ,` ` ` (   `߀` ܗ(2 :?# :* arpwhohas: overflowed arp_list! arp: no response for %s @'l  ! "@6  l "?`@   b  "b @ 8@ .ƒ 7Ɛ(7Ȑ /ʐ /7̐`@ `@ l@ l& 4#\ a . "a~?2  l'hh @ `  @Ք  b "b㿘 0@s(㿐@ " (2(?@ 2$?`(2 ?`&2?`  @?2? "* @*` !@`@A  ?㿘@ 0`(,`&(` $` @%   6```@k `@f  @b @^  .@(㿘 @O @K 6? ??㿘?  @ݔ    "0@֔  "` ?` 7? Ȓ   : 0 (  ( (``(  Ȁ   @ ? *@0 *@ ` 㿘'H'L'P'T'X ` 2 @"`@H @s!Mexit㿘 !㿘  !, *  " @   , 㿘. *  !@  @ 2  %"` 2  " @  `  ` @`$ "   " ? ` *@㿘'L'P'T'X! $  #H@L *㿘'H'L'P'T'X "@ H㿘 "@8  T  N@ %` N@? `* 4P4Qp4Q4RP4RP4RP4RP4RP4RP4RP4P4RP4RP4Q4RP4RP4RP4Q4RP4R4RP4RP4R0 L@`@p ϒ L@?,` < ,L@`L@  L@L@ 4`L@ `` >0 L@ `L@ `N@  - @- N@@% N@@ ~N@@ vN@ %`n lj0123456789abcdef㿈 "@ , @ ?L?|/-\㿘 `" ` "J@  㿐@a㿘@W   *  @ *   "@ @b  88  b   㿘  `  `  @4 0%@/  & &@*&& @@ "   ` 㿘?c @ 6 @o6` `B  & $ @*&@$@@W@S2  *   , "@@ 4 "  "  ,`@@ 4`   ,@@ 4  @@*  㿐  `  ` @` ?2   2@  *2  ?*@   *  2@*@  㿘  `  ` @1  `  &  4 @ *    ?: : 2@  *:  ?*@   *  2@*@    B 'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`884 `@# ` #" $@` `T@ ! c@ے"@  "b`  0  " 8 " D * " 0 L@ `L@ `N@  - @- N@@% N@@ ~N@@ vN@ %`n lj0123456789abcdef㿈 #> , ֒ ?L?|/-\㿘 @`"@ ` #J@ 4X44@4D4H4P44@44H   44 4L4 #4 *434>4D4@M4`V 4Hc4m4u4~444p 4L44H 4`4D444H444 4  4d( 4h1 4B48J4DS4D`4g4q4@|484 4`4P4x4 44 44<444 44`44 44 p 4  4# 4*4P1484A4P4b4@l4@{4@444 404t444 4|444("4 )4 84 J4 {4 4 4 44 4 4+4`34H<_dvma_mapin_block_count.urem_bcopy_devopen_obp_close.udiv_pgofset_sprintf_netif_debug_freelist_printf_putchar_obp_strategystart_prom0_iclose_io_twiddle_prom_ioctl_promvec_prom0_close_closeall_vprintf_block_size_prom0_strategy__rtt_dvma_init_dvma_free_prom_boothow_prom_si_prom_bootdevice_cputyp_pgshift_prom0_iopen_panic_progname_prom_open_etext_bzero_prom_init_block_table_ndevs_dvma_mapout_loadboot_errno_nbpg_exit_main_free_debug_close_alloc_edata_end_dvma_alloc___main_prom_bootfile_files_devswsrt0.obootxx.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.6_bootstore.7_prom0_fake_saveecho_pv_putchar_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.32dvma.ogcc2_compiled.___gnu_compiled_c/usr/src1/sys/arch/sparc/stand/lib/kern/__main.o/usr/src1/sys/arch/sparc/stand/lib/kern/bzero.o/usr/src1/sys/arch/sparc/stand/lib/kern/urem.o/usr/src1/sys/arch/sparc/stand/lib/kern/udiv.oalloc.obcopy.oexit.ocloseall.oclose.oprintf.o#!/bin/sh # $NetBSD: binstall.sh,v 1.3 1996/04/07 20:00:12 thorpej Exp $ # vecho () { # echo if VERBOSE on if [ "$VERBOSE" = "1" ]; then echo "$@" 1>&2 fi return 0 } Usage () { echo "Usage: $0 [-hvt] [-m] net|ffs directory" exit 1 } Help () { echo "This script copies the boot programs to one of several" echo "commonly used places. It takes care of stripping the" echo "a.out(5) header off the installed boot program on sun4 machines." echo "When installing an \"ffs\" boot program, this script also runs" echo "installboot(8) which installs the default proto bootblocks into" echo "the appropriate filesystem partition." echo "Options:" echo " -h - display this message" echo " -m - Look for boot programs in (default: /usr/mdec)" echo " -v - verbose mode" echo " -t - test mode (implies -v)" exit 0 } PATH=/bin:/usr/bin:/sbin:/usr/sbin MDEC=${MDEC:-/usr/mdec} set -- `getopt "hm:tv" "$@"` if [ $? -gt 0 ]; then Usage fi for a in $* do case $1 in -h) Help; shift ;; -m) MDEC=$2; shift 2 ;; -t) TEST=1; VERBOSE=1; shift ;; -v) VERBOSE=1; shift ;; --) shift; break ;; esac done DOIT=${TEST:+echo "=>"} if [ $# != 2 ]; then Usage fi WHAT=$1 DEST=$2 if [ "`sysctl -n hw.model | cut -b1-5`" = "SUN-4" ]; then KARCH=sun4 else KARCH=sun4c fi vecho "Kernel architecture: $KARCH" if [ ! -d $DEST ]; then echo "$DEST: not a directory" Usage fi if [ $KARCH = sun4 ]; then SKIP=1; else SKIP=0; fi case $WHAT in "ffs") DEV=`mount | while read line; do set -- $line vecho "Inspecting \"$line\"" if [ "$2" = "on" -a "$3" = "$DEST" ]; then if [ ! -b $1 ]; then continue fi RAW=\`echo -n "$1" | sed -e 's;/dev/;/dev/r;'\` if [ ! -c \$RAW ]; then continue fi echo -n $RAW break; fi done` if [ "$DEV" = "" ]; then echo "Cannot find \"$DEST\" in mount table" exit 1 fi TARGET=$DEST/boot vecho Boot device: $DEV vecho Target: $TARGET $DOIT dd if=${MDEC}/boot of=$TARGET skip=$SKIP bs=32 sync; sync; sync vecho installboot ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV $DOIT installboot ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV ;; "net") TARGET=$DEST/boot.sparc.netbsd.$KARCH vecho Target: $TARGET $DOIT dd if=${MDEC}/boot of=$TARGET skip=$SKIP bs=32 ;; *) echo "$WHAT: not recognised" exit 1 ;; esac exit $?  . ..Atlantic[,Central East-Saskatchewan Eastern Mountain   Newfoundland[ Pacific  Saskatchewanx/DYukon 񫠚0`#P@00zV@0SR<@4@:0@0@0E@U0@Kp~@$0n`@NB@0]@1@0^G0@P0mp@00r<@b06n~P`ˈ``u@U 5|u`W{`ݩtP޾]`߉VP?`i8P~!`IP^`(PG'챾`Po`_kPOj`?MP/L`(i.`KJ-,wpP``PP@`0P ` P ` xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%``LMTADTAST @2SC <  @@p\X<@`bT U2S 4d(PA2SD#F2SD&62SD'c2SNA2Szr2O{2S{C2SXA2SEe2SE /2SE!2Sdmr2Sz2Ox2S{ S+:2Sm%2Szr2Oy2S{߀2Sm 2Sz2O{2S{f2SAm2Szu2Of2Se2S$2Szu2OY2S2S$2Szu2OY2S"2S$w2Szu2OY2S$s2S$2Szu2OY2S /2S$U2Szu2OY2S&62S$ 2Szu2OX2S82S$2Szu2OY2S(2S$2Szu2OY2S.}2SAm2Szw2Oj2S2S,$2Szw2OW2S 2S.$:2Szw2OW2S,2S0$72Szw2OW2S /2S2$x2Szw2OX2St2S4$2Szw2OW2Sf2S6$ 2Szw2OX2Sp2S8$2Szw2OV2SI 2S:$q2Szw2OW2S82S<$2Szw2OX2S% 2S>$2Szw2OX2S>2S@$\2Szw2OW2Su*2SB$x2Szx2OP2SN2SDA2Sz}2Od2Sܓ92S$I2Sz~2OH2S]J2S$D2Sz~2OH2SX;2S$2Sz~2OH2S 2S$Z2Sz2OH2S沀2S$p2Sz2OH2S2S$Z2Sz2OH2Su*2S$V2Sz2OH2Sp2S$_2Sz2OH2S2S$l2Sz2OH2S( 2S$2Sz2OH2S$[܀ 2S$2Sz2OI2SG 2S$2Sz2OI2S-L 2S$2Sz2OI2S0G 2S$2Sz2OI2S3B2S$ 2Sz2OI2S2S$2Sz2OI2S2S$%2Sz2OI2SÀ2S$2Sz2OI2SĴ2S$2Sz2OI2S h2S$l2Sz2OI2S X2S$2Sz2OI2S߀2S$p2Sz2OI2S2S$_2Sz2OI2S 2S$2Sz2OI2S]J2S $2Sz2OI2S82S $2Sz2OJ2Sр2S$82Sz2OJ2S 2S$2Sz2OJ2S'V2S$2Sz2OJ2S+2S$2Sz2OJ2S.}2S$2Sz2OJ2S2b2S$2Sz2OJ2S!` 2S$a2Sz2OJ2S8C!2S$I2Sz2OJ2S:i"2S$l2Sz2OJ2SÀ#2S $2Sz2OJ2S]J$2S"$2Sz2OJ2SX;%2S$$2Sz2OK2S &2S&$Z2Sz2OK2S '2S($I2Sz2OK2Sv(2S*$l2Sz2OK2Sf)2S,$n2Sz2OK2SW*2S.$x2Sz2OK2S4΀+2S0$Z2Sz2OK2S(,2S2$I2Sz2OK2S!-2S4$2Sz2OK2S#F.2S6$m2Sz2OK2S)'/2S8$O2Sz2OK2S.}02S:$2Sz2OK2S3B12S<$I2Sz2OK2S6=22S>$2Sz2OK2S8ـ32S@$I2Sz2OK2S42SB$2Sz2OL2S52SD$l2Sz2OL2S62SF$I2Sz2OL2SX;72SH$2Sz2OU2S 82SJ$2Sz2OU2SI2SL$2Sz2OU2S;2SN$2Sz2OU2SW<2SP$2Sz2OU2St=2SR$2Sz2OU2S>2ST$2Sz2OU2S#*?2SV$2Sz2OU2S&6@2SX$2Sz2OU2S*TA2SZ$2Sz2OU2S/qB2S\$G2Sz2Ob2SC2S^$ 2Sz2Ob2SX;H2S`$ 2Sz2Ob2S S+L2Sb$2Sz2OV2S% G2SdA2Sz2Oc2SI P2S$!2Sz2OX2S !Q2S $2Sz2OX2SvR2S"úP?p ;Oˈa ӈhS`U 5\ޗݩp޾y߉rp[iTp~=I6p^)pG<4'o1bJggII++ wq pa Pp@0p π p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~ACDTCST7MeO0HE1*% 0pp `raQ8`1!p `p`ˉ acSoU 5Ðޥݩ޾߉iib~KID^-)&GJC',%P LMTMDTMSTCSTdp1`X袔 _s>S-ގpp܍pR诼SP~5Pg.@|PG@[P&@;P@$й@лнĝпox„aOZdC/p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTEST M҅萣jʐ5ÀS3ˉ aU uX9aP@0ހ ݐ  ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OLMTMDTMST b~8TdTtddT^DT=$TTfTݟ͂ԯ䰭dԱdFԳdm(ԵfbdM ԷFDd,Թ&&d TBT$TMt߸x(–X(v8b(_8D(?8`8Bˣ85(|8Z(@j!HӈDJHh&)HH H'HXtXݩmH޾VX߉OH8Xi1H~XIH]X(HG&챷ƠHﯽXHXHoX_dHOcX?FH/EX(b'XDC&%wpH`XPH@X0H X H X qH pX ٍ RXonQPy3i2YI8("HHXHXHXH u!~H"U#j$5%J|&'*^'X) @)ސX*"+rX,?H-TX.!H/~6X0H1gR2rH3G44RH5'62H7889:Ƽ;ۉX?M@oXAjHBOXCdLHD/aXED.HFCXG$HG_IHIAJHK#LMNOwPQaXRlS@XTLxU XV,ZWXXwHXXYYHZnX[;H\]H^l_H`iNa~bI0c]d)e=f/XggXhiXj݅kXlƢHmXnHoqXpfHqZrfHHs:tF*Huyv/Fv[x(x=y z{|?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]PDTPST{˰# Ҁˉ(( hir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]p YDTYSTPSTPDT . .. Pacific-NewAlaskaAleutian ArizonaCentral East-Indiana[EasternHawaiiIndiana-StarkeMichigan Mountain PacificSamoa H*ˉa&t ؀Ѡ޳ݩ޾߉wip~YIR^;)4GX Q': 3   qޠo_O?/(f fe HG *)  x q(a'Q A 0C ΐ ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]PWTPSTPDTˉ6aB0Gc@F0E@(0x'@qDaCQ&A%1_  @ ̰ 0 0@0@y0i@Yq0Ip@9S0)R@"o 4@QB%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k s`ps` ppCATCAWTAHSTAHDTAKSTAKDTˉDaP@UqPT@SP6@x5PqRaQQ4A31m  P @ @P@Py@iPY@I~P9a@)`P"} BP_P32 vG@!ٰ"V)@#j0$6 @%J0&@'*0' ) 0)*~0+,Ӛ-.|/~0^1g@2s@3G@4S"5'r@637T@8!086@90:@;0<4=0>?0@oAŰBOCdD/EDFG$kG@IMI؝@J/K@LL0Ma@N.0OxC@P0Qa_Rl0SAATL0U!#V,0WXҰXYZ[Ֆ\@]x^@_Z`i@a~w0bI@c^Y0d)n@e>;0fg0glh0iNj0k0lmn߰oqpq[@rfs:@tFu@v/0v@x0xڙ@yf0z{@{H0|}*0~y 0ePs`ePs` s`pNSTNWTBSTBDTHASTHADT :ˉ uXMWTMSTMDT,pptEҀcSp3ޕwaYC~;_gXp|AG:p\#'p<p瀹ppZހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A CWTCSTCDTEST!,ppW"Gpˈa u@U 5sޗݩp޾y߉rp[iTp~=I6p^ CWTCSTCDTESTEDT p`p`epjp5`S`3އpiRK௳4~-౜QpgJ`|3pG,`\p'`;p`p`ƴ`Ĺ𿏲o„}Ovd_/XM|p:-^pW` @p9`ˈp`u@U 5peމpݩ`޾kp߉d`MpiF`~/pI(`^pW.G-7'ֶƵ`p`p`op_y`Oxp?[`/Zp(wp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEWTESTEDT CH ˉ=aI8ՍsHlXzhzhs`HSTHDTHWTX,ppˈa U 5sޗݩp޾y߉rp[iTp~=I6p^Wp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p% LMTCSTESTEWTEDT :逢eEˉ a/v(XvuXW:9wqaP@0ހ5   ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OMWTMSTMDTb8U+00_^HePeP ePLMTSSTNSTBSTu 00'} ivgXI|: l+!\"L #;$+%& '@'@(P)xP)@*@+@,@-@.@/tv@0dg@1]2M3=t4-e5V6 G687)89 :;(@<@= @>@?u@@e@AU@BE@C5@D%@E@F@FGHސI΁JrKcLTMEN~6On'PgS@QWD@RG5@S7&@T'@U@V@V@W@X@Yƽ@Z@[\]^_o`_aOb?pc/adReCfo@f`@gQ@hB@i3@j$@k@l@m@nw@og@paqPr@s0t uvvwx}ynz_{@||@}m@~y^@iO@DFPT`bpT`bpT`FPLMTOSKOSD@8@?HGSTAFT " H P'0@50̅te|V lG!\8"L)#<$, %& '`' `( p)xp)`*`+`,`-`.`/t`0d`0     )*08@FP8@FP8@*0 8@ FP8@ LMTYSKYSDAMSTAMDT D P'0@50̅te|V lG!\8"L)#<$, %& '`' `( p.*08@FP8@FP8@*0LMTBSKBSD /l8@*0LMTGSTASTۆq̕2ݨҘR[hMXT` CMTBMTISTBGT t!aMT MXT`LMTISTBGTDgGkixpLMTBNT sDњgZ<[h~RMTBMTJST oD$_䓅Ab\cbppLMTSMTICTxǐm6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#vwp~ ~LMTMATCSTKSTCDT \'pZ6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#qp~pLMTCDTCSTm6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#cbpp~ LMTICTCSTCDTdm 6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#RT`p~ LMTURTCSTCDTDǑm06ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#G<MXFPp~ LMTETTCSTCDT(їazpyBZ:#p<fp&pYݪrsߵdp|ᖗ]wp>0 p!qp p ?/ypVp ݉ ν6~pCDTCSTE iZj8ԓJB8֚>A.$9ܸʨޢ8߭8(Oi8v(/K8_Ǩ-8?I+m Ol(wѸN(W0(@8h( 8G(%~8a(`8C(B8_^A@#"~n]MG(78&(8 ( 8 ( ֩8 ƌ( 8n(98ol{8ONkp~p LMTHKSTHKT) $wѸN(W0(7dh( 8G(c'`8C(B8_^A@#"~n]M=p-& ( 8 ( ֩8 ƌ( 8n(<vo;p_:Opj|p~pLMTCDTCSTw ݒ d P 9``uOc`SPM3P#`P`P`hPg`fe|H lG!\*"L)#< $, %& ' P' `(P)`*P+`,P-`.P/t`0duP1]2M3=4-s5r6 U6T77869:;6P<5`=P>`?uP@e`AUPBE`C5PD%`EPF`FGHޞIΝJKLbMaN~DOnCPgaPQW``RGCPS7B`T'%PU$`VPV`WPX`YPZ`[\]^_o`_aOb?c/odneQf`fnPgm`hPPiO`j2Pk1`lPm`nwPog`paqQr@s0t uvvwxЙy|z{{P|`}{P~yz`i]PH *0 LMTEET DSTEET P'0@50̅te|V lG!\8"L)#<$, %& '`' `( p)p*p+p,p-p.p)*08@FP 8@FP 8@ *0LSTTBSKTBSD ۆq̕2tR[hMX[hCMTBMTIST x`˿<&dg ix~pbpJMTJVTJST]xˈopp~ LMTMMTBNTJST  h~LMTMLTCST l}Ht-@@0:@UgEJ7-080H188@FP 8@?HLMTTMTISTGDTGSTIDTq 0<0hPPC@̓@Pte|V lG!\8"L)#<$, %& '`' `(`)`*`+`,`-`.`/t`0d`1]2M3=4-5r6 c6T7E869':;D`<5`=&`>`?v`@e`AU`BE`C5`D%`E`F`FGHެIΝJKLpMaN~ROnCPgo`QW``RGQ`S7B`T'3`U$`V`V`W`X`Y`Z`[\]^_o`_aOb?c/}dne_f`f|`gm`h^`iO`j@`k1`l"`m`nx`og`pa qQrAs0t uvvwxЙyz{{`|`}`~yz`ik`)*08@*08@BMTASTADT@0EtYPͬϏfЩyф`ҊpekZ`/pF۴4ܹ ޴΀ߤvV}J`64tҀ'O| ` 3``P `!I"]M`# $Z0`%?P& &'(P)`*+e,-G._P/{)0H1H2?|@lA\sBLrCEPD5`E%rPFq`GTPGS`H6PI5`JPK`LPM`NO~PmQ]RMS=T-UV VWPX`Y֝PZƜ`[P\~`]aP^``_vCP`fB`aV%PbF$`c?Ad/@e#f"fghijklm`nPow`pgPqW`rGPs7`t'nPum`vPPvO`wlxkyNzM{0|/}~o! *0 LMTEET DSTEETu{0'} ivgXI|: l+!\"L #;$+%& '@'@(P)xP)@*@+@,@-@.@/tv@0dg@1]2M3=t4-e5V6 G687)89 :;(@<@= @>@?u@@e@AU@BE@C5@D%@E@F@FGHސI΁JrKcLTMEN~6On'PgS@QWD@RG5@S7&@T'@U@V@V@W@X@Yƽ@Z@[\]^_o`_aOb?pc/adReCfo@f`@gQ@hB@i3@j$@k@l@m@nw@og@paqPr@s0t uvvwx}ynz_{@||@}m@~y^@iO@H$FPT`bp T`bp T` FPLMTAASKAASD u @' 0' wufW|H l9!\*"L#< $+%& ' P'P(`)x`)P*P+P,P-P.P/tP0duP1]2M3=4-s5d6 U6F778(9: ;6P<'P=P> P?uP@ePAUPBEPC5PD%PEPFPFGHޞIΏJKqLbMSN~DOn5PgaPQWRPRGCPS74PT'%PUPVPVPWPXPYPZP[\]^_o`_aOb?~c/od`eQf}PfnPg_PhPPiAPj2Pk#PlPmPnwPogPpaqQr@s0t uvvwxЋy|zm{P|P}{P~ylPi]P                                              / 8@FPT` FPT` FP8@FPT`LMTSHSKSHSDASDASK t ~0'} ivgXI|: l+!\"L #;$+%& '@'@(P)P*P+P,P-P.P/tP0duP1]2M3=4-s5d6 U6F778(9: ;6P<'P=P> P?uP@ePAUPBEPC5PD%PEPFPFGHޞIΏJKqLbMSN~DOn5PgaPQWRPRGCPS74PT'%PUPVPVPWPXPYPZP[\]^_o`_aOb?~c/od`eQf}PfnPg_PhPPiAPj2Pk#PlPmPnwPogPpaqQr@s0t uvvwxЋy|zm{P|P}{P~ylPi]PEFPT`bpT`bpT`FP T`LMTFSKFSDBSKBSD ~x𸄴xO)ᒀ 5x Dp!n=`"&p#N`w~p~KSTKDT~x𸄴xO)5xw~pKSTa5,*0LMTAST oFP_䓅A`0cbppLMTSMTICT ec{PN`?Ц%''Ш)P*-P ``추PqPﰥ`zL^`+wC P$7` j P P #``r.ќb`P `!u7P",#WP$g_`%8&<`'#P((V*m*+`,P-.B/`0vP1`2cP3g4E.5H`6&bP7*'89 9:`;NP<=>G`?P@`Ap:PBsCQmDU3`E2PF6fGHHYI`J׍PKRLM`NPO `P|yPQ>R]Sar`T>PUBV W%*XY^`YPZ[\`]3P^J`_P`}aibm`cKPdNe,Rf1igh`h Pij>k`lrPm`nPopv*qy`rW^Ps[#t8u=vw`wJPyy}zC`{P|`}6P~i*0 EET DSTEET gNː;>``0)aDbpg ~ixpSMTSGTJSTt L ܐ'apȀMK<-| l!\"K#;$+Ӡ%Ġ& ' ' ( )Դ *ĥ + , -x .i /tZ 0dK 1]v2Mg3=X4-I5:6 +67 89:; < = > ?u @e AU BE C5 D% Ev Fg FGHtIeJVKGL8M)N~On Pg7 QW( RG S7 T& U V V W Xְ Yơ Z [\]^_o`_raOcb?Tc/Ed6e'fS fD g5 h& i j k l m nw og p`qP٠r@ʠs0t uvvwpxayRzC{o |` }Q ~yB i3 d4bpp~LMTUSTUTT }0OMXPLMTISTNPT68@LMTGST ~̕2tݨ>MX[hFPLMTISTPKT66c`-P ``mﰳpy%ZYsp;Up6Ep9H7| ` 3``P `!I"]M`# $Z0`%?P& &'(P)`*+e,-G._P/{)0H1H2``0)aDbpg ~ixpSMTSGTJST Z(̕+u8KMXT`[hJMTISTIHSTx/^pa>p@ap Հ}R[ps(;~pUT66Hptp4gpgIa+C  p$S  .p p ?kYsLpmpJpU#p Gz!"ր?xp@k[A[>pBLC P?uP@ePAUPBEPC5PD%PEPFPFGHޞIΏJKqLbMSN~DOn5PgaPQWRPRGCPS74PT'%PUPVPVPWPXPYPZP[\]^_o`_aOb?~c/od`eQf}PfnPg_PhPPiAPj2Pk#PlPmPnwPogPpaqQr@s0t uvvwxЋy|zm{P|P}{P~ylPi]P                                              88@FPT`FPT`FP8@FP T`LMTSSKSSDESKESD . ..Kabul[0YerevanBaku Bahrain!Dacca"Thimbu#Brunei$Rangoon% Phnom_Penh &Harbin'Shanghai ( Chungking )Urumqi*Kashgar+Taipei, Hong_Kong -Macao.Nicosia/Tbilisi0Calcutta 1Jakarta2 Ujung_Pandang[3Jayapura 4Tehran5Baghdad6 Jerusalem 7Tokyo8Amman9Alma-Ata :Aktau;Bishkek<Seoul= Pyongyang >Kuwait? Vientiane @BeirutA Kuala_Lumpur[0B Ulan_Bator CKatmandu DMuscatEKarachiFGazaGManilaHQatarIRiyadhJ Singapore KColomboLDamascus MDushanbe NBangkokO AshkhabadPDubaiQTashkent RSaigonSAdenT  Yekaterinburg[0UOmskV NovosibirskW KrasnoyarskXIrkutskYYakutskZ Vladivostok[Magadan\ Kamchatka ]Anadyr^Riyadh87 _Riyadh88`Riyadh89 aIstanbul 6Tel_Avivu vD 'o׀֐ [hYJ;|, l!\"K#;$+%Ұ& ð'0'0(@)x@)0*ij0+0,0-0.@/tv@0dg@1]2M3=t4-e5V6 G687)89 :;(@<@= @>@?u@@e@AU@BE@C5@D%@E@F@FGHސI΁JrKcLTMEN~6On'PgS@QWD@RG5@S7&@T'@U@V@V@W@X@Yƽ@Z@[\]^_o`_aOb?pc/adReCfo@f`@gQ@hB@i3@j$@k@l@m@nw@og@paqPr@s0t uvvwx}ynz_{@||@}m@~y^@iO@MT`bppbppbpT`LMTNSKNSDul 'o׀֐ [hYJ;|, l!\"K#;$+%Ұ& ð'0'0(@)x@)0*ij0+0,0-0.w0/th00dY01]2Mu3=f4-W5H6 96*78 9:;0< 0=0>0?u0@e0AU0BE0C50D%0E0Fu0FGHނIsJdKULFM7N~(OnPgE0QW60RG'0S70T' 0U0V0V0W0X־0YƯ0Z0[˰\]^_o`_aOqb?bc/SdDe5fa0fR0gC0h40i%0j0k0l0m0nw0og0p`qPr@ذs0ɰt uvvw~xoy`zQ{}0|n0}_0~yP0iA0WT`bpp bpp bp T`LMTKRSKKRSDu bD'apȀMZK<-| l!\"K#;$+Ӡ%Ġ& ' ' (0)xy0)Դ *ĥ + , -x .i /tZ 0dK 1]v2Mg3=X4-I5:6 +67 89:; < = > ?u @e AU BE C5 D% Ev Fg FGHtIeJVKGL8M)N~On Pg7 QW( RG S7 T& U V V W Xְ Yơ Z [\]^_o`_raOcb?Tc/Ed6e'fS fD g5 h& i j k l m nw og p`qP٠r@ʠs0t uvvwpxayRzC{o |` }Q ~yB i3 abpp~p~pbpLSTISKISDu Jp'Sp`p?pL=.| l!["K#;Ԑ$+Ő%& ''( )xk )Ԧ*ė+,y-j.[/tL0d=1]h2MY3=J4-;5,6 6789:Ґ;<=>?u@eAUBEC5D%wEhFYFGuHfIWJHK9L*MN~ OmPg)QWRG S6T&UVVWX֢YƓZ[\]^_os`_daOUb?Fc/7d(efEf6g'hi jklmnwogp`ڐqPːr@s0t uvvqwbxSyDz5{a|R}C~y4i%yp~~~pLMTYSKYSDu H@ٷ'E`yxP`1`>/ | k!["KՀ#;ƀ$+%& ''()x])Ԙ*ĉ+z,k-\.M/t>0d/1]Z2MK3=<4--56 6789Ӏ:Ā;<=>?u@eAUBEC5xD%iEZFKFvGgHXIIJ:K+LM N}OmPgQW RFS6T&UVVWX֔YƅZv[\]^t_oe`_VaOGb?8c/)de f7f(gh ijklmnwogp`̀qPr@s0t uvrvcwTxEy6z'{S|D}5~y&i{~~LSTVSKVSDu 6٩'7Pkj@P#P0p!ppp{p kp![p"Kp#;p$+p%p& p''()xO)ԉ*z+k,\-M.>/t/0d 1]Lp2M=p3=.p4-p5p6 p6p7p8p9p:p;<=>?u@eAUBExC5iD%ZEKF`2M/`3= `4-`5`6 `6`7`8`9̷`:`;<=>?u@eAUyBEjC5[D%LE=F.FZ`GK`H<`I-`J`K`L`M`N}`Om`PfQVRFS6T&UVVWXwYhZY[`\v`]g`^X`_oI``_:`aO+`b?`c/ `d`e`ff ghijklmnwogp``qP`r@`s0`t t`ue`vV`vG`w8`x)`y`z `{6|'}~y hLMTPSKPSDu ٍ'0ON 0ڶ0PPPP{P kP![P"KP#;P$+P%~P& oP''()x2)m*^+O,@-1."/t0d1]0P2M!P3=P4-P5P6 P6P7P8ܸP9̩P:P;<=>?u@ezAUkBE\C5MD%>E/F FLPG=PH.PIPJPKPLPMPN}POmPPfQVRFS6T&UVVWxXiYZZK[wP\hP]YP^JP_o;P`_,PaOPb?Pc.PdPePf fghijklmnwogvp`PqPPr@Ps0uPt fPuWPvHPv9Pw*PxPy PzP{(|} ~xhdLMTASKASDP/0g$u <  jn   _9  f S ' H O  =w   2)  G & x`  y m ! # $a %& ' (V0 ) *: -? 5: 8(5 9y :+ < =n! > @ Ab B Dt EV F` G IKL J K3 M? N O Q3 Rm S U(O Vy W, Y Zn [z ] ^bW _ a4 bV c d fJ gZ h j?7 k l n3 o p] r' sy: tʦ v wm x ze {a |B ~ V  Jr Y > ; 3" ' x k  mW C a 4  V* J    b %  W/ > K M @\ ‘ p 4 Ɔ  ) {" ̱ ; o T  dm ӵ  Y ת . M ۟G B` ߓ y 7 ㈒ ! + }: N q g  f{  [ ( O < DF U 8!_!-d!~!sn! i!!_!P!U!!EK!!;!?Ч!A"!Bs!C!ER!Fg!G*!I !J\!Ki!L!NPA!O!P!RD!S!TS!V8!W+!Xۗ!Z-![~o!\!^!B!_r!`!b!cf!dc!f !g[;!h!i!kO!l!mf!oC!pH!q!s8*!t!u!w,!x}!yi!{ !|rU!}!A!f!2! ![#!!!!D!!-!~!#!!!s-!ķ!?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoponmlkjihgfeqrstuvw^]\[Zxyz{|}T~KIHEBBCDEHJK|Wy[`bqgjnܽpjsv]y}SQ++******k*R*9* *)))))))q)])I):)&))(((((((((((((((((((((()) ))+)5)D)S)b)))))))* **/*>*f*u*******+++)+=+L+[+o+~++++++++,,,,(,7,A,K,U,_,i,s,},,,,,,,,,,,n,d,Z,P,F,<,2+++++++++y+j+`+Q+G+8+.++********z*p*a*\*W***+$+3+B+t++++,,-,,,,--,-@-T-m-------..&.:.I.].q........///%///>/H/W/a/k/u////////////z/p/f/M/ //....v.b.0.-----|-c-E-'-,,,x,+?? `վТec{PN`?Ц%''Ъ((`Ы1P`J`΀Pˮ`Pqk PӢ9`CPL ){+ ]`?`\P`ݳ`dh`8kKi`4Pnp9u  :  ` $P 9`P`sPgM6Gz#݀'\>PܔP|s ld!\U"LF#<7$,(%& '5'&()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yql *0 8@*0*0 OMTEET DSTEETTUR DSTTURQ!b!ܴD!!W!!!LP!!!A!蒴!M!5!z!!*!|6!!^!p!!!e!3!!ZQ!!j"N"~""C"""8+" " 5" ,"Ͽ""["0""P&"""!D"""#"%8"&o"'")-V"*~"+B"-!".s)"/Ě"1 "2g|"3"5 ^"6["7@"8":P"";"<">Dp"?"@M"B8"C*"Dۖ"F-"G~s"H"J!P"Kr"L("N"Og"Pq"R "S[N"T"U+"WO"X"Yy"[C"\V"]"_83"`"a"c,"d}"eh"g "hrJ"i"k1"lf"m"o "pZ"qu"r"tOa"u"vR"xC"y>"z"|8/"}"~%","~"ϖ"!" "P""D" ""9*""4"-"C"""R"s"f""hu"" "]"","Q"E""F^""w";"""/"8""$Q"u"j""j"ļ" "_+"Ȱ"D"S"̥X""Hq"Й""="Ԏ""1"؃2"Է"&A"w"K""lU""_"`"i"">i"d"2""'U"x"F""m7"#(#a###U#q## JX# # ?# >#!##3#t##'Q#x#.##m #w##aO##!,#"U###$p#&I#'C#(#*>#+#,#.2Z#/#02#2x#4q#6#7lD#8#:#;`#<#>[#?T#@3#A#CI #Dw#E#G=T#H#I1#K1#L#Mz#O%#Pw\#Q#S>#Tk#U #W#X`#Yx#[#\Td#]#^P#`H#a<#b#d=-#e#f##h1#i#jԔ#mw#r#u`#x#yU(#z#{2#}I#~F##>Z##s#2###'#y>##a#m###b#E##Wr# ##L8##o#A##?#5#v##*#|K###q #¾#\#e## 6#Z#r##O#L##D#!#>  !"#$%&'&%$#("! )*+,-./0123456789 :;< =>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghgfedcbai`j^]klZYXWVmnopqrPOstuvwxyz{G|}E~CBA@>>@BCD}|zyxOqSnV\jaeʽ϶ӯ֪٤d_kVt{|++******p*W*>*%* )))))))v)b)N)?)+)) (((((((((((((((((((((())&)5)D)S)q)))))*****M*a*****++$+8+G+[+j+y++++++++,,,,(,2,A,K,U,_,i,n,x,,,,,,,,,,,,},d,Z,,,+++++++++~+o+`+V+=+.+ *******z*u*k*f*\*R****+++L++++,<,P,,,,--'-;-O-c-|------. .!.5.I.X.l......../// ///9/H/R/\/k/p/z//////////f/M/C/4/%/.....{.g.N.-----h-J-1-,,,F, +++t??Q##9]##ܔ#.-##_#"#t#/##i\#ͺ# #^#ѯ#E#R#դm##G#ٙ##$$$&$'`$($*d$+T$,<$-$/I$0$1$3=b$4$5?$71$8$9ԍ$;%$Z%@*%A|F%Bͼ%D2%Ep%F(%H%Ie%J%MY%QN %R%V%W%Y7%Z%[(%]+%^}7%_%a K%bq%c_%e%ffx%g%i %j[%%k%lH%nO%op%p%rD%s,%t%v9T%w%x܆%z.%{%|L%~"%t%%%iS%% %^(%%d%R%%9%G%u%%<%O%%1%)%%&`%w%ɜ%r\  !"#$%&'&%$#"( )*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklkjihgmedcbanopqrstZuXWVvwxyRQPz{|}L~JIFECBAABE~M{zSwvZsqobehlϼҴ֬idnqtVTRPNI++*****z*a*C***))))))){)g)S)?)0)!) ((((((((((((((((|(((((((()))N)])l)))))))***%*9*M*\*p*****++$+3+G+V+j+y++++++++,, ,,#,2,<,F,P,Z,d,n,x,},,,,,,,,,,,i,_,U,K,A,7,-,++++++~+t+e+L+=++ ********u*k*f*W*R****+)+8+[+++,,,,- --6-J-^-r------...0.?.S.g.{......./// /*/9/H/R/\/f/p/z/////////////u/k/a//.....l.:.!. ------m-O-,,,+`+B??b .= ..cMarengoKnoxdVevay Indianapolisx/%,ppˈa ޗݩp~=I6p^)pG<4'wp``pP`@p0`p p ` CWTCSTCDTESTEDT,ppˈa ~=wp``pP` CWTCSTESTEDTy_union_whiteout_procfs_validfpregs_pmap_rmu4_4c_in_revarpinput_revarpinput_svr4_sys_alarm_vm_map_startup_lfs_match_indir_vdumppages_myetheraddr_skpc_sys_chmod_allproc_sema_pmap_free_pages_mfs_start_m_split_sys_chdir_cd_ca_sunos_sys_ustat_cred0_selrecord_in_setpeeraddr_ttwakeup_time_myleintr_ufs_ihashget_tcp_rttdflt_setstatclockrate_cd_cd_sunos_sys_ptrace_svr4_sys_fcntl_fbrcons_init_lfs_writing_nchashtbl_sys_fcntl_cd9660_rrip_offset_sd_crazymap_audio_init_record_lfs_mknod_vfs_op_init_soabort_fpproc_sccs_cgsixmmap_looutput_kernfs_inactive_ctx_alloc_dvma_mapout_lfs_vflush_union_close_ufs_check_export_kernfs_vfree_tunattach_semu_svr4_sys_semsys_st_read_kernfs_init_sys_chown_msginfo_loadfpstate_ufs_direnter2_sbappendcontrol_shmfork_sys_reboot_scheduler_check_exec_audioclose_udpcksum_ip_directedbcast_ihash_ip_id_lookup_msginit_raster_op_lfs_match_data_sysctl_vnode_tick_makefstype_raster_bitmask_amd7930attach_icmpmaskrepl_vop_blkatoff_desc_vm_page_max_wired___udivdi3_ufs_create_dead_write_vntblinit_arp_ifinit_unp_discard_spec_ioctl_emul_find_pmap_rmu_p_ttsetwater_rootdev_ie_setupram_lfs_initseg_rpc_mismatch_config_scan_mfs_print_nextc_pmap_zero_page4m_ctx_phys_tbl_nfs_asyncio_in_broadcast_vget_si_dma_poll_netio_sysctl_doproc_pmap_pinit_xs_free_list_fdhash_sysctl_rdint_trace_req_ifnet_vm_pager_get_soo_close_nfs_valloc_hardclock_vm_pager_sync_pmap_reference_vm_object_reference_nvfssw_bigadj_isofncmp_crdup_config_search_ch_ca_msghdrs_svr4_stream_get_dqref_tcp_outflags_bremfree_xdcmatch_rn_match_constty_elf_load_file_zswrite_in_control_union_vptofh_ch_cd_thread_block_devicepagerops_nfs_pathconf_pidhash_tcp_maxidle_llinfo_arp_updatepri_vm_page_queue_inactive_union_allocvp_vmcmd_map_readvn_ovbcopy_st_interpret_sense_scsi_interpret_sense_auiop_iprintf_ffs_flushfiles_nfs_statfs_compat_43_sys_lstat_numccd_bufpages_openpromioctl_nfs_strategy_vfs_opv_descs_fdfree_fbioctl_chioctl_bpfclose_kernfs_link_slclose_audioselect_sys_unlink_vop_reclaim_desc_in_ifaddr_svr4_sys_fchroot_lfs_valloc_pmap_enk4_4c_si_obio_dma_stop_sys_setitimer_pmap_rmk_p_iommu_enter_vop_bwrite_desc_vop_update_desc_fddump_ipstat_union_setattr_oclock_ca_mem_access_fault4m_svr4_sys_ulimit_raster_op_nosrc_noclip_st_touch_tape_dmtext_msgbufp_audiogetinfo_sync_crash_oclock_cd_bpf_bufsize_umap_vfsops_portal_vfsops_disk_resetstat_pmap_copy_page_p_alldevs_leavepgrp_compat_43_sys_sethostname_vndwrite_vmes_scan_lfs_mountfs_xyc_xyreset_mfs_initminiroot_lfs_statfs_ip_srcroute_copyargs_sunos_sys_sigreturn_svr4_error_rpc_autherr_fdesc_fhtovp_sys_sigreturn_crget_bread_ccdclose_msgmaps_sunos_sys_setpgrp_cluster_newbuf_rn_newpair_logioctl_disk_detach_route_cb_sem_nbuf_svr4_sys_shmsys_subnetsarelocal_sir_shm_find_segment_by_shmid_vop_write_desc_shminfo_sys_chflags_nswapmap_nullop_nbootpath_xdc_xdreset_pil_to_vme_vm_pager_put_pages_proc_targets_shminit_st_identify_drive_vmcmdset_extend_svr4_sys_gettimeofday_ufs_pathconf_sys_gettimeofday_pmap_clear_reference4m_xdc_ioctlcmd_cpcb_cgtwoputcmap_procfs_lookup_tputchar_resettodr_kmem_malloc_mbutl_kbd_docmd_mfs_strategy_ufs_strategy_arp_rtrequest_procfs_freevp_clalloc_mixer_close_nbpg_pv_link4m_ndqb_soo_select_tickfixinterval_nqfhhashtbl_tcprexmtthresh_kernfs_vget_clfree_xyclose_soclose_fifo_ioctl_ncr5380_wait_phase_timo_pmap_bootstrap_kdvma_mapin_ufs_direnter_ntp_gettime_vm_object_cached_list_vactype_nfsm_mbuftouio_arp_maxtries_null_lookup_kernfs_get_rrootdev_shm_last_free_kmemstats_iommu_match_nqnfs_prog_arpt_prune_sysctl_ntptime___cmpdi2_fbopen_chopen_vsunlock_audio_write_lmin_dmamatch_ffs_sbupdate_loif_lf_split_compat_43_sys_mmap_romprop_lfs_mount_fd_ca_fdesc_pathconf_logwakeup_fbnode_vm_pages_needed_lock_cdread_rpc_auth_unix_uipc_usrreq_diskerr_fd_cd_max_protohdr_dvma_malloc_fdchwintr_kernfs_statfs_soconnect_dma_ca_lmax_svr4_sys_signal_xystrategy_ifa_ifwithladdr_ifpromisc_espprint_dma_go_getquota_compat_43_sys_lseek_rmalloc_kern_sysctl_dma_cd_main_svr4_to_bsd_sig_msclose_nfs_vptofh_firstc_eopnotsupp_fdrelease_ie_ca_delay_sddkdriver_ffs_valloc_phys_map_chkdq_nfsspec_access_nqsrv_instimeq_unp_externalize_lkm_nofunc_svr4_sendsig_mfs_rootbase_route_output_cinit_ie_cd_maxfiles_nfsnodehash_kernfs_root_sbappendaddr_cfree_msopen_cdsize_free_fbmmap_ie_map_in_ifinit_semu_alloc_st_decide_mode_grow_vmtotal_union_newlower_fdesc_ioctl_pv_flushcache_nfsrv_getcache_rawcbtable_sys_setsid_svr4_sys_pgrpsys_arpt_keep_fdciop_ffs_statfs_lortrequest_union_readlink_pmap_rmk4m_audio_select_pmap_protect4m_timer_ca_imin_lfs_vptofh_dead_print_svr4_elf_probe_sunos_sys_fchroot_svr4_trap_vm_pager_put_nfsm_adj_exec_map_kbdclose_unp_internalize_sys_setuid_numvnd_timer_cd_ipforwarding_svr4_sys_utime_ufs_dirempty_iptime_vnode_pager_uncache_domainnamelen_imax_cnopen_fdopen_sunos_sys_mctl_pager_eva_lfs_updatemeta_svr4_sys_pathconf_chmatch_kmem_free_wakeup_sys_pathconf_xyc_ioctlcmd_sigprop_ktrops_pageproc_cpu_match_ufs_lookup_nfsv3_type_raw_init_tcp_quench_bawrite_enxio_edatabzero.o_lfs_vfree_pmap_copy_page4_4c_xycintr_chkiq_fixjobc_kill_user_windows_ntohl_setptesw4m_ipq_if_down_dead_ebadf_pgrphashtbl_mmrw_cgsixopen_ppp_dequeue_vop_link_desc_sys_shmctl_sys_setegid_chgproccnt_scsibus_ca_cnclose_cngetc_fdclose_pmap_update_kernfs_read_rrootdev_dkn_shmexit_xyc_entoact_tcp_fasttimo_nfs_symlink_scsibus_cd_pagertab_if_up_sunos_sys_mmap_cd9660_select_end_st_crazymap_umapfs_mount_bcmp_msgbuf_raster_text_procfs_pathconf_ktrcsw_biodone_vm_object_list_lock_fpu_cleanup_tinfo_t_intr_fasttrap_copyoutstr_auxregbisc_inetctlerrmap_semlock_holdernegdi2.o___ucmpdi2___lshldi3___main_cd9660_abortop_xyc_e2str_bpfwrite_ktremul_vop_setattr_desc_cpmemarr_icmp_sysctl_tcp_sysctl_cnt_kernfs_vptofh_vm_cache_lock_config_found_sm_version_fdalloc_cmask_wildcard_rt_tables_endtsleep_ffs_dirchk_route_init_sohasoutofband_npty_cfroots_zsclose_vm_map_deallocate_vm_object_deallocate_enoioctl_closef_sys_write_sunos_sys_open_cache_enable_nfssvc_sockhead_ntp_adjtime_fd_types_pager_map_vm_map_entry_dispose_lf_getblock_spec_badop_ch_exchange_rt_setmetrics_dead_read_setrunnable_fdstart_ufs_close_lf_clearlock_sys_socketpair_vfs_opv_init_getc_fdcopy_falloc_ffs_mountfs_routesw_fifo_bmap_dk_establish_sbus_translate_ether_output_umapfs_statfs_cluster_read_vm_page_activate_nfsv2_type_nfsrvlruhead_nfsrv_readlink_sys_socket_mfs_badop___lshrdi3_cdevsw_securelevel_ccdwrite_sunos_sys_wait4_vm_map_simplify_entry_nqsrv_getlease_devout_cd9660_readdir_ntohs_ffs_vptofh_nfsm_disct_fdesc_mount_schedcpu_fdc_ca_fb_attach_dmmin_fifo_open_si_vme_dma_stop_desireddquot_hztodivdi3.o_st_write_filemarks_tcp_usrreq_sl_softc_kernfs_start_coredump_fdc_cd_min_lock_try_write_lfs_symlink_cksum_icmpstat_tcpstat_devcls_vm_allocate