default labelVEW vnddefault label @0VEWtB00000000@ 00000000ھ0P4 `@# ` #" $@` `T@ !8 c@2`"` H*/+     "bt "ah0  ""l ""p * ""|!` "!l@holdmonobp v0obp v2㿘  a€  a€㿘@Can't open device `%s' 㿘@ ! $!!  @ ``$?$  "8!+   "h " `0@ 2$@ !   t    $   $`  h@ !h㿘` bt, bt06 * '@ 㿘.  !> @  `2 < 8'@ 㿘  @& `& $& (   €@ " '@ 㿘  !̰ €@㿘  @e $ ? `$ ;*prom_iopen: "%s" error=%d 㿘) !< ?K  @ @ "0$`""0$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` () V`" * @H$`0 "@$`4 " @ $` @ 2!<&  %!<  @W  㿘# a<  @ 4 "$a<@ & 4$a<oldmon_mapin: length=%d oldmon_mapin: invalid maptype %d 㿘 "|*`@  !@ !      `   !@`` @"| 3 a Ԣ&@  ` !la @? Đ`IJ`  dvma_mapin㿘? #@(1? @# dvma_mapout㿘 #@(1 @#h㿘@f " ڒ㿘 @㿘 !@㿐  / < 㿘 "t`     @㿘 "l` ?L "!J@!, "   " " ( " H@ " "tS" "tA @L`" ` "t t`"t  t  " "@"t #` t #`H L J#`  T#`( $#`0 (#`4 @#`#`   @ #` #`(  #`0  #`4 L#`8  #`#`<#`@#`%s: can't open device `%s'unknown㿐@3' % `#  x"x$h   h  "pa  "@Đ @(  @ᘀ "t@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐) !(@a +   #`@a a, @E ?!0c' 5 / - ,`2 x@z    a( "!(@ ;@&!( @` `a,@?@2 @a aa a,@ a,`@Ʋ@    *@ ` 00 ?@ @: ?  a4 "a4"     0? 0"  㿘 aH'H'L'P'T 'X @ "aH@fH @"㿘 " , @  @ , 㿘'H'L'P'T'X@FH㿘 . " @  @    $"bx2  " @      @ $ ""x`  ""x?  X\@`*@"X㿘 !(@㿘 ! "a\ $!X#@!X*!X"8N@`N@`%` N@`oq``s`c"N`d``b"0T`l" 0z"B`u`ph0r]`x"h0m@wL`Р L !  ?,@ < ,L L    L  *`:    >0 `L` L` N@` - @0 N@@( N@@  {N@ 0 x@ oN@ % g lc0123456789abcdef㿈 "@ @@,  ?L?@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" 44<444444444 4444 bootxx ******+44,4, 4h'4p-4 44=4H4N 4lW 4pd40n4v4(4p 7 <  @  @ @(O/mntii<@`bT 7 <  @  @ @<@`bT U7(OP H OOA 7 970G70GA7 973(73(A$7.78 78 A7 75 R75 RA7 *T7 ]J7 vA7 I 7 &67 5A7 57E]J7E]JC7 /77n7A77z97)'A7,7H67H6A7 7=7;GA77I 7I A7p7 7)'A7z977A77=7A7,7)'7)'A7 71xˀ7I A7I 77)'A7)'7J7J=7bZ7%7D, (08@HPX 7?+7@7@7@>7@3%7@3%7@8ـ7A7A77AC7A*Q7A*Q7A,7B h7B h7B沀7Dv7DvB-7C]J7C"7D)*7C$s7D,7D 7E'7Et7Et../../instbin 7E87E4s7E4s../../instbin 7E57F X7F X../../instbin 7FN7F87F8../../instbin 7Fe7F/7F/../../instbin 7F1xˀ7G7G../../instbin 7G]J7G>7G>../../instbin 7G7G$s7G$s../../instbin 7G&67G1xˀ7G1xˀ../../instbin 7G3B7H'7H'../../instbin 7Hр7Hp7Hp../../instbin 7H97H'V7H'V../../instbin 7H) 7H67H6../../instbin 7H8ـ7I 7I ../../instbinA7I 7I'V7I67I8ـ7J7J/tmp$۠77=79" (08@Hnm476,7K 7K !7K(7K(7K(!7Le7Le7L!7M /7M /7M&%!7N7N7N'!7Nk 7Nk 7N8!7N1xˀ7N1xˀ7N2 !7O7O7Oܓ !7O'c7O'c7O+F!7P]J7P]J7PX;!7P!7P!7P#*!7P67P67P8C!7Q97Q97Qt!7Q1xˀ7Q1xˀ7Q2!7R7R7Rz9!7R&67R&67R'c !7S7S7SĴ!7S) 7S) 7T  B!7T 7T 7T  B!7T0G7T0G7UI B!7U 7U 7UI B!7U*T7U*T7V S+ B!7Vр7Vр7V S+ B!7V&%7V&%7Ww B!7W,7W,7Ww BA7rt7r7r!7X#*7X#*7rk !7Y7Y7rk !7Y4΀7Y4΀7r!7Y98p7Y98p7r!7Zׄ7Zׄ7r!7Z*T7Z*T7r!7[7[7r!7[ U7[ U7r!7[67[67r!7\7\7r !7\2b7\2b7rk  !7] 7] 7rk  !7].}7].}7rk  !7^7^7rk  !7^7n7^7n7rk !7_I 7_I 7r!7_/7_/7r!7`N7`N7r!7`/7`/7r!7a 7a 7r!7a0G7a0G7r!7bN7bN7r!7b&%7b&%7r!7cÀ7cÀ7r!7c4΀7c4΀7r!7c8C7c8C7r!7dܓ7dܓ7r!7d*Q7d*Q7r!7e]J7e]J7r!7e7e7r!7e4s7e4s7r!7fܓ7fܓ7r!7f+7f+7r !7g'7g'7r!!7g7g7r"!7g8C7g8C7r#!7hI7hI7r$!7h)'7h)'7r%!7h:i7h:i7r&!7iI 7iI 7r'!7i#F7i#F7r(!7i8C7i8C7r)!7j4΀7j4΀7r*!7j3%7j3%7r+!7k 7k 7r,!7k&67k&67r-!7l7l7r.!7lܓ7lܓ7r/!7l+7l+7r0!7m7m7r1!7m7m7r2!7m8ـ7m8ـ7r3!7nW7nW7r4!7n/7n/7r5!7oX;7oX;7r6!7o!`7o!`7r7!7o3%7o3%7r8!7p S+7p S+7r9!7p7p7r:!7p67p67r;!7qI 7qI 7r<!7q#F7q#F7r=!7q7n7q7n7r>!7r7r7r?a7s7s7x;3a7s97s97x;3a7s/7s/7x;3a7t'7t'7x;3a7t/7t/7x;3a7uX;7uX;7x;3a7u(7u(7x;3a7u;37u;37x;3!7v 7v 7x;3!7v-D7v-D7x;3!7w 7w 7x;3!7w7w7x;3!7w3B7w3B7x;3!7x 7x 7x;3!7x"7x"7x;3!7x67x67x;3a7y7y7}&6 a7y*T7y*T7}&6a7zр7zр7}&6 a7z4΀7z4΀7}&6 a7z/7z/7}&6 a7{,7{,7}&6 a7{W7{W7}&6a7{&%7{&%7}&6!7{5 R7{5 R7}&6!7|7|7}&6 !7|C7|C7}&6 !7|,7|,7}&6 !7|:i7|:i7}&6 !7} 7} 7}&6 !7}W7}W7}&6!7}"7}"7}&6a7}67}67#Fa7~р7~р7#Fa7~97~97#Fa7~'c7~'c7#Fa71-71-7#Fa7沀7沀7#Fa7k 7k 7#Fa7% 7% 7#F!73B73B7#F!7w7w7#F!777#F!7 /7 /7#F!7/q7/q7#F!71-71-7#F!7v7v7#F!7(7(7#Fa75757)'a7 !7 !7)'a79797)'a7)'7)'7)'a76=76=7)'a777)'a7 7 7*Qa7)'7)'7*Q!76=76=7*Q!7'7'7*Q!7u*7u*7*Q!7) 7) 7*Q!76767*Q!777*Q!7W7W7*Q!7&%7&%7*Qa777*Q"a7 X7 X7*Q a7k 7k 7*Q!a7,7,7*Q#a7ܓ7ܓ7*Q$a7#F7#F7*Q%a74s74s7*Q&a7'V7'V7*Q'!777*Q !7 7 7*T!!7*T7*T7*T"!777*T#!7 7 7*T$!72727*T%!7v7v7*T&!7&67&67*T'a7 S+7 S+7 a7(7(7 a77n77n7 a7z97z97 a7(7(7 a777 a7$[܀7$[܀7 a7:i7:i7 !777*!7) 7) 7*!7р7р7*!7p7p7*!74s74s7*!7 7 7*!74s74s7*!7ܓ7ܓ7*a72727!` a777!` a7*Q7*Q7!` a777!` a75757!` a7 7 7!` a7.}7.}7!` a7 7 7!` !7#F7#F7!`*!777!`* !79797!`* !71xˀ71xˀ7!`* !7 X7 X7!`* !7*Q7*Q7!`* !7w7w7!`*!74΀74΀7!`*a777 a7 U7 U7 a7'7'7 a7% 7% 7 a7bZ7bZ7 a7 U7 U7 a777 a7-D7-D7 !7 7 7*!7057057*!7W7W7*!7.}7.}7*!777*!7 7 7*!7$[܀7$[܀7*!7:i7:i7*a7C7C73% a7)'7)'73% a7773% a7I7I73% a7% 7% 73% a73%73%73% a7w7w73% a7ׄ7ׄ73% !7'c7'c73%*!7;37;373%*!7N7N73%*!787873%*!7-L7-L73%*!7X;7X;73%*!7p7p73%*!7/7/73%*a7'V7'V74΀a7774΀a7ܓ7ܓ74΀a7) 7) 74΀a7 S+7 S+74΀a7'V7'V74΀a7774΀a7W7W74΀!7'V7'V74΀ !7]J7]J74΀ !74΀74΀74΀ !75 R75 R74΀ !7z97z974΀ !7,7,74΀ !7w7w74΀ !7774΀ a798p798p7 a7߀7߀7a7(7(7 a7À7À7 a7(7(7 a75 R75 R7 a7u*7u*7a7,7,7!7,7,7 !7>7>7 !7/q7/q7 !777 !777 !7.}7.}7 !7Ĵ7Ĵ78 !7ׄ7ׄ78 a72b72b73%a7 X7 X73%a7#*7#*73%a7bZ7bZ73%a74΀74΀73%a73B73B73%a7 X7 X73%a757573%!7߀7߀73% !7$[܀7$[܀73% !7À7À73% !7W7W73% !7)'7)'73% !7773% !797973% !7/7/73% a7ׄ7ׄ76a73B73B76a7 7 76a7k 7k 76a74s74s76a7р7р76a7k 7k 76a7(7(76!798p798p76 !7 7 76 !7e7e76 !727276 !7р7р76 !7 7 76 !7$s7$s76 !727276 a7 7 7 /a777 /a7$[܀7$[܀7 /a7/7/7 /a7À7À7 /a7߀7߀7 /a7t7t7 /a7*Q7*Q7 /!75 R75 R7 /:!7]J7]J7 /:!7C7C7 /:!7 U7 U7 /:!71xˀ71xˀ7 /:!7,7,7 /:!7沀7沀7 /:!777 /:a73B73B71xˀ a7Ĵ7Ĵ71xˀ a7W7W71xˀ a7!7!71xˀ !75 R75 R71xˀ!7 !7 !71xˀ!7k 7k 71xˀ!7-D7-D71xˀa7z97z97 a7.}7.}7 a7 S+7 S+7 a7"7"7 !74s74s7!7 S+7 S+7!7 U7 U7,!777,a7t7t7*Qa7.}7.}7*Qa777*Qa78787*Qa72727*Qa7I7I7*Qa7) 7) 7*Qa7沀7沀7*Q!7$s7$s7*Q6!777*Q6!777*Q6!72b72b7*Q6!7 7 7*Q6!7&67&67*Q6!7;37;37*Q6!7&%7&%7*Q6!7 !7 !7>E!7$s7$s7>E!7À7À7>E!7f7f7>E!78ـ78ـ7CE!7u*7u*7CE!73%73%7CE!7v7v7CE!71xˀ71xˀ7bZE!7 7 7bZE!7 U7 U7bZE!79797bZE!777+E!73B73B7+E!7I7I7+E!7'c7'c7+E!7N7N7À!7$s7$s7À!777À!7u*7u*7À!7/q7/q7À!7'7'7À!7'V7'V7À!7bZ7bZ7À!7t7t7À!777À!777À!73B73B7À!7I 7I 7À!7*Q7*Q7À!7'7'7À!7(7(7À!73%73%7À!7I7I7À!7'V7'V7À !7v7v7À !7*T7*T7À !7 h7 h7À !7k 7k 7À !7,7,7À !7À7À7À !7f7f7À !7#*7#*7À !72b72b7À !777À!7 7 7À!7'c7'c7À!78ـ78ـ7Àa7C7C7z9a7!7!7z9a78ـ78ـ7z9a7k 7k 7z9a73B73B7z9a7N7N7z9a7!`7!`7z9a7;37;37z9!777z9n!78C78C7z9n!7C7C7z9n!7(7(7z9n!777z9n!777z9n!71xˀ71xˀ7z9n!7N7N7z9na7-D7-D78ـ a7 7 78ـa787878ـ a78C78C78ـ a7778ـ a7,7,78ـ a7 7 78ـa7778ـ!78C78C78ـn!7z97z978ـn !78C78C78ـn !7778ـn !7-D7-D78ـn !7778ـn !7(7(78ـn!74s74s78ـna7W7W7.}a72b72b7.}a7X;7X;7.}a7 /7 /7.}a73%73%7.}a7 X7 X7.}a7 /7 /7.}a71xˀ71xˀ7.}!7N7N7.}n!7% 7% 7.}n!777.}n!7ܓ7ܓ7.}n!7&%7&%7.}n!777.}n!7W7W7.}n!7*Q7*Q7.}na7 !7 !7 ha7 U7 U7рa71-71-7 ha7% 7% 7 ha777 ha7G7G7 ha73%73%7 ha7р7р7 h!7u*7u*7 hn!7$s7$s7 hn!72b72b7 hn!7Ĵ7Ĵ7 hn!7ׄ7ׄ7 hn!7$s7$s7 hn!72727 hn!7Ĵ7Ĵ7 hn!7G7G7NE!7'V7'V7NE!78ـ78ـ7NE!7 7 7NE!7(7(7#*o!72b72b75o!7N7N7o!7'V7'V7*Toa7 !7 !7 a7G7G7 a7*Q7*Q7 a78C78C7 a7 X7 X7 a78787 a7*Q7*Q7 a71-71-7 !7N7N7!777!7-D7-D7!7À7À7!7I 7I 7!78787!7,7,7!7t7t7a7/7/7( a7 S+7 S+7( a7!`7!`7( a78C78C7( a7 7 7( a7-D7-D7( a777( a7p7p7( !7/7/7(!7 7 7( !7% 7% 7( !7À7À7( !7ܓ7ܓ7( !7/7/7( !7 7 7(!7$[܀7$[܀7(a7,7,7  a777  a74s74s7  a7 7 7  a7&%7&%7  a7 bZ7 bZ7  a7 t7 t7  a7 98p7 98p7  !7 t7 t7 !7 2b7 2b7 !7 7 7 !7 57 57 !7 7 7 !7 !7 !7 !7 1-7 1-7 !7 t7 t7 a7 97 97'V a7C7C7'V a7,7,7'V a7,7,7'V a7(7(7'V a777'V a7e7e7'V a76767'V !777'V!7)'7)'7'V!7]J7]J7'V!7 U7 U7'V!7;37;37'V!7(7(7'V!7 7 7'V!7"7"7'Va777(a777(a7,7,7(a777(a777(a7!7!7(a76=76=7(a7 h7 h7(!777(y!7*T7*T7(y!7 7 7(y!777(y!7'c7'c7(y!777(y!7I 7I 7(y!7$[܀7$[܀7(ya7;37;37v a777va7#F7#F7v a73B73B7v a7р7р7v a7e7e7v a7-L7-L7va7À7À7v!7>7>7vy!7,7,7vy !777vy !7C7C7vy !7% 7% 7vy !777vy !72727vy!7 X7 X7vya73B73B7&-La7 f7 f7&-La7 +7 +7&-La7! 7! 7&-La7!,7!,7&-La7"X;7"X;7&-La7"+7"+7&-La7#7#7&-L!7#7#7&-Ly!7#3%7#3%7&-Ly!7$ܓ7$ܓ7&-Ly!7$/7$/7&-Ly!7%7%7&-Ly!7%27%27&-Ly!7&N7&N7&-Ly!7&) 7&) 7&-Lya7'I7'I7.a7'+7'+7.a7( 7( 7.a7(&67(&67.a7)X;7)X;7.a7)e7)e7.a7)8C7)8C7.a7*v7*v7.!7*,7*,7.y!7+X;7+X;7.y!7+4΀7+4΀7.y!7,1-7,1-7.y!7, /7, /7.y!7-7-7.y!7-ܓ7-ܓ7.y!7-;37-;37.y!7.#F7.#F7.&6i!7/bZ7/bZ7/i!7/7/7/"i!707070wi!70$[܀70$[܀70'Vi!71Ĵ71Ĵ71i!717171i!715 R715 R718Ci!72 72 72 X!72e72e72!726=726=7267!73I 73I 73'!73"73"73#*C!736736738C@!74沀74沀74߀m!74"74"74&%x!746=746=749x!75߀75߀75x!75'c75'c75+x!76,76,76p!$76976976)'w!76&%76&%76*Tw!77bZ77bZ776=!7777776=!77!77!776=!772772776=$۠77=7:1-PX`hpxn$%77=7:m77=7:6=pm 077=7;A77=o7 $77=Q7@k O$I77=Q7A$Z77=Q7A0G$O77=Q7B#F$I77=Q7CI $877=Q7C:i$I77=Q7D#F$I77=R7Eׄ$`77=R7Fe$877=R7G X$877=R7G9$I77=R7H4΀$I77=R7Iр$I77=R7I0G$77=R7,$Z77=R7KI $J77=R7L$J77=R7Lk $I77=S7L/$k77=S7M'$77=S7M4΀$_77=S7M/q$Z77=S7Nр$s77=S7N4΀$\77=S7N3B$Z77=S7O h$ 77=S74s$I77=S7O6=$_77=S7P$I77=S7P*Q$_77=T7Q$77=T7Qp$Z77=T7Q/q$I77=T7R]J$;77=T7Rp$g77=T7R2b$I77=T7SN$I77=U7S*Q$I77=U7Tw$Z77=U7Te$77=U7T98p$O77=U7U>$b77=U7U6=$77=U7VC$J77=U7V+$a77=U7W X$877=U7W#F$77=V7X$s77=V7X$I77=V7X2b$I77=V7YI$77=o7Y#FA77=z7 !$m77=Q7]e$I77=U7^р$77=j7^% $77=l7À$877=m7_9$77=m7`+$77=m7aܓ$77=o7bÀ$77=t7b$[܀ $77=y7c $877=z7d A77=f7w $I77=R7fI $h77=S7f2 $I77=T7g( $I77=T7hр $I77=T7h4s $I77=U7i( $I77=V7j $877=W7j8C $I77=Z7ke $877=f7l  $877=f7l6 A77=7bZ $I77=V7obZ $T77=V7o) $J77=V7pv $`77=V7p05 $J77=V7qC $ 77=W7q98p $77=W7r5 R A77=7;3 Q$E77=W7u h $77=W7ut $77=W7u2 $Z77=W7v $77=W7v% $Z77=W7w $V77=W7wu* $l77=W7w2b $l77=W7y $77=W7y) !$77=W7z9 "$77=W7{À #$77=W7{$[܀ $$77=X7|N %$77=X73B &$ 77=X7)' '$/77=X7}:i ($77=X7~!` )$77=X7 h *$m77=X7, +$77=X7e ,$q77=X7' -$`77=X74΀ .$77=X7 S+ /$77=X7 S+ 0$#77=X7 1$I77=X7#F 2$77=X7&6 3$77=X7]J 4$77=Y7 5$77=Y75 R 6$77=Y7p 7$77=Y71xˀ 8$a77=Y7 9$I77=Y7&% :$l77=Y798p ;$77=Y7 <$77=Y7) =$77=Z79 >$77=Z7C ?$Z77=Z7+ @$I77=Z7 A$~77=Z79 B$877=Z7&6 C$y77=Z73B D$Z77=[7 E$I77=[7沀 F$77=[7:i G$77=[7) H$D77=[74s I$77=[7Ĵ J$I77=\7߀ K$77=\78 L$I77=\7) M$)77=\73% N$77=\7 O$l77=\7沀 P$I77=\7)' $77=n76= S$77=n7 ! T$77=n7> U$77=n7" V$77=n72b W$77=n7Ĵ X$77=n7 Y$77=n7e Z$77=n7*T [$77=n77n \$G77=7ׄ `$ 77=7 U d$ 77=7)' h$77=o7w ]A77=76= ^$h77=\79 _$77=]7#F l$77=^7 m$77=e7 n$77=e7 o$977=e7ܓ p$77=e7 q$77=e72 r$77=e72 s$77=e7+ tA77=72b u$77=f7C v$77=f7 w$J77=f7+ x$J77=f7I y$J77=f7, z$877=f798p {$977=f7 |$S77=f7ׄ }$S77=f7$s ~$E77=g71xˀ $E77=g7À $W77=g7+ $F77=g79 $977=g7'V $977=g75 R $K77=g7w $l77=g7z9 $77=g7e $f77=g7bZ $#77=g7 ! $R77=g7w $I77=g7z9 $877=g7e $877=h7)' $877=h75 $}77=h7#F $[77=h7 $I77=h7 $877=h78C $E77=h7X; $877=h7C $877=h7 / $Z77=h7, $977=h78C $77=h7X; $877=h7ܓ $q77=p77n $77=x7k $[77=y798p A77=7-D $+77=i7, $C77=i7 $77=i77n $77=i7G $p77=j7'V $77=j75 R $77=j7 $+77=j7f $77=j7( $&77=j7e $77=j76= $=77=k7w $77=k7z9 $:77=k7 $E77=k7+ $K77=k7À $777=k7沀 $b77=l79 $77=l7> $>77=l73% $77=l7]J $<77=l7> $J77=l7$[܀ $77=l7/q $77=l7;3 $/77=m7 X $"77=m7G $&77=m7v $77=m7G $77=m7!` $77=m7 $B77=n74΀ $"77=n7'V $77=n78C $77=o7 $77=o7 $77=o7e $"77=o71xˀ $:77=o71- $77=o78ـ $77=i7沀 $77=i7e $77=i7*Q $77=i78C A 77=7*Q H$77=k74s $77=k7' $77=k7 $77=p70G $77=p7( $\77=p76= $77=p72b $&77=p7u* $&77=p7" $:77=p7X; $777=p71- $777=p7߀ $77=p7p $Q77=q7% $ 77=q7'c A77=7&% $!77=q7 U $77=q7 $77=q7 $77=q7C $77=q7 $77=q7 h $ 77=q7' $77=q7p $77=q7ׄ $77=r76 $77=r705 $77=r79 $77=r7&% $j77=r7ׄ $77=r7w $77=r7 / $77=r7( $M77=r79 $77=r7I $h77=r7  $77=r7 $77=s7$s $77=s70G $77=s7 $77=s7  $77=s7 $77=s7$s $77=s71xˀ $F77=s7-D $*77=s7v $977=s7% $77=s7G $77=t76= $I77=t7w $Z77=t7z9 $977=t7 $77=t7*Q $p77=t78C $I77=t7 $~77=t7f ${77=t7$[܀ $I77=t705 $77=u71- $i77=u7 $I77=u7G $I77=u7&6 $s77=u73B $77=u7bZ $i77=u7N $77=u7t $`77=u7&% $I77=u78ـ $77=u7 S+ $I77=u7> !$N77=u7#* "$I77=v7/q #$I77=v7;3 $$77=v7 S+ %$I77=v7 &$77=v7+ '$I77=v78ـ ($I77=v7e )$77=v7 *$77=v7" +$77=v705 ,$77=v7À -$77=w7沀 .$77=w7 U /$Z77=w7-L 0$\77=w7:i 1$77=w7 2$77=w7 3$77=w7% 4$77=w72 5$77=w7]J 6$77=x7&6 7$77=x7!` 8$77=x7.} 9$77=x7/ :$77=x7W ;$T77=x7z9 <$`77=x7" =$Z77=y70G >$I77=y7À ?$V77=y7N @$u77=z7 A$77=z7) B$77=z76 C$77={7X; D$I77={7 E$77={7#* F$V77={70G GA77=7! $ 877={7*T $877=|7/ K$877=|7N L$;77=|7 M$;77=|7G N$;77=|7'c O$;77=|76= P$;77=}7 Q$:77=}7f R$:77=}7 / S$:77=}7-L T$:77=}7:i U$:77=}7 V$:77=}7 W$:77=}7% X$:77=}72b Y$:77=}7, Z$:77=}7I [$:77=~7e \$:77=~7*T ]$:77=~77n ^$:77=~7X; _$:77=~7 `$:77=~7#* a$:77=~70G b$:77=~71- c$;77=~7N d$;77=7 e$;77=7) f$e77=75 R gA77=7e h$77=7'V i$77=7 k$77=7 m$77=7k p$77=7) r$77=78C t$877=7 o$877=79 v$877=7'c w$877=76 x$877=7 ! y$877=7 z$877=7&6 {A77=7G |A77=7ܓ }A77=7I ~A77=7 X A77=7 A77=7 A77=79 `7 !7% 7% P!N%7 77  C7705705 "73B757Ĵ (08@P7沀7>7>/tmp/disktab.shadow77 U7 U/tmp/fstab.shadow7"7*T7*T/tmp/resolv.conf.shadow 7,75 R75 R/tmp/hosts 7]J7v7v 7z974΀74΀H$۠7&67,7,PX`hpxn(O . .. catchmodŸ cpXx_ddŸ ddX dfX edXexprŸhostname lnX lsXkillŸmkdirŸ mtX mvX pwd pax rmX shXsttyŸsleepŸsyncŸtestŸ[Xkrraid2clrraid2dmrraid2enrraid2forraid2gprraid2hqraid3crraid3asraid3btraid3duraid3evraid3fwraid3gxraid3hyrraid3azrraid3b{rraid3c|rraid3d}rraid3e~rraid3frraid3grraid3hbpf0Fbpf1Fbpf2Fbpf3Fbpf4Fbpf5Fbpf6Fbpf7Fbwtwo0cgtwo0cgthree0cgfour0cgsix0cgeight0tcx0Fscsibus0scsibus1scsibus2;scsibus3randomurandom iplipnatFipstate ipauth . ..group< master.passwdpasswd protocols(services(@disktab.shadowAspwd.dbApwd.dbB disktabC fstabD resolv.confE hosts ... ... . ..fsck_ffsfsckxrebootxhaltx x_ifconfigifconfiginit_sxinitxmknodxmountx mount_cd9660x mount_ffs mount_nfsnewfsx mount_mfspingxroutexshutdownslattachumountx disklabell mount_kernfsx ... . .. bin dev etc mntmnt2sbin tmp usr varinstbin install.subinstallupgrade,kern?netbsdF.profile(G install.md(Hboot_ . .. bin mdec sbinshare . .. tarcpioahchflagschgrpah ftpgzipahgunziphgzcatah sedsortah tip basename cksum sum! gawk" awk# getopt$ netstat% rsh& tset' reset( viP) less* more . ...boot Hboot.net(bootxxH installbootbinstall( . ..chown(chroot(update(+ sysctl . ..misczoneinfoi keymaps . ..>termcap . ..AfricaAtlantici Indian AntarcticaAsia= Australia HPacificpEurope WET CET MET EETAmerica Etc(Factory)SystemV7ArcticEST5EDTCST6CDTMST7MDTPST8PDT EST MSTm HST8 US GMT9Brazil:Canada;ChileCubaEgyptsEireq GBX GMT+0 GMT-0 GMT0  GreenwichHongkongIceland IranIsraelJamaicaJapanT KwajaleinLibyaޔ<MexicoNavajo[ NZX\NZ-CHAT PRCPolandPortugal ROC ROK$ Singapore<Turkey UCT UTC  UniversalW-SU Zulu=Mideast$ posixrules . ..amigasataris ... ... . ..- tmpwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: news:*:8: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: staff:*:20:root guest:*:31:root nobody:*:39: utmp:*:45: ingres:*:74:ingres dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/csh toor:*:0:0::0:0:Bourne-again Superuser:/root:/bin/sh daemon:*:1:31::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin news:*:6:8::0:0:Network News:/var/spool/news:/sbin/nologin games:*:7:13::0:0:Games pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:Postfix pseudo-user:/var/spool/postfix:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin ingres:*:267:74::0:0:& Group:/usr/ingres:/sbin/nologin falken:*:32766:31::0:0:Prof. Stephen &:/usr/games:/usr/games/wargames root:*:0:0:Charlie &:/root:/bin/csh toor:*:0:0:Bourne-again Superuser:/root:/bin/sh daemon:*:1:31:The devil himself:/:/sbin/nologin operator:*:2:5:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin news:*:6:8:Network News:/var/spool/news:/sbin/nologin games:*:7:13:Games pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12:Postfix pseudo-user:/var/spool/postfix:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico nobody:*:32767:39:Unprivileged user:/nonexistent:/sbin/nologin ingres:*:267:74:& Group:/usr/ingres:/sbin/nologin falken:*:32766:31:Prof. Stephen &:/usr/games:/usr/games/wargames ne." ) < $_fstab }     @D, @' n$`'P$+#@  /P@ / "% %@@$NetBSD: crt0.c,v 1.27 1999/01/22 11:29:17 mycroft Exp $%s: %s not compiled in instbin㿘@W@`J@  @L@ @_ /  @P H`  H@ "  2  €  8`@r@!㿘 ?@?`Usage: %s ..., where is one of: %s㿘'b@I8PH H)+@!6@  O48@6"P@8@1bX`@ 8@)"P@+ pwd[testhaltrebootumountupdateddx_ddhostnamemkdir-shshmountchgrpchownlncpiotarpaxsyncfsckfsck_ffsrouteftpbasenamechmodsedrshexprifconfigx_ifconfigsumcksumdfsortnetstatsysctlcatedmvnfsmount_nfsmount_kernfsgetoptkillmtsleepcd9660mount_cd9660ffsmount_ffsslattachtipcpmount_mfsnewfsshutdowndisklabelresettsetlsrmpingviinitinit_smknodawkgawksttychflagschrootgzcatgunzipgzipmoreless㿘@&Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘 ?@1?@  "  >"<"! @ ? /"H@ !("0 !   @_ ?@$?쀢 "h@09 seek errorread errorWaiting for data㿘)! `$  2 `( ,aa 2 a ! ?a!   "t a@ 2$!a  $ & & a $*  @ ? " a4a2?@ a`2``P` 2`  ?@1 ? a2 :  #@/ @9y?: P"Ȁ? " `  ?*#" a`  Q`!h     *  $` " @- ?ڀ   #@/ @9m !`aY 쀢   `@1 a`<  B;` & "` ;`0` #@/ @  "T`2?a" ( " "& &"`#! ( @ Za  ch_ungetchar overrun㿘? P"Ȁ #@// P""ȁFinishing logfile㿘#Y`쀢 $P̀ ! 0 4? "  @/G !ˀ @&?"T@0`?Y$`" Warning: log file is incomplete㿘+a cB  gB + 3`    ; ) 'Ya 2@` @0q`  a@2`` @.Ȓ   a"  2  2 㿘@ T? 4] @ 8X  cF *2 #a : 1 @*Ð $aa`46 `80  `@?"T`a`2 `@   $+  cF + 3` @; 2* @ * @ f ( 㿘1!` @H` !:0@:? 1  2 @I?"T 㿘  r  !@  @@ ` &@@ 2`! " $" (??0 2%08$(( 8㿘!!$@ (  ?! ?`(#4`$ "`("`( "`$㿘1!`( ?"`(`$$#?`  ! !?# $" (" $!$@ ( @ jCannot allocate %d buffers㿐#a` a% @W a!x & @-r'! 2a@$?  @a seek error to 0㿘!! ??.:0  ?"  2" a@U a  ; 0 0;  4# $# ( ?? ?# ; 0!   @. ? # @-) 㿘 @$ a?   " # ## "@" 㿘#a@ a! #`@,#!@ !a" 㿘  @. ?  㿘#Y`@! $$! @^ 8?" ??  " : 0" `$!" "" " : " $ " (Ӑ `!` ?"``@!!` ?""` V㿘#a`  a a` 2   ?@.Q` ?"`  @,aY`$a@h 8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘N!؀` : + *:  9   06,  . c(0 b cc(0     * N?? @,. @# "' @*,@8@,# @" ,@? ` N "؀@,@`@*,@invalid charset name㿘 " N P "Ѐ` "@﯐ "    2 @+ @"  㿘a0@L #D  aؔ   *@ "*@*@ `*s<%X> J *#PJ k"Psd P  uP P    P  P   P LESSBINFMTLESSCHARSETLESSCHARDEF㿘@ ڐ"x@ Ր"v @ ΐ"  J@  0    %cESC^%c㿘   1cP 1cX@Ð!! P @ݐ P1c`#1@!а!Ё"!("a"܁"㿘@5"!"aЁ㿘@*@Ð!@"@!Ԓ@$!ԁ㿘@#Ё㿘@4'J`#)J@@a!@@ @*u@aД@$a$J ؀@؀@㿘#aԀ@  @5!aԐ? $!a#Д"a؁㿘'%+)" 2  aܑ: #Р  L@ M`@OᨠԒ"@ 2`@:` &L@#А$@a%a㿘'%-+" 2  ܒcБ:  @  cР?L@!ᨢ@Ԓ"@ 2`@:`@ cА$a%`㿘%J ( #@a!!@@ @!aД@@  J `ؐ`@)$@aа @$aЁ㿘#a#Ѐ@J!@Ѱ!!!В@ aaؐ@$a!Д"$!@4_N   㿘#Т@!@3Ű 0@ؒ@ *  @*`@ : @ذ *@㿘1!!ؐ#Т@! !J   *J`2 aPcL 2  !ؐЀ@ L#Ѐ   㿘!J@T 㿘1!Ѐ J? !ؠ J?` a؀@!J?   !J?` !؀@!؁ 㿘1!J`  !J@ 0 !J` !J@ !؁ 㿘J#Ѐ`"!*@YPcL`? P L㿘!P#L @3  0)q@3 #L ` @" #L ` 2##!$!N` !ذ *@N!ذ *㿘@Ɛ "  @Œ 2 2 @ @$ $ $  "@& & 㿘P#L ҒcЁ㿘P#LPc @?  `@ `d!|*` €HHGG$GG8HIHdHII0ITITIlI|IlIlIDI|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|I|HP "cP7"c!P!"#J`!ذ!J`  !!J@ !!J` 2| !J@ s !!%P@ "# !J?`  !!؀@!!ؒЀ - !J?` "S !؀@!K P"#A"a 0@1P!"#J`"9 !J@ 0 P"#, P"c'P"c"PA"cP/"cP`"c "aP"c  @ P"# 㿘 *`:   @1L   㿘!!آJ  !؀ !J`!JaJ@!#Ѐ@(: J "6 !Ѐ.  PPJc J#   J  "J "  !ؒа?  N? ? 8N?㿘'䀢 @'E$ "%`"!@'8 #aؒ "@ a$"@盒aP *J L " @ ͐a$*@?㿘   1 #@ !@ !LESSSEPARATOR/㿘%P  !!䀢J  !$!$!@  ̒ !!ǐ$!#1 a!쀢@! a!$ 2"$@! a#Ѐ@ JPJ# 2@" P  ` $@0 㿘a "a@+  ǐ  㿘@s#Ё#Н㿘@05@%㿘o"#4v<4 @ Non-match First-file EOF-ignore Keep-pos Regex-off /?㿘!#8   :"c4c8 @!<"#8! 5"#8  ."#8 "'"#8"  ##8 "## Pc !done|done㿘c4`* |*` €Q(RRRQQ@RRRRQ(RRRRRRRRRRRRRRRRRRRQQRRRRRRRRRRQ<@W0_`L@ + @ "`!Y ؀ `@% @`K$ @mG$ #D!L#@@ ?,#@L` #<+L@07L@ #<$L`00!`,@ ǐ0(L@ ! !P#T @%@ $#T!`P#T  @C`(0 !` JH@ 0@% 㿐'4`/"*` €SVVVVU SVVVVVVVVU VVVVVVSVVVVVVVVVVVVVVVVVVVVVVVVS?Ѐ @  d "c<G$4 "X !܀ #Lc@  + - + -! #D "cD "cD ,@@ א  L@#D@ؒ`  L@ + -o,c@@ ϐ  -/// /^ v  [ ?`;M !H*` €V8V@V\V\V\V\VHV\V\VXV\V\V\VPV\V\V\V\V\V\V\V\V\V\V\V\V\V\VXV\V\V\V\V\V\V\V\V8V\V\V\V\V\V\V\V\V\V\V\V\V\V\V\V\V\V\V\V\V\V@  ! " @c8  ,"c80  ϐ 4  ?݀   x Y 㿘@% ap? ap?ap  @H 0apap@C0 !h`!" @$"$"[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘P#P`"Ѐ@=" `!`  Y@`܀ @ !!  @.@##x@.$!@(L @#{ :0@-@#a @##@-less version %s㿐Zc' @#㿘PP`"Ѐ@"PJ"P @$ #4   g   0 @4ungetcc overflow㿘PP`"В"P#4@**@!@# @v `"P㿘@N? Lޠ?:LPattern not found㿘@E!#8! @ @ #8@=0+  >$#8!@  @   ` #8@1#8 `$#8耊`"x@#M `@:%s@/\less/\help/\file/\@Command not availableExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN!(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈b,1 2  :  -ʦ%Т  e/%5+3%4bT$<  .@@2@"(`@?@,~bT 耥 e bT ߀ e, e4 "/=  4 "/   '/'@쀢` ?g?`c "*` €a`bPd$`(gjehb|``Xb$dcbhehftbjxg cbhdh4cha$aLce`D`iii4gle`atij@dHdTddgjjac4jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj]c  XbT<`""< @$<y< @  0$<`""< @$<f< @ Ӕ 0<  $<ZR<<  $<QT<<  $<H<@ <  $<><A < @$<2<* 7 (!@bT $"  "  @ 3 bT bT $" " 20< 4% В @  0< 4%В @ k 0 (@0@l<  $<<@D<  d$< d d$<@<0< @v<$<  :@0n j@%'#TpY ܀`  @ې  O쀢 @J@ <  $8$<žh< `$8 $<D< 8< $8` $<w< 0#8 8 ?  ? < " $<`<j  $88 8 ?  ? "@8< `$8 $<zE<O @+ĞF 7@#0!`P#4c/ 0!`* Y@ j`@hc耢 2Qϐ#!`ɐ P#H`@  '@$i @G 0<  $<@ " `!!` < <@H < $ H ' P<  $<@ {<  H '``@ R0m<  $<@ cm xc /  t"D`  QbX@ K!܀@ G` @ 0A`  0W!`BP#H`@ 0K +` } %bX@ !܀@ ` ` @z0` e  bX@ !܀@ ` ` @0!`#@ג 0` %D bX@ !܀@ ․` `  .@9 P#H*H`@' %0`! 0<ʀ`ʐ $< `@$" $<"   <ʀʐ $< `  "`#!h4 ``Ȑ  ː0a ʐ "a@)C0㿘P#X@)!cQ @= C@%h@㿘  @  @&""" ?Warning: some commands disabled㿘Q!ߔ #h@> Warning: some edit commands disabled㿘Q!ǔ #@& Warning: environment variables from lesskey file unavailable㿘Q!   @ @ 9J@K @.`J@ g`"(&"! +`J`g+` f`?J@`J@`J@2``@ ˘  d㿘  d   d 2 㿘Q㿘Q㿐Q ڔ "@H"H("@㿘@J J ?8 㿐@N E28?N n24?N d20? 'J `e'`v`c?0!`x?0Ð 4' 㿘!`2T @@: @`I @9 @    @ؖ ?  @@Ɛ)?@@< "N@? N  M N  +N  G_m LESSKEY.lessCannot use lesskey file "%s"㿐/! "@v@!(   !0'@@x"X C !܀  =  $,@,@ ,@ܰ ` ` 6 d` "  d ` ` d` d ܀?L@ ?0 㿘@4@ & @@  & PPN@  ".@   N@K# @    "`N@J @" `@ *N@㿘`@ @ @*N@  N@ "`@ ` @ J"?8J?  ?J?㿈%Y܀ &@T耢쀢?@@H#Qa "$@@В@ma@֐@a$a$܁㿘 Y@0 @-@/\less/\help/\file/\@%s"%s" may be a binary file. See it anyway? 㿈)Y ܀"ٰ @v ܀`'  @  @Y` @h @U@\'@  W aX@B Q! L'a`@7 ?'C @I '!x@l@X쀤@@P@@L@.x @] '@̐'"` @ `@ !'@쀢 y Y`@̀`Y"`@Q"!"cА@%  @apʔ "8 2!YY 􀢠"$`Y@M Y ؀ !Yj 䀠@a`?"$ $ @@ @'cP4ޒ` "`!x'@@Ӑ 㿈@ o @g  'Y  `@ܢ蠒 @z `!Y@}  @^ ܀ @zƐ@l 㿘Y"`@1 㿘Y"`@9 㿘 #bT  @@  逤  㿘ޔ 㿘Yܒ֔ 㿘ϔ?㿘Yܒǔ?㿘 @ "  @ 㿘1Y ܀ @   ܁㿘 @?㿘@@f    ` @ Missing filename ("less -\?" for help)㿘Q@Ra " x@ @ː !X㿘0@f ?@GWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐5 }@~@ @k Y ` O!'@!? 0T* "4@€llllllllllll~lllllllllllllllllllllllllllll~ld@g!!Y$ @k !Y$   @ ? 쀢 @  ? $ @% !P@ ? 쀢 !'@C@/㿘PJ# L@ @ې@ @ @9 @ ܐPJc J "*%s%s%s/㿘 + L@ '@ Ɛ@ Ð @     8`0@@ @ @@ސHOME㿘 C ˒  㿘 @ 0 )Y'Y`* : `#`%2  @*L *L: @"` % #  ܀ "  @q`@ g ` @א  @b  @ 6`*: `#`%2',@(LL " ,L*: @"` % #2 Y Y ܀  ,@6`@@ ) ` @ϖ ,%s*㿘!` @  @  @ْc@)@ @; @8XS !  @ ?   @֔ @   @   㿘 d@Ւ  d@&,,,@Ȓ @@@, ? $@z  $` ܒ$,LESSMETAESCAPE\㿘!@ !!LESSMETACHARS; '"()<>|&^`\㿘!Q!  . !(!8 $!!!H$!. !@:`@ 㿘ՠ@mL *`ߑ:  `L @"  L  @\ N* Ǒ:  "@ ,N `,SHELL%s -c "%s"%s -c %sr㿘!Ԑ" 5!L 2 @@ @ !b@!@ @  @  !b@ϖ@9!b@Dp@20@DibLESSECHOlessecho%s -p0x%x -d0x%x -- %s㿘Ma 2E!z# !L@ !#X /@Ð@ @Ò PJc PH !@c@@`Ր@DN`@ؐ@֐0@Ӑ@ѐLESSOPEN-㿐!`> 蛐?"+!0 6"a@@ۅ "C L |  8 @l@i @l @01@@  V @D  @D[ ]O&&@@8 o@DLL@` LESSCLOSE㿘!`9 ""@D6"̐" . ) @P0 @@@  @ @ҖӐ@9@7@5@D0@8   <  `?@0   @Ր @ ْ @*Q a @ @"`<  @ *@  @ Qa0@@0@   6ȁ㿘"`@ @ 㿘"`"T`@L??  @ a "a㿘a @,"a...skipping... 㿘    b,?4 "<  b,? O5Q3b  b,?@ @B @b5Qd @ H@@ W@ @? @ @ 5Q@! @"  @ )@5Q ?5Qd 2?#@Ӑ!5Q?,a)ʀ` .  *@?# !  @ ?DCː @R  @L   , @D /ː@% d 3ˀ?b b  Y ` bY!`b  %!b @@?`"`"! "T`a "a &d"&d@9&d@ /?㿘@   b,?ʴ ʰ? "!@? @G`@!@(@z?`@@?㿘" `!`    E@ < @??6 4` , @ *"`@x   @     @??  2 0Ka  "ay 㿘@ ?  `@?@)NQ`    #,?!Y   " 2 㿘`2@Y @ && @" `&@& Y "㿘 ?#  "Y?"㿘 @ q 0@ [& ??> . & & Ȑ㿘 !Y ܀@'$ ѐ@ @ 2YY  2 Y Y 㿘 2ސ  Y㿘Y  "   @ 22  㿘  "   @: `: ( :@ (:` * J   "   " 㿘?ʀ+!̀`Yȕ+   :@ F ? @"H[ @@P? @=??0V '!ˢ $!B? @Ȕ !` 0 ?0B? "T π ?  @a `0"T   ? 㿘 `!̀`Y ȓ*@ :`  @ @@ f   @!?ʐF? s!`+-孠  -#bT \  ?R0f j-T B ?Q`B 䉒 2 @@ɒ}/<B? @  ᔀ 2# @ YD@)?T @I??0 D  @Cannot seek to end of file㿘 ' @ 0E? ˀ2,ː  ,,@Cannot seek to beginning of fileCannot seek to line number %d㿐@?    @0'  '@'! '!@㿈@ؐ@M@lDetermining length of fileDon't know length of file㿘s?  '"@ "e?  '"@W 0@ 2@ D?@㿘㓒 0 { ? OD @Cannot seek to that file position㿘@@ & @?   ?@~    O ( @ 0}@k  @g?   4A! 8 @o@8 㿘@ɻ.㿘@  @ @_Cannot allocate memory㿘@Ȓ 0#x@ = @ JJ "  " 㿘 #"#˒ "(B Y`䀢 "$`@@@r@ w @@͐ń?? 3$8?Ƅ??: Invalid mark letter㿘? . 1‘* "? 1 @  . 1đ*  `Cannot seek to end of fileMark not set㿘 '"1 . $0,! ^)Yİ#`܄  > & 1"#t 1'!@,Yc > & #c!İ#@  Y`$#   ?  ?1!`@  㿘`?㿈  @ ƐY>  > &㿈@ 耢Y쀢? Y  # ;`;`㿈 (Ɛ 耣@2``?2`` ?2 `Y a#   #`;``Y?`?@ ܀ "t Mark not in current file㿘T  Y @ 2 @ ??log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"㿐!`2- p $Y  Y0/0,+" N 2 Y 쀢`2 Y"`ӞH 쀢`Y2 @ 0 |`'2 @@㿘 Y"Line number is required after -l㿐 ' l@`22 Y2"@ 0 "Cannot use lesskey file "%s"㿐 7  3'2@j"@Vtags support is not available㿘  0*Y(" !`2#@M 0@@ @? 0Tags file "%s"㿐 Z  Z00"#Z "cc'3@  @/㿘  Y a"a3^ %s㿐 4  "N@076N@ h"Z m = M! sʰ!`ʰ!`ʰ! `Z#H`#L`!@j &"lʒa*@ 3' @㿘   !&"t$"t㿘   @-㿘    c -" must be followed by 1 or 2 charsquotes %s㿈 "P  "N`0('N` " @N` 3" @P*# N```P*# P*# P #  c 3//'"/@NUse "h" for help㿘   3#@< 0 "ad4,There is no %s option ("less -\?" for help)㿐 'D'    € $$J  J?`0]'D4 *` €000ќpDJ@ +`?kD`g'DY D"J + a'DY"` D@R'DD z?'D@ِ 2  @d'4 @r       / & D) 2    `? ""N  "@@  @+`? "J@ a @q'DD@  " D€ DJ`2PJThere is no %s optionCannot change the %s optionCannot query the %s optionCan't use "-+" or "--" for a string optionCan't use "--" for a numeric option㿐'H@X @'4#P `@@א'4 #h ` @̐'4#@0    HJ@ " @ "l``  "&   ``> 5Z`"P` "` Q`" `M` `?G"` `?B""9` "N@:`" N@6`` @ @ `@a`?` ("4'`#4#"` H`4` @` `  "`"@#@ 05`H  €` @(`  "`   ``  * '`@[` ʐ "ah` @  ` -%s㿘!#5!c@㿘@b    S@ 㿘@V  ` 2`@ String is required after %s㿐͐'6 P@ 㿘aJ㿘N ː *@ * :  $`` @ 2*  Number is required after %s㿐J `-   ?А ? !&'6@!   + .  * :?А `` ?Ѐ$&`2 quotes: Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenYH ` ` "J@ YHhJ  "  ( P  J2J 㿘'D'H'L@%?" @!ʒ $!D?H@GL $!"a@N ?㿘Ɛ"@%( 㿐@b%s: %s㿘 nb@+@3@0 3 8b@#㿘@\ d:  26`@ 6`.  .`@B2`* @ *`B2*@ *   d@ @  㿘@/ d:  2@ @>  d@>  d@ @ 㿐"T`ʐ l"ah M >    0  0@  @  @ .@        @  @  @ @   `@ @9 2   0  0 @ Þ@ Ӟ@ @ 㿘%ZhƠ#0@Y 䀢`  @1ʐ "ah$h㿘aĀ !Z@ n"a!Z!hǐ#/@**@!h*@`$!h㿘N  * : N`㿈6 `2 @U 0,@J  ` -, 耤 $?L?㿘N) *`:  % `N d  s2N@L`  *`:  L`  N@ `@N 㿘@   ?O㿘"#Y``""  "$` @ @ !`䀢"$`ZV 0j!p@ ! Š@ @ u! ʐ "ah)㿘@ @ ZK!@ ʐ "aā㿘!Y 䀢 "$`@ e@ 䀢`"$` 0 @ 7! @ ʐ "ah??? ZZ, ,,08Z*  ",  Za : ",a(8, Za*:?a8,  Z??( :㿈#%b,0@#!Z! @l@ !b,???b,Β b,$$0耢?쀢?!*  :?Z4#? ,  6?Z  42 ( ?㿘, @   Z*  2      , @ Z2`"``"@  ??: , ː ,6?㿘Z+!!$!Z!%!$ Z!"8$ Z"Z"cHZ"Z"cL H `"`H `%qd㿘;c8@ז%d㿘;cp@ʔ㿘`Ȕ"ڒ ?( 㿘? ? ?#b,? ?  b,? -㿘?. > `6< ̓*` € 0LX ǒc@@ K@ 8 D!Yl`<@j`99"h"h`4 ϥ"?5 4+  0(&!e? Ϗ 4 ` τ ?2    Y`܀@  㿘?`6<#*` €4(t8DX4h? wȒ0tbP0pYc`Y`ɞ bž B 8 U`S ` N?0LŐ ? ;64u ' x 0$ǐ#@@ J  "Y*`܀  szr@0y  J:" ?." \ J2 02 0?㿘N l"   p b" 0UT ?* : `2J="*` €&@?&@? &@? &@a&@&@?㿐'%Ȑ@$N 1>X *`:  :) ? %( ."5 ` \`* *$` `*@`#$` N 'm 2 D N  ?'Xq `*` ʔ@@ "!  `*@@ &@㿘ZH 㿘2 2"l!aʒ"@*"@   !Z!"@ "@ Lvh#ZcX Ȑ @Z\ "`@`@̔  \" " " " " " " " (" " $@bX"j m#`n"Y m`2"P m`Ixˀ`KIsˀ`"L m`Ejˀ`Ea,Fc !@"O mg"C md<Tˀi`<"@;K%"@"< m#@3>8!@1p"@03 m.2#+  m( &  m# !  m  m   m   m  m    m    m  m 2cԐ ے ~ݐ ?˚ #X""x''////Ȑ`@ (`@' ' ' ' ' ' ' ' ' $''  @K$cXLESS_TERMCAP_㿈?!ؘ!  '?7@Ð㿘 " J    0 @ #耢`2 @ڐ㿘א "@Z #耢`2?@㿘Đ " #耢`2 @LINESliCOLUMNSco㿐`h @     2 2?ۣ#  @$? "",#( $"", "b,?ۊ#0 `@? "!#8 "!ʐ P"akrklkukdkPkNkh@7kDhа@ X' & /Ȣ@@餐  ,@  ,@ @@闐  3,@`p@@錐  *, @ `'Z /%3Ȣ@Ւ@x ,@ ,@@Ȓ@k ,@`p@@@a` ),`@ h'. @@N ,@`p@@@D` ,`@ p' @@1 ,@`p@@@'` ,`@ x'  `p@@q@` ,@`@ '  `p@@_@` ,@`@ 'В  @M@ ,@@ '  @;@ސ ,@@ '̨  //Ҩѐ@%@Ȑ , ,@@軐 , "[/А//@ @謐bx ,bx //@@蚐,`p٘٭TERMunknownhcamxndadbsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll alsr㷈A!H A!P!$#@( 4A $#Aސ!X  $#/J#AҐ!`"b0A͐!h"bLAȐ!p%`AĐ!x$aAא!ʀ "a"aa#!"bd#b8" \"ሀ  "!Ȓc'A!ʒɀ "c  n*!A!ɀ "c'A"cA!ɀ "c'A"c" `Y 耢`A!"A!"c ɐ"c䀢 A"cA!!ɀ $#J AZ "#T$#A!uaɀ`"#ZJ AZ "#T$#A!_ɀ "J  AA!Z "T"A!M-ɀ %J 2ʐ%"a "a#%ɪAA!a#\c@cAAɐ!a@#\!A"cAɐ"#\@˒cAɐ"Ȗ@#\A"ɀ "c"cA֐" A"(A"0ɀ "cJ AA"("cA"8 "J@ ᘐ  @I @Y@ @'A@^@"A"HĒ "J 2b, @$ @4@֐ @'A@9P"cA"X "A"` "` "c@"ccJ`Q "a` 㿘",!C@r$##㿘N  N@ *`Z "cT*` "N@  ސې6㿘\I &&&@ &A"9& A!&㿘"@`c#!9"b,@$ؔ@b,Z "P㿘"@`%ZP c#!9"b,@ @b,$P㿘c9@ 㿘c9,@㿘c9@ 㿘c@J 9@ג 㿘#J`",9 @ɔ㿘 㿘"`㿘c9,@㿘c9@ 㿘!䀢`cc9@ 㿘c9@ 㿘c9@ 㿘c9@x 㿘c9@o 㿘c9@f 㿘c9@] 㿘c9@T 㿘c9@K 㿘#!9"cԒ @A* cԔ@; 㿘c9@2 㿘@%  D (.  .` 2.(..`@.J D   J  `ZZx|@ 㿘!`)  @1 % @!`''% @, ? ,  @  " ,А , ?% @No previous regular expression㿘 E P 0@  `?"@Invalid pattern㿘b!Z 뫒 @   #Z@֐E  ?cx "$cx@G$cx!Z#| @@䅐 @S  $#|@ؒ" ` 㿘!Z#x "Z@GyZ$#x"#|㿈 `b Z|@Zx @ `? &@ & 㿘#Zc` @{ ??:H$c`:P̀- Z@2' Z`"" 4 2 (2" 4 2 ( 2 㿘` 42  ` @ 2 `4 >`2`` 8>``>`"`` 4 >`2`` 8>``>```@4 `` @8@0&@#㿐I    7    >    2 J@ 2J@> J@ `'@`J`C `ؔJ Ԑ'`JC `"Jˀ 㿀'PD'T A 'PT #P@ _ P T"@8@  :`F @ F : : HT@(N޶ ۶"p`  1Z'-#` 2㿘 \`!"`X㿈耢쀢? Ґ? ?@ 㿘!ʀ"`@㿘h    0'7?"  -!؀`  ? a _  㿈'TdhbT ? \  \`\ 2-?`T `\'\  '    O  ?? ˀ"h 2?X"h/T`- `@@, $䌔X`p   p@ "쀥` 2 ` ` `T` |˺`x!̀` ```2;@ Please re-enter search patternNothing to search㿀`N@ ' 2E] P ` b GU#3à   à  `@ "`@1" @!!Ԁ ~ ' T?`" \!Ԁ " X!" X3à   o"`@à ?? ?*G#8 %??#\#`#d??Ә  à   0 ߴà  r  㿀)' H H\P  H?@ @P PP`@YBȕ+   : 9FP" HP2 H`(  HYȕ+   : F H H2P`(PY ȑ*` :   Ȁ*    * @ :`@ f  2'= H($= H#\#`#d / PP?" 4 2 = H@(= H= H㿘Iap@կ Ta "T-㿘  I`@՜ Ia,@՘ Iap   @Ց  @Վ   @ՊLine numbers turned off㿘"T Q """T @w |   @l  @i @՗@թ Ia,@a  ʐ "ah #%a,a, ʐ 2  : ʒ ""h &Y`Ѐ h "`ʐ "ahI"h" I tagsrNo tags fileNo such tag in tags file㽐ZcIc@'@ I#& "@@Ԑx#ʒ@9 2sL  2m'+ʐ%aD$a@$H'J`_ $a@  `'J  2J@*` ''J`Fa@$a@ 7%H$HJ@` 'J ^'@߅  扒 %aD J@J  \2 ' + 'J  K?ʐ $`?`"L?+@0"@ @I# $a@㿘!!@  ү@z!@$!@Tag not found㿐!H  }D "v ??0=  5˦  /+-T ୔ ?h"J )ʐ,@aDaD@e TL J  T@&!D%!D/dev/tty㿘J#@2 ʀ "aP "aP㿐!ʰ?!Pi ` ?O  "/`!P㿘@ Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r㿘l`LKL 8`@ҭ  file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s 㿘l #MMMਘ `@ѫ`8[!` !%M`8@џ  2㿘l #MMM`ਘ @ь`8Zc  c%M`8@т  2Compilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H 㿘l ! 8MMM `@XMMMaؖ@PMa@LMa@HM@Db.exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' 㿘'D@л'HH#l@@@$`  `M?@b M`*?MD@ H "`H["  @   @  `" hZbP@  @  ZbP@  @  ZbP@ M`b@#   M b@   Z "cM @b  M@b -  ZZ"c"- MbȐ@: @ێ+ %a%Z/Z1Z3Z)M'[`EN!*` €<<<<<<<<<<$<$<$<$<$:<$<$<$<$<$<$<$<$:<$<$<$; ;<;T<$<$<$<$;<$<$;<$<$<$;<$<$<$<$<$<$::::<$:<$:<$<$<$;;0;D<$<$;`;x<$;<$;̐ f$]@WaZ`"Z \"cZ X"cZcؐ S"ctM  ZZ"c"H%B  A&#?&# &c;&#&#8&cZ Z"#2"Z ."c!]@!%a!@Q&D ZZZ""c"Z#Z`"#" M` 8@b0[" & @ nD"H@( C# cZ#&#c܀ !]Z#&cD`! "Z#` aM` 8@ϱc aZ#Ԁ`$ Z]`!M 8@ϞcP@ 0 Z#` Z#Ԁ`o!["aD!䀢 !H* @[$!!D@!@@耢  Z#`![?@?![@   %s: compressed data not %s a terminal. Use -f to force %scompression. read fromwritten todeFor help, type: %s -h stdinfstat(stdin) OK 㿘Z#؀`3-Z+Zc耢 0#Zc! #X@R !%lc!O"` 8O"XO"hcԀ "KO"x" @ O 8@b@  -Z+Z1ZL `O `b  +  b/ `h+`h *` ( * *` *` *` *`c***** %Z#`2 `R@ O@]" $%?@."cZ  "Ѐ "`x@bc[ "`[@ E`c耢 [@0A! #[@Mc[ 9"`l" #RfaR /Ԁ  #` `l Z#쀢`# O 8bԀ l`  p! 8" "@@fMb@h-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s0Pb@# 3 !Z#$#Р`@d <  @ 3 Z#䀢`! ``? ? ? ? ? (? 0? 8? @? H? P? X?@ 6?@0oZ#`2?[l`P  8b@Z#`0[l`P  8b8@͖h%[ '+ZcЀ $ZZ#؀`ZZ#`[l `8P "p`h?  s@ͩ[` * ("`Z#` <#"+ZZ#耢`  $cЀ #@Z#耢`Z#`L ` `+ ` `* `*  `*  `*  `* * * @ 1  h @±!)ش?%#l`P 8@[b@_[ "`@/Z `" x#@#[  $`Z#耢`[@#@8#0cЀ R#% $"#[@ Ԁ #[#`'Z쀢 Z#`l !P+ 8b @ h% 'ZZ#܀ `?"쀢 P hbȐ@!   8@ P"P"K"@![Ԁ #` `l @Ѐ  $`l#`!#П€ ?$`@#cЀ` `@ `@`? cЀ ?+@ 0; 3#Zc !Pb@̫ 8cԀ  l `p ! 8` "  a ` 8p" @"@c  McЀ   8P+b@̆ 8M 8@̂bcЀ @Q`%s: %s: warning, name truncated 0'3[-[+)l/P5R@f @\ 0L+  &`*@!# ? $a@Y@J :%@曒  `8@E@I@: @8a@r&%@S Z #Ԁ`Z#`[ `8@%[`     "`@a@O@w0㿘Z# n "bZ#؀`@`0@D_z-z-gz.tgz.taz.zzp[ R @cЀ "`@ܐ %&@}*@@ʐ@@$?J`/@@" "`@  .Z㿘  h[ @| :Z#Ԁ`  n"쀢`  @~[ "`' @ֈ% Mb@ " )[ @|l   .@|֒@~x%   %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘+%  h@|ZZcԀ K -Z䀢  ZZ#耢`2h Z#`2c Z#쀢` Z䀢 2Z Z#`2U Z#`B[l`S 8a@h8[@Rc@ Rc@  26.S "". .  .  .  ). !Z#쀢` lZ#䀢`[Z#` [l`S 8b @[`     "` "@|7` %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐+Zc؀ Z#Ѐ`# '`l  ( $`l@ / l   0# '`l  ( $`l@ / l   ( $`l@/- x1[ ?& %x3 )T`X&a%#@M    T``@E  T`l  ( $`l@f $ l`T  8`h@h[ #`?e`l# [ "a (  $`l@D  l`T  8`@–h[ #  `T  8`@ɴhc![  $  l`T  8a h@ɡ c![ `$ `l  ( $`l@ `l   ( *` $`l@ * `l   ( *` $`l@ * `l   ( *` $`l@֐ *  Z#``l"#`l @`$`l@ `l @`$`l@ , `l (  $`l@ `l   ( *` $`l@ * %Z쀢  l`T  8aXh@ ;`l %Z (  $`l@} `l   ( *` $`l@n * 쀢 "?l`T  8aph@ ? @`$`l@T ??`l LZ#܀`Z#Ѐ`%Z耢 x  (`l @` $`l@1 *` `l. +@  %Z,  T@:!`l  ( $`l@ *,  耢  `2$ @ x`l @ ( `$`lx 2i `l d&aaȐ@  2`l 2 (@  2e#["a$`l@ 2l? C%#TaА@   Tt"`[ "a4& aؐ@   To !["a%#%& a@v   cs",[  "%#& Z#Ѐ`Z#耢`2  m 8[ "a%#$`l&  $x` ![l`T  8a@h!$ Z#`  l`T  8b@h  ? $ deflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐[b$ `#Zc쀢 "b$W@? (Z#`2.W@7 H)'![ #[`Z#쀢`W  xZ#` W @  a `" @o"@W@ 0~#'l% ?$p$`0#Z#`,??@_  "$p$p@=  "@* *+`(+  @  *@ $@e+# + c쀢  [(.` W @Ė Wp @p [[ " "%`p%   " [" % " $p[ &p "p" @"@W+ @`` @`?0@ڐ ?@?``?`??`  `(?`0??`8`@?`H??`P`X?``??@,? 2,?ʒ@ ,?name too shortcan't recover suffix .internal error in shorten_name㿘@іZcԢ   X@& Ȑa*? 2,X@ , "cSb@}? R ##,? ,? ,? ,? ?,#`@g0 /  L `'X@ɓ?L    ``"ऄ`  `* ,@``@g . 2L`X@̐ L` " @w`%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten # n$b%+ ?2 Y@6 b'ZԀ     D@#     '  h@Ғ 2ll Ԛ`8X"O"xK"   `X 8c@ŴP[Z#؀`;X#8'l 7@8Xc@@š  h ?P@0T`  XcX@Ŕ@ݐ@@ O#DO@ ` YXy X8@|c[`   @ l `P 8@gb@xk[ "` 㿐``$''@  <`  1Z# 2 [l`P 8@Cb[` # "`# +@x< %s: time stamp restored 㿘Z#Ԁ`#쀢'+ $ Z#쀢` & $Y+ 8b@'+ @/! o %Z  ![l`P 8@b![   $  2 @w @.  h["`@ #Zc  ![l`P 8@ؒb  c $ c @wҐ%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@ 3[l`Z 8`x@Ĭ[ :# /X-Z+.)Z@ (@ #@ύ@ϊ #l@uܒ  /,@ @@uԒZ0  `8 @y &`@ Ѥ @X㿘[L ! @j  `"L@ߑ $ ![ @߉$ @X㿘[ ` @Fa+@ ې 㿐#$cܖ $cܐ $cܔ)ؤ#ؐ?,  , ,  3['"#"a 77&`$c@9# 2 c, $c@c5 !#`  `2 , $cܒ , $cܰ#  , @$c@ cܑ2 , `@$c@cܐ@ ##* `$cܗ2 `* $c##ؐ`1, $c@~#cܑ2 , `@$c@t @  /%@`@Ӑ[@cܰ# %. %c@Ycܒ . $c@P#  @ h# , `@&#@>L  c' @$cܐ@  # `+ $cܓ2``+ $cܤ #ؐ`1, $c@cܑ2 , `@$c@cܐ@ #* `$cܗ2 `* $c#ؐ`%, $c@cܑ2 , `@$c@cܐ@!  p # `+ $cܓ2``+ $cܰ p #ؐ`3, $c@ cܑ2 , `@$c@cܐ@  p#* `$cܗ2 `* $c p#ؐ`1, $c@ pcܑ2 , `@$c@  @$㿘cР@ޒ?  @@ p˒@""pbad pack level㿘? \@m "b  @F@[T. @!l$" #`$ " @   @ 6@  tl"c" @#ˀ $b?!ː "b$b! $"@b!" `"" " @ *  #"㿘5l3 c &! @0`$l  ! (@ `^  @  ` ` &~ @6'@` @/'@` @('@` @!'@` @@'@` @'@` @ '@` @"ɲ`'@"ꀦ  ؁㿘'["P%"@ "@ ?;??"6  `@< lc?#@#c؆c $  33 lc   @  2@2@ ` #b "`  t ☐ $b $☁㿘)" "c 39lc ` /ˢc␐  @*`@ c` @*`@ l* ` 0@7@ `%# b  " 8 @#ؒ?c@e" b" &% cl ` ? *  * #c`  *`4 ?0  c $cc @  @ + @ @%&c%  c @( @ c`%$c耡 " ` @c @# c&"!"!"! " " sc ` @ c  @" 㿐" ` E-3ꀢ 5l  9ˢ+7c%c" @*` @ # @ *`    #  # *  l 1  1 `'""c@  # "`  8  ccؐ" 8 c`F Dc "@"'c" `#l1!`  %"%c"  *`@ @ *`  ##*0@ 0 &"$#c    3$c` @" @ c'%c   @L  ` @c @ђ# c%c" $c %"c "`?$c%"! 1%! "  Gc耤c @ ` @ c @" 㿘!l"c""! "["Ӣ       + @  ( $ @ ሑ(*  `  + [#* Ӡ     Ҕ + @  ( #  **@    $+  !:[#Ӣ ` ҄ + @ *?+  $ @ ?∓( *   + ϐ",  2@Ϙ b,  .   3 2 !Ϙ b, .   3 2!!Ϙ b, .   3 !2!Ϙ b, .   3 !2ΐ @!ϲ`  . 4@   6@@㿘9˰"!$t0̈́  t6?τ  H6? ";3517(7$&a'a&!&|#x.ᄁ㿘цL@.`.`6тH+ ./`@./ @.@*  .@@..bL. *L2@@ L'.` Չ.`L 㿐  ",'      2@?#DϒbL*@ * @<82 ϸ",75ϑ,L,`@* @ `@ 2,    @7 $@* @@ሀ` &ሔ@@@&<π Fτ",-,  2  ,?, @ "?  ?3 * ?`3  ?3 %Ϯ",-ϑ, `"?L%צ,`* @  " @ @Ð$6 $`2?, xτ",  ؖ ** 3@  آ @`"  *` *4 @|2 6  `㿘`1Ѧ 5ѐ"= @&D`?&#@7ц#HL`  #@`*` ##@(2  #@ *2 ј"LcHר נ@ * @  @"@ "@ *`4@ ?-@   a "@ #a#@ @#@2  :   &`? 4Ѩ"LcH/+@*  %@%  cD,  + %*% *@,@%cD 4@ %cD   -@2 @2`% l #@ԦDL*`"&D:㿘?      * ? ;0ς @"- .@0@ .@0@`@ 0`@ 4`H`D0`D0`H         ̲`㿘 ?      JϪ!` `@ "<@ Ϧ!,@2  , @@ `@@ `B ` 4`H`D@`F @`J @         㿘[V"\Q#\ \ϖ`8!  * `2װ? 4 ሔ * `@"ሁ㿘>@ @ @  \Ϥ 8a  *@ @ & ː"c?͐#_block vanished㿘! #ax*@ ?#)[@MV#%[S+נ'aጔ ᔐ 2 2@ "ᔔ`@   @e !!,`` @$!@ 0% @S ϐ @a!!@H #   `͐"@c!!a  $!!@! $!!6 㿘)!x (* `  %!xː".` ג`72 Ґ! ˒a*` ? 2 ͢# Ґ *`> ! @* # > ! *`!@!|+ ,   4@2 $!|(!x* `(! a!x* ` #!(+a[ `$xo2"!x#l[c# #+` !ו. @   @` @!x!|2 @6`4@  !x#@ !|  㿘5x   J Ү",` 7쀌(Ә!x   ,`  -Ҙ! -[* @n["`Ә @d$@-`*`2 `` 2 ! * @@S@`x@$@@Jx 4$@C$-l used on binary file˖   *   @  ˖*     2˖*   @2 #`?2@ 0ᴀ?"a[ t㿘)! "7'!#ܓ.  #ᴀ@ 4 ؐ#* `$#ܓ2``* $# ؔ`c%,@ $#@ H#ܑ2 ,@ `@$#@ >! " . 2`:@4ᴓ.  2%! 0`* 2 㿘)! *!##א ᴒc*@$#ܕ2*@ ($#'א ؐc%,@$#@#ܑ2 ,@ `@$#܀ # a#*  ##@2!%!㿘F'!#ܐ 5ؔ*  $#ܑ6` * $#5آؐ %,@ $#@#ܓ6`,@ $#@#ܐ@ ؐ>`+ `$#ܕ2 `+ $#ܢش>``%,@ $#@#ܓ6,@ $#@آ#5!,@ `@ &@܁ %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘 `l (**@  `  "cЀ #`l** @ * @#P@ " l`e  8&`H[` " ` l`e  8`h   "`2 \\ "T"P l`e  8`@_h[ #  out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈 "#"a @N 5\P  /\T [6  *` @ ( ( +  6 @ +`* @ [ `/\@  ek"@keg"PP a``e> ! ?*` ( ?@  ?( ?* >@  +`*@  ?: ` `+` `+ :  * e 8b@e@"  ? (`3 )1' `l @` &`l@ #-@ &#@# ?@Pe"@P 'T ( 1 3 l` @` & l@ ,@  $ l* +`(*@ (쀢 + ( 1 3 l` @` & l@ ,@  $ l* +`(*@  + *`  ؐ#@[ @e@"l  e@#P F  l`  ?( +`+  @  *`Ҕ #P2-&PZ#Ѐ`Z#` [l`e  8c8@˖h[` 2&P "`l`e  8ch@h[ # &P%T &P%T   'H\ 'L'P'T'X????????'*`   " H2X$#<   , `  , *  ,``,`8 # * ,     / ,`   "  ' "@ `     ,  *`#` H`@*   '?'x'h ְ .'H,@'-xd'|-? ;ؚ|`'x!`x&+  " `@*+  "+ * '`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx''@Ѡ?  @h cԒ X'c$ 'X h"@#@ //'|@$4@, "  "|'|x&/  c/L   / LT"*  /"@P*`  7x 4@, , `@* " #   ,@x@4 @2@x ,@? @ " x$*? @'x @x/.   @ 㿘 ?@v  ? 㿐'L\./` 9  '#''D'H7(+ /`l @ `*%`l@ * `l\,`!$   4! +( l` @ @ `*$ l@m *  l H*  `-\!3쀤`c $4+ 1`(`l @ `*%`l@C * `l,`  *` `ڠ $4+ 1(`l @ `*%`l@ * `l\,`! %  #" $4+ %@%@@% %@ߔ ` @*@  @('#ܨ 2ޠ L ! +( l` @ @ `*$ l@ϐ *L  l D*  `/\!1쀤`c2 B $4+ / (`l @ `*%`l@ * `l,`@  *` `ؠ `$4  +   L@'# `߀# '##  㿘9 7 /&܀ 4 (# %`l @ `*$`l@X *  `l-? ? 4  (# )`l @ @ `*$`l@9 *  `l*5 4 -? 3 -쀦 8.# +(`l` @ `*$`l@ *  `l.2@D%ܦ 4 ۰?' %& x  "<" ??  .   "@! ! .  !"@! p .  !"@p 'p#\\\घ ! !t ( .   "@h 'h#\\\ !\  l tt0 lph  tް l incomplete literal tree incomplete distance tree 㺐;9``  (! ' l @ `*$ l@q *`` l !`4 (! ' l @ `*$ l@S *`` l  `4 (! ' l @ `*$ l@5 *`` l  4XU )\ X/쀤`, 1 )( l @ `*& l@  *`` l, @ *` % 4 ޢ  \ X ,  *` "  '#\       0 \!*`  /@! +( l` @ `*$ l@ *`@  l * @' `$@4` . "   / `! +( l` @ `*$ l@ *`` l `4`?f. ?"@? ]/``! )( l @ `*$ l@c *`` l `4`?"6 . ?"@? - ! )( l @ `*$ l@7 *`` l ` 4Y` ?"  . ?"@?   JZ\!'#\\\' '`घ !  3j 8@c0\a'#\.\\ !\ ̚  j 8@oc8%#0(    0 㿘-+ ` (% 'l @ `*@$l@ *@ l `?& 4` (% 'l @ `*@$l@ *@  l `4`?%` %   㿐%#" $$` !$# "#8 "$#`   l?"l`"@ 㿘' + n %b)l ( @   $ @Ϊ $  ?  b쀢  @~  " p \?`\ 0("ȁ8  l"# l"` "p㿘! n""$ %'@ #@$`  ( Д" @` ``    ?@3 p    ("p# l㿘!#܀  ؒc@% l#ܐ "$#܁㿘!#܀` Z l @ #l #ܒ@ " $#܁㿘@@&@?J J@D  @ *@`J@D 㿘@Q˒ / 2 㿘@Q’ .  @"` _J@ ."*@@ out of memoryargc<=0㿘@@7  e @͐@ @b$N`m#@N`@N`. 2@@<  $@@r  2@n@8 @&@ n@/ @$` 3m@c$N  N " $@$` $ %s: %s: %s 㿘l`n aؖh 8@c%s: %s: warning: %s%s 㿘Z#` l`n  8b(@Hh[`  "` %s: %s: unexpected end of file 㿘l 8nb@. n쀢  @c- h0n b@ h㿘l`nb@ 8+@c %2ld.%1ld%%㿘`1  @4 . "* * @.#@* ?`&@ - -* &@b ?`&@  * &@b!n#p@ @ @㿘@v nI output in compress .Z format not supported 㿘]Ѐ   o"А 8@`؀["   %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.㿀 # `lZ'D'H ( $`l͐ $Z ` ] Z#` [l`o  8aP@Ah[` Z "`Z  , 'Z  l`o  8axh@& [ H ]ت  ``l'!* ''?  !!l  @! *?<* = "  6 ( +   `? (D@@ '䀢?!   p@$ p 䀠 @g "*'  @<!-`?@$!?! '' *  "'쀥-`?@Z$?`@ ' (?' (?'= ((   *  *` : ? oذ(!]؀ 2l%l@ /Z#` !Z H.l #Ѐ oo!,@  l ` ,  ,@"@+,@/غ 97Z%l'4 ؆ؐ@ȁ  2  H$ @'@ ' ؆ؐ@c耥6 l -(2 C䀠2Z#`  Hcl" 㿘+)c!#* 5c& (#% / c& *l@ 4 $l+ &@#䀢?"$#$c耦 ##"c2@  5c%#㿘 "@> 㿘2#"c" Bad table В  +```2@ @  @ *` ` @ 2  7  +` $  `*@  * `0 q!p  @" +`& :2( `3 @`   +`# *``2 * :@`  *@  +``@ 6 "  *@:)'l@ "/+  @ @:$1+``@ 612@*    @(2 32*  *`21*@ 㿘G 2 B @ א!*`@&*א! !2@0=@+%+רȦc* 2   2   2`@   ?-`@ @  ? @*?`@c@ א!*`@&*אȖ  㿘   'ؒؔ a*@@ 6*@, c/2@0S@A'׮!-+ר2 *  #l`   , @ 2az @ 4?        ? @ؐ#*?`@-`@a ,ؐ#*`a$*,ؖ! 㿘!!܀ x  $!,!  '   !?#,*2!ܔ*` ?!$!l`  2 @ . @!2ؒc @㿘#ו*2a* @ l ` 2 . @ 2גa @ ?$ *@@㿘&"!܁㿘"#"c㿘#c?  $c#ט@.@ ` @ :"#? ##s! א ,"c?.@ %0$c&c? !$!" !@.@! ` @  #!? "0΁㿘 "#"a!#  #Zc`2 # "##  invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘ؤ  ("` ) 1 l *  % l ``%@ l/  ( % lq $Ā  s"`Ĥ  3ؒb0 (` l @` % lU $@  asf"Ėb0*   " $ غ!ȸ 75,`'@Ȫ( l @ ` @ % l& `-Ĥ,Ĕb0* `"`Ā ؚ!؅*0@*: "@#@`Ā 4  ؅( cؔ ؒ  ؘ0*" *??"??*@ *c؀@@*@invalid compressed data--length error㿐 "#&"a+ؒb0* @ * ?9''%c'#!ȓ.` @   *   c"%cc@ % (# '`l *  $`l| #%  $#ؔc#" 2@ @ `#23@" 5c,``@ /ج% )(!l *  $lD #% $#c.`#"2@@ @@ c@Ā@jl`t="8 J J  J(8  J  ]a#ȇ((  @""@ *ca#Ȑ" * (  ##@""@ *a#ȅ* (  c@""@ *POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘] a]'D'T !#a "c"#"%aN - +ؐ "cu"# @-"x "#"#- J #cĀ +a!#Ȁ  a䀢@#(]#a䀢 2"]DD "䀢  *@J`-2J  $#aD %*@ u@b a]aؖ !#̘ Ȁ  #a䀢@ # D##̀@Da"D$#%aaD  *#c̀ ]#a@J`-2cJ`cĀ ]f?#a]#a` D  `-`? '#a* @J`-J  -` L@ @    `="`L@  @  @{$@ 2#n$@ŀ2    ]!耢` a*@ u@ 8@bM a@%%a䀤ga%aL@ * `]I#a]!耢`+ ?K `-2 Ku@ 8@ɒb u@ 8@b @% $D  ]+ @]#a]#a!耢` + u@ 8?@c@%N :  :T@`%#@`  "@ `a* @J`-J %]!耢`a* @J`- u@ 8@bc8 au@ 8JcX@Yau#x`%%ae  ,`> %J@ a %a :2J]!耢`u@ 8c@0]"!@ :2=> J :#J@ a] #a%a]#a+%J@ a] #a %aaD *]!耢`u@ 8c@]"!N`:   :@]#a]#a%,`> 㿘   㿘 㿘@"G:g:u:no such group %sno such user %s.%ssetgroupssetgidsetuidSHELL/bin/sh-iP@b  - + # !x n u ? G c0  c %$c%a($a @@ `?怢 g#@*`& @ @a( %DK@ `  @kq a(  @ x a(`h@  ! 0 %7x! @ , ! . ! DJ@ `  @kE ! $@@  @y a( $@h@ d  `%! ؠ$ cDK `  @k  $  @ؐ x $`@ @ @9@ xx@ x@`@u?  @( a(x`@u3 a(  $@# $x`@u&  " `@ߐ 6`x`@u  " x@8`x``@u @0 xx ȔА@  x`@t usage: chroot [-g group] [-G group,group,...] [-u user] newroot [command] 㿘y`@ 8@| 㿘@HLPRinvalid flags: %sinvalid flag: %sfts_open `%s'%s: %s%sfts_read㿈@8   +%y`&y!*` €444444444444444 4,         @@k?Ғ?c@&*  @@`   2 `"@? @' @?А   ' n$@j+   "$쀢 ya @t[ J`"'ya @ D  @耢 ya8@ 6  : '' n`@ U y@aP@t3 ?` 2y#ؓ*` € ,XX쀥`7@-   #y @{Ģa`@r,   !y @{!`@r!    <L "L <L "L < L@ y @*.!h @ 2 6쀢 yap@sِ @{usage: chflags [-R [-H | -L | -P]] flags file ... 㿘za(@ 8@{ uappnd,uchgnodumpopaquesappndarchschg㿘1 !0.!0 za@Uΐ!z! `!z@UŐz@Ua! `!z@U!0za@U!0! `!z@U!0za@U!0! `!z@U!0za@U!0!@ `!z@U!0za@U!0! `!z@U!0za@U!0!`!0` ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐` &@2&'7%zL 3 n L  o   * : `!{ 8*` €(d$hza@  z`@`@@cP@ 2 `@`@@z`?c`@ݔ  2߰ ``za@Д  2Ұ `ǐ &`@ &@za@  2 ` &`@ &@za@  z`:`<@ch@  z`'`~)@a@z  z``cp@n  zcx@g 2i `] Y&`V@ R&@za@O  z``c@C  z`: 5&`3@ .&@a@,  z``c@   zc@ 2 `  &` @ &@  @CH 2& 㿘@ `X PH@80(     werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscardrprntflushbrk㿘@9@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %s㿀|b|`'  @qy 2|bh @qo 2f `&` 2 N|"@o8@ AN u2 N|b@֐ " `N <2 `|b@ː ``( =*@  &@f   |# @o @  |#0 @o@ J`|#X@n@ ``(* N ^N `(`? `-   * `(*  &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 }}a@ a@ gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘} ! @p |` `%}  ( @ @pݠ  2 !}"0@@@pΒ:%lxcflagiflaglflagoflag%ld㿐'H@| : 'H H` 'H-|;}9}7}5}/}H@Aݒbಒ sN@ o@| = !},"@=N@c2 N@@" 2N@Q&  i2 N@@ 2N@E& l2 N@@ؒ 2N@9& o @̒ -&  $| +} N@J@2`  @ 2`   c@  , @@ H'H H@`<TTx(pxh`XPTttyspeedsizesanerowsrawostopostartospeedoldnlnewispeedextproceverythingdeccookedcolumnscolscbreakall㿘@%@illegal option -- %soption requires an argument -- %s㿈@L@ -2&` &``~~aP"' @o 2 # ` `` ~#@mI@ R `"  & &`~#0@m8@ A @ 㿘   D@ 㿘  " $@0 " `  & & & & $㿘@a  & 6 F $  ߆C w   " * +* -* 0" $" 㿘   D@ 㿐   ``' '``@z & 㿘 @a @+ &     " "  " 㿘 @a @  & 㿘  @0 @  ? @c & & 㿘@ac  & 6 D  $ g   cˆ  " " " " $" %d %d 㿘 F"@n D%d 㿘!#@ @nTIOCSETD㿐 `' @ cH@n> TIOCSTART㿘`n@ c@n. TIOCSTOP㿘`o@ސ c@n xph`X P H#@38#03(2 33#@@@@-cdtrctscdtrcts-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5@80(   @@xph`PH 8 -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk  x p h X H @ 8 0 (    @@@@ x h X PH@80( @@  C$CC$C-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho            x p  h  `@ X@-onlretonlret-onocronocr-oxtabsoxtabs-tabstabs-ocrnlocrnl-onlcronlcr-litoutlitout-opostopost㿘`  @{%     ` *@&`  &` X&`   "`"  @{      `*@&` &` =&`  !H`!H  @z     `$*@&`$ &` "&`$  !`!  @zԐ     `*@&` &` &`   tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s%s Ȓ& ```" `"@j @j @j  @j @j @@  @j}@!@jw@`@@jo! @`" @jh!8 @!@! 4 !H `@@  4 !P `@@$ 4 !X `@x@  4 !` `@m@  4 !h `@b@  4 !p `@W@ !x @M@  4 ! `@B@ @ 4 ! `@7@  4 ! `@,@" 4 ! `@!@ !4 @@4 ! `@ @4  !Ȓ `@@4 !В `@@4 !ؒ `@@(" 4 ! `@ܐ@@Ð!  4 " `@͐@! 4 " `@@ @ 4 " `@@  4 " `@@" 4 " `@@$ 4 "( `@@( 4 "0 `@@4  4 "8 `@~@ "H @t@  4 "P `@i@  4 "X `@^@  4 "` `@S@ "  4 "h `@H@ @/"p "x @:@  4 " `@/@  4 " `@$@  4 " `@@  4 " `@@ "  4 " `@@ @"(2 #4 " `@@ #!""  4  # 4  """"@4 "ؒ `@ѐ@4 " `@Ő@4  4 " `@@4  " `@@$ 4 " `@@4 @# `@@4 # `@@4 # `@}@! @b#(|` `%`@ @`  d@%0@b@ 2`@G 0C@D |`` 2 #@cH` ,` " ` ,`@ @( @c @`` 2 ` @g @g` @ ״ ` !#H@g@g(㿘! "8 @gڐ!8$"8 ""<%s: %s %s %s㿘! "8   <"@g”$"8@"8@`H @g""@g  $"8"@g"8$"8%d㿘2 1*#x?  1 "0@ 0 "0 M."0 -*  ^* ? *4* ^*@**"0-aefgaef:g%sTIOCGETDtcgetattrTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@b'H"#< 'K#HX@?V?`(S!4*` €ddddddddddddddddddddddddddddddddddddd  ! n#@  '#``@f  c@H* @x`Pc@H*@I@ "c@H* 'H`@7 `h@fv @ `x@fl `h@"쀢 `@ ` ` H` HHH''@ HH )' 5H /Hǒ )HH@D  `  @Y @@' @>  H`'@d(@1H 'H Đ   @ޔ `@e    `g@쀢 @, @m usage: stty [-a|-e|-g] [-f file] [options] 㿘`@ 8@m 㿘@|%.6gsourcehelpusageversionassignfilefield-separatorcopyrightcopyleftnostalgiaposixlintcompat+F:f:v:W:m:@(#)%s: %s: can't allocate memory (%s)mainsrcfiles-m[fr] option irrelevant-m option usage: -m[fn]=nnnempty argument to --source ignored%s: option requires an argument -- %c POSIXLY_CORRECTenvironment variable `POSIXLY_CORRECT' set: turning on --posixno program㿘@ƶ! a@5 @2 @/ @@;'a,&@!`#b@^   # $#4@  " @7  > |2 "L" "" @;.@+^@ %a nb!#%"b@@lH@!a@= 5u)u&h% l '^%^#u/^1^  &h`f",!u`s`F"#!u `V`Cmጀ`"`d ``WY| "f!u`u`m:s Y`v/m @ ``d`#DK@@ `  `K@ `2`  a* $" K@` ``d *`@`"[$`d X" !u@v `T`d᐀ !u@!"X `J@ r fJ` =A@ "x>`d!u@ `9`d@5`d@1`d@V -`d `K@ @ ߐ"#`d a*@"@"$  l l`"$`d@p  l$`d a, 8@b`d% l!@  H^!`@ጀ 2@P"耢  ᐐ `$@ "ጀ ^ "a@yRc ^ "a?`d`d@"@  `da*"@ *@@ "`$$`d`da,@x@<@H ^!l`@k @+᐀ ^!p`!p!` ^!^!t 2^@ G#8^!p !^^ @"^!x^ "a!`!t  ^@#7!t ^ @~"^@'%"a ^a|  "a|^@kpa| -f progfile [--] [--] 'program' [POSIX or GNU style options]Usage: %s%s%s file ... %s%s%s file ... POSIX options: GNU long options: -f progfile --file=progfile -F fs --field-separator=fs -v var=val --assign=var=val -m[fr]=val -W compat --compat -W copyleft --copyleft -W copyright --copyright  -W help --help -W lint --lint -W posix --posix  -W source=program-text --source=program-text -W usage --usage  -W version --version 㿐!,! 8 !#`b8#\@Ր"h@;"@;ߒ"@;ے"@;ג"@;Ӓ#@;ϒ#@;˒#8@;ǒ#X@;Ò#p@;#@;#@;#@;#@;@j㿘! 8^"@;^#@;_ @;@-Ft does not set FS to tab in POSIX awk㿘!D `<@ @5N`tN  ^!`@!^!` ^!` .@L @5!@/$ARGVARGC㿐aL!"p <@C @D%  $@4 c@2@'@4 $@  ' c?@4д@1.  @@4 $@  `2 '!"x a?@4 <@CH @DG"4ERRNOARGINDSUBSEPRSTARTRLENGTHOFMTORSOFSFILENAMEIGNORECASE RS FSFNRNRFIELDWIDTHSNFCONVFMT㿘_!h% @4l a @@4 @B @C"@  `  ENVIRON㿘aL!!( <@Bܔ @Cې n+@ .%a)_#  = =@n "#,@`a@o@4@1T@f@4; $ @`2 ,@ illegal name `%s' in variable assignment㿐'@mݒ = I.#D L `  _"L  L   #DJ `_2 J 2J "8@@ @3`4`@D  `<@ @4}$ ? =.%s: '%s' argument to -v not in 'var=value' form 㿘  a,c 8@ floating point exceptionfatal error: internal errorinternal error line %d, file: %s/work/tmp/mrg/src/gnu/usr.bin/gawk/main.c㿘 ?@ (0 8@F H@ h@r"source=empty argument to -Wsource ignored'%c' -- unknown option, ignored 㿘N* : `m!*` €999999999999999999999999999999999999999999999999999999999979999899989898H999987\99999999999979999899989898H999987\a@`i  @  a@`] b | a@`R  W q a@`G  d^ "ad aА@`: W@j ZNa@`.  K ^^"a"I a@`  <^ "a< ax@`  /  a@`  %  & a@_   N ^@@!  a^!*  # "  #aN 8@aH N awk: bailing out near line 1 㿘a@j 8@>%s, patchlevel %d 㿘`cb 8@Z @g\ 㿘@1 / 2 internal error line %d, file: %s/work/tmp/mrg/src/gnu/usr.bin/gawk/eval.cuse of `break' outside of loop is not portableuse of `break' outside of loop is not alloweduse of `continue' outside of loop is not portableuse of `continue' outside of loop is not allowedstatement has no effect8'D' 'D``` <#aDDD R  `1#a  *` €<<>HHH>H>@BEEF F0FF?G|F@HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHF'D'`  'DD`D`R    #a@l#0 ް   D`D@@  D~`0° "h@A    '° 0D'` b@'` 0D@V@ D`P D`J  _hh` `4"'`'` '`'`'`'`'` '`$'`('`,'`0D''''0@#h    `0"h@Ւ @@  ; _hh` `4"'`'` '`'`'`'`'` '`$'`('`,'`0D'''' @ͮ#h    `0"h@ @@   ch 4_ch' ' ' ' ' ' ' ' ' $' (' ,' 0D'' ` D'0@d#h    @ `|0"h@@  `@p   ch 4_ch'' ' ' ' ' ' ' ' ' $' (' ,' 0D''@ < D `D @'D `' `' R` * 'D'@-S@0@@/l"@ "  @ܐ#h 9  .*@0)_ "hh# Ē##" " " " " " " " " $" (" 4" ," 0"h@!@-`_ "hh#Ē##" " " " " " " " " $" (" 4" ," 0_#` ^!` 1` 2^@@" & ^!`2 @W" #0@` #h@] _#` ^!` 1` 2^@#  & ^!` @5#X #0@> #h@; D@ 0D@ 0D ` DD@, D@+Y@  #0@ @ɰ 0D^@ ."xD "ax `'`>@Ϟ `<!L'^!| "axB@- @& ` @/ #0@ D "ax `'`>@ `<!L'@.L"a  @/\ #@˾ ^!` D `<@#D`"!x` ' > < @@h 0 !L' ` @/- attempt to use array `%s' in a scalar contextfunction `%s' called with space between name and (, %sor used in other expression context%s: %s: can't allocate memory (%s)tree_evaltreeliststrliststrdivision by zero attempteddivision by zero attempted in modillegal type (%d) in tree_evalx '2 T a* 2P!L`K"*` €LORTRDRDRDRDMLNRDRDRDRDRDRDKKRTRTRTRTRTRTN|N|LDRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTLRTRTRTRTRTRTKLRTLxRTLNLMN|RTRTLLLLLLLLLLL@ "'@@ ' cډ@ 2 @ "' '?ɔ c@       c@ư@!А°@*i' c@<@=  @u ! $!x `'`>`<8!L  $!x@+!  @-?? c m @{  "ax `'`> i`<!L  "ax `'`>S`<!L@0F!@ 8"!x '  ' > < ΐ!L  <@" @,s&@-  @- "    *``*` @  nb!#%!`a@a٤@@  nb!#%!`a@aƤ@  2 $@$@`$@@ 2 %x-'@ $x `'`>V %`<L%x   0@x@+ $x$  @ְ$@L  2 nb!#%!`a@ap@M* `, @  @ @,ߐ  `2@,1  `@4 @X@T% $x `'`>`<!L $x `'`>`<!L X  V@p `@,  "@,?瀢`=#p*` €SSSSTT(  ` c 0  ` c 0  ` c 0  `ܔ c 0ؐ  `Ԕ c 0А  `̔ c 0"h@"w  $x? @*. ?耊 " @,4  $x? @* ? "@,#`<!*` €VVVW8WLWWWVWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWtD'F & ` 0? 萂?D0@e !? c 4  c- F`  B@!? c`  B#@!@fZ? c    cF c?@*  @Ր "@В  㿘 2 E  @!   @  7 & ` 2& .  ' $!x > <x   $!x@)5 `@ ` B#  ` @ `"@+,㿘@"\ ``` "!x@)``` "!x@)` @!` @"`@@D#: `؁  4?2   $!x`!0 "`@)y`  $!x`" ` !0 "` @)j` ` 2` &`@u "&division by zero attempted in /=division by zero attempted in %=㿀@'  <@Ò%` $x@?`@( ?` 8  85`0@*`` 2``  B? a  @*~`` ```0 B? a @) & "@) c` $x `'`>`<!L  $x? @(7 ?耊 "@@*=@  <@O@*3``n Г*` €]]]^0^D\菠F腠'D   O a?J a?F? a = @d)? a 4  a- F` 聩 B@C"X荡? a` 聩 B#@3"@d? a    aF a艡?@)&"h@# "function `%s' not definedfunc_calllocal_stackfunction `%s' called with more arguments than declared' 'H'|@8 'x  Bx @ې"xR `@.`'||` nb!#%!`b@]ؖ@|`MHK`c "c@)/ <& ``' `=T` a* ``= @>`> `> `> `  > `"!x`'`> `< @[!L@( &&   "$@)$ @K"萖`!` <## $#@(aL& && $ _c! ch' 4#cch' ' ' ' ' ' ' ' ' $' (' ,' 0''! '' _ |'#! ' ' ' ' ' ' $' (' ,' 0' 4c'`'#cL't@ x0_ t""Ē#" " " " " " " " " 4" $" (" ," 0x"aR H`|0 )`+` 'T` a* @`?Ā   =  $`$`$@ $` 4`  =#@(K#$`%# #`  =@#Ӑ@(6c$$c | |@ " _"c hh" " " " " " " " " $" (" ," 4" 0   6 attempt to access field %d`%s' is a function, assignment is not allowed㿐 `' T a*  `KE"$*` €jkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkikkkkkkkkkkkkkkkkkkkkgdgTkkkkkkkkkkhlhgggglhiili,iL @ݐ `!T!&@`!! &@`!D"&@!!@'f@Ȕ a?@&!`"̰  @&@!!@'R@t a?@&!`"  `&@1!l?!#@!!$@'5@!l a?@&k!$`" #&@!!@'"@8 a?@&W!`"  &@`!< p|&@`x! t&@`p!!l&@`h!d!ld&@T a* ^! $!x `'`>`<!L  $!xB'@$@ ' @&Ő !@ !Ѐ` `&!p#"&@@  'V a* @!N @#  @!"h@$㿐 ` @ `E2 @^ +!!x $!x `'`> $@`<!L$@!x   !0 !x@$ !x @(   @( : `?  @@&H' c?@%}IGNORECASE not supported in compatibility mode㿘^!``^!`  2 "@W x!@`8 "!x`!@ B@$ `! B#  @ $㿘!!d#a` #!x !0 !x@$y !d!x!d $` a#!* 㿘!!#à` #!x !0 !x@$V !!x! $` a#!X*  fmt_indexfmt_listbad FMT specification㿘+`a  !`! @*  %a nb!#%!`b@Z @` "!x!0 )`@$ )`!6a.  O 2! a !`* 2!@"!! *`@$! %a nb!#%!`b@YǤ@@$/!a.  " %!㿘a<`*   "a#a@㿘a`*   ^"ah#a0%s to "%s" failed (%s)standard outputreason unknown㿘! n$"@Y\ +#`^!`` @ @| `@` `!"쀢 "@YY!@4exp argument %g is out of range㿐! $!x `'`>`<!L  $!x @"?   ! n@$! n$"@_?" " "@ Д@#Д c㿐! $!x `'`>`<!L  $!x `'`>`<!L  $!x!0 " @"   $!x !0 @"א!8 `   8_#85L@MM@ M@ 2 ?#@Q " ?`  "8L@M@2?  @w 2? ?"@?` " @$  "'@#' c?@#2㿐?`$%  @t; 0? @_% 㿐! $!x `'`>`<!L  $!x@!?  Œ?    @#@" c㿐! $!x `'`>`<!L  $!x  !0 !x@" !x @#|' `! B? c @" log called with negative argument %g㿐! $!x `'`>`<|!L  $!x@!6?  `a(?@ #Ȓ@ i@]ɒ?    @#%@"] c%s: %s: can't allocate memory (%s)format_treeobuf`l' is meaningless in awk formats; ignored'l' is not permitted in POSIX awk formats*.*%s %s %*s%snot enough arguments to satisfy format string^ ran out for this onetoo many arguments supplied for format string@'D'H'@ x''/ nb!#% a @W10@ HD  x wt'HO %h #;`'@5+)' n. @d$ 2 @Wa @ !0@@n%a@`'Ȅ0''к ''''`OH'H`y #*` €}8888888888888888888888888888888888t8}888888X8~l~~~~~~~~~8888888888888888888888888888t888888888888888888888Ԁ@uO %. @$  nb!#% a @VG0@ $ %,uĀ2OOԀ@``!8'`gЀ А$@H*`: 9@ *`H *  'H?$@O /Ѐ &0 /@ `?! $!x `'`>`<!L$!x B@_@$@ @!dЀ@ " O(`ro/Ѐ Ѐ@ Đ?'`0'_'ĐԀ@̢к`T'^᐀  '^!`!l 2 @ c!8!l`$!lጀ @ {!h'D`"!x` ' > < @8  !L @`p؅B' B' /'Ш  `А '>  (72 '! $!x `'`>`<!L$!x   !0 "!x@?!x` (N 'I! $!x `'`>`<!L$!x `@v !`x -` )D'       @ 0?-@ ` -? -(``?-``0'Ԁ@4'Ԓ  'Ā `0"M - (`Ā2,. @$  nb!#% a @T0@ i ,ФԒ?'Ԕ  '`!X''''! $!x `'`>`<!L$!x `@Ɛ !`ሁ  ` ` g(3p 7D' B'``0'@ȐȨ?-@Ր :1?-? 0-`0 ,;35+ n. @P$ 2 @Sb`a @є0 , ,Ԥ?' ? 0-' 'Ā+Ԁ '3;5+ n. @$  @Sb`a @0,ԤА? 'Ԁ$3;5+ n. @$  @Sb`a @r0ЮА@Ф % Ԁ $';5+) n. @ʒ$  @Sn"` @Ka0,ԤВ@' @ސ̀2 '!$!x (3 `'`>`<!L$!x  @ ! @?`Ԑ 'А  . @i?$  nb!#% a @S0@Đ %/؀ِ -/٨ڀ`-  #- `0"a 0- aa- -  ?-  -  -- Ԙ@@Ӑ%̀HD'!a!a@H 'H^ @f""'75+) n. @$ 2 @R" @na0@$@b  `2 㿘!!x $!x `'`>" $@`<!L$@!x   !0 !x@g !x    `@ΐprintf㿈    @  ` 0#   #\"H @sqrt called with negative argument %g㿐! $!x `'`>`<!L  $!x? @l ? `@r`! 9 D@"D @@\;? c @ substr: length %d at position %d exceeds length of first argument㿐' $x `'`>`<^1!L  $x `'`>`<I1!L   2?` $x `'`>`</1!L ` $x`!7ąB' @ݐ`! 7@ '  B'`"@Ԑ $xB' ?@@'"`@`  $x` !0 "x@<x & `   ` 1@#!L @  ^#":`^!` " @ `@I``@{(!!x $!x `'`> $@`<!L$@!x   !0 !x@ސ !x  2@&0% $!x `'`>`<f!L  $!xB@@'  @$@_`@U d@㿐@& c?@J㿐@ ! $!x `'`>`<%!L   $!x  !0 !x@r !x `" L@   @ @},@  : ,@   "'@͐' c?@print     @ zv# b)/-+ %!x `'`>`<!L `@$@a0`%!x ? " @  !@ʐ  @s@@6 h #\S  " @^  !a#\ > 2!X a #\"h.㿘! $!x `'`>`<X!L   $!x  !0 "!x@!x @    : JD `"`(*@ `* *J  @㿘! $!x `'`>`< !L   $!x  !0 "!x@Z!x @     JD `" h*@ `*  @ *J  @㿐% $x `'`>`<!L  $x `'`>`<!L  $x@d?    $x@X?    " @[  @U@Ui? c @ 㿐! $!x `'`>`<c!L  $!x@?  @Y!?    @@S c㿐! $!x `'`>`<0!L  $!x@?  @Y0?    @@  c㿐1`!   c @|"@| &!@}['`ᨔ c ?@㿐%`!`!  ' c @|p"  @|Đ# 2@$S @|_$!-# $ax `'`>`<!L ! $axB@@$'@|9  `@$ c?@㿐!!x $!x `'`> $@`<!L$@!x   !0 !x@ސ !x @@   @   `$`(@" '?)/    "'@/'!!#@?@%@] a!aH"@@@T aaH c"@Ndo_subbufp'H'D@'D'`# 'Dax''''D $ax  ' > < $!L$ax   !0 ax@` ax ܘ @" ?$  (   @  a c > < 'Ȓ''  `5  ?c 5@5 'ؠax $ax`'` ' >鷐 $ < $!L$ax   !0 "ax@ 'ax'ؐ`` '@ @'쀤#@ nb!#% a8@LŤ@@,@* 耢 'J & \ ' J & \2 *J $`'(  $@6& @9753 n-`@Ւ  @@Lzb 8@W@@ :  ,@ `耢 :$HJ &  @`,@@ `耢 \2 ,@J & \2,@ ,@`*JH`  $@,@` $@H@" ' ܔ& @ ?ܐ%@" @n`  nb!#% a8@L @@ : ,@ ,@ `,@@=$@%% ` @w Ԁ`Ѐ@k@#@ "?# @5 c?@㿘G 㿘A %s: %s:cmd. line:%d: FILENAME=%s FNR=%ld) 㿘#@ X,`P@t#`a `!@t`X!@t``!a 8@t`p%Ȁ $!!\ 8`?`"@  8 (* $ 8@'J (``x@t} 8Ȓ`@tx 8 8@tt@uc`@tl@h㿐'H'L'P'T'X"'DHwarning: 㿐'H'L'P'T'X"@'DHerror: 㿐'H'L'P'T'X"'DyHfatal: 㿐'H'L'P'T'X"Ȓ'DiH@K* can't stat fd %d (%s)0@ "'@$@e?  nb!@J#ג  @ ?Ȁ""؀ ̀ ؀  Ȑ  ؀@  0   ̀ ̀ $%s: %s: can't allocate memory (%s)iop_allociop㿘?) @} 2$! n"#!% @`h@Jx~$@C ! n $?$$$$"$$$get_a_recordiop->buferror reading input: %s㿘``'D?  &?  `  ``*  &&`-d: @@R%@ &`^!` n2"@JF"$aX` ?` ` &` * 2)L!P``   L      *L %   L"y L-: ` @ L    2i`` `? $&`` 2S`  O$`` @,@?!&`@ $`*`@ &```` @   &` n@Ib`@a8aH``` *  ``` @&@)$ $& &@ ``@$&`&` @` h ` D?&``?2 &`` D2&`D?##@?-L;  2  ,`` @ 8 ?J@ `@ &`?L; @2 ,D$#@㿘@ !@N rcannot open file `%s' for reading (%s)-㿐  !`!̀ "$!@$! -`̀  ) ?w@%)!4#`@Ba'@ V`'`+/3a᠔ c?@@ J@ 4!4 ^*@` aa `:2`   !4Ȓؔ @$Ȁ  % n @HbaӒa\@w@@[aa\`"$a "@BĐ $' `Ȁ ̒ ""@ \"@R%́B"aB"at㿐!hJ6 ?  !taȔ#!t#a@ P close of fd %d failed (%s)㿘 2S ! n  $"  @|$$@$ D$#R   Rf ?Rྀ?@y ?2 "!@Hb   > `#ap     @- ap@ap@ 7"@@ @> `?㿘@!%^~  x#Ba xs x ΐ to>>>|<invalid tree type %d in redirect()expression in `%s' redirection only has numeric valueexpression for `%s' redirection has null string value01filename `%s' for `%s' redirection may be result of logical expression%s: %s: can't allocate memory (%s)redirectrpstrwacan't open pipe ("%s") for output (%s)fromcan't open pipe ("%s") for input (%s)internal error line %d, file: %s/work/tmp/mrg/src/gnu/usr.bin/gawk/io.ccan't redirect %s `%s' (%s)㿘ɶ"  `$ !l*` €̪ 7 ` "## #  # #; # $ax `'`>`<!L-^    #@   $ax  !0 "ax@@ax L #x &-` "L 0 c@e  -`L 1c@es -`#-` (@z   2 "  LJ 2  @eS 2  _ "  `     2> @ 2  nb!#% `0@F@ @  2  nb!#% `0@FH @  , a&& & & &  & " & & %  + n?ɤ `@%b!h*` €|(`@7 P4 X`P@  & !@Fb `@ !&`@ `!@FN  a@ &  !`-@Q?'#R X& R`"& R`2 & @Q & @'  "  @ "  & `2.  #`逢 8&@; ?ɀ  b!@E!є     @p `2  "V  @aclose of "%s" failed (%s).too many pipes or input files open㿘`!` ``2 %` "`@`"``@! n$@@QI$"쀢 "@E`a$``2``x 㿐!!x $!x `'`>= &`<!L&!x   !0 !x@ !x`! " @yn   2 "   JK@2   @cǒ "      @͐ @Q#@* ' c?   c@pipefileno explicit close of %s "%s" providedfailure status (%d) on %s close of "%s" (%s)㿘 l `#f X2@0a% n ` $@ @"` @P  @ `@@[@$` `""``" ""`@D^a `"Д^!`2`!!`@H@@xȐ@ !`"```"``` "`" "!@`@error writing standard output (%s).error writing standard error (%s).%s flush of "%s" failed (%s).㿘#) n%"@   !"@Dz 8 @`X  "!@Dn , `!`%/-+@ "`` "`@k "`@ b` @DK"``2@㿘`!% n  $#^ "a 2  2 c@<  !@D$  @0`X  !@D ֐ 㿘N r"  w a  &"   ܒ"}/dev/stdinstdoutstderrfd/file `%s' is a directory(Ӑ^a g?L - /b@K  L /Y?cp@b?  Q?@b?K?L  s  cx@K̐ 2N@??k  $ $  $  $  $  $  $  `@O$ 0?%d 㻘N` g i!#@@Ģ !#@@l_#@@Ԡ@ Ē@v  @F %d %d %d %dcould not find groups: %s%dX#@zc@Ԅ@~@Ԅ@ @vȐ @Ւ   nb!@B# @6  ),,`@ x @v`@ ,,@v8  @ /dev/user/dev/pgrpid/dev/ppid/dev/pid/dev/stderr/dev/stdout/dev/stdin/dev/fd/could not open %s, mode `%s'0L^a T?L - /b@Jb 2 LFR#  0\ /?cp@`  7@`?1`!Ь     5 "LJ@2 @` 2@ ϰ '˔" `,ݠ ,@`[!@[  <  #͒6㿐' @k  @k  @k -`(+ n  ? @2 $  `$ @ې $   +$ 2 b쀢  @ ע@Հ@j @jݐ @jڐ cannot open pipe "%s" (%s)close of stdout in child failed (%s)dup of pipe failed (%s)close of pipe failed (%s)close of stdin in child failed (%s)/bin/shsh-ccannot fork for "%s" (%s)㿐@O  # nb!@AY 7@^ A@\ ? # n!b@AG!&@T b!@A<!0@E?"!@@? !b@A+!H @4 ?2 b!@A!h!a@) @jy   nb!@A !@&`?  nb!@@!HېD&` 㿘a  ? $ : ?$  $  㿈 '-^)+  2 ' ,   cC 2 ` @@ !`'@ E@@t@  !`"/ s c   k c!h'J@+`쀢 @@!`'@ @@t@ p !`"/ I c?$   6$2 atȒ` "%at` @  <'  @ @@t]@ 2 $@ `2 €"j   c@ 㿘@.:/usr/local/lib/awk:/usr/lib/awkAWKPATH㻘N - ^b@H5 ^Z !`Pa`c4  "c4@V{" `L `"#0`c0@D / 5a#/L   : @ *@ L`  @   J / /*@` @Ba؀ 6L : L  `  `2/a%s: %s: can't allocate memory (%s)init_fieldsfields_arrnodes㿘@{ ' $p nb!#% H`p@?{@g ) %"0 nb!#% H`p@?g`c "c@ !L; ; ; ; p; "0#@"@pD@@ $ ","Ёset_field㿘 +*`ap@ %ap nb!#% Ha@?D!)"0@ %"0 nb!#% Ha@?/ '`@ 4"$@#`%c $c@ zL,  8 8 8 8 "08 ap#@"$@㿘`#@ "0.  !p "`"` 2`" rebuild_recordops㿘!d#@   $ax !0 ax@ ax1-!lp* @  +`  $ax` a0ax@̐ ax p !l@S?, @u  al nb!#% Hc@>valp* @`1-@   ,@ `!l @ @ !lp* @ !l ,@ `!l@ٔ@!lp*` (@ < p@ p"@ "Ё㿘#`c<? "al  %p, @ @ Ǡ c< p"$c<p@ @b(  !",@ "b(aD@$","0  "`" *`"02 p"@p@ #!А 2㿘!!p` "x !p!0 "!p@ !p  㿘!$'@`l "!x@B@\ @$`#@l ` al`#<`@ %)p,`@@ Q`p!Ll@ ""!Ё㿘@`#c<\ Y!hJ@2=!P`7L   . *L(2 ( $@     $ @ " @ (   @  $@@ G ?р  @$@ &@㿘@`#c<\ 8 2  @@*&@ $,    *LL "  L   $ @ ,@&@㿘@`#c<\ 7!hJ@2 2    @ #,@ @,@* : L L 2  $@" ,@ ܀&L,@&@㿘@`#c<\ '`D.   $@4 @2&@&@㿐 .`!Ѐ`"`#al?ap` b$," 8 $ #b$cH#\`"c<$al`#&@aap"!%`< U'l?0<`#!p`"$ap!``"$` " ," 8cH #\"$ap$<` `"$ "$l#" < ``#@ Ґ#<4 $l!paL*"$l$<1!L!p. @㿐@ '  c4 ?@@"second argument of split is not a variable㿈) %!x `'`>`<؍!L@@ `@T %!x @ !0 "@ΐ ' ?T a* ?Ā #x@ː ``!D@%!x   " !x!0 "!x@ `=#8`!x %!x `'`>7 $`<!L$!x   !0 !x@| !x   J` 2!#`X@ x 'c#\#' c?@@Ő``@[ ]+[%c ][\\][%c]㿈!p`# '`8#/耢 $aP@ $8!D@  #!x !0 !x@ !x %#`XK$ !hJ@2#% ?$  J  "$aP "'/07.*b%a $ J  2J$aPJ O O!8`\#"  " `"/'b@O耢 #@n8@ `X$8$  `X@2 $8  !8@ $8 "b(㿘!!` "x!0 !@ ! N"huse of FIELDWIDTHS is a gawk extensionset_FIELDWIDTHSFIELDWIDTHS㿐^!` `L 2^ "L!x^!`j!p`# !T`,""  #!x !0 !x@I  !x -`D``')`#H@}*  %D nb!#% Ha@:D ")`#H *`D%#H@~\*` %D nb!#% Ha@9ה@q;@D," ?" 㿘" `, %s: %s: can't allocate memory (%s)concat_expstr㿘  &,!!x $!x ' > < m$@!L$@!x   !0 !x@ !x3ax &ax `'`>F $`<!L$ax   !0 ax@ ax  !|@  @`@}4 2  nb!#%#`@9X 5 @|”   @А  ]%975` , @|`x $x `'`> $@`<!L$@ax   !0 ax@$ ax  @}\$ 2   n@8b#ܔ  @|h   @v  `$@ɔ `4㿘  ( ,`" '`@@U`@S`$$@ 2@ "  @} ?" @6 & & &㿘`O ```J2  ̓*` €x\@$J. @. @"@J. @. @"@J. @. @"@J. @. @"@J. @. @"@J. @. @"@J. @. @"@J. @. @"@Ȗ @k㿘 . "   د  2  㿘  '2 V a*    h`` }Ӓ  `   @  @ subscript of array `%s' is null string㿘`` "!x`!0 "@ 2`?b  =4$$$@`` 9` 4  ^` ]`@^Y`^!`" ` 2 쇐" a$@}   `@`` `c @"c@  G$`` ?@ $`c , 4 6`@$`6`` "`@`?# @2`.  !L2$`` $@"@ 㿘  '2 V a*   G    * @`" `׽ " @`2`  `@֐`%`" @$@@"@@`@``&@ "? &   @`* ?b  6 &@{n& & 㿘&@&`&`&`   @ null symbol in assoc_next㿘 2 "  "'&  8"&  ` `& @& & @& & :&   *@`2`& @* & & grow_tablenew㿘`#P  ,@ ,@-` !>6 @z  nb!#%#c@6둔@`3   2 & , "`@ * $@$ 2` ,@zА&& 㿐` cp  @ 6 >f+ cDJ `^  J `*J#DJ " `cp0C`?# @6  @ $ % nJ#D `/' @6 >0&$  ,@m>#DJ@ `" ,cD'J@ ` ,쀢 2 $*$ 6 9876543210%ld%s: %s: can't allocate memory (%s)force_strings->stptr݀x? D^`#  `# = @^!h@@iې& Ja3' *`#x   & cP@@iƐ& ?&  @y  &  nb!#%#Xc@5ꆔ  @y  . 6 dupnoder->stptr㿘`?# @ K4 ` 2 `   ,@c "c@?>#> > >    > 6 `>"   . @y'  &  nb!#%#X`@5K( @x   *㿘` @"@ >:@"`2` backslash at end of stringmake_str_node㿐`c "c@s > & 6 & @xא` &  nb!##X@4`ڒ @xh :* @'%^#J `\'@ 6 .@  \限b \.@ ` &@@y$` &  nb!#%#Xb@4¤韔 *@  6  ?& . & 㿘  `2 newnodenextfree㿘@xn/'` $ nb!#%#X`@4n㰐/x: & (&6   (&$㰁㿘  ``?# @  6   `` ?. @x `#"#&Posix does not allow "\x" escapesno hex digits in \x escape sequence㿘J  x$"t.  €                                                                                       X`   h       p   x    l j h f d b ` ^???Y$?В J  / $ 74*?E$``$@ ^!` @ 2^ "@C!^!`- xK cD  `D` 1" x  JD ` D $cD  *Ѐ ɐ $ @(#)Gnu Awk (gawk) 2.15%s: %s: can't allocate memory (%s)make_regexpdestinternal error line %d, file: %s/work/tmp/mrg/src/gnu/usr.bin/gawk/re.crprp->pat.bufferrp->pat.fastmap%s: /%s/㿐`@v'  nb!#% "(bP@3`@wJ@ \l @`'J`?Ѐ`H]#*` €                                                                         a 6.@"h} L .@ \.@`.@`'.@`'@ `.@@vW 2 nb!#% "(bP@2{X @[ @v@  & nb!#% "(bP@2dA & @v+! &  nb!#% "(bP@2OЖ,_#& & &@@-S " @*@ & 2 &  ,@?  & & @vj㿐  @@' ,@ @>Z.@   2  @# ?㿘@v@@v>  $ " (@v8 ( " @v2 @?' ,@v*㿘㿘 `%8  2L`"``!!x $!x `'`>z &`<!L&!x   !0 !x !x@     "h`!d`@$@ `"`` "T` T` ` `4` *`:  44` @ 25@`!!x $!x `'`> &`<!L&!x   !0 !xd !x$@ `"@̐@8 8 %T` `$` ,`  ,`㿘! @@., whiletouppertolowersystimesystemsubstrsubstrftimesrandsqrtsprintfsplitsinreturnrandprintfprintnextmatchloglengthintindexinifgsubgetlinefunctionfuncforexpexitelsedodeletecoscontinueclosebreakatan2ENDBEGINunexpected newline%.*s^!l!"``'H"!l'D'L'P'T'X; bl61a J    "h "  """dbl  K   ` "   :   ` 0tcP1a @d&   Œ#  0"`   bl@ ^J@ `++  bl ^+  + `DDH @ Ő 8䘒@0Y %s: %s: can't allocate memory (%s)get_src_bufbufcan't open source file "%s" for reading (%s)can't read sourcefile "%s" (%s)㿘-t7^dᄀ@# #^a*` z+t)t#l  @d` %#ld %dd`a*`  1 #!""d"hR&"`tcp 2G1"`J @5l3"bh  "cp L " 8L`+t"##l@s  %ch nb!#%Š"Pbx@/䝔ch@s+#lcha#l# @  &"`*@ "`"ch &l&bh #"d1##l""h"bl&"`"` dᄐ  }%d0c` P)  !` $!!t#h t@s$#ht"cl""h"`"l >'? $P! n!b@/n"LP]1t#h)t`%#l@s #l@s- &#h nb!#%Š"Pbx@/Q.#h  `"bh"*%c`"l%h `  "  L " 8L`"4 1t#h#!a @r$ #h "%"l$h)t'#hP`@u#l`! n!b@/ "2 #hdbl %d`%c`*@%#l ""d"`tokexpandtokstart㿘'tt+a* 1a $t`" @s1  @r &  nb!#%Ơ"Pc@.ˤ㨔 t "t%`source file does not end in newlineunterminated regexp ends with \ at end of fileunterminated regexpunterminated regexp at end of filebackslash not last character on line**= is not allowed by POSIX** is not allowed by POSIXoperator `^=' is not supported in old awkoperator `^' is not supported in old awkunterminated stringInvalid char '%c' in expression yylextokkey%s() is a gawk extensionPOSIX does not allow %s%s is not supported in old awk㿐)"`   "d  J "`J `%"`t|! ^!! "|!t# H! А ` $#"`"h %b`"`Xa l  3a'a$"X /3-`|;"  \ /C!k` d W"`e* ]!^`[!Y "``d@`J@ %b` `J $`   =!` @% \*!"t  /$`,`)`"``bh@%b``*"t  $`t!'ap"|!`bh@%b` `*"t  $`"``d@`J@ %b`L `J $` q ['a3a5#!"``bd@`J@ %b`0 "`J $"` "` ꀢ`"`a`b  l$ ~y&pȐ".  €$8l8l8l8l8l8l8l8l8l$8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l+.%&)48l&&&*&01l(d2222222222&&,,,-|&8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l&%&)8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l8l&6x.|.Xt|! 3^!! ~"|!t# Ұ! Z ` s$#`t ! k"#!! %^-"`tc|!  \"c|!t# ! 9` R$# "``bd@`J@ %b`M "`J $"` Հ `t ! 1""` "d J` %b`+  "`J ` %"``a "ar } _ t $"T"|a $t^"#|"` "d J %b` "`J %"` =^} !`D"` *B"` "d J`=%b`"` "`J `=%"`^!` t 2U  "࢐! N "`"h %b`^!`t t "!@"h %b`t *"c| *"T`$"` "d J`=%b`"`  "`J `=%"`  "`"h %b`t /"c|Ű /"` "d J`=%b`"`e  "`J `=%"` "`"h %b`t %"c| %"` "d J`=%b`"`= "`J `=%"`^!` t 2  "!` "`"h %b`^!` t  t "!t ^"c|X ^"` "d J %b` "`J %"` = +w "`t!!"c|7!!"h %b`t +"c|* +"` "d J %b` "`J %"` = ~ "` "h %b`t !"c| !"` "d J`=%b`"`  "`J `=%"`U "` &p"h %b`t <"c|հ <"` "d J`=%b`"`u  "`J `=%"`+ "` &p"h %b`t! "c|! "` "d J %b`N "`J %"` = > t!&p"|! "` 8t!&p"|! &p"h %b`t >"c|t > t! &p"c|"Tk! t#x t##xc"#|"` ?t! ##x%"`"|Y!  9%7/`#aN; \"``h@%b`K \( "``"d@`J@ %b` `J $` `Ḑ #%Ḓ \*bt   $`  !"``h@%b``*"t  $`"``"d@`J@ %b` `J $` " `!"@&p t`!"` "d J %b` "`J %"` = - t! &p"|ð! "`t!""c|!""h %b`t -"c| -"` "d J %b`R "`J %"` "`"h %b`#D ` .t ."c|!"` "d J %b`' "`J %"`  *"t  $H 9 E 0C` . =  e 7 25 3 20 "`  "d J %b` "`J %"` - + "`*"t  $  `"h %b``  "`"h %b`^!` #tc 2ݐ ` $c*"t  $`@X!? a&p t`!2 "|"` "d J %b` "`J %"` &Z"` &p'6%` #!G "``bd@`J@ %b`i "`J $"` 逦 .  $cD ` "` "h %b`"` "d J %b`; `J $`  #t!"c|"Ty!"h %b`t &"c|l &"` "d J %b` "`J %"` |Z"` &p'6%` #!G "``bd@`J@ %b` "`J $"` 逦 .  $cD ` "` "h %b`"` "d J %b` `J $`  #t! "c|"T! "h %b`t |"c| | _ !#D `#ǐ!#`cD$ `#*"t  $"` "d J %b`t "`J %"` cD ` _"**"t  $`@k@"@ ` nb!#%Ǡ"Pb@'dA`@jΔ"  "`"h %b`^!` !t# 9t ` $#9t ` `  );ǐ2  : ,`*`@`JJ   @/<  EC`^!`` $"@֐b"@ϐ0!@ȐH^!`* d#"`^!`* b*  ~݀` &p  &p@k,*` t |"`&pJ@ (  t!"T"|!t!"c|!㿘`c "c "l "  2J ``a?2 `!2 `!" 㿘ې"" %s() cannot have %d argument%cstring literal as last arg of substitute㿘  ``.  2`.%t*  ` :   ϐ ؀` s G*`  `$`"Ԁ@2`   a   & i`#@   `E"^$@@ X"@ 8@ @,` E`@ &`^   a }  &z @ǐ7$@!`"3$@  @>2,$@̐ '$@#@2#$@`2  D &Y @  @ E`@ `"`2 $@ `  *$@㿘` @"8 @"@"`"` make_for_loopr㿘@i ` nb!#%Р"P`@% ژ`c "c & $$$& 㿘@Y#`c "c F"a|, @ ""@ " ""&`  㿘@Y!!|Ȕ#*  "  2`" NJ 2  @Cה 2 2  t㔔 2t   㔐 2t"   dup_parmsnamesfunction `%s': parameter #%d, `%s', duplicates parameter #%d㿘V  `F @h.`  nb!#%Р"Pb`@%p  ,%   ,/Т@-@ 2  @xٺ  `& @i$4  function name `%s' previously defined㿘@M @ G "١#0 B㿘@X#* | % )` @2`" LJ 2 @C  2 `$#%# $@h0 2 㿘  Ē 㿘`c "c"p '2 `""p"" "ENVIRON㿘#tc L E ђa@,_  $cÐ  `L < @hw㿘  E`c "c E ""2  ""*㿘+a    Ȑ#4,? #. 4'!!ܥ. Ḑ " :@hO ,` )$!$!@hE.  !ܓ,` ?%a ""(%! ?syntax errorBEGIN blocks must have an action partEND blocks must have an action part%s() is a built-in function, it cannot be redefinedplain `print' in BEGIN or END rule should probably be `print ""'file`next file' is a gawk extension`next file' used in BEGIN or END actionnext used in BEGIN or END actionreturn used outside function context`delete array' is a gawk extensionRegular expression on left of assignment.non-redirected getline undefined inside BEGIN or END actionRegular expression on left of MATCH operator.regexp looks like a C comment, but is notRegular expression on left of comparison.call of `length' without parentheses is not portablecall of `length' without parentheses is deprecated by POSIXyacc stack overflow㿐9!5);?&x`'a%! !+!%$%a2@ a␣, R ax  b &x&xb!TR 1x . _+bk#B+ R@ $b(a a qac"R%a2!?!p:$Ā&x b#R x  _!k#B+ R @ !c"PR !  ʐ#a`'aԀ <xb !T`_kc ဖ#Bb#1aR@* P !  !ܡ+ R!!(@ aN  aT`%a2`a!p $ad; !܀@aĒ?%a$aĀ ?V&xaaN+ R@ Đ"* @1?'`>!Ӑ"*` €Q Q Q<___RHQRHRTRRRSSS`__Sx``SSST_T0TTThT__U __``__^\_U`UtUUUV V,V8VLWWWX X0XP^\__XX\p```_Y_Y Y,Y8__YDYX_______YpY|______YY____\pYZZ ZHZZZ[[x[[\ \ \4_\\\p\|\\\_]]$]H]h]|_]`]]]]^^^0^@^P^\^l^l^^`_,_8___D_____`l```````?" "&!&! 2j`"&!` "  "Д " " &!'^p #`  " " $pĐ  # "   Đ  #$p $c&!#`$c'^t  #`  "ߒ " $tĐ  #$t#^alL%! ^alE%!Ē #rg&!Đ  #Ĕ a   b  &_  .\  #,I&!a. @^l @"l=""ps "\&! .^al *"al?"b\$&!  3( &!"\Ē &!bX "bX`c @"cĒ E$`@TĠ눔 $` 톖   $`,`4` $@&!?&!?` ` $ Đ  $ "Ē $ Ē )Ē 2Ē Ġ   +ؔ *Ē Д *  ,  -耢 .& 2#   a   & ^Ā`"#`c  t 2  "ڐ xa? -#` ?@'c^!`!^ ! ^!^! " calҔ"alÐ c 2 S^alҔ"alԸ   Sc  0! 0& Ē 1""\`&a !8!aĒ 3Ē nĒ 4 ^!`!^y!`! ^!^!  alҔ"al{!`Ē O 4Ē %  (Ē %ܒ (ג ;Ԓ 7ђ 8Β 9 @&!@ &Ē &  &Ē & ^!` `E!Ē Ē AĒ :  5^!`#`c  ` 5!Ē 5yĒ tĒ o `E2ڐ!]^a]&!!a J@ *2Xa@S   ?J@*Paӹ"(Ka  鷔 a K Ē 8Ē Ē A0^!` `Eӗ"XĒ Ē Ē %  DĒ  ""TĒ Ē ^!``#` ` 5V!Ē 5Đ ؒ Y@ϒĒ (Ē AĒ % DĒ Ē Ē Ē Ē Ē Ē Ē Ē  !?&!Ē ?&!^!`!^"Đ  ?!u&!ߐ"qa@R" k C&!@bQ^aQ N  `> ` "!x#m<@?&!5   誔 aĒ .3&!/&!Ē )&! `w Ē $&!`?"?"g Ē Ē  &!""T%!a-"@&aa-R " R $Āc%a 2!x: %V &x&xx 9ac"(-R   _bk#B+ R @bc"R b R (a aN  a%a2!:d$쎐#  㿘%t %#b @Fɔ!  a, ``z$, " A * ``Z$* " 0 * ``9$* b  * _$t Unmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit'D'L'@``"    ' t'** L*@  '&'& &/& 2 @`Œ &@`; &  Q &̀ - B  '̐  `r ِ"*` €z                         h   zdzii  n                i                           o`z g                            zzD̐`@ L`2 D@ *   $@  (%@@ *`&&@`  & $@%@`@ %@@$@ %@$@  ݀@ x ̀ L`2 @ ˔*   $@  (%@@ l*`&&@_  d& $@%@`@ %@@$@ %@$@  ݀@ ; Ld +L`  6` @ ? ̐@  >  (  '̐  *'+L` +" +?"+ \̀@    '̐`` + ?2'̐? '̐+@ ? ̐@  ǚ@ ̑+` i$@  * %@@ *`&&@_H  & $@%@`@ %@@$@ %@$@  ݀@  ?OK? `.O .@`&$#`-  "K O` O @`$`L`@ `$ @ ` `$@  $@  *%@@ {*`&&@^  s& $@%@`@ %@@$@ %@$@  ݀@-  $@ @ _   (`$@  (%@@ ?*`&&@^  7& $@%@`@ %@@$@ %@$@  ݀@ @ ) `$@  )%@@ *`&&@^p  & $@%@`@ %@@$@ %@$@  ݀@ِ ̀׮ $@  "  , %@Ց* &&@^; & %$@@`@ %@@$@ "%@$@  "  ڐ  $@  )%@@*`&&@^  & $@%@`@ %@@$@ %@$@  ݀@̔J``^  *K ^2 ''Ȑ$@  * %@@f*`&&@] ^& $@%@`@ %@@$@ %@$@  ݀@ ,@` @B۔ La׀@ ` ,`̀`-"K ]+ `-2KD? ?K? [?* KK? [2KK? ^K ]LK -LK  ] '̐L@ 0``[2`K : ` '̘ܲ 0 ,̲`ڒ  '̀   :  ]@` `:K,J`]2Gق`@ `?/`@ ٔ`?`/@ ؒٔ`?`/@ Вٔ`?`/@ Ȓٔ`?`/@ ٰ``?/@ ٔ`?`/@ ٴ`Д`?/@ ٲ`ؔ`?/@ ٤``?/w@ ٮ``?/o@ `?/g`@  K̒@  E̒@ | >ق`@ u 7ق`@ n 1̒@ h +̒@ b $ق`Ȓ@ [ ̒@ U ق`@ N ق`@ G  ق`@ @  ̀  ' '\'Twog\`cD `_ cD `W  Q P cD ` H T`cD `? `cD  ``6 cD `. cD  ``% cD ` cD ` cD ` " cD  `D`"   2` @ ` * ,@   \  `   ̔? '̀` `  `` ,`  ,`2` ` @  * @,@  ̀@S` @L'̀ ` \2 E` ` '̐``2` @ ` * ,@  `] ̐`  ,  ?` @L@2f L@`_ LhdY L @dR L"@@ 0Ì    ـ`U;'ސ#4*` €|~DpDL@ۀ Đ `'Ā &**@ @Z*` '* '* % * "`* * @%@ "`"`*` * $@ " * đ* @`?"`* * $@ @"`$@  &%@@B*`&&@Z :& $@`@%@@$@ %@$@  ߀@ ,@Ģ`,@`,@`  '  L@R  `@J  :$@  * 3@@*`&&@Z[ & $@%@`@ %@@$@ %@$@  ݀@ ,@``$@  @Β`2 L@  *` * '@ @   ?  * @*`@   @*$@  (%@@*`&&@Y & $@%@`@ %@@$@ %@$@  ݀@ ,@`,@L!@ Ld $@  *$@%@@X*`&&@Y P& $@%@`@ %@@$@ %@$@  ݀@$@@A  ``$@@+ $@  '%@@*`&&@Y & $@`@%@@$@ %@$@  ߀@` լLb7"@@2D̀@+ ̮?? ?L@  ۰  ' #D& -* ̐ @? @` '̐   `뀥,2+̀!  '̐ #D& , * ̐ @? @` '̐   `뀤 ##LL@}\̀s  '̐ } L@ j  L` [` 6 $@  (%@@R*`&&@X J& $@%@`@ %@@$@ %@$@  ݀@$@ @<`  $@ * 1@@*`&&@X &@ $@%@`@ %@@$@ %@$@ ݀@ `$ $? @  @  Ϣ`?$ @`$@ @` '   '̐ L@ D@ J \ 0t#  $@  )%@@*`&&@X  & $@%@`@ %@@$@ %@$@  ݀@u t# Ā $@  )%@@p*`&&@W h& $@%@`@ %@@$@ %@$@  ݀@? t#  $@  (%@@;*`&&@W 3& $@%@`@ %@@$@ %@$@  ݀@  t# Y $@  (%@@*`&&@Wl & $@%@`@ %@@$@ %@$@  ݀@Ր t# $ $@  (%@@ё*`&&@W7 & $@%@`@ %@@$@ %@$@  ݀@ t#  $@  (%@@*`&&@W & $@%@`@ %@@$@ %@$@  ݀@k t#  $@  (%@@g*`&&@V _& $@%@`@ %@@$@ %@$@  ݀@6 t#  $@  (%@@2*`&&@V *& $@%@`@ %@@$@ %@$@  ݀@ ,@`L@O Ē`@'''@vБ*  > $@  )%@@*`&&@VP & $@%@`@ %@@$@ %@$@  ݀@ ,@`,@`L`} 2  "0   2*`&K *" ^L` \ bK  + ?LbE@J@ { ? \2;K  {27$@  )3@@*`&&@U w& $@%@`@ %@@$@ %@$@  ݀@ ,@`,@`$@  (*,@3@@K*`&&@U C& $@%@`@ %@@$@ %@$@  ݀@,@`  -̘`$@@   @Um $@ &          *@*`:*`*@*`:*`*`:*`㿘  *㿘  ?? +ې H\`?J`(  2 2  `| 2 2 J `\`?     `)  H)"  `J|"  0 H|"    * (     @ "@( &  "    8 8  (@@ * 㿈    @ ` '.? '' @9Ɣ! /  &  2` @ * @& *'  @``"*` €`pT     ` T  ` , @* ? ʢ`  : *  @" : 2,  @*  *  , $, @* ? `  : *  @" : ",  " J `", $J  "  J 2, $J |  *? 6* @2 m, k z L` @* `b@ @  ]@` @L`* `@ R@*@K@H'L` @* `@  쀢t#쀢 8D?*#`*@RȐ  '* '*" '   & - @` ` @L`* @` `Ŭ ``@8 @@ @ 2  *` &   `(#`"`"@ "``(#`"`"@"`㿈#\#`#d @ 㿐\ `d4??> 4$ ` `  `  4w? ``2  `t? `g?$ ? ?`A@  ; * &$&@` #@ @O@ ` ?? #@ O@`#@&@&`2 J   2 #\`"#\ 6?#\#`@ ?  ?㿐#\#` @ H'D 'H` ' `''L''T'X!!'''' ''''''` K' '쀢`:')   ?#`#`'̜#`#'Ȉ`#'Ă`#'`#`#'`''#̈``&'Ȁ "Ā` `` ` ?X`LTX?а #7!;=##0`. ! @ Ȱ ! @  " T` H L'T'H'LHLT'H@'L"'L` XH@L"؀2 [\ 8L ܀` H@ `?`@   ܀ Ј '' ̑.   @ !`"\H (а \.   @Ȁ !\`D 2` 2X2` $ А` \!\  @\@P* \@ `@P*`\ `3!  0D`* @  `\` * @QT!\!  @QN*`\`  ` ?\` X"\`H$"@@L$"@\̞Ȅ` #?8 . c`@  @ L\ " ## `H @"@L"\#L`   H@8@"@L""@ \`@ Ѐ@  \Ѐ X?\. ` `" " @ \X܀$L&"@H"@逢` !*` €|L`,$$h8 Ԁ  ԦLH@ դ?LL@ä?@-`@  "@`D `@ `Ԁ` J `Ԁ  J @ @-`@  "@`L  `?  sԀ`   * 2  :@ `2``V@O-`@  "@`' + @ 2  !;ؐ@ 0*@ * * @&@ + @ 2    # @ ! #̑*  @ a*@  &@ *`@ &@  Ҫ *`@ 2   7 # @ ! @ȑ*  @ *`@ &@  ? *@ 2  " !!+ @ 2   2ؐ ' '䀢`  ` `  ` J * ''䀦 o'  2r ` 2n ` @2i*`@ 2` *@&@  ĕ*@ ! @ @& !  @  ' J*`  '% * "@#Е** @ `)t#@Lg쀢ڑ*#`*@N( '* '"@ #@̛( (" '@ *`" '@ *"  '(" '* " '* #@ '*`# ' ̩* c @ L  H@@  L   H@@`? !@%$4Ԁ @7 @  ɢ@@瀤 @@ @@׀L HDT 2LD`2  D  D 2  c2LN  D` QL HFT r@L * % * "@$Е*?* @ `5t@Kb쀢Ց*#`*@M# '* '"@ @̛(@ (" ' *`" '@ *"  '(" '* " '*#@ '*`# L * 'ؐ ` ؖ' `" ؀ %  % a @ % * "#Е*?* @ `5t@Jߒ쀢R*#`*@L I'* '" @̛(@ (" ' *`" '@ *"  '(" '* " '*#@ '*`F# L * ؐ @?  ؒ`ؐ`* @؀@6  @D  / 2.  ` '  2 `    `?   *``? `  2  :@ ` `? 2 ,  /,''*`*'  @ +`+`?'*  @! '*` '*` L * Ѥ% * "#Е** @ `1t#@I쀢l*#`*@K c'* '" #@̛( (" '@ *`" '@ *"  '(" '* # '*`"'*# '% * "&Е*?* @ `1t#@I쀢*#`*@K] '* '?" #@̛(@ (" ' *`" '@ *"  '(" '* # '*`"'*# 'L *  ?,> ,,&,L * ?,> ",L * ' L* *> *`L`HT`ڀ@N@2LOJ `?N2LOJ@ `? L`HT`@N@2LOJ `?N2LOJ@ `? N2LOJ@ L`HiT`f@N@2LOJ VL HT{wT t@N@2LOJ fN2LOJ@ ($RP"N2LOJ@ <@4-`@  "@`)"N2LOJ@ @-`@  "@`Ԧ@/Q g?* '@ 2?'* @ ?'*`@ ?* '@ @ +`?'*  &@ @'*` ! '*`  @ ؀:'H    H H ' J *` @' @ H @  o؀(lk ?㿐 Z' G I' J`*  G'  ?` 2"J @C*  <'  ' J`* '  ?  J *` @!*   ' '& @/*  " 􀢀*  㿐'  @*    'J`  * '*  㿐@'  ``'!*` €8    4 8888ˆ       ´ (  8888 L, 2` *0*@* &*& J  *`  ' #'' K * '' J*  ' *` 2    ' $@ @ `JJ   2 @ 㿘*@* @t c"Ht#* No previous regular expression㿘  !#`2) 1&## #@H Ȁ  $# $`@H! $`1#h# @@@8$ t㬒t#* 㿘@8#   : 2 㿘"@"&& & & @HO! & 9  cD `  (*   * cD& @  ?& ! @*@&  6 * * @& @8W籖 " h@8I 2`  @  *@ *7  `**` * +      ' ' ' '''''.'@G'@Gݐ쀢`' ? ( ? Ȁ      *#@ & @H'@H%6 Success㿘 t@,#.  #@7֐ @v*@"㿘 " @G &&  & @G  *@& & @G & Memory exhausted㿘@,q Ѱ ؁㿘@G[ Ѧ ؁㿘@G֒ ћ ؁2 ( @ ( 2 *@  ("@ 2 (@  (*"@ *"@ (" 8"  *@ * 㿘%ؠ   6آ`ؗ, @ "`ؠ `````* "`*`"ؙ, @ " " ܁"`  D@ @ ` D@ `  D@ @ `  D@ @ `  D@ D@ `  D@ @ `  D@ @ `  D@ @ `  D@ @ `  D@ @ `  D@ @ :cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]㿘@6G` @  `? Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [p  3``  ?$쀢r&`#X* €ל$$$$$$$$$$$$$$$$$$$$$$$$$Ѭ$$$4(p$$؜$$$$$0$$Ә$$$$$$$$$$$$$$$$$$$$$$$ِ$$T$$$d$$$$$$$$$$$$$$$$$$$$$$$h@` d ϡ"_ 4 ܀`2 #`?!! &!"`S!܀;``6`J `)` J@ \2J` )$ @` J `|  J@ \J` |܀(` J` !"`!  !"`"!  !"`!  !"`!  !"`ذ!  !"`˰! ܀d2` ` `!"`! ܀` `u! "`!  ܀dk2` f` `^! "`! 5܀"S2   O`)/ % %!" rΩ`  $쀦 0&`+cD `)?%!-*` * ?$!`   L΃`  $쀦 $`cD `! , ,m"Ѐ ,)!+%#)!*` * ?$!`  b T`  $쀦  $`#D `!%@ } \8"`  " -`  $&` }!"! "`"!  ܀$22     ܀$22( ! ""Ű! `ܑ2      !# #`"!`ܑ2`   w 2@n!# "`"!bSY#`܀ @  7`܀  1"`DG  C5ؠ # 8  cD `"  ؠ    W#&%`` "耢 Ì` @?`$쀦 ^&`  "耢 6m ' @``?$&`';5/- [E \`܀ @t  :t)+!t, +# @ " ؠ  $@3! @3% `"@`%`耢 & `  % %`,`ϣ, \``܀ `  耢    %%`  耢  @?`%쀤-A%  耢   %쀤 ]%? *&` \``܀  耢   %%`  耢 ̸  %%4*9). 7+ 䀢  #D `(  8  #D ``hؔ@ R ` ]& [Ԁ `܀! "`!5"` /"` ,#cD `&ȒcD  # ( h.  Rذ! $`  `@'?"`?㿘! ``& `* "`  *` "  ؘ?  *`"`"#+  €a  ? ` "`a  "a  !  4"Unbalanced (㿘!! !!! ! !!!!!!0$!@ !aĐ $!!㿘 ؠ` ,  ?! !  ! !  ?  ? $ 㿘  #`ؒ *` Z `؁㿘!!> G+!! 7`)`'`آ`!";!   5! 6 !ɒ+!   ! !! !  %$!!> !㿘! !  ! !!! !㿘! !$! ! !!! No syntax specifiedUnbalanced )㿘 ?  "# "# 쀤 #`#!$!"a  !" ߐ# : !   !  & `  @+ @ "@@"`&@ ` ` @@ +    +  6`@+ 2`` " #h`#l#`@+ @@#` h#d"@l"`#h`d#l#㿘#` A  =(`@) .`  `#%`:.`  `# ( ` `.``  & #`@& @6 @(`.``&`' #``@&@ ) .``&`' #  & `   @*  * #`@*@  "  " `&@㿘@ `@   @  @  ( @ $      @2-2)N@2%N2!  @ @@@  `2 ͞ , .*`$ ,* @ $Փ*`$ $. $* "@`‘*  $" $@` $ *  $*  $@*` $*  $@"``6p (  @(  * @ V!  ` $@  ` 24@ `@  ` 2%@ `  `  2@ ` @  2@  @ @ @ ` *` $@  2`@  *`  "2 ` $ *  $@ *``&@ ( $ (㿀` .* `  , $@`  ,   t,  ` + @ $h !"e !4b '  '' ' '*@ ?M  $@ ` *~`%!p*` €      '`0*  6 *,  ''' `0*  * ?  &@>|p & 4* '  * ' * '  *`ԑ*   *   *`@ *    - %   &-   u* ' f   & 0 - ?`*`# €88888888 %@$% ''68 @ 0*` p@* ? ,  * * %  *` ? 6 @ 0**  )*`@ 0*"@ @ 0*`   β` a "  % ''*` 7@ 0*` )@* ? ,  * * %  *` ? 6 @ 0**  *`@ 0*"@ @ 0*`   β` "  %*   $* ,  @@?#@"?* $  @ %1 @%$` "% % !`?"$%&& &&%g  0- " `   &  6+' - @ !!$  0- ' 0 @  E* 0" 0   & ' @''  `    `2  `0 2    & ,& ( & $ ɒ@<@<@<@<Ő@<Ð@<@<?b؝`'D'H'L   "` #!`8 `cD@ `"` ```` ?#ؠD ?#L(`!H`$* @ ` @ 6`?c\ ?@#l @!@;??cct@ @?cp ?@#h;? @cl!@@.D ?* #\@ -`? ?c#t'@  ?#\'`@H*``   ?#@;?!o;??Hc\?@a* @ ?@ #ؐ@;?c  ?H#p`$J `  ?;?cؒe H`$ ?#p;?cJ ``@`??cؘ  , @ "?Hcp@ $;?@cJ `   ? ?#ؘ  ,* " ?H#p`$?cJ `  ?;?cؘ  , @ "?cؤ @ `    ?#؄,`";? ;?cX ?@#l'@.? @ ?#X?cH@ * @  "h;?? ?ccؐ  ,`@  @`  `` "M;?? ?c#ؚ   ,`@*   * # ` ``?;?.c ?#H `J* &@%` ?#?+ c"@@ #` &   /;?;?c\@?@ch@?@ .@K@ ?#hOH`* '?. c\"@ @@;?c?ct"@@  ";?cL@@`HD`$* @ @ _DH`* `?c$ *`4 ?#[$ `$   @      2  0 2  2   2 `@ ;?c  H   H | ` ?c H o #D L` (` `L ! 8" @ """```  ? #L"? @6; ?cT@ @?@#@;?cd@'@;?@cP ?@#d'@ ?#`!?cd@@;?! cT@ B@?c<@ @ ??;?c<@@ H`0*` `@% ?〴#,`;?* c@ @$ $?@`H* `0 @ @ ˨ H 4   $ ???;?#cc,$$H`$ ?-`@ " ;?c  ?cP@@;?c?c`@@   `2  `0 2  ;? @  ,@ ?c  ? ?;?#c ` ` 2  ` 2  ?cH [  H S ` ?#T;?Hc C ?#D  (  ,: "`@ L!  `L*'@4`L* @``(ܘ `@ @ ?-` @9 `@-` ?# @9;?c@8 㿘`<#! `8 @ 6&`<`@,` "`H@8 `@ "`@8`H"@`8`@ &`@&`<  `L&`<. "@`$* J  ` *  * J ` 2`L `L@ "@`$* J ` @* * J ` 2`L `L@ "@`$* J ` @0* J ` 2`L0`L@ "@$`8  .  *&`8  ``D*``8`H&`@*`&`D&`H`8`L~*`&`L`8`Py*``8  &`P`@, " `H " `8 &`@``ͤ`(?`P"%`(`$* `"`@`H"㿘 & 8& < 9 & @ 8& D2  8& H9* 8& L5*`& P  㿘Ģ  #D `"Ĕ  (      "@8" """  `8 2`@`@  .   ` * @.` `  * @,  `   #!, `H ` `L* @  `5`$* @J` ,'@*'@@  ŗ,    ?  '  `@, ?  .``P@, 㿘 &  && &  & & T& & & & & 4& 8out of memory㿘#`䀢 <@6֐   # $`#D`(N    `* **  @7#@ $`& &&&& @㿘@7 @7  ( 6 $  $ @`@6` ( & $ $@6    0, @  @6  0 , @6ݐ  8 6 D @,   H " @6ˠ  8 & @ D " H@6 H " P@6 P " L@6 L " T@6 T   @6 @6 2 㿘` @&`   @&V @@6 @6` `@̞㿘ِ 㿘@&8 @  N  㿘 @6]㿘  @6S&  㿘 "I ː 2.@@     0   , @ `  @6 &$@ 2@@6*`  ,&" @60 㿘  `"5 @5  2+$@. *`:`@O    *`J :  N  8 N@9   "    N 㿘 `2@ @%~l `@ 2@㿘  `. @5.  2&' D#   @ "@ Ȓ- `@ 2 2@㿘   **@*㿘`u `X@4*   `  Ȇ      ""@"" `  .  @4ǐ $@@4Đ $@4 %@4 %@@ <8 4`2 *@**@"``  ۪` " ` -@! "v !!!?t0 !!  ! ?0݀?0ܨ? ?@ *   ` JK@2* K@ 2J*@$@$`@   `@ ?JJ@   6 + $@ + + @ C@4$?*@ "  @$J@@$G`@  @C " 0~ |? q$K "`J`"ݐ b` ]@$$@4F`PJ`" ` ` E$` J`+` 8$J ",*` J@ "'*  %' %!` **@+* *`* $ ` @# "`@3w $@#@3q @$ `T&`T$ `  @{ q@n`kh`  @3Ð㿘uad!)'#! @6##@(. @`@@'@'@#@6@@(. @`@@'@'@؂@da! "!"aPOSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿐u `d'Du !#`` "a"!"%`dN - + "a"! @5"X "!"!- J #a +`d!!  `d@!/u!`d 2"udDD "d  *@J`-2dJ  d$!`dD %*@ @bh `du`d !!   #`d@ ! D!!@D`d"D$!%`d`dD  *!a u#`d@J`-2aJ`a ue?#``u#`d_ 'C  `-`? '!`d* @J`-J  -` L@ @   `="`L@  @  @ $@ 2!@"$@ƀ2 '  u h` `d*@ @ 8@bp@! ?`d@%%`dg`d%`dL@ * `uI#``u h`+ ?K `-2 K@ 8@Ғb @ 8@ɒb@! ?@% $D  u+ @u#``u#`d h` + @ 8?@b@!@%N : ? :@! @%&`  "@ ``d* @J`-@J %u h``d* @J`- @ 8@kc `d@ 8Jc8@b`d#X`%%`de ? ,`> %@J@ `d %`d :2Ju h`@ 8c`@9u" l@ ? :2=> J :!J@ `du #``%`du#``+%J@ `du #`` %`d`dD *u h`@ 8c@u" lN`:  ? :@u#``u#`d%,`> 㿘   㿘 㿘ܚ 㿘@invalid major numberinvalid minor numbertoo many fields for format㿘   `@#+ +` ?  @ ` 2   `h@z̐ 2    `@zÐ `@z 㿘   `@#+ +` ?  @ ` 2   `h@z 2    `@z `@z 㿘  @??`c* @   2`@   `h@z  `@zz `@zw 㿘  @?`#* @`@ 2    `h@z`  `@zZ `@zW 㿘  @#`*  6 @   `h@zB   `@z< `@z9 㿘  @#`*  6 @   `h@z$   `@z `@z 㿘  ?@#`*  6 @   `h@z   `@z `@y invalid unit numberinvalid subunit number㿘  @#`*  6 @   `h@yې  + `@yՐ # @`#+ ` @ * ` 6 @   `h@y 2    ``@y  `x@y `@y ultrixsvr4svr3sunossolarisscoosf1netbsdnativelinuxischpuxfreebsdbsdos4bsd386bsd㿘@@^F:invalid format: %sformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.invalid number: %s%sp@    %  F# nu c`" @㧖  2   cb8@yI @@/0?倢 ?#@& *`? @ @@?`@J c ! p b  bp  bp! !   bP@y @y ?`?@`@m " - n/ @@' ԑ, `$J@ 2 @2  쀢 "2 @@x `  0 ؟`@}4   0 @}%  b@ؐ  Usage: %s [-F format] name [b | c] major minor %s [-F format] name [b | c] major unit subunit %s name [b | c] number %s name p 㿘#P! 8 `a(@n `aX@i `a@d` @_a@a 㿘@initial setsid() failedrootsetlogin() failedP@@|@ 6  @"P @"h   @"p bl)u%"$ " @R    "T#\#`#d    @E     @>   @9 ?    Т '#\#l#p#t'''ؐ;`#h#x    @I  @P '''''' @M  @I @/ݐ @/ې @/ِ "$@ h?''L'P'T'X''H'''؀L Ѐ'''''' @  ?Ё #####Ȕ n  0#b(**"`#㿘'H'L'P'T'X @ɔH@@ 㿘'H'L'P'T'X @H@㿘'H'L'P'T'X @H@㿘u"( `""(@ fatal signal: %s㿘! "@@(ې@ې @cannot get kernel security level: %s㿈   ?'  @/o ?  nb! @"?cannot change kernel security level from %d to %d: %s㿐'DD@  ?   D@/A ?  nD! b@# 㿘㿘 `@  c@ה can't open %s: %mcan't get %s for controlling terminal: %m㿘@{@X @  ?  0.@ @?  H$@ /dev/console-shPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin/bin/shcan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingx 5 @}: % t '''' @    '!a'@}ה ! !`@u !h@ @r 1u !? @  ?H1 &"$' n) + % 2("$?@ ?@8? 쀢 u!+blܐ   j@Q ?"$"$ ܐ     W" @e @% Q"@1 u 1 "" "lu $  㿘@㿘`А @- 㿘#  @r @(#0smkxrmkx㿘`!8!@@?@V @(# 㿘@׆flash㿘"@\ 6&#`#@+ @֐!@? @W# # `&@+ @Ő!8? @F##`&@+{ @!?" @5&&=0=(= ====<9<<<<<<<<<<<<<<<'@7 @ 㿘 (T @  $@m 2h (T ?$(T``$2^ `$2X  &$    &$! n H  4 (@勒 @Л ( H! n 4 @  (@偒@c (+@ 20 b  $a$b$`"' a"# " " "" *` 8* ? @ @⩒   @q  b$a $b 㿘`$" ( @ 2 hT  " "hT@= 2 hT   "  @Ԑ 2   @t!" $"016|Vi's standard input and output must be a terminalTERMLINESCOLUMNSunknownterminal type unknownerror initializing terminal%s: unknown terminal typetcgetattrtcsetattrsmcup㿘 `$b  hT @!   0@ հ  >@ 2ϰ #耊 " ## * * `8@3ah@ @/p@" ` " * * `8@" @+ax@w!`` !X * * `8@!X@ !#! n$" "쀢 @a 2@R p  @uah @up2 @u ax @! n@$@ (@0  (9  $b @  @"a\ %abda\"$a\"aha\$$a\ah  $ah,a~,aw,au,av,a{,az@ 2   @sa\  @  @ 0b 2 a $b` !b@aa` @O @{# 㿘! n $  (! ( @ @ѩ ( m㼔  (@@ (@@&" cupsmsormsoelcuu1rmcup㿘 `$ O hT nb0@sb8@nb@@ibH@dbP@_`  2`@"S $ "@"L$!`$0$4$< $<$8$@$D $H$$L($P,$T$X$0$4  @s0 @X   2   $bX@ @଒ @א# 㿘 $@# 㿘; " @ "  @!| & @  @$ 㿘! "!@!&!! "!@!&!! "!@!&!! "!@!&!! @!&!%lup` x@ (@s% ddddddddddxdpd`dXdPd@d8d0d dddccccccccccccxcpchc`cXcPc@c8c0cccbbbbcursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1de`dceXcbePbceHblakahaja㿈!``*  ``@ ""@o@l@i#\#`#d@, 2   ߪ` ``4)x `  @ "%""  ,  ,`@ 2``"@4@1`#\#`#d@ 2d  ֪` ``"E   `3`@ "5"2@ah "- @@#\#`#d @@@#\#`#d@    Ū` !D " $ "     @<  2 $ 㿘!D`  `$ @@1 2 `$ 㿘$   " @ kf%d233|This terminal has no %s keyfunction key %dH!!@ƫ@ @  " @x  !!8@ƒ@ @@e #d#\#`@' @  㿘`"  ``" 0 `> (T`@"(T$  &$  $@`? stderr%s046|messages not turned on: %s045|messages not turned off: %s0@F     9@} 4 @U 6b +%Ȁ     &b @n` 6  @n  6  @J  TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS㿐  '`h @ ?  `1 ` 2q'0oi" " "" *` * 8 0YW!` " !X!X *` * 8@ ܀0G@؀0C`( @ߐ ! ` ( 6 0@ے ``   @ 6 H@˒  " `" P@ X  @O @ `  @F 2&2& 㿘`? "`` . :  * "@㿘  `>  @  2 @ @ې#D `  ` #D"  (*@ ` `#D ` (*@  ` !@  `    2 0   @"  @ 1 1 !$   @    @-  $ , $   a@ $ !@"` "a@ !@$  @> $ , `"  , @ 8=   @ Y`@. @"   @ D   @ :`@ @  @{ (  "! #D 2` 1 ( `e 1 !@  `  }  2 w  q  @ϐ , $  㿘 !@3 ?π`8+"*` €ss(s4s@sLsXsdsps| 2* 3* 4* 5* 6 * 7 * 8* 9* 2  "  "  @"@@&㿐 @v˜ 2(  @F    "" @@&  & &  2 ' "'     ' 㿘!@  "@F "  " @"@!@ 2 !,!,@0㿘 @b <  @  & @G &  @   `@  @T& 㿘`& "`@&"@ @2@㿘  @@002|Line length overflow㿈/ @  ' @v  d d@ & d  (T`  @si   (T`@? ' @wڒ 2 @*@  @uݘ쀢 2 쀢@`? n @'' @v@ b d d@ & d  (T`  @s!   (T`@? '@ @u쀢 2t    "`T!"`` '  @4耢 "`x ( Tt@'x "O x&tT'!&Tt`@w`@@v ( : @@2Q` @u]쀢 2.    T!"x ' @耢 ޠ`  t@x "  x&tT'!t&T`@3` `@ @)" `# @@v" բ Ӣ `7 @u  2ܰ    aT!"x ' @耢   t@x " x&tT'!t&T@ @t֘쀢 2 쀢 Y?@U" @ `@R  `    T!"x-'%   "TtTx >&T  t@Cx "k x&tT'!t &T@2耢   @ @" "@ @@u 20 @ '' @tܐ # d d@ & d  (T`  @q   (T`@? '      ` `thT >"hT@script 170|Interrupted㿘`@a& "l԰    "  " "@@b @`l 2T * "P $$`x$d @hl 2 @&@$ $d@@ @!?`L@ d# @$d@: a<`"a4a4`* *  8@2@ b `@ b   8bؑ* * `(Tb؀ (T #(T :@[ 2[ `(T`  @p  `(T` bX@:5@:X @ t`x` 2`"` $$`$ $@ "`T "& `(T   @pɖ  2T`(T  ?#(Th@} T @2 &d S & !#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedx 9? `|` "`` &a`&a` @t L   & P`*@$`   a &a`` * `$`  $`! `Q @' 3`$`@ϒ 2 h`` $` `J  a &a` ``$`  2 ` `?$` $``  :2`?  $```$`J` :2``? $``" "  ` $`J  "``? $``J 2}`|` `@ ?$`$`r$` "``J@ "` 2 ```?$` $``  $ `("`@   B `|` " >'G``  ` *`J` *$`@ >쀢  $ 쀢 2``  ` J@   :2 ```?$` $`` { `J`|v` t @z!   ``?$`$``` #DJ ` `?  $`$`2  g  * : `i" ̓*` €4TTTTTTTT4T4TTT4T4TTTTTTTTTTTTTL;#!' LJ ' LJ@L l p + - ^ #$#` `"@! $`0!Ę" !`$!$`!$`!$`$$`($`,$`4$`8$`0h$` `(*:   ,@ ޒ Z$` L k s0DL AL =``?<"@ $`$`?$` L c" g" r ;#``" $$`(h$Ē@$$`$$$`$$`$`$$`,$`0$`4$`8$`($` L`h*  ,@ `` ="H $ $` ! <#` H !Ҁ"<#X "#P#P *` * 8`2 < <@^W u` H `0L < `02 ` L > `+`` : `J@``?$` $``" @ 2L`` < @  "@`$@2`%0`?# @$`<#`$` `0``@ $`$@2 ` $`` L`$`d P$`h`@ $`" """ *` * 8`2` ` " ``@`| b$`4`|@*@$`$ " ` ` $ "` ( `@ $` >$``<` !$`   h䰀n8`!`J ! `|!4`|$` $`$``J   $``$`"``J +2``$`$`8!``@J  0  'S ` 0 'R @l  ``` $`$`J   " `,`` $``$``$`"xhX`` $`~$``t !`J   $``$`d !2c``$` ]$`2[`` `J@ "` 2 ```?$` $``#DJ@ `;`|2`;#$h$`($Ĕ$`$$$`$$$`,$$`0$`4$`8$`(($` `%$``$` "``J \  `$` $`J@ `` $``$`` ``J @ ` Y `@J  04  'S ` 0* 'R &@kK " `  `J ` '쀢`|2&, 2 `a &a` `$` `` $`$`  |2, 2``  $```? $`,`` `$`$``$ "`=` `$` $`$` $`   L \",` `"f`` `` 60`` "`   ` "`l` @$`` $`@p=耢 23`耢 2 L`$`d $` L$`d Pg$`h$```p$`db$`h _ 0)`` & @ $`$`` `$`l@p`l 2```   `l  `$`$`d$`d`$`p $`7$`h ",`d43` 20` `  $``$` L`2$`d @o耢 2`耢 2 L`$`l $`$`d$`d$`l$`d$`l P$`h $`p `h$``$`l$`p2` ` 7;Ѐ@2-`  $`` L`$`d#4   L#, *` * 8 #,$`l P$`h$`p@o耢 2`耢`" `  L@(` `l 8$`l` $`\^ !"Y`J@ !2T`|`!$`$`K4`|`J@   `$`$`? ϑ* : `F &!0*` €L\\ttttttttttttttttttttttttttttttt@ttttttttttttt tttttttttttttxttt"?#`J ^"`\ l +"`\ - #"`Τ" `\ʤ p"`|Ĥ $`\?$`\`| $`4`|0 b`|$4`|0d 4`|0@ %0`` $``$`"`J ."`| = + -" `| ^" `|   @`| ( L 32}`| 4`|`` $``$`p`J + - ^ #2 `@f 1 2_`#DJ@ `U ``|?`,`Q$`$`K4`|`J #D ` L +2>+-29K@ - +`|`  `|` 4`| @ J䀢L 020 ``""@$`$`L a2 $`X`l`p $`h$`l$`d`| 4`|`@ ?Հ @쀢 쀢 "܀  `@m  $`T ;` #@ ``?@  ``` ?'``@ J  0  'S ` 0 'R @hz  `` `$`$` ,  2 ,`` $` $``` $``$`$ @ - 2``"` `J@   `$`$`"` `` 6'!``@J "`",   'S `"`, 'R @h 2,`` `$`$` ,,`` $``$`$ @ ֒ 2c`^```@ 0 YL NR?'L o, "K`` 2?` F```  @  "+  *  !X@+`:`@g!@uْ   `"``J  $` 2``? $`` 2 `  @:bȀ " ```   А@u ``` - 2I$`l```2$`d$ 2` @@2`d`   @l 2`d`|   ۖ @l耢 2`$`l`d``$ 2` @2$`   @l 2$    `/!@*)!``  2``l` L `d` L  `    P & L& P@x``$`$`!"$ L# P''` $` '@tp  2r`$ "  , & ,  " `$2`@m-` " `   ?$ ?hT @2h|` Ѐ@?h|€ `?ߐ# $``  2hT (T`2hT  @g  2$ (T`" $hT 2!`$$&$ " @v\  "$$`\" $ L @ :`    @ @kՐ 2 L ޔ L`\ & L$ M`  I` L E``|:! 4`|`@@?! 4`| *  2 b $@! "!! *` * 8`2`  ` @2  L''@. `A `$`*```  $`@J?`"`"`@ ?   'S `"`` 'R *:`@f 2 `` $`*` $```#$` @$``$```$`$`$b    |`, `P`"*!l*` € 2@ 0 2 @ h @sڒ @@F@`2 `P p n$"@2y'`|X@s ` `x@t `     @,` 2@`` "<``J` @ $` `!   'S ` ` 'R @er  `` $`  $``  | $` $``  `|`@" @s] @Ԑ@hd   @sQ  '&a$# &$094|The second address is smaller than the first㿈&`  &``` ?* : `2+ *` €                          p                    `@2    @jD`l  `l` `@ `?&`d&``&`&`&`p&`h`@2ʰ    ""J`` " L  " LJ" `lJ &`d P` &`h`p&`d&`h L &`l P`&`p&``J ; `` "`d  `  `@& L`h`l& L`p& P` `?&`9&`@ 2x  s쀢 - "S``" ` ` &`d&`h&`` &`l&`p &```l&`d`p&`h&`l&`p ` 2``@2A /``"& L0&"`l0# L &`d P&``&`h  @  "&     `p&`d&`h L &`l P &`p&``2 `d`l + @r   & $0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0㿐'&`* &`  `,J@!(     @M  '` ?ܑ* : `8,"L*` €0Xlllllllllld &`@ &`&@hג 2p ` &`&``@  @ Y'&&``""@&`&` &``  &`,@@qF >'`J@pL  "`3'` e` ,J / ?" ``@q'  '`?&`&`J`/ d  L& P&` p  '` `" " &`&`&` *&` & P& L 2&@hL "  "`&`  `cDJ ` +*`` &`&``  `J@ "`  ``?&` &``  `%JD ` 2 +-^2 2 ` & L& P&` U&`KD@ `2KJ `2 K`+2? ` >&` - ^  `?&` &`  @ 2  ` " $   ` $ :   `$  ``" " &`&`` "``J@ "` 2 ```?&` &``D`K ` +-^"K  "     ,:`  > @& 㿘$*@ &$) `D`@g# " `D@gK L " L^   & L@ `H@"``"@`@ "@|@2 ``@D @ `?$` 2= `P `<`<  @@ $`@"` @$`<"@@ u`<2 " `P`H`L  `@$``L$` & L$`D`$  `P $ &$ 㿘 `|`"1&  P " < <@& @"`@& <"@@ 5  <2@ / H"  " @ $"@`|2 P&  098|The %s command is unknown㿐    (T!" x ' @N 1 ( (T t@B x % x$ t(T'! t$(T,@@ . @pV   ` `t@hT >"hT@ ΐ㿘@$   < @%(@ 㿘@J?`!  @   ="@`?㿘;cР cLJ@4 2  @ܧ   2 099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0㿐"    /  @nq 0:/,H)h @@Q 0+*/#Г. €$<D/@e //@n@ 0 @/@@n7 105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end㿈`x  "`t0 @ 2q 0h@m j @U`t@@` ?D ` 2 @_0R@ "@0  B  @ `#D  ` _2    ` _   ` @` @ #\#d@#` 2  hT  "hT0@m  109|"%s" is not an abbreviation㿘 `t(T @@`@d "  @0H@n  㿘@ 㿘@ 㿘@  273|Entering ex input mode.㿐  2`d` y  & L`22``d `d`l ꎘ  2Ѱ g  2ɰ ` C`%1     2$$@$   .2   @c $ ,`    @c `ǖ2&`&`$@u``)    `  @On $2  ``&$1`(@(Ȑ1`0@qY @(1`(@(@(ߐ`|!! "!! *` * 8`2!< "!<!< " !4!4 *` * 8`2@0 2@  ?''@I 2 @```@b  `@@2`` & L@c   & L 111|No more files to edit㿘`x``( 2  2`2J `!``(`@@ | @w@ws`| a@Z  k `x Cd@`$ "@Ƞ  @`$d*@$d$`(`x @O   $`$  @kB `t @]@ $  ` 2`$`$$`(@S  `|`(@R d@  2`|!  $ @Si    "d`( $`(d ($d㿐 @ , @9 `t@R  `|2 @S<  @' @( 0 @ "("$$@&$&  112|No previous files to edit㿘`(`$@2 `2@kV 5 !"`|@ߐ@ ' @Œ" a@Y   `(@Rj  `|!  $@R   `( d($d$`(113|No previous files to rewind㿘 $ 2 `|3@k     a@Y    $$ (@R1  `|!  $@R  $ ($$114|No file list to display %s%s%s[]㿘 $ 3@j˒ 0O    F+3/3)3-3@O ( ` 8@ ?@  @&͒a (  "@&Œ (  3!Д!؀ 3!!@& hT   @]g  2  (T`  @&a 㿘` `x @Ӓ   @jk `2`t@@ &   @@@ $`@ ` 2`$㿘  @.$ , $&`t ,&`x 㿘 @# , $* @  , $* @* , $* " , $`$ ,&`t ,&`xx    "'(T!" x'' @" "c '쀢!  t x@" "W $ t(T t! x$(T''#\#`#d'@     t@T >"T@-    J@ "` @ `@ *J@@ |쀦   ` `thT >"hT@n  echo x  ` "'(T!" x'' @"  '쀢!  t x@" 2$ t (T t! x$(T''4b@  '#\#` #d@$ r  3@w  T  4@w  M cp " chch`* * `8@ #D*`:     ` &N@O  1N   #D `2  @5  @  ?`'@` ` t@T >"T@㿘v "t$N  "h$ )`N  0 ` 'S ` 0 'R@ @Z     آ`@,`$* " $@ ')`" "   'S `" 'R  @Z\ 2  ,ޠ ,, $,$&`t,&`x 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #㿐\`d'@+N #"]  % ! > \"  5@    "(T t@(T x >  $(T t x@ "  x$ t(T'! t $(T @ ̢ L  6@q    "(T t@+6@]    "(T t@(T x >  $(T t x@Ζ "  x$ t(T'! t $(T @ @`=&`( N % # !2    "(T t@(T x >  $(T t x@ "\  x$ t(T'! t $(T @{ @/ *    "(T t@(T x >  $(T t x@[ *  x$ t(T'! t$(T@I  ؐ(@g    /'@%` #㿘 `(`,@&"`$`$ @Y,  @ۓ,  $`$ @f `$2`(@b> * @ P$`(`$,@ 2@ @C `$ " @fٔ `$@ "@ ` #$  $ @  @ $ @f   $ , $  @f   , `$,@ 2  @ `$ " @f `$@ " " 㿘  $"$ , ( . `"  ` @H@ $@E $ ( &. @= $ ,$ $$ ( 289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %s304|Shell expansion failedx'D#X'H'L 'P#P *` * 8` 7 DDP 7D0 D cd  Dc\`* * `8@'\'@o / '''H?@L'''@Rn'耢  77DВ @e @mc؀ '7D@R3 7D@eՒ 쀣`@ ?"@\? @V @PN @P@N@L 7 @KM7D@f @旐 @;C쀠9D` `  tL(TL >&(T@ x*`  x t@D "Y & t t x'L#@(T!&(T*  D@䀢 "D 'L@"'. '`?  @ȹ@  #@䀦( .N?  2..?P#@H  @8@a  8D@fv   D @* 2 ` N  ` `" 8D(@e @ 㿘`|  @`Q ` @ *2 , @2 ਐ 4  `,#D  $䔖   (+ @  ` a@`  ` `@`2 ``  +  * !X@ @V @G 0_@ 4 <$ <$ @ @  ,``d " P"   P`l " , P <" @"$ @"`$ <` `   `   .`@  $  @d # $ H$ L*`    @  @ .@ ``| $`|"  "`| |$ !!%s 303|File modified since last write.! 㿀`t@` 2 `   @ @@ $  @d4  `@$@2```9@c@˙ ``9@c@ @ [`` 2J   `X : !$ "!! *` * 8` $T  @S   "#$m $T "$L$L *` * 8`2$$ "$$@2 $9cА@h $ @`?@(:$ 2 ``  @F 09 `d @`&``l 2@@[쀢 (  2@&`l&`d @#\`d`l@)$ & L& P@ߔ P$& P$ @2 9@c 120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s㷘  `X "`x`|!2`x  J@/:@cI y `x  "`t0 :@1#` @Ll@7  : ":J  :h@c& V @@@w5 2`xJ A:`t `/";  `.3 `.2   .2   /& %:  ` :%:':`(@@w 2@@qD( Ȑ@d   `2`:@d  .㿘 ` "`%  "@ @  23 .;"  @  @b 5 @ $  @b   @b$ @  `*$ $  "@%  @`" ` @*:   :`@ˀ@À` ` 㿘 ` "`$  "@. @,  2  a       X PaT H (          xB H P 8 01x1 (   B H       1  x ` PD H 0      sh    "   h ` X @   X  X BxH@)B8*px/8pP0(/8p02pxs|ph0(:hH 1 pPHLLB@U a Hh`YtBX8U QVx`X4P0aT H^t `Xa H0 _04 _D4 x_ h@0˰ jpq k xpk1 P ``s `X(P8  u Xph ` x x@ hH@@ 0H(X BlP, LPh` P0( 84 X@ xhhPHTp@0:  xp$!h8p/8p @$XH@ h$ $ \$ Xxph`84L Preplace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnext[Tt]a[g][!] [string]tag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]edit the file containing the tagrta[g][!] [string]!w1ortagre-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalswitch the current screen and a backgrounded screenfg [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, screens or tagsdisplay b[uffers] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangebackground the current screenbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D|`PH   #   $  p h&\ @ hDiscard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd db-nameAdd a new cscope databaseadd309|Use "cscope help" for help㿘 $@   @^ " $@R  ,$@`t@#DL ` 0C #D*:  `  , L  #D*`:  ` L  @ː 2  C@Z   CSCOPE_DIRS 㿐D@!( "C @凐    "'(T!" x'`' @| ") '@  t x@| 2$ t (T t! x$(T''@`!D @@{'!8 2J %s/%scscope.out0 @<  2p `x C   @C@IcY `t`@< Q DD"ph@ǧ$@T @Yr = @ @̒ 8 `4 @Yc .  &`@U&` &`@- @ ` &@`" `$`&`@ @@   @ cscope.tpath%s:0DE` ph@M(@ P@o` &`, @Y [  @ E`,@E@ZA  F @B @`, *@ `,:2`J` 2`J@  @@C  "&`( `,!E@ "! & @   @Y` &`, @'  &`(`,  "@`,  @&`,pipevforkcd '%s' && exec cscope -dl/bin/shsh-cexecl: %swr㷈?'D'H'''@E E@E耢 EDh@E1H?#`  0CEDp@Xx ?"@?"@耢?"@쀢?> @@B @B @B @@H`Ex@x(EEE "b@=ߖED@Y @) @Ͱ @EH b@#`$EHb#`  @#`H#`310|No cscope connections running%d%s 278|No matches for query㿐  2 F@X     @_  $ $  @W ,   % % @2 $ " $ $ @    L  P` !`?!'+F`` @c@_ @E "  @@0ђ` 2` 2 `F@W R $```|! a @- <    @- 3 2 $$ 2$" $$@$`2$" $`@"    "  L"   P""  "`  "   @)  @$ sgdct efi311|%s: unknown search type: use one of %s㿘`]CN@`N@ @ "``"PCN`  JC#F&Lcc耢  c*N@:     &L` 2N`@F ` #* *  !X@*`:`@HGc@V p ` `*:  "  * L  *:   "C@cHT $ L  L  #D ` (*@  `  !@ `  2   @E @`#  @V @.& && *`& @@ * . cscope: %d lines%1[ ]%s: "%s"x#G@ G`'*@`  @Vl`@&( c@DA ??'`@( @} '```? "`@``@  "@ 0*@' %D@w8  "   "   @᭐@xp  耤 ]耢 "Y쀤`"V@ᘦ@o܀ .G@0   `@@`@M  > ($  @ٔ  / *@  '  @̒$ ` $  $ $ @$  $$ &"@&  &??['@}  @U  ` `  n "bE`@Vܒ @  0`( ""'%D$h@ð@] 2 &@ '` 6  '@ '㿘@!%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 㿘`HN@ c@  HHc@4#  @-c H@(c c@#C 3I `@   2 㿘@Ð@  312|%d: no such cscope session㿐 `I``  @ `@```2 `I @T ) ` "` @` "`@`@Z @``"`@`"`, "`(@`( @@ 1㿘   " #IbX "    No cscope connections. %2d %s (process %lu) 㿘   I@b0  %I  @ ` 㿐 @K 2` ' ''  @r/  ` @- 0  "& & L & P@w P 㿘@ِC` `@:   2 㿘```? "`@``@  "@>2` % `? "`@h` >` @`">``? "`@W` ` @`" 2` 㿐  2 `|` @7 &   `Q`d`lI  2 "  2 `d& L@K& 2  L 8& L buffersconnectionsscreenstags㿘`t `c" `s`b"  >`  `t", 8` 4J @wbH 2/` @@0 'J @jbP 2"` # J @\b` 2` @@ J @Obh 2` @+` @6  123|No cut buffers to displaydefault buffer㿘 a@ 2 a@a 2a@J@SE 0\ "( # cD 2  @@^  (T`E  @F  2 (T`9 2  !@ "( # cD "  @@4  (T`  @Eٖ  2 (T` 2  ! J@؁ ********** %s%s (line mode) (character mode) 㿘K!``*` *  !X@@D` KK!!Ȓ@``@2%K`&` ` *` *  !X@@C@ T   @Eo   (T` ޠ @@@2`㿘`x  "`t0 ` `    @9 7  @9 . `t @A`@`!@`|@A a 2 `|!,@9  d ($d 㿐 @nJ 5 @ɔ 2 `|2 @9Д @м @n 0" ""  `6 L"L P"P煒 "("$$@&$&  %ld 㿐  2 `` @5  @ @I= L  `d'L@ ђap 㿘  2 `x` @4 .  & "`t@ @u8 2`  `@A @v``?#? @`6`&` @@  L@T  piperfdopenvfork-cexecl: %sfilterforkwparent-writerp'L'T''D'P'X `'ܐ  D 3@_ ~ \?''''耠 '@=ΐ LD"@=Ɛ耢 LLD@ɒb 'LD@=(?LD@Q1 ?"@?@@E쀢?"@쀢?. @䨀?"@; @; @; ?"@?@@@Dd`" \\* * `8@@rK / Dd " \\* * `8@Dd " \\* * `8@ LX@6c Dd`\* * `8@LD@Q @ѣ @E@C\`&L@:Lc DL@   'D\\䀠D  \L T   D X`@=*X? 0%LD(@Pt  @'@lD@L@c0  @O #` LDc L#\P@6 @C@\ L@kD  'c DP@M   'D\ \LD8 @   '܀T\TD L ͐P   L PiD  'T` D@G:D DT? D `X *`X\  D @ DX@ۘ 2 ܀2 filter read㿐   @ r 2` @1ڔ 2`  (T`  @B  2 4 (T`" 4` @N@O @ܐ 㿘`|2@ 㿘@ 124|The %s command can't be used as part of a global or v commandppx  2$` k @ N` @@O} E `x "#` `t@ 'ܖ'J " J #D `2 ` \ | ` 6 'ܖ  2 J  \2 *ܔ ' *ܔ` 'J  䀢 \ 2*'*K@   2$  @2T 0@2 L    @~  " Lհ   Ę @s  2̰  &  L P '' '@NJ 2  @S `<$`<@{$`@ 'N" ''ؑ*`@5  $` @Nؔ  $`H ܐ  @F$`L `P$`D  ,`P `| $@`|"   " |`l d `d |@z$`( (T`2@  @A   (T`@"``"@`"@@^`@\U@nߐ  d @C؀ ؠ  ?  ?@<     "/` `@"*``@@!`@ @ $  @θ   @NP " $ $ $`@$ `<@2`@$`<"$`@`@(@n  㿘``@Π`2  \  @N' V  |"R P "I<<"C$D  : @ `2`? $ -$ 2 ?@'$ @ $@$` @$<"@@齐@O  $` `$` $ $@$`2" $@$2 $D2 P 㿘 @,$D   $ $ &`$$ $ $  $   "@A $  @M   @%Ւ   㿘 `2$(  @ @@  2 `4 "` @R` @L@'< 2   2 @@$ 㿘``= 0@&/etc/vi.exrcNEXINITEXINITHOME%s/%s.nexrc.exrcP# @s   P@ 2 Pc@*  P@ @ I c@ " P@ر @ 8 @ #ࠒ "6 L 1P#(P#$@1 @,  "    P#@$ @  2  @` 2[   |`"$Ϗ$&2O ! "!! *` * 8`P? ;P#( @ "%   ( P# @՘ 2 (@,@ @ "    |`"$C$&  X#\ 6   @.S @@.j@㿘 `| ` @Œ 2`| @L\ 3  $`|" `|$`|$ ` $ $ `2 $ @oĔ $  `$ $ @Ȑ@o $    $ $  125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner㻐@  @5 ` "` `" `` `?`  l @P@ג / 9`@Z$ 1@P`  `  RRR @K (   ` `thT >"hT@>` R `  RPR @K\    ` `thT >"hT@ 131|No following lines to join.?!㿈   @.h - d@BZ  S(@K"    "'(T!"  x' @n*! ߢ|` t x@n! 2 x &l& t(T'! t&(T| "dl &ldl@ &l      @@J쀢 쀢`"`   "(T t@(T x >@  &(T t x@mՖ "  x& t(T'! t &(T@ @mÖ x@`= |!:쀥  쀢0J@  2+`''J`)!S H@ ,   ,  J@  2 `''쀢 @ِ J?  `$?"$P " ?"$Pmd$Ldl `@@% ?`$@A"  ` `t@hT >"hT@  ` `t@hT >"hT@אd hl`" @$h132|No input map entries133|No command map entries134|The %s character may not be remapped㿈`|!  `x  "`t0@k  2 `TT!8!X@Iǒ  @0 #;`#D @ ` 2    `2 '`   #\#d#`@i " Z ( `t KI `27`t  23`t  'S 'R  @;]  "  " `t2`t T` !x*` *  !X@@:@IN   `@ #\#`#d@i 135|"%s" isn't currently mapped㿘`t ``|!@ @j" 2`t  U@P@J]  136|Mark names must be a single character㿘  2 `t` @,9   ` U`d @HG @H  .exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s0`x  "`t0 U !@@8`|@&`|! @ U_ &@! UUSa@ U3 nb@(EUؐ@jʖ 93 n @6bU@j  2,3 n @2(3 nU@j  23 n @23 n@Y 23 n @23 n@ 3 n bU@I   b@vU&bȒ @I X    ` @+t > `d  `l?`h`p '''䀤 ''??''  ʘ؀ Ƞ '`T /'ؔ @\   & P"  & L(139|Destination line is inside move rangex 2 `T` @+  `d`h `l'`p'' '耤 VH@GҒ    8   '" * 8    `. @@ 2   "'(T!"  x' @j! 耢`  t x@j! "ǰ  x& t(T'! t&(T耤"@F` $? @<܀ 䀢  @j䀢 ܲ@ܐ @= |` 8   '" "&  2 @=0 c??ƐG ?A @<܀ P䀢  @jF䀢 Eܲ@坐ܔ @=Z 8 `"` 8 "`  '" "&  2 `@< ??Đ ` `t@hT >"hT@⹐$L`$P 8 "l  '"  * 8@? 2 l $l140|The open command requires that the open option be set141|The open command is not yet implemented㿘" " "" *` * 8` 2WWH@F  306|Vi was not loaded with a Perl interpreter㿘W@F 㿘 㿘 142|Preservation of this file not possible143|File preserved㿐  2 X` @) %   WX@FS  @]k 2 @= 2 @]  2 W@F9  㿘`t@@5`|@4 a 2 @-Y "  2`|a  $ @-ϔ  $ ($$㿘`|$`d@8`l  `l $ L`p$ P㿘`|"`d@%`l  `l $ L`p$ P㿘`|`d@`l  `l $ L`p$ P%6ld TOOBIG x  2 ` @( T OX"?a#X!X"'䀦 a@ٖ''  @ 23  @; ܀ ܀ $@"  @  2  (T`2   @8W  2 (T`2 (" $㿘 'PP$@ 28  (T`  @8/  $ (T`2' $ XcP @ "   (T`2   @8  X (T`2 X@Eb  [ynq]㿈" '" *` * 8`Y@" Y '  @Q 2J @ @:h쀢 2A ` @= 26 `  '&  @+ ^ 2$  (T`2   @7  Y (T`2 Y '  @  2 @ %c㿘"8 ""0"0 *` * 8`2$#Ā "#ĸ$#Ā " ## * * `8@@` /$-`@α 8 v%@#Y??qbp` @r T j  @7E  2 8 (T`2_& 8:V?`, *  !X@@5`,  * a] @@5}`2 ? 8@@T-??"*)Y#X 8 @Db"p @ T   @6  2? (T`2 &??ݤ2|@& 㿘`$$<'L`<" 'P'T'X@fjL$<@@$$@# "΢ @1Z@ؐ ,Z 2'`/ @F\@ @A   ` `thT >"hT@T  Z㐐@BÒ @ `(h  㿘@㿘`x " `t@@㿘`|       `   ` @$  `X@149|No background screens to display 㿘 `` ] @A- 0F  -]+]@̶` 8@@ H  `P0 + hT   @3ݖ  2  hT " hT   @3͖  ] (T`]`H 150|The script command is only available in vi mode㿘$  ]@@͒  `x  G  @@ tcgetattrptyforkTERMemacsTERMCAPemacs:EMACSt-iexecl: %s㿘 3@N 2 @ ? @@  $ & $  \$ $  @w?2 `]+P T d ? $ `$ d`h @?]P  @ ?]`@,?$ ]0W]h@@S  ?" @ ?W @۞L]"pbx@- ]]"b@- ]]"b@-| @) `a@ݻ @  @*  @*  @* @ݶ #d`" #\#\ * * `8@@av / 2 ]@% ]@AG @ @  2  $  @&$T  "TselectError: timed outError: shell: EOFshellh    '????' Й2+ @  * "@     @)  ^ ?$h^x$$ " @7?  ^@? 0g^R) ` 'S 'R@ @1   2 @6̀ G̐ @5$ ?  * $@@a"'' А   @)E " ?  ^p@?R 0@6̀  $̐ @5 @ @)151|No command to execute x@6 2  @4쀢 2ݰ @)耢 7耢 5      (T! ' @b䀢  x   t@b  x "  x$ t(T'! t$(T@\ @4%܀ ܀ _}  @ۖ耢   _X@> h "@  ''  @1@  ` _`x@'   `^ n "b@> F C   ``t@hT `x >  &hT`t@a`x "= `x&`thT'!`t&hT  @a䀢 & @ @ڔ @5M 2    ` `t@hT >"hT@p   ????'' #  $"  2* +  #  ` 42$`  @'? "'  ^p@>  ' $" `2* @ :@ `"@  2 2$0`@5À 2˰     "'(T!"  x'Ȑ @`$  c  t x@`ܖ$ "  x$ t(T'Ȑ! t$(T  `@5$?  @ ^@= | ' ` 'S 'R@ @/}   2 ̦$ '̖ @3 V  * C$@Ā Ā %a  "''????`Й2+ @  * "@ `   @'0 @@2 +  '̐ @3r  ̀& L& P& P@    ` `thT >"hT@㿘  @@` $  @=   @u $ * @F   7 - * J2J %? J"? " JJ@`" JJ@ `?ؔ  2" script-shell㿘` 2d   * $d@ ?" @3 ?a@-a` @~  @[ @Y$`   "(T 䔀 "(T 2(T"(Tttypqrs0123456789abcdef㿘a@7#h ? aJ#p`T#pw -a xMx F-w  p,,  @/   t n"쀢`/:?@%r,@&@&!@&% @ ?&&@@n@(ْ   `g@٦ @٪L 2  M 2  n "b?㿘`x 2` @J   `t @G " %s -i㻘 3@J= "#d" b!p` #\ * * `8@#\  @$$3   @ $@ &$ vfork-cexecl: %s㿘'D'L 3@J  D    ` D @0mD  Dbb(DbDb(D@(4` DK bD0@;{ H Dd " \\* * `8@@\͒ / Dd " \\* * `8@Dd " \\* * `8@ bL8@  Dd`\* * `8@bD@@<| @% L@  waitpid%.*s%s: received signal: %s%s ...; core dumped%.*s%s: exited with status %d㿈! n"쀢 c$"@A0 ? `N`K ` HNN " "@?@~@f `c`` `c c  #\c c #` @:͘Z   ` `thT >L"hT@օK 2H 2  C2B NN " "@?@0c` `c c  #\@:   ` `thT > "hT@C  x@:q    pXH8(     xhP8 Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitPower failure imminentProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d㿘c# @  ` `1 d@ (㿘@ 㿘@  152|shiftwidth option set to 0㿈   @ k  | " tt*` * 8` d@97 U  dl  M t @ ' " tt*` * 8 'J >" | <" |  "'(T!"  x' @\! d`  t x@\ !   x$ t(T'! t$(Tdl@  @.N쀢 쀢"<L , L@  ! $ Ā +  * `8@  +  *8  @$ *L@  & L" `   t(T  x >  &(T t@[ x "  x& t(T'! t &(T @[   İ  !  . Ā  + @ *` 8 $ $ `뀤 + @ *` 8   . ?`@@֯"" "@/!  ` `thT >"hT@: L2`@ P$@ P$@*`"@$P`@$ $L$P@[@P ` `thT >"hT@Ӷd pl`" @$p%s0`t  @ Gf@Ҽ BfȀ   n @ n 3"b@   @7 `@G2  ,@ @0@= ș>`̀@ ȕ>`̀ n "b@\f@8͒     㿐`|!2  @&  2      2  @  㿐`x `t` @L   @a]#DL `  \2.  J . 2,@L  \  ,@  `,@ `L  ꀢ \" ,@L   2$ @>  @      @g  2     Ę@Z  2  Ȗ ܘ @P  2  & L` @`%@"  "& @ҙ& & L `@2@  Ϡ*`  *`:  ~  L      (T!" x' @Y    t@Y x "  x$ t(T'! t$(TL ' ~L  \?  ~,@ `827 "P  "H *` * 8`2)  "H 2#  2 "P ""H"H *` * 8`2  "   @Գ   @ ,@ `L   \" '&  @@s &  @6   ` `thT >"hT@ѐ @x   ` `thT >"hT@ѻ@㿘 Ȁ2$ @  @2`x    @=  "`x   `t@ @g 㿘 2$ @  @2`x    @  "`x   `t@ @= 153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found㾈 'L 'P`  ! L  P' '!| *` * 8`!| L. . L '' ` J@  ?* : `ii *` €888888888888888888888888d8888888`8p8888888888888888888888888888888888888888888p88888888888`\ c&`\`\?_&`\m5 nL&L@V LJ 'L쀢 " # hh  `l &`d@+&`l /L@+ْ`l )L  #' $`?.   ?'' `?.    ' $@  'PL 'LJ   J@ 2 ` 2 $ "$`  $ "`d ` h"`d~``d'`l ' ''''8)  (T`#  @&   (T` L@)u E  H    T! 5' + x  "TtT >x&T  t@Vx "< x&tT'!t&T  @Vٔ GL@0'L ' '   L?(  P@?   @i  ц '<` $@28 (,@23 `   @`(!  '  @  @T ' @3q  "' L@ݒ@ ' $',@''̀'''$ 3 'Ԁ 'А& L& P@$  {hc@7 @ ؐ @& j ")  (q @'l иȐH 2a  2Z  @( D  @/䀢 q"K  yN(  @ B   20@ - @  B  2 `  @ B BB'  @!  @Σ ' @2  L,@.@,^' hT' +"hT   @$B ?& P & L2@ 0  @ B  2 `  @B BB'  @  @S ' @2p   L$@ݒ@$ L'@ @  ',$@Ĭ   `)    ' @͎  @ ' @2-  "'L@К@'  !   .@"  @( N  \  `& \ $ " '&  @( 5 L@'^ -   "TtT >x  &Tt@Tx "> x&tT'!t&T  @T۔ IL@2 'L' " ! ' @  @́ ' @1  "%'L@ '  `ؖ ժ``)    ' @Ð  @E ' @1b  "'L@ϒ@'     .@"  @'ݒ   \  `& \ & " ' @( 2m  X` `& X & `2 '2'"'''̀`'ԐЖ@$Ж7" Ж-٦  L@2& P P& P@T' P􀠠 `   ` @&`P@k  $@ h@0   !   ``thT >"hTh( @0 0  @ٰ 0 )'@h @b㿐'H`S ! "!! *` * 8`2 ! "! ! "!! *` * 8`2`! "!`! "!! *` * 8`H` `H  #D*`:  `  "`` $@ `@ϐ $*@&$` $@ @ $*@&$-' `@&` H@8 2N ``H@ @I 2? @H2&H@Sz $&H@͐`    Ht@T >"T@˩H` `2 @t `$ &$ $ &$ [[:<:]][[:>:]]㿐@ L@x *`:  ["a"P \ *[ ."Z"Ph ~">"Pb`L@ <"  [ *# ."""PT""P ~ >" K""PGE "H* @ *` 8 2:`# "P "H* @ *` 8 2+`'   "H* @ *` 8 2 `"`  "P "H* @ *` 8 2` `L@  @  &   "(T!" x ' @RA @   t@R5 x 2 x $ t(T'! t$(T@ @  ~ \* :  ["}"P \ *w ."v"P, ~"V"P,`L@ < @ [ *1 ."0"PB,","P ~ > n9,""P5,nb0b8@I ]  ""H"H *` * 8`2O,3 "0 H,"P ""H"H *` * 8`27,8, "5,0, @ /, ""H"H *` * 8`2  , ", @   "P " "H"H *` * 8` 2,, @ , ` @ i,&@ & ^.[]$*㿐&@ @   ,(T!" x ' @Qg     t@Q\ x 2 xT $ t(T'! t$(TJ / ?2J*J $ * L@ / @ ?`^` @`^`,` @`! )o \* :  \2 *`L` / ?*` `:`@0# " @,  @`, @   $, ,&@ & ([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*㿐@ L` " L  * @*`$ @@ *``     (T!" x' @Pϔ   ^   t@PĔ x 2 x< $ t(T'! t$(T ^,@%p`@Ȓ @`N )p \*`: ` @Ȃ   @! ", ,  N @m   $,, &@ & RE error: %s㿘p@D @ȯ  @-R 0 @6p @-G@㿐'T'L'P 'T @ L & \ 9 "P  "H*  * `8@} ) % w* `L'?ڀ`O q!(*` €hhhhhhhhhhƨƨƨƨƨƨƨƨƨƨhhhhhhhhhhh,hhhhhhDhhhhhhhh\hhhhhhhhhhhhhhh,hhhhhh8hhhhhhhhP"P "H*  * `8@  *: ?Ц* @ ?@ @  @ `?2`` ? `` "@??  gS  gR@e   $`  @2  ` & @Ǻ*` @<*` &  @,Y  耢 "&   * "  (& &` ` #D0``#D0 #D `  ( #D `  h, @  `@ `a@p@ @, N.@?`?        gS  gR@ђ   &`  @2  ` & @&*` @Ǩ*` &  @+Ŕ  耢 2 & Y  * "  (& &` ` #D0``#D0 #D `  ( #D `  h, @  `@ `a@ڐ@\ @+y .@`?'L #@P#@T#@X#\ :   @ 2 @@ I@   > $㿘` @ "`158|No previous tag entered㿘`x . 6 "`t@`t@@ $ @+ ɰ #Ѐ " ## * * `8@ "!@(!*2 !sP@*  @e!؀ ! *` * 8`2 ` !Ѐ   `  @ 2  @C "    @+ j $ $  @# , b  $$ @2 $ " $ $    L`  P` `!2`| ``|! a @ =    @ 4 2 $$ 2$" $%% 2$" $  @I `"    "  L"   P""  "`  "  @&@!@l 282|Already at the last tag of this group㿘 2  @ %  @ 2 `|t@*-   @S "   $ բ ` @  255|Already at the first tag of this group㿘 2  @\ %   @ 2 `|t@)   @ "   $ f ` @  㿘` `@ &`` @ @E   ` @r   $ >($$ 㿐` 2  `@ِ  &` @E = @;    @} @F;0/` @@= @) @F* 0 "@ "@`"   2` "( ~`"$"$&$&  159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]㿐 @@2`x @ f   "`t0WX  @nJ` $Q @ ? ?=tȖ@) ; @@@"  /  @JU'  @ 2@2 @u@*  2`|  @A`|@ 㿘 @  ``|@  @  㿘@   @  & L & P@)  2)    "     ` 3`@L  "$ (&$@@  2@@@2 @ 292|Display too small.%2d  ... %*.*s %*.*s*%s%.*s 㿘 @2 8 @ 0} "uX@(K 0uc r@"\9u7u5u3u/u-u@p4`0x` 2 `@ c  㐔  2@!` 8?• @  8݀ u u#u##@@2 (T   @   (T` 㿈 ?`@ [  $@ 2Q  "` "  "`2 #`""` "`"@@2`$@"$`Ɛ "@ 쀢 "` "` "@$`     @ $` @'n  㿘@¾  2` @'a  `$ @ `$` $ $ @~$  $ &  㿘`  ` !@˜  @';  @0` $ $ $  $ & 㿘`  ,` -` ``$ @p  @'  @` ($ ` "&`   $ & 㿘@` `"``" ` @"@¸`@¶㿘``@ @`&` "`@&`"@ž `@2@@` @`& "``@"@@Œ 164|%s: the tag line doesn't exist165|The tags stack is empty166|%s: search pattern not found㿘`  ` w0 w@wh@& 0@'ђ 0@㿘  N@ @  /`&@`(*`@Ɛ   @&j $ @` $  @&_   @% @͔ *, $ $  "@$ @``2ʲ` 㿘 Y@ = `  @ 㿐cDN@ `" @h֐'@L 2$ '' @Cؚ @Gh ( ,   @Cɚ  ( , ,  P 0 2 & & L & P@I( P 㿘&@N`#D@ ` N  `  N  `" " .  #D*`:  `  "w &N`#D@ ` N  `  N  `" "S .  #D*`:  `  "< &N`#D@ ` N  `  N  `" " .@@ " @   @  @g  $ global -%s '%s'rxxr162|%s: tag not found㷈@ @v ! {   &  & & & @y y  W- y  $@#y`@ "M @@|?N` @u?.@Ð 쀢 " @c@` .@-  2 ( @V$ @S   $ @V$  $ $ & "@& $@gi @F 2 & y@%ߒ @f  %s㿘@ @ ! K   &  & & & @x   @K     ,   2*& yఐ@% `  % n#y  " 2  $  @%b  ,  2 @    163|%s: corrupted tag in %smunmapclose'H`'P @   n" H @  n#\    @+  nbH @ 0ܒ P@P@+ ' ' %z@EXP   " 'x@p   P ` @` >PP@(ÔH'@(z X@#`    t@T >"T@r U   ` `t@hT >G"hT@^D@(x QH@d||`.@`@`@  A| ($ ` @l | / *@ | '|  @_|$ $   $ @S$  $$ &"@& 'J '@  @"J@ "J*@@ zx@#2 @Đ z@#)  %s/%s0'N /"@ `@Dw / ,@`{@6$ /,@@ `@&'㿘&2  : @!L  *L0@5 2&2  : @ L  *L㿘@@ " @? @0 `@*N@쀦@  (8 + 8  ? `  @ J@  @  @  J@` ` 2?302|Vi was not loaded with a Tcl interpreter㿘{@"z  8@  8$   ^ " @$ $`@2@&`" &@ L $  T`   L  @p: 2l @p    ^* #* Y## ؔ @ Q?`| ȓ*` €8V @֒R      @E  "0 $ ?`|!X*` €Tx쀊 @    J?`\$     @ @J?`.@ &`"` @&@"@۰   Ӏ  $` @o 2İ @a   @o  @$`$ @@2`&@"N&`  @2 @  @2} |@*  @   K "` @ `@ *K @  $  #*  *`?`" @T i `" ؀"  ," 03 @''    @D9 "I '  @  '' @ |€ $ $  @ؐ@f 2* |@i|€ @&Đ@cD ` 耢    *@ $  %c%6lu %.*s㿘}@p!" """ *` * 8`}  }`@pߐ!"}`"@p`@6#㿘#Ā " ## * * `8@#| " #t#t * * `8@`  `M 2 @$`@*M?@$  @$@($` ` `@Cq` 2&` &` &` ``* `&`    `?`* `&` 㿐`L`P? '@  , ` X @2 4 @ . X& 4 4   @ 2   & 4@N    & 4@u $`L$`PTo see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" 㿘~Ԓa@~Вax~̒a~Ȓa~Ēb0 The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s 㿀`x X `t@D  ` `(+   * ;#Ѐ`#@@M` "  2@ `"#~ !2#~` @ `h*  *@~`Jb0f  Db="H  Z 2    4b0P#;c4 ~~&"!! [/J@ ]h*  / // ``*  / * +@``@  `   (T`  @̖  c (T`c@U The %s key has no current meaning Key:%s%s Usage: %s %s 㿘`x c `t `" ` @   `~4,`[`]`~ #`~$ "## *` * 8`Ā  Đ .`@  2 `` !*` *  !X@@xN J !؀ !!h> Ĥ  # !.`$ "## *` * 8` `.` `.` C"``~4  (T`  @  Հ`~ (T``~0@ 㿘\ @0 .`;*#В & & `& d& l& h`& p |!6 |& t & x$ x t( "`"@ x t(" x"@㿘 ' n4$ 8   4@A8 *$4@`? &`@;@  &@`  "쀢 2  6` $` 2 ,@2& 2&  `Ơ 167|More files to edit; use n[ext] to go to the next file, q[uit]! to quit㿘`2  0 , @"  ( "    & 0`@   㿘   ""   " "" * * `8@!`  & 4!X * * `8@!X$& 8 ? &$ 168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s㿘 K"4. €`p ,4@ 0/)%H`2  H@ 0 p@} %s Version 1.66 (5/18/96) The CSRG, University of California, Berkeley.㿘cP^X 175|The visual command requires that the open option be set%luz%c%lu%luz%c 㾐" " "" *` * 8` 2 `d@/ y  " & L`| hb  - @  ^  L( + L .  P#  "@?R L  -2`  L`X@+!  L@#! @  `|" @d" 4$b2 $ "   @) $`@&$@  '  & `@w" 2 = 2  ؒ`   &$ 㿘@h 2  @  2 c&`x㿘@S  2 @  2 `|  `  $$"&$ 㿘@2 㿘  2 X`  !  @  2 @ ^ 2 `|  2  `$$"&$ ! 㿈  2`|`  !  `xp`t@L *`:  "   L  YXL !T#X "#P#P *` * 8`2`    `  * :  "  `  ` ``  @}И  2 `t  #\`d`l^ 2 $ @2 ` L >L  > L `*`:  "   L  "`L  ` 2``l`dR @) 2K `x 5  1@`t!   `  @= "  @<` " ?#? @2  ` 3  `@  `    2``l`d@c253|Writing...%s(`\`%'@ ( R O @V d (T`C  @   (T`7 @?hh   @t A @q 29 ? `& * & @MG`  @t 2V@  <  @V 2 @| 2  X`8@ @|ې `hh  `%'@㿘  2 `|` Ҕ     `Q`l`d ---------------------------------------- 㿈  2 `|`    "$``X " $X$X *` * 8?`| `d ( @('  @_`3(bY`, @ "@ &`d&`d`d?W&`l"@  &`dN&`l?2 @ "@&`d&`d@&`l L ' P?@t 9`?2 @ "@&`d&`d&`l, 2= c%&`d&`l 2/ ?&`d&`l@ ' @?&`l&`d` @C쀢 2 `l쀢 8&`l 2 2& L /tmp㿘`,00(    $4$  @$0"@  @x@v@x@ 52  @   @ `# a@x& 0@p  & @N @~  0&4& 024$0"$4%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only`   ?cߒ 6`@2̒ 6` @ \ 2 `X @.  ? `$`T,`X$`$` $`H@p U @&h 26`!x#` p!p * * `8@!p  @,$p@A?@ `@``` 6`@ow  &` ` 2` @on &`` "@ @Ӕ @`` /$` +6`  @icB + gB + 3`   ;  " x< p t $`<$`@$`D, 㸐 @  ??  ?/''hT2   '`@." `L'@o $`L @{ ` `X' ,`X  ! @{D؀  $`@  @7 2{`@C 2u` "     "@  `6` @) @# V``?# @6` ` @`H@ "   0 `! 6` @Q  $@` x `@E9   )    )   @$@&  $@& @?$@ @&$2 "` @&`` " `X@@` &` `X "`L@`L`L "`@$`L`  @@`l -c option㿈  & L& P $   `2 $@  L p L 2 & L& P #b@   [H$ $ @ ג L P L 0 : ` `& L`&$& P!l  8!d* * `  & L!d  @i & L  L  @ 쀢  & L& P P쀢@8  L& P@9v P P L''& T '@z 240|%s: remove241|%s: close242|%s: remove243|%s: remove㿘`" @? &@  L $  P`$ `14  ".`@  ਐ@6 @  `$  0@ "4"`  0@"0"@  @@& ` `"@   @ @  C&@@ Œ@`X2`H`L " `P@| `LȐ@ `P " `H@n `P@ْ `H?"`T@$`T?"`L@`L "`P@P`P @J@H 244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters257|%s: %s%lu lines, %lu charactersappended:  @tz      "쀊 """ *` * 8`    @#X=# ?$ " $$ *` * 8` / @{   ## @f    8@}  @U "    D <@  @     X  &"  @"  !0 !( * * `8@@ `" @! \    @  ؐ @^ !!@v  `@L @ x ''@ Z 2x 'x#\#`| @’ $ D$ <$ @$ D` 2W  @ 0N?# @ 4  `X *`X``@?# @4@t`` t |0x  !`!!x #\|@t    ` `thT >"hT@O 258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner?b! n$" @- ?   "쀢 -S #\      NN  @ 26   8@Y @) `    ?(T!||'` *  2#  @6 | x*``2   t@5 x Ҁ? x$ t(T7?! t$(T' |   * : % /L  %" *@*@ `" *@  `   % d-- `- @q-#h ,@@q' /,@` |@c @y @4 @tʐ ?@r  %" p@| @@U !*<  x@@ 6 㸐@ H?$`@7! '?=  @@Ĕ 3 :@ D  @ 4"@Ő @ `ꀦ   ` `t@hT >"hT@+ ?@@ِ@@B `   ` `t@hT >"hT@ 㿐  @R  " `3 0J@ /,J` *($!&$" J@ * 􀢠( J` /& L  '􀢠'  @ 262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override㿘 2 X7 1!$ "!! *` * 8``  `@   ` ""@G  @B264|File modified since last complete write; write or use ! to override㿘  X   `8@  @265|File is a temporary; exit will discard modifications㿘 "   `@"  4  `2 @  266|File readonly, modifications not auto-written㿘  `X !$ " !! *` * 8` 2"  """ *` * 8`  @    Ö 㿘 `@j` & @h% &  @ 㿘"D " "<"< *` * 8`  1 n&"@R  " #@? ` 177|Empty file㿐@`` @   @W  ` ` @g#`  &`&``&`` .` 㿐`` ``"*` 056`2@  &@@`  @?&`$&@` `&`@f "` &`&`&`&` @.``?@`  &``&` .`@p 㿘` 2 ` 2  ` "  㿘 "`  " " 2  ` "  㿘``@"0*` €::D::D;@' &@ `@#`  @ '&@` ` @fy`  &`&`` &``  ?@    &` &`?`&` .`@ 㿘 "`  " " 2  ` "  079|No non-printable character found㿘 c@S @m @=  @9  @5  @1 #x!x ,`H@k ,R` S R@:  ,R ` +  #D    ``",p 㿐 h ! x ,   , ` 2`"@@ 2 `@  x` ,*` * `# #`㿘  ] *` , !X@   - ,@` `*`㿘@ 㿐bԀ /b`. (8b̀`"b@ "+(``@b b`. (8b`@ `@D (` c`D   2b ^(`@ ?(` K`b"bb`(( 8" \x0 \`(`(`   8 8  )6`? ` \ x`x(`(`  @0  /@ `/ `/@㿐x x/`,"H@^$   㿘 ! (!! !   !8!!*"@($! !  ? @@  "!Y ! .!*"@ "!* + " #H*` @B* !$!!*`" !* 8$! ```"$?@$`$?$?$?$@$`$   ,? 'S   'R  ~$ $, Ѧ 㿘`  ` !` `?!!! " @ `? @@!!!*" $!* @+ "@ `*` & 0` $?@ ,?` 'S   'R  /$ $, 0@" `"`"` " `"`"`" h`   @2w A=T "xϐ 2i x1 2` ``!T*` €EtEEEEtEtEE  @JF   hT "hT] 28 A25 * "@*`   ` &@ &` &` &`  &` &` &`? $$ $\  YcD"W L  2H @ : I  #\ @- Ԁ`5$ "$$ *` * 8`2 v s   2"! "!! """ * @*`8 * *  Y* *` *  S* `&cD  `2) a&@ &` &` &`  &` &` &`? $$ $"`  D 2  a .` &`.`&`~ * "@*`` @/!```?" $$` $` "# "## *` * 8`J F@Œ  xؔ  2     (T `"(T3&````  "  ʘ  2& ``    * "@*`a `    "   `    O 㿘 ``" `@#``@# 276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event287|Unexpected write event288|Unexpected write-and-quit event㿘`?` :*` p €LLM<LLLM<M<LMMM !8`   @  ` @m @ ! !!* (   #!#!#!! 㿐 !* ".`*"@*`  '!@-  $!@ $!   ` 㿐 '@ ` @ 2 `  @O  ' 㿈J'H `  G 1H$@"#` x |`      @`2@ `'> :`" "'H`2&` *&` H ?`  ? 2H H@ 2'2&  &`&` &`' `& 003|unable to delete line %lu㿐  'H K @ @   29 HҒ  22 H@| H ''    HH@    @($   ?$  X  @  X , XH @ 004|unable to append to line %lu㿈  'L  J L ?''   ? LL@  4  @*$    $  X  @  X , XL`@  L@ 7 L@ O  2 L@:   005|unable to insert at line %lu㿈  'H 옔 F H ??   ? HHp@ K 1  @:$    $  X  @ X X , XH@ H@ܒ H@   2 H @    006|unable to store line %lu㿈  'H ? 3 @~ H ''?   ? HH@   @"$  X  @ X , XH@W H @ 㿘  `   2  $@ x |`"     `?007|unable to get last line㿀  2  Ҕ A  &@$@"9  x |`" 0 ?   ?   @t &@ &@@ $ $ $ $ $ "  | @   &@ 008|Error: unable to retrieve line %lu㿘@E 㿘$ 2&  @   "  2  @| 2    @{009|Log file㿘 &`$&`,&`(&`&` &`0 "! @kޘ &`  @ `X .`X㿘` "` @&`` " @&` &`$&` &`,&`0&`( 㿘 X  , L",P "0 ",P @"0/work/tmp/mrg/src/usr.bin/vi/build/../common/log.c㿈     @*ɖ "& $   ,*  @  ( ''  ''   ? (  $ $$ (b @Ɣ Ű 㿀 'H X " ,b ` , X  2X $ ,H ژ H`E # ' ' ǘ 29    (   @*c ", $  H*  @   @ ( '' ''   ? (  $ $$ (b @Z! 㿈  X " ,; V  23 $ ,    @*  "' $   *  @m  ( ''  ''   ? (  $ $$ (b @!Y 010|Logging not being performed, undo not possible011|No changes to undo`  X`  ( ` @ 0b @! ,X( '' ($(   ?`c*` €_0^_`__`^_`8`"( @  X P,X @ U B  d & dĒ @ܔ  Ė 1  \ & \Ē @˔  Ė?    XĀ "( `& X & ` @ ؐ''̔@  (@ X  ,X012|Logging not being performed, undo not possible`  `X`@  `(  `~ b @?!w ,`X`( ''`(`$`(   ?`[*` €abaLaLaLaLbHb @Q  L2 `X`( 2`( `XB  @A  L"`(`( `X` ,`X3$`(Ē @0  L@2  X   X "  `& X & ` @ ؐ''̔@ 2 `X`(@ `X  ,`X013|Logging not being performed, roll-forward not possible014|No changes to re-do`  `X  `(`$@X @] 0b @"K ,`X`( '' `(`$`(   ?`eT*` €cdtddde(ce`($`( @  `X P,`XĒ @  Ė ?  \ & \ @  1  d & dĒ @x  Ė    XĀ "`( `& X & ` @a ؐ''̔@3  `(@I `X  ,`X015|%s/%d: log put error267|Log restarted㿘!!@(8@    € @ exnexnviewviewc:eFGlRrst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s8hh   ($hhh ` $h``0a,$`|``| @$`$`|$`,`p$`4$a0b$`$` $`$`$`0$a,$a@@c$aD   @@cڒb  @@cҒb @@c̒b    @@y "hT   $hT    p-`8i *` €jpjpjpjpjpjpjpijjpjpjpjpjpjpjpjpjpjpjjpjpjpjpjpjpjpjpjpjpjpjpjpjpjpjpijpijpjpjpjpjpjpj jpjpjpjpjpjj0j8jpjXjda  n#($a ?% hT ?!$hT   t r rt n#  t?   n#h 0@Z??c@*    @@@U   hT "  @ } `""` @2`$` " o$` "`""` 2`$` "  $` 2\ Ȁ   )'Ȕ̀` "` " 6"?"@  2@ h@qm!@''''''@”    @5  (  @/  C  @)  G  @# d #d " * * `8@"4 !` " !X!X * * `8@# 8   r 2 䔀& r  2 `@ ԰ z ` X* @*`8  2 "a   ? "_ 2  & @E @   & n" @d@  @4"$"(@r"@" 6$`2 @ 龒 | 鷐 u䔀   2   , 2f `| `!d&  @ U S d    @۔@ΐ @ؔ $ ;  2hd耢  2hd $ @ "$䔀 ~ @^  2 @ @ @@@ʒ   @ %s%.*sex/vi: 㿘    @   "  @   " (T@ (T  8@ta l  8a %#  a0(  @a` "` " l 2 ---c$-s㿘`@ "` )'"`h+@a?bX "U @L +$L  @  '&@ "` `* `* `*8*@@ݐ  &@ - c**@3i )` -2&`L   c@Ȑ   &@ n@%   h * ** T t w2`J` "``@  %s: %s 㿘 8`@ِ`@Ґ` ! nb@X @ǐ@Ò`"`8 㿘 `8"" @"@`82 017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists㿘``" '@   ` `*`#  `! ` "  2 `` !8*` *  !X@@  & &㿘``" '@C  %@    @ / 2 `8 "`8"  "`8  8 " "" $"  2     $ , $  , ,   8   *"02㿐`  ` 0=@  8 "7  * ? . !&  2 " ]  2        8 "   * &  2  020|Error: %s, %d: : %s%.*s㿐'P'T  'X` G `"D C+`< !*` €yzpzLzpz$ / $$  8$* * `$   T  $T$$  8$* * ` 0$  $@+a@"+a  %a$   ` `t@hT >"hT@e, '    (T!' @" "%a x   t x@" "%a x$ t(T'! t$(T` a@@ @Ԑ @ ``? ;: 6L #! ` $@* *  !X@*`:`v@m[' L  $@@mJ 'p@Ŕ "@@!P`'Z`2 nb!$@@V! @m 'F B  /& 蔒  8a(@m   ` `t@hT >"hT@%a㿐! n0 "@$"    ` `thT >"hT@c`P@0 299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedx301|lines300|line%lu 㿐$@#  & X# * * `8@# \  ,```    t   ,```"@0    "'(T!"  x' @!B" zb  t x@!6" n x$ t(T'! t$(T#lb    ,`@`"6`  ;, , @l   `  '  @@Y , @ @L  $` `Ŧ , h    ` `thT >"hT@y021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu㿈  @ ` '   (Ta" x ' @     t@ w x  x$ t(T'! t$(T  @ : , , `  ?# @2!b`b@@   ,,,  X`"bbȐ@ʔ@   a  ,, ,bؐ@@q  "쀊 " "" *` * 8` 0   ,, ,b@@K   :, ,-!쀢 t쀢 b@j@*# c@^.`** @@0 c(@I@@  ,! 8$ L /2 $  *L .?,?,?,$' h    ` `thT >"hT@LANGLC_MESSAGES%svi_%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog㻀@ / "#L  2@j  K  @j   K  (@j8$   @_ۘ  xb 2*"b*  ? '`  2` 2 ``0@i  " `@xb "b H  0 x`h""@  "`h 㿘 h  @268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 㿘`(#h.` €bpb b bcc@@{㿀#DN@@ ` 8N` `2N` `,N` |( ?@='䀦    "` h   2`` &@*? `@&㿐&  #D*`:   ``    x` `thT >"hT@  @+ + .&  (T!" x!' @ږ 1   t x@Ζ  1 x$ t(T'! t$(T13! & L $" `8 *`* * !X@:`̐J@`.J@  @ L  .xh`XPPH8(ɀɀɀxxphXP@8Ș0(( ((L8 xhX@H8(@@ t ʤ ` p`Pwriteanywrapscanwrapmarginwraplenwindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsgtagsmodeflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase   "%&+)x/p1h3`9X6P5H=@<8A0;(> >HLHIJKwswmwlwiwawttytypettytstotltagswsmslowshsectscrroreparaoptnumodelinesliichtgtexedebdircobfawapaicdpath=%sCDPATH:directory=%sTMPDIR/tmpescapetime=1keytime=6matchtime=7msgcat=%s./report=5paragraphs=IPLPPPQPP LIpplpipbprecdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sSHELL/bin/shshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionhТ?'''' >  @V  W#.#   @J  K" ."    @> ?!`.!` 2  @2  23#X` .#X@e"0 "8@e@$@'@ " b@@d"P "X@e&$@'@  "` "` ?/'@r'@k  "p "p7?@_'@X Ѩ " "'?@L'@E  ⠐@dג$@:'@3  " " /?@''@   -" "????@'@   &ؖ@d$@'@ p *#  #`?`7`?'@'@ "Y 1c@d<#( #0@dk$@͐'@Ŕ > 3#8  #8 `?`/`?'@'@ ' 4#P #P ?/'@'@  5#` #` ?7'@'@  8#p #p7?@x'@q  ;@d$@f'@_ "" ب = " * @*`8 ?2 '̀ А '̔@cߒ$@B'@; "  /`̀ 2 ̀"X$  " " "" *` * 8?'̠̔@c$@'@   H#p#p`_ !  "  P  "" 0G  @h   @b > "  * * `8@ @P , " *` * 8`2  " "  * * `8@ @, ,@u  `@#pБ*`@@@&@'@ 2 @`@?*`  #p-    all032|Usage: %s033|set: no %s option: 'set all' gives all option values291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean㿀 l @Ta 2\ $   L  = ?2  = G M  L ꀢ =',@ L n L o  '@ڐ ᰐ#p$: - *`` `2 ` 2  @ `?2    "  0 `  }`  s mP`v`22   *  a" *` * 8`2 ¶ 2 *  a"  *` * 8` 2     2  . 2  @% 2  h 2     @ y  @ r  `cDL `^@ `MSN䀤` ` `   =@s    ` `thT >"hT@䀢    ` `thT >"hT@ސ  J A ? ">  耣`   ` `thT >"hT@䀢 k   ` `thT >]"hT@Dz  @   K 2 *  a   *` * 8@  "    2 ) 2 @$ 2  ( 2~  o  H n `2 "  ` a-` 2, *  a  *` * 8`  *  a"  * * `8@@Qג "6    2*  2" @$& 2   2   @ " @rw`2@|㿘.`*  a   @ * *   8@ @In  ٔ   `  @ "&`&` @  @ "&@&@ 305|No %s edit option specified㿘.`*  a   @  * * 8  J 2 2  #p.` XΒ  %ld%*s  8'H @ ? = p  #p `p %@`: H, ",0`,  -,,@*  a   * * `8@@*  a" *` * < "ު`n,"٪`i,@*  a   * * `8@@*  a"  *` * < "`@*  a" *` * <`2@3, 0,@*  a"  * * `8@@*  a"  * * `<@@Pf ,{`*  !`"t`,@q,* @ !? `,!@|D@` `.0R !    *` * 8` "A@ !#`p   * * `8@  @^ @|p' !   *` * 8` *  a"  * * `8@@{/`." " ``@ C@@{ 2     @xô  @6+  @p-+,  *`@?@ ' c(`@, `@`ހ@%0؀@ @%#p,` *`@@`@0@,` 0%s%sno%s=%ld%s="%s"㿘#p&@`: `* `>+`0l+` *  a! @  * * 8`    `#(!@H +` *  a@ ! @  * * 8  / *  a@!   *` * 8`    *  a"  * * `8@#(hset %s set no%s set %s=%-3ld set 㿘-p p 2 p %`*:  `@,` ,*  a  *` * 8`  cc @o` ,*  a#    * * `8@   @o` @*  a  *` * 8` `  "` c@o-  \2`` \?`&``@ \@* &@@"4`?`&``@ @* &@@"!`L@ Ӏ ` =?`&``@ =@* &@@" @*  a"5 * * `8-@  \2`` \?`&``@ \@* &@@!`?`&``@ @* &@@!Ғ`L@ Ӏ ` ?`&`@* &@ @!` @  W   2  㿀c! ' %@>]  1 * #p0'p!$' M@>K  0!  @yp` L@J &  @[ 2    2L@㿘@M@㿘@M@㿘`@p##p`  a  , @2k  2g   " @`*` * 8` 2   ֘   И F  " @`* * `8@      ( "`*` * <`2   "  " `* * `<@   킔     ` L 㿘#p  !  ,@2F 2B  @ *` * 8`  @  " @@ * * `8@@ "@@ *` * <`2  " " @@ * * `<@@  L 㿘  B    040|Screen columns too small, less than %d041|Screen columns too large, greater than %d㿘      ! 042|Screen lines too small, less than %d043|Screen lines too large, greater than %d㿘 !   ؒ !캰 0~    2:?$`` & $X * * `8@$X ` * @ *` <  $\`  *@ *` 8 M (J  H    H  < $`2 ` & $X * * `8@$X ` * @ *` <  $\`  *@ *` 8   ( ? H N ? H  F 044|The lisp option is not implemented㿘P*  㿘 048|The paragraph option must be in two character groups㿘@w    㿘$` $$ $($"$ 㿘$@ @ڀ $*@&$@@u $*@&$ 䔐   049|The section option must be in two character groups㿘@wN  봒  㿘      㿐 (`€   $@8 㿐 (`€   ;P.@  㿐 (`€  "@@  `*` ( 8`0 ` *` 8(?" " 053|The default buffer is empty054|Buffer %s is empty㿈`C2 ! `2<`  #D `  (+ @ ` @` ``@`2``2` +  * !X , V &`; 2L  2``      \ & \`' '' . `  B``'     \ & \`' @ '    ' 쀢 2    " T!     ' @ 耢 `  x   t@ x "ٰ x&tT'!t&T쀣 @ @ʔ@' @  `"@b  쀢`' P@ ' `&@&   X |  `& X w& `` '쀦   "Tt@2`T >&T`@x ( Tt@ x "l x&tT'!&Tt` @ 耢 Т``@@W`@P` Ö& 2/  X " `& X & `    2  \ & \` '    \ & \   ` `t@hT >"hT@\%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails0 * T" " "" * * `8@@_0 " n"쀢`@_6 B 2; +@#N` N H$@WR@!?@@@ &`L  @VX   `X  .`X057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails㿐  X , XB  P ߀`0, X @k 1+ + (ha(   €  LP  (h   h   L@U! X  , Xp蜒  060|File backup failed: %s061|Copying file for recovery...㻘 `"{ `X  u `` €   `X `,`X`L鮒 b `` `X ,`X``P@a`J  * 2C " " "" * * `8@H@Vn$@!?' (hb `L@Ȓ  @ @  " @U@  h  ` `   2 062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery file%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: X-vi-recover-path: Reply-To: rootFrom: root (Vi recovery program)To: Subject: Vi saved the file Precedence: bulk%s%.24s%s%s%s%s%s%s%s%s%s%s%s On , the user  was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to ex or vi: vi -r 064|Recovery file buffer overrun065|Recovery file`@Й@   [   * 2 " " "" * * `8@? H$@Uk@!Ԓ   ֤  `) `2 @>%T %P  `L  /@v  ?b @?b @)H!!#dؒb?#\#`#h#-a@b"8#l#p#x#tᨚa@U.@Xg@f@"b#h! #P#`#\#l;p#x#|#Ppbx#d@T X殒 B`-` <@Bϒ $@`<@L@ 2$@ <@8L@ ,@`$@@2ٴ`? @|@  p `  ?%T @ .recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. 0 * ""  " "" * * `8@@C  @D#   _ t 9753/`-#@\   Y@6Nऒ TT  v   H$@( !@[  @B $@( a@[۔   @B 2* 0,@! n$"@[ " T"쀢 2T@S0 @@K@5 @Hې@G  `@5 @E+ %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover('H * ""  " "" * * `8@@Cِ H ?` '    c@[?  $b@Sf @[   ԡ      }''$@ #a@[  @A= $@Δ a@Z   @A) 2 , 5b0G,@! n$"@Zǒ  "쀢 @R07@Dx 2@Ò`)@<^  Ȕ @] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A㿐`0 2 " ` `4`<  Q< 2I S 2A `D` 2 24   &`D+&`H`D        &`D`0   >`H @ &`0 &`H`0  > @&`0 `4X#\   L ʔ@e @207|The Q command requires the ex terminal interface 㿘     L" Pc  #`  3 $ W$$05  `4`0(`` p#\   @N<X#\`4`<   ˔А @6>X#\`4`<  К ˔0 @suspendX#\ 7    ˔Ж @180|No previous file to edit ˔ҿ   >  2 X#\     @^;@Ӕ!؀ "!! *` * 8`2`8   `8 #\X 1#\X :   T  X!0@^h@p#\ <   9 @!`0@ `,Ő @"@bp`4#\`<     ,ؐ h   2?  ,'$4@Ɣ ! /  x 8  L &`D P$&`H@9wp`4#\`<     ,  g     ,'$@)'` "#\ "#\0 " #\0p ,p Hp J    @RE@p㿘`  €@   㿐  K f`!T "!L!L *` * 8`   @ 2i     -  2_ @8$`` ?"`* "@ T6@;_ < #` ,  & ,| `@တ@ : 2-  x 8    @ 2  ` $@&$@;0 2 @ 2    @"㿐 L w  $ L $ P P ` $ P L&`D P&`H 㿐   @ 27 ' . @N   0$  #  `"  L #  J3``L  "`L& @ "$@ &$&  307|No ex command to execute㿐 L 7   L   @'Ӕ   ͐б    @  $  "$$$ 㿐 ` 2 @  2    `2&   2 & ` ƺ`&  㿘  쌔  "        X `*X 88877%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number # +. + -(@'C  0(   @  4`   8@  !#DJ `@ `@ *J@ h@!&`P@;ے #J 0% "@ J  X x2J@`J#D `  ΐ @, 9@ J `X-͐B ? J@ 0 `J#D `  89-͐)  "JJ@ + -2J`J-#Dؐ  J-#D   ΐ(ύ   A)΀ 00 0-#DJ `89& ?Ȑ %$ #DJ@ ` $#DJ `   @+   $@O Ā $` ` (T!  2' K  x 2   t> x "  x$ t(T'! t$(T  @@m-@ 5x|  m - |`  #" [   6  " P  '|  "ؔ@= d# j ; + xx:` 1 @:"* 'x?x@< d@m*@@m%"@@m"@""  '4ō @'`` `` `t@hT >"hT@jN182|Resulting number too large183|Resulting number too small㿘`  ``0 @N8X] 㿘 @N!̢  &`$a,$a !H "!|@i $aD @  !D@l!H!H$aH!| " !@YĐ $a|   !,a!$a!$a 㿘 !0 "!D@i!D "!|@i!| " @i ! @i@i͐&  㿘`1""`H`&"#L% " ! #D * * `8@ " "" * * `8@@@)m㿐`4  8 2  ` & P   *`" *  `ѐ@x@ & `4 & L쀢  쀢 2'      "   P 2& P& P `0#\(` #`#d @@ 㿘& P`4 P "    *`" *  `z@x@K  & `4 & LŠ쀢 쀢 2'  " `0#\(` #`#d @ 㿘@  㿘@ x@  L `& d 2]  2 ''D  & P 耢` '*`" *  ` 2 L Lw 26  L F쀢 2-  L   2"  L & L /쀢 " L ?`0#\(` #`#d @t x`4`<@쀢  쀢  @  & `02``&`8! "!! *` * 8`2`4`4 " `4`4ﳔ`8 2 `4& L`8 & P  *`" *  `2`0y`0` > +&`0`4`<@2'`0 ``<`4I 2  "`0h#\` #`#d@ `0" ``4`<I 2 `? `8 ;`4 | 2     "`8(T!"`8`8 '   耢 >`8 x   t x "]  x$ t(T'!$(T t`8@jQK% 2H ``4`8a 2> `4& L`8'& P`4쀢 쀢 2'+ `8 :`0#\(` #`#d @j    ` `thT >"hT@gVx@  & `4Ø쀢  쀢 2'"   " H`4  &`<?`0&`@(`<#\` #`#d@ x@J  & `4쀢 쀢 , ' " `4`0&`"7])"<(&{[ޔ}ؔ 4 )" ( 4 ]" [ 4  }" { 4 >" <`4'' 2   `2`Ā    `ՐH n &`<`4 &`@2`<`8 :`<`, " `< @"`<`8&`D&`H`@&`D&`H`, "N  @"I `4`<@`<@`4  'Ѐ 25  Ѐ :`4. `4`<@`4 ؀ 2  ؖܒ"@  '܀`'J@    ؒ`?'܀ '`0  &`0㿈`, "`4 @"`4`8 `4&`@ &`<귔`@ 2 `8`@@8`4`0 &`0`4 ј 2`4`0( ``, @& "?  `  g?0_`"?@  ?= K@  .?"6`,ܨ2ڨ (֨ !|J` K`*: 2J` 2K` "?K`@2?J  `"@ 2?2 `, "&`D @ &`<&`@&`@`4S`8&`D&`H&`<P&`@@GK`4@@ 2!`,쀢 쀢 = :&`8 `8?@ `,`2`,@ ) @ Ő"P`0 > @&`0&`<` `,` &`@`@"`<`4`8`<`@&`D&`H 㿐`,`4  @`8 ?`2`0@(`4  &`0 &`4&`8y ֘ 2r `0( ``, @+ "`8 ?  `  R?0J`"?@  ?B K@  .?";&`Dޢ2ܢ (آ !|J` K`*: 2J` 2K` "?K`@2?J  `"@ 2? @Fc &`D&`H&`<&`@ 㿘` @Qv @Qp`@"! @a,  2  ϔ  !| `@a`@d9`@d3&!| 㿘`0@@v`0h ` -?`4`D`0" ` s 2 `D`H&`4&`8 (T`2   c    (T`  ٠? 㿘`0@@8`0h ` -?`4`D`0" ` 5  2 `D`H&`4&`8 (T`2   %    (T`  ٠?  `π"ل|(dddddddd 2  3  4  5 6 7 8 9*`(㿘  186|No characters to replaceh `4 jЀ 8 Ѐ2 `0ِ -  ``8`4? &`<&`@@H`4 D  $ @0  ؔ   ?`*ِ"L*` €fdfffff 耢    ,<$@$ $$$@0d؀ ΰ 0ِZհ    (T!" x '̐ 皔̀  ( (T t玔 x "  x& t(T'̐! t&(TԔ @bݐ'@ "`4@ 2}`8`4&`@`&`<ԐD`8 | `8АԔ" @ 'Ԁ%' ! "!! *` * 8`    J` `     'Ԁ'Д C 6Ѐ "$&`@ ! "!! *` * 8`2`4&`@ "&`@`4  @ 2'  ` &`@ ` &`@`4  #   C"   <@D@`4Ȕ   ` `t@hT >"hT@_`<`@&`D&`H㿐`4   !G  `0(`8`@`&`@`8@ `, " @2`@@ & `@ `,`&`@`@"`<`4`8`, "`< @`4`8&`@&`H&`D`<`@&`D&`H 㿐`0("(`<` #`4&`@栔`@ 2N `, "` @" ``8`@@8``0 &`0`&`@& 24 `<   "( ' 2`,`,@Ő"@@  ?` &`@`@"`<`4`8`<`@&`D&`H 308|Enter to execute a command, :q to exit187|No other screen to switch to㿘d@@ې `@@" #` 2 #`ې @ے   `@@ "d @ #d㿐`0(` `   2  " @`4      " &`<@; 㿘`0(`<`? @?   @' 㿘`< @?   @ 㿘`0(`<`? @>  @  < @" D ," H 0 4@@ " 0  8: " Dń@ 8" D" H㿘`0( ``4 " `@&`H&`D&`< @`4 㿘$@]0  2`4@0㿘`0(`4`@`A 2`,@V`4   &`< @"`<`4`8`<`@&`D&`H 㿘`0(`&  `<@9|   `< `@&`D&`H㿘`0(`&  `<@9f   `< `@&`D&`H㿘`0( ` @2$`  "!$`$`  @$X8+ @ *` @ 0$X@  +  *8   8$X* * $X@Z  ?`<@9   `< `@&`D&`H㿘`0( ` @2$`  "!$`$`  @$X8+ @ *` @ 0$X@  +  *8   8$X* * $X@Zp  ?`<@8ʖ  `< `@&`D&`H㿘`0`<( `@8   `< `@&`D&`H㿘`0`<( `@8   `< `@&`D&`H㿘@" 㿘@ search+%lu188|Characters after search string, line offset and/or z commandx`0@  @r p  / ?#@ "#8#8 *` * 8`"" " "  @U 2а  x8 ʀ 2  L&`< P`,  &`@ @N `< `@&`D&`H&@ && L PMP܀ 2   ܀ & `  " l `< d&`< h&`< p&`@`< 2`,`<y"`   Qߖ x&`H "  @  @ @@j `R @L zZݖ #DJ ` Ӑ *`:  + ^  8݀   ݔ`   22    2) `<h@.0   2  aȐ!2a`<`@&`D&`H`0 > @&`0  p &`H&`D 㿘  "    @o 㿘  @f %s%s%s[[:<:]][[:>:]]㿐 !4 `   (T!" x' Ɣ  ( (T t⺔ x 2 x, $ t(T ! t$(T' !0ޚb( @- @@     ` `t@hT >"hT@[>189|No previous search pattern㿘  ( -`4`,`<  @2   `,`4`<  @2   " `, ސ5  @? "`< @ @  0`<`@&`D&`H 190|Search wrapped to original position㿈`4`< `8`@@ ߐ B  `0`4 `<&`0 8 `82`8`8`@@( `8&`<`@'&`8&`@ '&`4`8&`H#&`D`< `@ ? &`<  B쀢  `8 `0 &`0쀢` ?&`@ 㿐#L " #D#D * * `8@" `, "`0 @"`0`8 `4&`@ &`<ߔ`@ 2 `8`@@8`0`0 &`0`0( ``4O' KJ`{  `, "K@  `}2 K@?2;``{")`,/&` @&`0 H&`4&`0&`8`< `@&`D&`Hx`4`8? 2 `0( `       2 2 `4@`8䀢@    2 2     R ۢ ?`Ty *` €````````````````````````````````````````````````````````````````````````````    "   2 2   U  r T S `4@ `8䀢@ @ ; &`<`, /&`@ @"+`<`8 2!`@ 2`42`@`4  &`<  ܀  ܀` &`@`0 &`0?&`@`4`8`<`@&`D&`H x`42`8`8 2`8 '' 2 `0( `   2Ӱ q   g     zw`  2 l ."  ? b !`0NM` [ Y 䀢 ) ] " ' ` |`   2 `4 2s `4@9`8@6 \`` " `!''`   ) ] " ' ޒ 2``&`<`, +&`@ @"'`<`8`! 2`4`4 &`4  ܀  ܀  ?`0&`8 &`0 &`8`< `@&`D&`H㿘`4  㿈 L&`D P@^&`H 2Y  a$ !$ L$$ $ P  *` * 8`2  $ " $ $ "$$ *` * 8`   #`#d#\  @  $* $$@h   4 2`D$ @$$`D $ L`H$ P4Pa"a!"a!"a@"aD"a<"a@D"(ࠄ(aa :ࠚ a" aa " a"aa *aࠔ @"`"  !*`."@"<"@"D 㿘 4 M a& <a& Da & @ 8 <   l€  @ (  < * * ጐ?@"a?$a" " " "  *` * 8` 2a @5ː 2  !a  a a$a 4aȰ 191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter㾨d`x'H``x `'\'P'T $d  ` @P9BT$ ($ $$ ` $ T $ P@X $ TP8 Ұ @$ $`@2@%`" %@ $ 8`L$ T`P`$ d@" T"  $ ( @ $ @ $ d@@ D  d    @    $   $ $$ $ $d   *   $` d$ $ $ $    *      $ @-p$ d' ' dx " dpdp`* * `8@" dl`8" " dddd`* * `8@ ',hT'  d2  d  + 'd   /#/#d@' '4 '('( $`L  @%-$`P  H`0@d(  4 "d 2 'a\'4`4 " ''&a\&aX&aT@$@$ ?`!*` €d  P4d $$d@$ƒ؀ ð 0̐d@  *@'d ` aD  * 'd  2a d  " aT` aL`+ @ *` 8 `@ ` `+  * `8@ J " @# a  a`*@ *` 8    `* * `8@ J "  "=$ 8  $@6$ 82 @4 `a'  m d@#''d @% . "aH*   aDpaH "#&aD- aD"* #"" " """d@- "aD* @  `"  '  1 ( ?'(?     ( $ $ (  d cD   `D`2 @  Ǹ ` !*` €H ttt@tl,,tlHPd(  @+   d @0     $@_ ]$ 8hT   0@z, 2r0ndd (  @(d   ?$  $  $ 4$ $ 0 @+X  Kd@ (@ ($ ,`"&   @J   ` , $ ,`27"4J  2. , '$ ,J   a  a`*` * 8` a    J     6# & & ( d `*&  x@  2ߐ` ` t@T >"T@R   @ Đ  `;& \ ` 2 X "/' ` X    (   "& \`X    @@U=`X  @ & \  & `& (X& ' ( 2! 2      پ "q& d   'd *    & & $`|$ `x@2`|$`x"$`| @*]  P׀d  `` + '`  'd@,* ($ 'd'$ (  $@ $ 8#   $  @  $ 8(d(hT   0@,  0d(  d@(d  @  ?d$ $ @PT@  (d "     @T  ( " $ d @  ͐   `     $ *@   ?$  @)   0  @kd 2i h @  @ad 2_ ^ @d Z @ "  >"% 0H`Kd $@ Ed''    Ô "v'  @T  ''   `)d $@ #d    * $  $ ("@  $ ($  `d $@ @ ΀@5  $  d #$ 8 @d , (  $ (@ $ $  2  $@d   $d   $$   (   J?  2   (  $ ( $   u d #  ( $ ($  J x v @ 8 (r# (   $ ($ J` O` N    JD ` _2   '0 @ K#D 0 ( $ ( $ J ` _   6# @ J? / -@ 8 (*# 2  $@d   $8  d@@ А  $$   ("  $ ($ #  /#d$@  U d@  '%  ^, (  g'( d @cD  `  ` 8^ d2d1 #D `7_32! d@2 hT  @  0@, 0d @?"  (  d@@u( #D  ` _  d@[ ֐   (?`$ $ (   @  "@%$ $ d8@0 0 "     '  '      ݔ "$ d   'd *    $ $ " " d@i2 `!`  @'p  f `"a\`!`2 '@ W 'a\ 2dhT d@ 4 @ؐ ? 2 `!`2# $`L @ $`P@E , #  H@# ! d@(dd*  $d&aLd@   H `D  `H@ 㿈'``$@}` 4  ? 0 .#D `_?? ` ? `2?_"??? ` ? `_  2?"`2 @C  5'@'@ 21 #\   %/  Ř  2       ``"` "@&`&```(  @Q$' 㿘` `  ` `$@ @ J  @ @  `$@2  C  ? &㿘``o`$ k` g@8#&`&`a&` " ## * * `8@`   L@   2 2 @%`$@`(  &`(&`@   @;(%($&`  /@8   /@, ? 㾠&`  ` `?   `$ L@  2```` ` $@  ǔ` &` @ *,@#\    v FU 2 F  ,@|`),@`/ |@@<R||@W I||@&I  <  @2  d@ &@ 2 |@`    -`  * :@ @@ @2* ` | @   ?,@?`  ``("@&`&`( `(  ?,@`(` &`(&`` *````  $@  ` ;&```@` &`&`@@N]?? ` ?,@?``28 |@% 20 <  2) `` `  $@  ה`  &``( ` `@N%` /` `&`&`,@`٦  %s %s%*s 㿐'L / 'H@ LH@?L$  ` L@@V  H $L  @@  * @ *`!] @  @  2 @8@9s $` "@ * &$'' 8@.)@H#bk$T w   ` `thT >i"hT@JՐfT?@IGH  @I@H@9( 2`   J @:;97L, ے@bjڔ`   ` `thT >"hT@JT (H  &@"jT `@ Lj̒"T  * bjT  ?j ?&T $ &$ 㿐`'L J@!] @  `L@  * *   '(Q```   `с` K &``  #`L@ @@LΒ```(`@L&`&`(J  `  $'L , ` * *  !X@rL 'L @,` ` $L+@ `@! 㿘@  = `& L & L$& P @&$㿘` ` *``J   @"``$@J  2` ! n$" @r "쀢` (`` `"* `* ``"`"@&`&`*?`("` `` @L6` "  ```(  @L+ 㿈@`( Ɛ?&`(` `*@ &` "`` '` * `@``+@ +   * a] @ '  `(`~`&`(J`   `@p *  * a] @' "]'# 'T``   ``` m&``"  @ `(@` `@K ``(&``&`(K `   ??(  *??&'  * *  !X@@ Q`  ??   @?*`?' 2`(`"  &```( `  @K` "'``` ` `` 2` &`` `&`2``` @  * ``(  @K8 ` `* `&`㿐 4 2+  `4 `8&`D&`H J \  " J \2  JK?@2 `"`4K? \" `4 `8&`D&`H n.*  `2$* &$ 2_   @`4`8`D H`H''J / `D+  `D 2`D& L`H& P . a @/ ,  .A 2%  ?Ȑ# @2$ &$a&*  a@@  @V 2    㿘@``` "`  x@@"$~`` / 2  @@ $*@&$ Unmatched %sx@ǒ  2x ؔ @(U  2p ``''e 2e  ) { ( % L    ` *` *  !X@ < ڲ`ِ؀*- ܀@*' & P& L@m  2 "\ ""T"T * @*`8 * *    *` *  *  A @ ` `H @"L"`$@F"J   2`"`"`$` 3  "` `( "`(`  #``( ` ` #` #` `(` ` #`#` #`(J``#`@#``$@  J "` "` " 㿘(`' @ x @2` `, @@@'    @Ib(" "@ & &&(194|No more characters to erase㿘В 㿐`0 `4(3`81` 1  `* @ϔ & `?&`H *&`H#@$&`H? @=    2` А&`D 㿐`4  2!  `4`8`0  `<"`@@ "`< `< ܐ 㿐     (T!" x' i    t x] 2 xG $ t(T'! t$(T@H@@  D@   h"  `(*`@ ` /  *   2    ` `t@hT >"hT@EƐ㿘&`H   X`@*X "4㿘 , "a  X @2`0 @  *X@4   "44    `D V`D@*2195|Movement past the end-of-file㿐`  @@  @ 08 196|Movement past the end-of-line㿐`@   `?@ @ 0{ 197|No cursor movement made㿘Xk 198|Already at the beginning of the file199|Movement past the beginning of the file㿘`@ 2A 200|Already in the first column㿘@0 " J     201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi command205|Usage: %s㿘1!. € $$DԒ 0  @ƒ 0  ` 㿘@  㿘@ 㿀`0( ``4`8''3 2  '  !`,@ Œ"@ `a` 2ٰ ?6 ?Ť#5#Ő      2 `,` `bP@\@0XZ  o נ?k`, g?#   cD `_  #D `_ 0 #D `_ ˒ R9   ݀ `,@Ő"P!P2 `, "`,N       ?`,  @`4@ `8@`4! &`<`, &`@@ &`@ @"`<`4`8`<`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8? 2ʰ    + 2      t 2 $ z? `q`  2 H`T v "^`,? X?#   cD `_  #D `_ 0 #D `_ Ȓ C*   ݀  ( "`,A       ?`,  @`4@ `8@`4 &`<`,  &`@ @"`<`4`8`<`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8?+ 2     2       2 $ z? `q`  2 H`В m ^? X?#   cD `_  #D `_ 0 #D `_ U :*   ݀  ˒ 5    x   ?`4 `8@`4 &`D`,&`H&`<` &`@`@ `8?&`8 206|No characters to delete㿐`4     5 􀢠2 `0 * (`@`? &`@`@ *`8`8&`@ &`H`0" ``<`4# 2 $ۖ 㿘`82`0J' ( `@ " &`8&`8`@ `8?`0&`@b&`H``<`4 "Ҙ 2 $ 㿐`0" `3  `4"`< 2# `4 t `<"@  & t`D   `0  >`H @ &`0 &`H 㿐`0(` I'  r  `4'`8&`D`0 (&`H` "%`$`` $X *@ *` 8  0  `"  * * `8@&` @} 2x ` ` -" . + `K ^% `E@C = @= 7 `0(@4  2Q `D @!1 &  <`D `0(@ 2; `D @!  23 `D@   <`D @ # 0" 'S 'R  k   `(   @    4"<@"D"D"<< ࠅ((@"䔆@"㿘  X`    ]   ;     $ "$$110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted0  @% L0 @B$0 " ݰ Ȩ  aȐ 4a0    @> L Ȑ "0d `Ȑ("` `Ȑ >"`0 "*D % "a0 "aH @"$H0!" D0D@ @$H @ 4aD )D@$ D$ LH$ P0@@@  @ '  "      (T`2   U  2$ (T`"$ T  w"T a $* @@$$@  2.    aȔ@34aȀ 2$ $ $$T`@2&" &@   *`" *  `2a@  2 aȀa?" @ 4aȒ $ @ 2 0!` ?aȐ# @4aȐ@ T  *`" *  ` ' h'| `Đ#$( @# L ` @`!*` €(pڒ~ ( "'0 #X "#P#P *` * 8`2 0 "0 `*` *  !X@ٔ     "`0(p $0 L' P' L$4$D$< P0$8 $H$@ `@ϖ "0 (T`2   F  ݐ (T`2 ֐0 ((2 ,<? $< , $ ,( $Q 3 @    @!  &  - ,  ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command modexئ@ `?@Ֆ   0& &&&&& "&$耢  쀊  '@  "1+  Δ    @  耢 쀊 2'@0b.&0 @  耢 쀊 2'@ +cD `! 0@> հ 0 (&0' @j  耢 쀊 2'@ ' "6 ~0"  \  ؒ @F  耢 쀊 2'@0b.&0 @2  耢 y쀊 2'@ ~  , * `!X@e7 r )ē,  @ D .0("'0& 7&0  ~@ V ~2&( d "cc`*` * 8`&(  &( 2D0 . , * `!X@耢   $ `p`0 2`h `,!@  0Ő c`&0&(  ("&`0&`0".`@; L h@C2" @@b9@@ @  耢 쀊  '@0".&0 ` [ ] Z=`z @b  耢 쀊  '@䀢@(`z2~  d "cc`*` * 8`    .  R  9ؐ @$  耢 k쀊  '@.cD  `  @Ԕ k 0 &0 @  ^耢 H쀊  '@.@  !@, * `!X@* 6 @ @͖  *耢 쀊  '@.@ @    " `0 p  d@ @0!  ?????????'    @: Lؖ '؀( 0( '@80'ؔ h'&0@2((0` &0 L &4&8 L @  &< < H c !Bp&@` j&@%@'Ő#&(  0  !ߐ >&0`ؒ ~ L  P'''''''@€ 2M <L  <  c ! $ 8 &@ &(0 !@!&0&0&,䀢   耢@(&4&8&<&4&8&<&@&D&H( @ @9Д L&` 214|Windows option value is too large, max is %u㿘  蠟€  2n $ " ? ` $$" * * `8@"$a !`  $ 4!X * * `8@!X $`  $ 8$X * * `8@$X 4$ D$ <    $ <$ D~  4?$ @$ @ $ H @Ր  " <  * ጑* ?@"   L" a" "`$ $$aȒ`4aȐ O  %d screens backgrounded; use :display to list them㿘  ``)` ! "@9 "a@ $` "` @$`"@$`$ `@2`$`"$``ܨ @ $`"` @$`"@&` & `@2` $`" $` ? 212|Cursor not in a word㿐 L O 2a   P  #cDK@ `      E  #& P@  KcD ` _   @ #D J  ` _ 2 `@ *J  #@a4  ' a0a4 $a0 a0@;@a0*㿐@ D S C $0 Y  _0  c $ d _ c y/.@   V  @ē*` @235|Number larger than %lux/ #, *   ?Ѐ! @( 2# #D ` &?  @  #D ` Ց, &  㿘  26 ?` - !T*` € 2 ݠ  hd€ 0@ Җ  `  %7lu $'L'P !\`8 "` &@ *` *  *  *   @  4 :  2 `@ 'TL`2 T`"  ptp ! &@ *@ *`@ *`@ *`@ 萟:`@ lh"` 8"  *@ *` 8 2 ` `" "`` @5"8 " "0"0 * * `8@'`'`$@+'\"`  '\" *` * 8`0" @  x@@ T XLh V L`"T@ L@2T &@ *` *  *  *  : #@ 8P"@#@T`J &`&` .`,.`\@  ~`" $  , *  !X@!  , * a] @ Xl@Tl &` Ϊ `l` `'l !@  ""@@2"    l&` 'l.`8 8L" "    * @ *` 8  0FD =l    'l`` #Ā # +  * `8@ +   *8  @%$ *  * a] @h  lOl$G$@ Bl    'l`` #Ā # +  * `8@ +   *8  @%L$ *  * a] @I h$ 8h  ll$@?'l&` .` &` .`L`"T@ L@2 T P@  "@T`, h hx'X'dߦ l   $'l``! #Ā" ## +  * `8@+   *8  @$$"   ,  @*`!] "ْ"  2.`$$@.`.` $$@.` 'd&`hHTF`$ 2 d`<T &@ *` *  *  *  L: #@$@ P$#@" """ *` * 8`2$T T$@ T `P@ #@T`T`AhX"; x X $,X,'h ,X$  , *  !X@@K h @,`h  & 9  * @ *`!] .`#.`h\?``&`.`  b5X ,xX$  b0 @,`xl@x $ ,X萰 tp㿀$  a  В`p ᐀J +"  " * @ *` 8 2@"@ 2*` 2  $ a $ + @ *`@ *`@ *`@ :` @bX ᐠ ` 㿈$  8 "Q!\h!`!\ `$!` 2h$!d!t@⥒ hp!l!pӔ 4 @? h hXhp@!hhlW 4!``]!\ $!``2!p 4 @? h hl!phB!l 2Bh!` =@\ z!t G#@ *"@ *`" *  !x* "  ,$!t!d`$!x$!d 4 @? h!h!dzah $!dhX  4 @? !hhh€ 㿘 4 @?  萐  (€ %s 㿐$  #`##TwThp 4 @? h hl` @# 8 8 hX"h@#ݐ 8 @ "hXhh %.*s . ; 㿈$ @ (T "` (T ?(d$(T€$ $(T$@`4```   z{ `(\   h@'`2(\  @0~#$*@`&$ ђ `2(p@e0ɐaP@ `aX `p  x @$aX$aP` @ (J?` " 4 2' & aX ' 8 x  @   @|m% J " ""_(aX 8 ."@  J  K  ? K   "@ N "? # ?K? "? "?#  #  &  J?`.?# @( p@!  (T`     (T`((  'H 'pܐ @"'p "!X 8@ 8"@ [ 4 "/!\!\`2 @ @?( (l@R!!\`!T 5!%!T %!\ @@2!\!Ȁ ?!Tc? %!\%!T5!!\  @  4 @? ( !\!T%!\%!T (T`  {  H (T`2up ` @? (H`(\  x'l=M " `  ,`* a] @l $,(X`,`*  !X@??"  @?,`?Ȯx $ ,(XH`2(l(\  (l@p&%!X`(%p`(p!Xtx &@!Ȑ 4!$`    "$p !\  *@f&$!\`$$@2($ (T`2#$  Ė  2$ (T`2$$" @`?`@@@@ 25 $" !Ȑ 4!$  @@&$!Ȁ  &$?# &$!\` '!\ 4 " ''$!T$!\$!X@i $!T$!\$!X p  hphT` hd$hT€$@@*@ &$ L `l`"(\$ 2`l@Z  "`lE    "  " "@@1( @1&`l 2hȐ 4\     Ȓ  4@  4 '\  "@ '' $T`$\$X@ؐh ԟЁ㿘 4 & a\   @@ "@ "( (t `  4 @? ( (aT @@ @p 4 @?   (  4     0  U @</(T &$(T(Xa\$aT$a\(l@(€ `2 &@ q(d@ؔ    "  䀢 q (T $(T :`2&@+=+=+=+=+=+=+=+㿘 8`8  (\   (Xc(\  %.*s 㿘 @Β  (@/ $ @2ٔ $ $  l`2@$ l& l$ @ 2 $@" "@$  @0  8cp@ז㿘` `8  *@ !*`  * ] "`   `  &`  㿘$ @" "   "$ @&$   "    " 8* * `2  1# " "  1 "$&2 `2  !Ȁ@" Ȓ `@#` Ȑ 2  䀦`  $ !   @   $  $$h$    $$!  L L   @ 2 $ @&$ @ D    a L&  @ܐ @2 M 4 I "~  < y `@" ͠? < m& < @a@@f@ @2 % 4 ! "V  < Q @`  a "a  u! ? < :& < @ 4? h hl < D@($ L a a" *@ *`@ *`@ *`@ h:`hl < & <ᐐ?" < D 8  L  ! L@ / !@("$!2 2 L <  2 @8 <`2` 0C A??""@ # /??"$!2v 2p L <  2 @ <`2`* > 2;   ??"_"@ ??U"܀ 2    L'a' <@' <`2` * L 2' Lܐ(  '!`  <' L '2   @ <`2`   L 2 L   @ 2 $ @&$""  *@ *` 8 2n$ ! L  ! 2b$ @ P ! L@) @:'! <`"2`8ጀ(ጐ" @ $ @ &$@ j 2[  ! @ ! L@2)$@(%$ <`$@2`8!!(!!" @[ $@ &$@ * 2/  ! @ $ @`"" * @ *` 8 2 ~ ""Ȁ 2  LḀ2  Pἀ@ ؖЀ Ѐ 2   Pἀ Uؖ" Ԑ '     ? 'ؔ  * @ *`!]  آ ` ? ,`@*`!]     ,` * ]  "@  " \"S$آ" @2'   K'ؔ  * @ *`!]  h" """ *` * 8` 8  8?:$$" """ *` * 8` 8  8?:  hp̟ P ! L"@ "    2  * @ *` 8  {$Āw   P@ט   "##* `* `   8 ` `" "   8 "  ꀣ`" """ *` * 8` 8   8   "$ 8 :$ :$# #* `* `"   8   `$@" $ ( !  !($  $ ?!'̀ 8\ P L@V ̀?2L$  a쀤!!8 $,   a(, $ ?!'! 8$_ ̀?" Ā "$  a$ @  D @ " P <@ 8 Ph hl @`@ (h  P$ L$" """ *` * 8`2 Ȁ  3 23 2``` 4  Ȁ  $@ @<  h̟@Q T`h€ `$? >&$ȔJ @ 4Ȱ :::::219|Replace218|Insert217|Command216|Change215|Append%lu,%lu x   8L?`  L 2 ?(0 4L / ` * @ *`!]  ( ` *`* @ *`!] `$ :`[$?`8L 4 @? 萐   @2   "0l  `"+l `* *  !X@*`:`e   * * * a] @:`NX  `ږ l€#(`"# #  *` * 8` 8#  2@ L @ 2`% 2` ' 4 @? 萟  Xc ؐ X؟# # *` * 8`2  #   X`2? * Sت$ - 4 @? 萔#" ## *` * 8`2 0   X`  bYXbTX؟㿘 " "  *` * 8`2  " " @` 8@'}?"  " *` * 8`2 &@" "&@&@ 㿘  "   *` * 8` ) 2 a a   @ @(O88@7@ " "!"a㿐` 'H H`` H2 b8 2'ǰ " b0b0`* * `8@ b " b b `* * `8@ b   b`*` * 8`2  b  2L??' ` cĀ c`+  * `8@ + ` *8  @&@ *` * a] @~ `8  & @& ??'C` ` cĀ c`+  * `8@ + ` *8  @y&@ *` * a] @~v `8  & @]& 2¦` ` "5 &'㿐      ?0  T @ 㿐 i` 2"8ư " "0"0 * * `8@" " " "  * * `8@ 8@'@N  8@9 " ` #Ā # +  * `8@  +   *8 @֐$@ђ $  * @ *`!] @ }͒@2 8` 2 8  8&@P  ` #Ā # +  * `8@ +   *8  @$ *  * a] @}@@* %?80 @ 8@ *  $@ @b&@ 2 ?㿐 ` ` H     ` @ ( @1"  < " <s @ i"  L?" L ?& L"  L " L  & L!Ȑ 4!!$!`4! L2$`4!$@2 `2! !\`( !Ȱ  04!Ȑp00@ @ 2 !Ȑ  4!@ "   @  h 㿀  <??!*??$ @ &$ jK`0 <'''䀢  2 @ < 2 @`2 ð '  < `'2`@ < 2 @( 2 <`8/ < !" !" !e" "    " a" !"`  "zB??0z??  ????)Z+XY-W?@#X`2 + @  *  "@   @d 'X2 n"쀢`-@ #a@i X` `%X' @ !0 n"쀢`@ #@!@ 8 @ @`@m`z"` f!0@ߒ zL@@Ð?@`@61Zz )X`А@wz  z"` z"``z@@dz "#j*g+Za@P!0z Z!z!bpDB =ȁz*+  G@ 㿘W+ n$bW"%z@  !$#""  .`?`$``@ .#* $#@=? $% # W"%z"@ ?!$#""  `?`$``@ #* $#@  $ !#Wb %z#`?"`# * $#@ ?$$b#@0@. XZa0a0W""""`%b㿘z"``#WWb  ZW"⌐!@bz"  z"؁  z@ g Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%d㿐+Wc@)Z -! 'Z4 B0?, =Za* <: 4 @, <4 >@? 4 >%X'  @  $c@ X   @z    z"``$@&#ؔ '   @`  ! c@ϐ @w Z!*)z"` ,`<4`@b%X0 0$`H$`Dz"d4`>@`<X4`> W `*`  2#H @7 @#@А `6%$@~# W c@Ʊ@T 8#@zX "b: !X 00*  А*`Z, !#! %c@`"X$ "  "`$`@ŐZ  `#X@Β`0@3zb  `   "` @%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.3f ms㿐'XX?^ ;zb` )%#p@ȇ%@Ȃ#%#@~b`b z"%# B? @p b` @% 8@ɒcpacket too short (%d bytes) from %s wrong total length %d instead of %d wrong data byte #%d should have been %#x but was %#x %2x LSRR: %s (same route)RR: RR: NOP unknown option 0x%x㿀 *   @  z"`` `!& '@y@ 0 &@Z!(@ W#B*`2` Zz "bZ!0X!0 Zؤ`"`؀ $"#`!X #zb` b($  ''@ϒ蕠 zz"xz!b? h!LJ :"xH:b:hz?"p-:"pX 2 ` ' :@ `  z\ `?"\$  * @* !X `@2``@yr' #\  `& @ǂb` W 1z"d`@yV'  #\ז1z"d[b` 2Y "ؔ@ O"d  K@J@    `@y$'  #\⌒D & @ @1 "d  6! 3&%&   ?$ 2 @@ @@a"d     @ܔ   ΀ @ ` "   !&D !& ` @```,S`R ?!&%&`@x'  #\B@Ր! ` ?"`* "@ @(``|` @` @?  %@3aH@M 2$@&@ƛ!0 ,  ?@U$$@aH@S %&W &@Ƈ!@ &@Ƃ!H` ?"`* "@ @:(?` )&!&`@x@'  #\@T!P`@x.' #\ @ @A!X3`!#`?"`# * $#@X @#0j?2`  ` ? ( ? 22 :* 2 `z  #dd@ #ddB#@? "`"?/"";``z*+B"ąHB"# zƁB ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's printing up packets!%.1f%% packet loss round-trip min/avg/max/stddev = %.3f/%.3f/%.3f/%.3f ms %.1f packets/sec sent, %.1f packets/sec received xD  W(#@pc#W(c@@k# 1X( @f#@!z"\`(@^#Xc@`( $"@(@S#p(')z #' F (# ?@@(@=#r%z`"n"\z')z bx#+zƪc?@ zJ" JȅąƁB @+z?@Ȓ+zzzc (bh Dp#D;`D'#\D??@`,ZX `ZX?!`+zc聪B B)z#(?c@+zc(( #腠 ??@ɘ㿘L )b@L 㿘z"`X `2)@ )@:c|XW#@@4"hX `Ȑ @X? *@'Ԕ @a  @  X`$  @* %d bytes from %s: `'z`  A ` `$ `` 2` <$ ` $ $  $$` @`@ Z!( Z "! `   !* @1`@A Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d㿘`j+!\*` €tx(X  "_  `g*+!*` €0DXl0DX*@!ߐ*@!8ڐ*@!XՐ*@!А* ɐ!*@ݐ!ǐ*@ؐ!*@Ӑ!*@ΐ"*@ɐ"8*@Đ"P*@¿"h*@º"x*@µ"*@°"*@«""%  *@#  "   ` "*  " ** "**@# !*@{#8!**@v#H !*@r#p!*#@m `!*#@U O * #@Z  ֖ *@N# ʖ +@B    "   `  " + ++@, @( 8 X `  [+  x@@K_  J+@ S  >+@ G x 2+@ ; l &+@ / ` +@ؐ # T +@̐! H +  @! z` @.  Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02xx   ' $` $` $` $`, `*`@w#H,2` `#`2``@m `8 ,?( #@d2` , `# ` @^` ` !,#'@s8@T`!,#'@s/@K!,  @?# 0.0.0.0㿐`@`@* `@ @*  `* @ '@-!0@%s%s (%s)㿐z"`a2  @%  2!-!'@r1!p@!!p!-!'@r֐1!p@!!p TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u``%z` '````$ $ $ $ / *   @` 4-  * @ *`@ @"h0(  ` "-  * @ *`@ @"0 @ M ` -"@~0-@y"Ё"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x(!Z!  #D `  `D`!  !" $ @#.!`8@U Ȕ̖ИԚؠ܆#\;`;h.#|#;p#x##`x@]zbd    "Д @ +@ `  $ @z"``.@  6("%,  @  (@ߐ#㿘z"d   "=bФ #'.9b@ƒ-2 - $bCannot resolve "%s" (%s)%s only supported with IP㿘& .&&& @ 9z"`a  @$q %@#H 2  nb!.@#@U  ".c @U  @ . . . .@t*Usage: %s [-dDfLnoPqQrRv] [-c count] [-g gateway] [-h host] [-i interval] [-I addr] [-l preload] [-p pattern] [-s size] [-t tos] [-T ttl] [-w maxwait] host 㿘P`/``@ 8@ơ 㿘@ dfiPRrW㿘@?%Z/aP@+  $<Y#/`3T/!*` €|Z "aDZ Z"!L"@ZZ "a@ "L  $< Z "a8@@@aX??#@*`& @ @@@`Z@ Z "aP@Z@Z@ aH%s%s: %sfts_read㿘%ZL   Z!@` Z!P @   Z!8`2 @L 1 n//cP@ ?` O0 T*` €$tt|thttL ` `!/`@Ū#@S  8L  ` t ?r p`!/`@œ#@Z c"HL _``@`< X@Nߔ  R$` `  L 2 `6``@`< D`6    Z!<Z!<@W` 0L "'`"! @W"` %L "`"  `@ @ۉ` L " `"쀢  ?  `/@s#Z "H@MI 2_`6"쀢 /c@j %s: is a directory0 s 8!5Z3 n//'Z )<7/-+8@r  8 Z'!LG`  @ @\K$H  #ZZ!D` aL0"@L;$HaL   @ ". @V Z@W% !<`@@ "aL  b쀢 "  ?"  "@s:$H  ?c0`2 `@ Z`<   @ )?# @`8 @* #   @ a|<@ d `䀤 @ nZ  @ j @fZ# @`8 @* #   @ .I<@ d `䀤 @ݐ ;Z  @ 7 @3Z# @`8 @* #   @ <@ d `䀤 @쪐 Z@   Z /"aH#@r{remove %s? override %s%s%s/%s for %s?  㿀Z!@` 13c@`80`8Z!P`Y(< S@u  "O @@2ǒ @3 O31#Ѐ` `8/!P1# #\@챘`8@?P`? "`@h ?P  &?P ` `y`? "`@S   "` `y `Y "." and ".." may not be removed㿘A %2 @5 ?@   J@ /  *@@ 8J@ @# / `J@ .2 J`  .2 J` 2 ``!Z@  $!H`&   &  Ő usage: rm [-dfiPRrW] file ... 㿘2b@" 8@$ 㿘@̔㿘 @@`@㿘 @@`@㿘`< < $`$ 4   ? (`(  ?㿘`< < $`$ 4?    (`( ? 㿘`< < ` 4   ? `  ?㿘`< < ` 4?    ` ? 㿘`< < ,`, 4   ? 0`0  ?|㿘`< < ,`, 4?    0`0 ? i㿘`< < 88@  2  8<<@( 8 `8@4? <<@??㿘`< < 88@  2  8<<@( 8?`8@4  <<@ !uappnd,uchgnodumpopaquesappndarchschg㿘1Z!X.!X 3b@t!3" `!3@k3@gb" `!3@_!X3c@[!X" `!3@S!X3c@O!X" `!3@F!X3c@B!X"@ `!3@9!X3c@5!X" `!3@,!X3c @(!X"`!X` ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐` &@2&'7%4L 3 n L  o   * : `!4!*` €Ґ,ӌ3c@׬  4`@`@@`@י 2 `@`@@4`?`@׃  2߰ ``3c@v  2Ұ `ǐ &`@ &@3c@^  2 ` &`@ &@3c@F  4`:`<@`А@3  3`'`~)@c @   4```ؐ@  4`@  2i `] Y&`V@ R&@3b@  4```@  3`: 5&`3@ .&@b@Ҕ  4```@Ɣ  4a@ֿ 2 `  &` @ &@  @3 2& COLUMNS1ACFLRSTWacdfgiklmnopqrstux㿈@ @  5@֡"8 @^{"``h @-  `{"  ZZ"bx"%Z%Z $@Q  Z "b'Z+Z5Z){/Z-5`G5#X*` €xtttttttttttttttٌtؠtt\tttttltttttx0Ltthtttttttttوt,ٜtٴ|tt$<\Dtt ZZZ$""""xy$Z ZZ"x"""☒ ZZZ$""""xg$Z ZZ"""Z ZZ""""x$V$Z Z""P"Z Z""J"Z F"b C`Z ?"b` Z :"bZ Z""|4"Z 0"b -%b!Z$$"( Z $"bZ  "bZ "bZ "bȐ & % Z "bZ  "b̐ %  %@@[@?*?#@b*@ & Ā Z"`Z"` Z"` "`Ā  Z"|`Z"`"`⼀ 2`Ā  Z"` !Z@E"" &!: $" % "3  2@= 7#X5"XZ"`3. Z"`"23&!d$#Ԁ "3  2 #@!Z"`3  8Z"`3!2#pZ"b\ 9#Z"`;"Ā :  dZ"`< :#|Z "bX{a @@ %s%s: directory causes a cycle%s: %s %s: %s: fts_read㿘Z"`9" @Ew 2 77a@ @G @q Z| _%Z  ,  !-7+7)7G'7   @  "T 40= 08@05@  @@a0-  3ZL @ .b`Z"`"b`   @!  @Ȕ &b`@Gg@%`@GN @F  2 6 n"쀢`7a@+ %u%d-%llu㾰7 #'H'D/ @P / @K H Z"` '$%ZĀ  Z"`H '$H  '@'D'4 '0','(?H    '8'<` `P' '''`6  D`@`@7@Ḗ $` 2 L`@ZZ"|`Z$` . ZZ"`Z $` "Ȁ``@`&@ؒ`&4$%Z`< @H2  D(  @ D8'D @8'@ 8 8  82   <L@(  8?H < @  @@2@  # @<2  '4'<? @2 `8 4'8@ İF rZ"`5Z7   @ӭ7  @Ӧ  @,  2  7  @ӗ @,W 7  @Ӌ@(4'(@,4', 7 Lǒc@ظ0@4'0    @   77@  @$   @$   $ @ $```2`6q$'H'̀'V%Z!8p ? @/@70c,'D''ؐ @!@'@ @@|H'@ @r('4"'< @@e'8@ @]   ' '" ? 4'Z''ZbX€Z  "b`H`@u```㿘 6"1 @`6 *   2#  2 ? Z"|`2ZV 4 2 Z  Z?Zb\€㿘  "  $@ ` ?"`* "@   2 total %llu %*lu %*llu %s %*lu %-*s %-*s %-*s %*u, %*u %sx@ ZR4"blZ"Ā`Z!Z" Z" 8@ !: 8@쮐B   @F 9:3<;: "Z"!Z<`':+Z/Z5:7Z): $` @*`" Z" :``@@  8@䋐B  @ (`@Y0`  #\  (#`@ 0b: `H@ `  "`2 ,`?  3 c  42 8@`P (@`8 Z`"`"`$`,@B`@Ғ@℀ Z"` `  2`@``(  #@O#` ?"`#* %#@א 2m 㿘Z"`$` %Z ` Z"`2`Z"`#{`#{``-`@{0L@$!Z"L"h@*`  $"h:: `@iQcxː` Z"h` "`. " ``2` `@@@@ `R`4 Z"Ā`Z Z"8@ !: 8@됐B   @(  A- +;Z9bh, $@F  #`?`$``@ * %@) bh` ?"`* %@  Ħ 㿘Z"`  $ #Zb   Z"`2Z"`{{ , 0u@W@SR4`Z"Ā`Zb Z" 8@ !: 8@B   @   <) "5@#` ? "`#* %#@  $@ @ # `?`$``@ #* %#@ `2 #`?"`# * %#@t 㿘Z"`  $ Z"`   Z"`2  `N%` "G` >` ,?"` +{`* $@? , `&`@@ ` ?"`* $@*  ` ?"``* $@   $@ ``2` `?"` * $@ 㿘Z" `<:` @ƒZ"`Z"`@8@ !: (8@$B  @: `@@Z` Z"` <`  @`㿘'D@D#c  L?`$  @  c* $c @  $ Z"̀`#  L?`$  @  c* $c @  $ Yc;DZ!bl ""  c#  L?`$  @  c* $c @[  $ 0cc`?"``c * $c@C #  L?`$  @  c* $c @,  $ c`?"``c * $c@ 㿘<(@- @@ I0L0@-8@8 I0D`?"``M /F /`?"``@ |9 |`?"``3 @, @`?"``% = =`?"`` % %`?"`` * ** "@  %s/%s ls: %s: %s -> %s㷈V 4 2  :` @@Y$ > 8 @@P$@t$> nb!#> 8@`@@ਔ0,  P@?J cD   ? +usage: ls [-1ACFLRSTWacdfgiklmnopqrstux] [file ...] 㿘>ax@v 8@x 㿘@malloc><@=!:illegal -m option format: %s㿘@Q@  Z>a@ Zc܀ $\"c" H\ H" H"@>$ a@#$  $ i$ @ $ @ߑ* : `;>#*` € ; $  5 $     $ ²`*:  : #> `@x : .@@s`$ N@ $ , : $    "$ >b@D $ 㿘Z#܀`N ` "` @ 2B@` `9? *` €` <+  mRc`$`? mR#` 6    mR#` 4    mR#` $    mR#` &  "@``2`㿘N B" @%swrite to stderr㻘 @ԣ ?b@  %? @.?@~ @,$ ?b@q @1㿘8`? "`` . :  8* "8@㿘\` @n  "  `,    ,   `,    ,   `,    ,   `,    ,   `,    ,   ,  ?   c # `+, $$ $ $  @Jޒ kbbcbsos㻐'@ @J @J` @ @@`@J` @ @@* ` `!Z#Ԁ @@ #\ '` @@ ?`"#$##Ԁ \,`:  " $Ԕ  #Ԁ  #Ԁ   `*  Z#Ѐ`" #Д#Ѐ`  +   Z#؀` #ؔ#؀`  *UCLCEPOPNLHDpt㿘@@"  !\  @@"!\   $ @& @"   * & @@"    &  @   & $ ` & & @" " @   > $ & @@" "@ ?& @@x"Ȁ "   ?&   & pcrsisrfif㻐A 0'@f  n*!@Y\`D)A 8'@U  ?A @@N ?@|  A H'@? A P@9 = ! 8`?"`` 8 * $ 8@I @ 8@ stctchcmOOPS%s 㻐'A!@ A!@ ! 8`?"`` 8 * $ 8@ #?b@ A!@ے  A!@Ԓ J+\`@ 1!5A#?3\/A-AА @cJ@ O @`@W @O  @b 8@  @֔b`@  ـ 8`?"`` 8 * $ 8@   TERMunknownTERMCAPterminal type %s is unknown%s㿘 BA@,# @  "B@} /  @)P "B  B`@ " NJ /"N@IِN ?#[N    @1 #[B@ @( `@z ?2&@ nb쀢 2B "bBB`08@  Terminal type? [%s] Terminal type? 㿘#  B @fa@h %'Z+B)B-B`a8@Y88@T!Ƞ8@OА!@p?P 2 `2@C@E @Ӓ 2*LЀ `"astandard errorreset-a:d:e:Ii:k:m:np:QSrsarpanetdialupplugboardcoli|:strdup%s Terminal type is %s. EraseKillInterrupt%s SHELLcshset noglob; setenv TERM %s; setenv TERMCAP ''; unset noglob; TERM=%s; TERMCAP=''; export TERMCAP TERM; 㿈@ې;\` @2 6 Bb@  9Z`#'# "` "` "`  "` "` "` "` $"`  ("`$@~"`( m2c@@|} /  @#DB  b @'耢 \ "`D@ʐ      !B`FC!h*` €                                                               D  l      Q  nB#K nBې#D nZJ#Ԁ`^!J   ?  `0  nZJ`^#J    nZJ#J# n  nB#      @m@"?[?#@*`& @ @]@ 쀤<B@b#(1\& @B@]#0!\$ `h @” @      @   77`g@ 耥 `#@ ,  @FĒ 쀤 L :Bc8@  @, 2,Bc@@Đ ,B#H@!`B 8cP@{B#h @Q B#p @L B#x @G  B#@@쀦 B@ǵ# "B@MB?@Qc 2BBB#cC#`@ߒ@@ې@A %s %s isset tokbbackspace. delete. control-%c (^%c). %c. 㻐Zc @\ $ @:5D"8D"D"@  D'"@ O@ `O `D8@b0``D8@b0 D`@8b@ 0D8c@ߔ-e^H-i^C-k^U`3E0EE8@J@-2&  "J`H-2 J`eik2 J`2 J`i" "ke"" ""  2J@usage: tset [-IQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘Ea(@م 8@ termcap names not colon terminated| '"%s%s:\E\040\041\054\042\047\140㿐'D@ : 'Ea@>~ *@E 'a%E Ea@, 2 E!@ڔȐD@z  2N!#`?"``# :* $#@ :%E#D ` N+ : 倢`EE#*` €                                                                  0  0  E@V!E@S!FNE@N!ANE@I" MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: offset %% cylinder-size != 0partition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %d offset %d㿘 (  R"8 , 2 0R"H 2 4R"`@   2 HR"x@   H 2 8R"@  8 2 < ,@2 0& 8 < 2  8@* 4& < R"@  `@ ( R@ې" R"@Ӓ  `@  ( R@ʐ# ` R#@@   @=`  -@7R5R3R/S `ax@= 8@ ,:`@` < ( ,:`@c <` ( ,:`@` @`@  Ϥ`4,`  @%S`a "`@n@` `  P P P Ph PP P@ P0 P O O O O(to write disable/enable label)%s [-NW] disk(to restore label)%s -R [-r] disk protofile(to create a label interactively)%s -i [-r] disk(to edit label)%s -e [-r] [-C] disk(to write label)%s -w [-r] [-f disktab] disk type [ packid ](to read label)%s [-rt] [-C] diskor Usage: 㿘S#h `& 8 )P1T/J -T+T`ؐ`@r @ʐ  @r@ @ʈ0@r`@  (   @*`2  R R R R R R R R R R R Rx Rp Rh R` RX RH R8Linux Ext2FILECOREHFSADOSbootISO9660HPFSunknown4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedwrite the current partition tableWrounding (c)ylinders (s)ectorsRquitQprint current partition tablePname the labelNprint this menu?%s %s [a-%c] define named partition 㿘| `  #Tc @  2!T@i# `@v㿘#:Label name㻘 UU ``h@8 @[ RoundingcylinderssectorsRounding can be (c)ylinders or (s)ectors 㻘!|U ``U U U  @  O c sU0 $ $ @ Filesystem typeInvalid file system typename `%s' Start offsetBad offset `%s' Partition sizeBad size `%s' 㷘N@*  `  6 'U %U@?"U,` !@ ` @r`@  %U@?"U$`!@˒`@ђ`@  %U@?"U$@"@@@`@ Label disknLabel not written Label written 㻘TUU#c@b O y U#dbP U#U#@lUnknown command %s 㿘| ` @@ӷ@ 2 ` `   @ 2@N  VN `@. a V< ?@/ h %s [%s]%s 㿘'V%V#!V`@!h@p@$@c 2N?  2` @i. 2* %gc, %ds, %gM5㿈'`8V" '` !| B`('􅡉 "?!| B!V"0$""#\#`@$Unit error %c 㿐@Y  !I?J@ c"`8 s  M|#J@2!J@D'"' |B @ B`('  B|B B'V@"?| ``8@ዐ`8@r  @l㿘` T.`@y 㿘T! . @ @   . ?>partition㻘%W#WВ`ؔ ?ٔ?Ё㿘@>NOT super-userDdfhknprincompatible switches -f and -nphincompatible switches -%s and -r-Shutdown at %.24s. Shutdown NOW! ???shutdown: forkshutdown: [pid %d] shutdown㿘@@/ #lWaX@,w )l'l%l[!W`3VW"*` € _ _ _ _ _ _| _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _p _ _ _ _ _ _ _ _ _ _ _ _ _ _̐ $c %#x $dl "c $hl  "cpl "c|l "cl@@!h??#@*`& @ @c  h  dlcl d "cld  l#|`W@!x@h l#l`l#`"WW!!W@ !@@@K`@ @W@aЀ 2@` "l@l#`$ @э $@`"@, @@g`@` ,, ## 1 L  $@`@# 2Ll@_#lc\l "t!Wl!@dR#`@0W@!@lc  "c@.@2 "W"$  @/N?#xW@21`W@y9"@5 "WW@Ȑ"@. "0 @M @ 㿘%l\!, @ #|#|a\@a@s" a  \ @& \@ @4 @b@s@[!,@ @sx `2 @%s -n/usr/bin/wallwshutdown: can't find %s: %m*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %d minute%s sSystem going down in 30 seconds System going down IMMEDIATELY 㻈lbP  "bP!l"X@6!,!Y 0Y($@Y@ `@ 'Y`H@K 0WY  hY Y l#l@f"X"X !Yl @cT#` @["l ;Y`Ȑ@ቒ < <Y Y @Gl Y`Ya @:l#tl#@U m@.# Yc,@P @-> @ *@-:  @G 㿘m#@. %s by %s: %shaltreboot System shutdown time has arrived but you'll have to do it yourself /sbin/reboot/sbin/halt-d-n-p-lshutdown: can't exec %s: %mX!l#lY` #@l#h`#WY#Pb0Y#Xl#l# @J @r[ Y@b#`lcp Y@[#@ l#d`@`@E#ll#h`8#WY#XYcY#PYc'l#`Y#"l#|`Y#"l#`Y#"Y#"" @b Yc@J @w|b00 @ޒ @n nowTZtime is already past㿐@qyZa@ 2Nll"c`"\ +  cDN `@S@`* "@*` ll"#`"\$'  LD `2 : @  @, ,@,@) L` Z@1@!@`Ð$@@?` i Z#*` € l m l m l m lt m l m k N? ?Г* @N?*`В@ *` *  * 8$`  N?Б*` N?* `?А @$`N??Г* @*`N?Р@ D4$` d$` N??Г* N?@*`@ $` N??Г* @N?*`В@ $`  N??Г* @N?*`В@ $` N??Г* @N?*`В@ $`@@c!l?$#`@#`l" "\Za@(  About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. 㿘[@ !x[@!@p [@!/fastbootfastboot file for fsck 㿘["&@! [b(@. @D/etc/nologin NO LOGINS: System going down at 㿘#[b@j![# @W @T @Q@N &@l! [b@ "l@a#` @ [b@ !l#@@@㿘l#p`[@2"@ illegal time format㿘[@I#@usage: shutdown [-Ddfhknpr] time [message ... | -] 㿘[c@ِ 8@ې 㿘@ (   @*`2 %s,-o %s: option not supported㿘@ \\`@ݐ ='\ n L  o  @+ = 2*@Ґ " ` |  @2   "*@ ""`2 \`@'  @ ภ 2L@Satimeupdateasyncsympermunionrdonlysuidexecdevcoredumpautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:a:b:c:d:e:f:i:m:o:s:B:NOS:T:a:b:c:d:e:f:i:k:l:m:n:o:p:r:s:t:u:x:bele%s: bad sector size%s: bad maximum contiguous blocks%s: bad block size%s: bad cylinders/group%s: bad rotational delay%s: bad blocks per file in a cylinder group%s: bad fragment size%s: bad bytes per inode%s: bad track skew%s: bad interleave%s: bad free space %%%s: bad rotational layout countspacetime%s %sunknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute%s: bad file system size%s: bad total tracks%s: bad sectors/track%s: bad spare sectors per cylinderswap%sr%s/dev/%s%s%s: open%s: getmntinfo%s is mounted on %s%s: unknown disk type%s: fstat%s: not a character-special devicecan't figure out file system partition`%c' partition is unavailable`%c' partition overlaps boot programmaximum file system size on the `%c' partition is %dno default #tracksno default #sectors/trackno default sector size%s %s %d%%Warning: changing optimization to spacebecause minfree is less than%s (%d) %s (%u) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%dstatfs %swaitpid%s: mount: %sabnormal termination/@ P`\@-'b  '|5 /+n` %a&@M+n'x 5 /\b@% a \"\"i;}`9d^!*` € ~| ~| ~| y ~| ~| ~| ~| ~| ~| ~| ~| ~| ~| ~| z4 z@ ~| ~| ~| zP z ~| ~| ~| ~| ~| ~| ~| ~| ~| ~| ~| ~| z z z {8 {h { ~| ~| { ~| { |$ |T | | }\ ~| } } } ~ ~| ~| ~L! n\#@gc( #\@ac0 } "`x & / "a! n@m#  a\#c8@%r ! n# /"!! n@\#}  ``\#cP@%a ! n@P#}/ `P\#cx@%U ! n@D#} / "`T\#c@%H  "! n@3#} "`d\#c@%8 ! n@'# /  a\#c@%, ! n@# '`L\#c@%! ! n@# o  a]#`@% ! n@#}  `H]#`(@%  ! n@# /  a]#`@@$ ! n@#}  `X c]#`X@$ ! n@#} x"`h]#`p@$ a  ! n|%}#c@t g]#@` #} \$`\#]@` ]S$`\]]`@$ ! n@#} E `@]#`@$ ! n@# w 9 bT]#a@$ ! n@# / - a]#a(@$ ! n@# ! a]#aH@$ ! n@z# /  a]#a`@$ ! n@n#}  `D]#ax@$s @@Y??#@*`&  @ a   @a '@]a@) ! @!  $ " @./?7(7j'|7 ?''''7*'tt@_͒ / ']!]$@@6h?2 ]@|$ C?@,  ']]a@ @1  ]aД@ @.   ? $a r/]ᰢ @  ,  @ `@ L@#Ґ ?!'a ! /! "@$ 2`]!a@# k`@ג '|]a@ |@Ғh p]b@ <   a 2@]" @Œ@@ ?]J?``x``@ a!#D@ `a]bH@#~   ! /a 2|`"a|@O#D ``*:@`2 *]bp:@#Z    /*]b:@#Q  /a`@   a@  a   w]Ob @#<  wbT 2 `H  bT. bTa 2  /`0  a]b@#$  /a 2 `,  a]c@# a 2 }`(  a]c(@#  }`H?2 /`L `H /a  `L`J  a  a`L 2 } '`L`(c$ '`L}`P } @M}  `P`L*   } `P}``  o}`P@@}`P@@ $ } `` oaȀ 2}`L*  a}`X }!} \  ]]]#@cPx@ז  $ \}`@?2}`@ `@}`@ /a}`D "`B `D /a! /@a}`D`8"  $!]]]#c@ /a 2`P}`P /2  a`P`T" w'#"P'' '|@8  @v  @Ғ @@|a`@)%}?  ^\@pb@ !^ @c@ d0G d@'^#^)^%^@7 `@%Β `@) X@ `L@J Z  \<@b @ @Be ?`@   02  @̐ @` @! @! @%@ٵ @ٳ @ٱ ^@P2 Ht?'' '' /a /aa@6''\`bt@&  n@b@ ioctl (GDINFO)㿘'Hn`PHE`e@w 63 /a  w\`@"h"\ ]aa@! b@A!X}`@! ioctl (WDINFO)%s: can't rewrite disk label㿘 w"\'H`66H E`g@<  b@AŐ"bb@!j usage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device%s [device-type]where fsoptions are: -B byte order (`be' or `le') -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -s file system size (sectors) -r revolutions/minute -t tracks/cylinder -u sectors/track -x spare sectors per cylinder 㿘n!` !P bb@L 8  8P bbb@B 8 8bc @=bc8@9bcX@5bc@1bc@-bc@)bc@%c`@!c`@c`0@c``@c`@c`@ c`@ c`@ca@ca(@ca`@ca@ca@ca@ca@cb@c@b @ preposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %d %s %d minimum bytes per inode isMinimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %d cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%d) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d,p'D'H@f9n!  '@  ' /%@ф / ?@@Ґ$Ḡ@w@ { / "a@ސ  /! w w"bd"`1 o!А?"e,"e(1 o!Д  <"%("%,; /a  9d (@Y@ 9!!?@  /!$ऀ`$d@F @@   ;}d X@=@ ;}`P9} L$0@$4d p@.@ ? ;d @$@ ;a  od @@ o @d!@@u @ d!0@@k = <= <$H$L<8<@ $PP> "P! 4 " T`T> "`T!0"`T:  "8 ``> "``! 8  d 0 4!p @ė:@*  0} h292 4$%P!$ t@Q$ x$ d $ | o!`d> "`d};}`l!`p 4?@9 8?@4@А@% @+?@'@Ѓ  | %  @% ?@@s ?%  % `>* "`! @" 0 * #  0*` * ? `t:  :`;%0 < @oe0 @C2 !В cX>:  "cX"cX!9!@x6`?@)@0* @ӯ ?@ӫ@X@`@ӝ< ;}|@ @:`?@Ӎ?'@ӈ@``$`$ 4 $$ o?!Ьc>'؀@h! 0 'ؑ* $ 0>#X-`*`$#X@@^@Ϻ$  8 `*` % ``% 8! 4 0@2  8d@!d@!@  8,` `: |* $ |$ 8$ `$ 4 %P@ϓ*   , @,: @ @φ |@$ , %$:` 0@ `*, @ , :`@!А@ ]!Ь 'r"``~'8 zw=@n>` @ d @K :@ ;d9da`@C"`=`08; :$`@$0$8@В@,P*@'$*  ``: @|@ҹ , $:`0`*, @ҫ , :`@80 (0* $0@$0 @ҏ- x?@Ҋ@ ܀ 9! 0 @|*  x?@x  x@Ӓ%d0=@n >` @ d @d@ :@1 `؀`  od@"Pd"p@؀  !d@"d"p@܀`!؀ )};} 0`P dd"@b9} 4 L dd"@c @ )} T!"`@ # /ad`#8d#hd#x @n! ?@@_a`$ % T! @K $ " $`@B$` '`0 @* `x?@@>`4` o!Ѐ9!`" $`@#$` '`eP@&*  `, @,: @`@`|@ѷ , e$:``0פ``*, @ѩ , :`8`!  @ |@ї `$ ,@ @ d@#@W 6  Td#@@N  T2! /! d@ې# ؀` ܀ `@8 ؀`܀ e  ؀`"ee ( @@!e@ `!!@ !`eP@ͦ*  `, @,: @`@͙`|@7 , e$:` ``*, @* , :`!L@ 8 9 /Bd ! |8$`'!@m$$ଢ@ @e$ఀ@$఺ 'ఀ 4De@_ @Ő D /L%h }`H $$$$L$h$XPX@<* @8|`@֓* '؀  %h`!В#\%`$X$T!Д%``"%X"%T !Ж!|`਑* * $D e 0eeee#\ `Ȕ@! $#X LX &"h / pP 6XЩ,?,L, ? P@* T@@2@P `X&Pؠ! 8@Ԑ? u#\%` |@̐ @j@l @b@̾ @b@̸ @\%P@̱@Q  `, %L?> , @@̡* %T@@R@? !L? X@*@L? X@!%L?2%P, @@{* %T@@ `",@!%L?2%P, @@h* %T@@2 8< |!ഐ@@$, $,x`@: ,@:$༒ @;@6$@#e8a`@͐8$@ǐ @(eeഐ!@"@ @; /a"@6A@ 9 288!e*|@ !@ @@g 8!e"@ϔ@ϐ@|!e"`@@,'ఔ@$,9 /"ଐ @$@t|$$'!䀧`9n! !Т!; /a%e`|@``@˻ `$"@@! ,# p%D*  0  L2  # #  # l `p> "`p!@ FaT}}d$\X9} ` w /- w! wbP%X$XT$@$<$$$\@! <}\;na ,$D$$$$$$,Ѐ1,$!e|@i"eH#\@f#$9}4 e#(, (#`($" FF?9n'#\@H!2,e@A#`, )9n+e@;na2`,%e)@,c`@"``@, ``d , @@}#`,9n! 2 /e@# /!`;na @k @H!%9}$  p@̻)} x @G ;a@Ά9} p@ ,  x`@ג``@Ғ, ``d;} `p,@u`, &` x !@ 2 @( @X!X!` X  T >    d" 0@ * @J@ 0  & TX@D@D / !4'  ;/ 7 Panic: cylinder group too big 㿈 oa`@u`$4``@k/@ ``` ' ``4?@  w"X5/`@'`@2 `,@"U$ $ @ $ `@`4 `4  oaи$e$`'4 $`8@א$p` eP, $T$X@+`* `$\`e$: `$``@@ͻ`| , `:`" `@@ͮ`| , :``e$` *`` $h@$l```|@͙*@ , :`$d o da`" l@#@S %``  '$ @"U "Ԛ ``:`\ @`` ? $@+@@* ``#  o!Т % /`@ɱ``@ɬ/@ ` `d`0,@O`8@ `x```@>: @瀧` @| o o!@a"U8@+  `#ؐ@$ l  :`@*` $  * *  |@e$ @ *  T@ T@"@|@R@@@I@@@A@P@:@` * @Ӓ`Ԓ@ *   @˒@'* `X@@@ 2@8@ @ oa`("`( oa (" 8 @# ( /$*4 "@ &" @"U؄    :` ` @   ? %(@*`$ #`$ oa`8@|@ @!bU8@i`ؐ@ $ l  :`@*` $  * *  |@ȣ$ @C *  T@ T@"@`|@Ȑ`@4`@+@ȇ`@+@)@`@#eP@x@`  * @ Ԓ@ *   @ @e*  X@@@ 2@8@ @ @$8@0 o @ cؕ*`4@ @ U"@  ``  :` ` @`` ? &@(@*`$`@#`$ oa$ 6 l  p  h @ `    `$4*    ` * @ ` p`@瀈   oa%$4*    oaФ$! ``̞`Ć `Ȅ @ $`$`$`$` @ ` `$ ` @ɗ`0}x @X`@’``@ǽ/@ ` `d `0,@a㿘# waА @ n$ $ $ #!4a /!aВ 4 }#}!@* : < ! o!a 4@ba%@ L`<B *2  2 $`(@$`h@$`p$`t`(n d 4@*@̒ 㿘n !@"    4@`%@  !!@,`* 2 @"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘- o` +`da*`@7}x @ /@U@p)   2 p"! p `c``8@ʗ@  a8` &`p!(@} 0`U@ >` ؐ@$ a l  :`@*` $  * ** a `Ĕ) w$ "X$`?@  " ` $ $``"`|@Ƨ@G` U *  T@ T@А?"@`|@Ɠ`@7`@.@Ɗ`@.@,@Ƃ`@&ePa@z@` U  * @ Ԓ@ *   @ @f*  X@@@А?2@ 0 ? 4@ "Xa 8 "@ "  84$#@ $* @  ̒`#@ %$ @آ"U   :` ` @   ?" (@* 8 x Аa@ ad@+㿀 /a /?'H'L @ɡ ?@ɝH;`'>`'?` o!'x| o`'a Ȫ ='@Ʉ@ݐ  ; @e=H @e @=@@b@e? @:@7>@4@[@ŷL`` ͰL;@fsinit: inode value out of range (%d). ?c5 o  da* @#}`x @ @"U@" p@| @ 6`? \$  @ ` `x* @ +@ @ d@+ w"X$`?"`,@]@*q#H@|]@Ð @f@M @H,@  @Bx@S+?`* d, @0@x" xx@-* @ ( ,@=x@*  (" @* @ה  0? @getrlimitsetrlimit㿈%np 2'p@{ @q? * "@s$p @ƚ r@_R!?@M  6r@_G! /""ap /ᨐ * 8 " "@K 㿘 @@0 㿘@Ĭ@ seek error: %d rdfsread error: %d 㿘n!` @Ď /@@є0) ; @c> ! w "d  @ 6 "dr#p@{yr@^#@ܐ !@ȿ r#@{kr@^Ґ#@ΐ "wtfswrite error: %d 㿘n!` @M /@ɐ0- /!`) ; @c{> ! w "`  @ȡ 6 "`r#p@{4s@^ @ #@r s @{&s@^ @ $isblock bad fs_frag %d 㿘 8>%s  @ !`?>@ *  @ *  *@ `?>@ *` @ `?s 8a@I  clrblock bad fs_frag %d 㿘 8 >  s .@>@ *` @ *` * *.@ >@+ * .@s 8b@ setblock bad fs_frag %d 㿘 8 >  s  .@>@ * @ * * @.@ >@+  .@s 8c`@ܔ 㿘@鈢 &@@ &`@ &`@ &` @ 6`@ 6`@v &`@s &`@p &`@m &` @j $&`$@g (&`(@d ,&`,@a 0&`0@^ T&`T@[ X&`X@X \&`\@U `&``@R d&`d@O h&`h@L l&`l@I p 4`4&`p,`@B``$`5@U@ `X`T`\ "" @ @@-`X@*`T$@'`\@$`X$@!`T@@`T@`X@@`X4` @: 5,`@`@ %5 @: `,`@`@ 5@`U@`h@@`h@@`h oae$  @  ,`@`%$`@ ,`㿘  @Ă}x @&@@  /a6`@ 6`㿘 ,`@躢``3&@@#X&cX@% &e @%$&e$@%(&e(@%,&e,@%0>e0@%8>e8@%@>e@@%H&eH@%L&eL@%P&eP@%T&eT@%X&eX@%\&e\%L@舐 ? ?%L #\%T@{%L @t ??c\eT@i@ @r6@#X,` @\ %P @S@3@ `㿘@V6@@S 6`@P 6`@M 6`@. >`@9 &`@6 &`@3 &`@0 &`@- &` @* $&`$ (>`( 0>`0 8>`8 @>`@ H>`H P>`P X>`X `&``@ d&`d@ h&`h@ l&`l@ p&`p@  t&`t㿘6 @ ,`@`@ &@㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@/ %h   5 d#u`3_u#*` €          t    ؄    ؔ  ؤ                    ذ            $         %h   "#"t@IRc  "t "c  "cl &p@@b??#@*`& @ @p  h ub@  u b ub@   h  2   @? "c|@/  @,"cx. @@Y$+~uc@@  a̒@Y@K$? . -a$?, ?  ~  J /"*Ā@ 8Đ"  &@@s  n"쀢`ucX@w\ <  6  @%@ - p 2 @h  @@F(@@Y(0u@cX@w. <  2  h  p " @J@~%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected.fts_read0xl@  @vȐ ~!İ 3  #@( 㿘bx  bx@   2 v831vadict3000courierhayesventelhourminutesecondLocal file name? %s: cannot create List command for remote system? 㾘`. ?> "`` * "@T b|#@ P  @Đ"@!# $b} @qC0} (@ ! @ѐ0bؐ@T[take] usage: from [to] cat %s;echo 㻘 b}!P@ Ɣ P *% Ȑ@c   }@q !X0$ @z "@! 6} @p 0 }x@$}@ %d write error lines transferred in 㻐!  Ș'H'L'@2@  "@@  ( b@   Ȥ/@ ! `  Ȓ@ "܀ O ` 2  @ +  @ #b@. @N  b@ P   '}%} Ȓ@ݔ   b$  O b@ 2/3*`L@y:  -O & $b@+O   'VN ` @pb#b@H@"'@pRh &b@'b@    H@}@p?"hR"`"  !}"x@M "@ L @   t b@n @ @HLocal command? can't establish pipe can't fork! can't execl! 㾈~!@ ! M@ A ~@o!0D@ U ~@o!0<(} (@ !  @G@E@ 0+@?b@i  @a 0@b쀢 0@ # @$ @"  @~@o!@w! 㿘  "D@= r%s: cannot open 㿘`. ?> "`` * "@R `|#@ 6 P @~@ocX 2!~#`@oz0   L@ T!~ @q`ȁ timed out at eol chars transferred in 㿐 bж@* + ~c4%bD@   @ В  (9 "@ N*`@:: N R">`5 @ 05 @0@M" @L '  /} 2O ? & @>  &bD t' p`T!ހ 0`( `  T!ހ 2"  '2T!ޒRaހ 2 Ra> " @ @ސ  " * @ё:  2T!޴VN `@n˒V~ " # @?$bx5   Ȓ@ bx`bD  `@n `@'   "܀`L  @   R!ހ`@  *`@: N @K @p@  RaN  Raހ $ x}$"x@ t"@  L @  [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo 㻘 b @  P 2! #Ȑ@   @n4 0$#$`@#Ƞ~@n8cX ~#`@n#0R">`"``@ $` timeout error (%s) 㿐# `Ȥ/@  'R!~`# ! a@p$"x Ȓ@> @j "x`!,!@ 9: @m  `Ȓc0@  㿘b@]   "xcan't find `%s' away for 㾐`. ?>  "`` * "@PՐ~!@ S! a @p  @)  @&   @   (1 "@ݔ @  ~@m!) @J !@ 0@ϒ  @А   @  @ @"@mb@tȐ R"`"  !"@JӐ "@ې t"@  L @ ̒  @Ӓ  @В 㾐`. ?>  "`` * "@PT~!@ Ҕ! d @  @  @   @   (1 "@\ @ g ~@m!, @J} $@܍ 0@N  @K  @L   @t  @q @"@lޒ@tD R"`"  !"@JO "@W t"@  L @ H  @O  @L [sh] ! can't execlcan't fork㿐@l# @6  @3 @ I@?3  @-@ 2@l#  @  @ 0(@   @%a\@= /  a\@ \ @ݒ 8@֒c(c0@l   8@͒c(c@@l  can't create %s 㿐 В @%%T!. @!   ! `t@@ t`@  (@ On @l0 [cd] %s: bad directory ! H!X@˔ P   l`",@/ 6!`@l @l !x %s [EOT] 㿘 b@Β  "!@k@k!@{ @ b4@@sQ 㿘"L`L@   `@7@@I̐ Ӑ 㿘@k   "b@#@B -c㿘%a\@< /  a\@Qa\@    (8     "@8    (8 * ` *   %s%d %s%c 㿈#$ ,@$@ @ke "#4#, `2 2쀢 2 2  ``  s@kF,@k@# [set] onoff㾘!@ߔ! D@ #`   b, @ !%  ?,!% !  ?,!`   ?R.`*`  ?R`*! !(@`  R "`* ` *@  h!  @@zFa 1 "L$d"L ; {'&"L Ȓ @RȔ"L @N 㿘!  `{@ @H  Ȓ`z@ 㿘@[. >   @m@ @I~{[*?$`'"\pipeecho %s/bin/shfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" 㻈'Dch@ D@ @M#xzDD@j$@ ?" #@@ @@@ @ @@   @M#@ @0H@ c@$@@ΐ쀢  '쀢  8@c. @M#' $D 8 c  D 8c@y 0#Ȓ*N    (1 J  1 *#ȁ㿘 N@ "N    send breakget this summaryset variablesuspend tip (local only)suspend tip (local+remote)exit from tipchange directoryconnect program to remote hostpipe local command to remote hostpipe remote fileput file to remote UNIXtake file from remote UNIXsend file to remote hostreceive file from remote hostshellusage: cu telno [-t] [-s speed] [-a acu] [-l line] [-#] cu: unsupported speed %s Bad flag %scu%dall ports busy link down noneConnect failed 㿘  '  8@c@p % ) $% `$$+ 7 5/-@J@ - R" |J` a"` s 9G 0E`. "  t l"#`0:9 ?%`&6??$`2`$ `@[`@  `8@y@p{ @[`% `??$ `"  @`@ ` *?  ?@U@ ` *?@h8? `!#@u @r @o @l !   H@Β @L ?@hА P@p6 ?2 @hȐ ` @ b4@p+ #@ @@:@ @ϐ p"b ` @ @Vj  @h x@. @ b4@p ` @ @@@o 㿘   "b!@ `'Dc@ Q' "b@9 /  @ "b4 E  `F @֐!Ȁ @  J`Ѐ   @ "@ݐ !  Ȁ  @K  "b "`  @  JЀ   ' Ȕ@Ò  ` @  @Œ @ Ib4@D '@   ?Ā @ tip: flock???%s (%s) <%s, %s, %s> %s 㿈#`쀢 0R @ZD  @Ko!0&@  @@F 2!@Ep '@6J* `a#\#`@Ia@E`` @ZRacan't open log file %s. 㿘!|L`b@gא "` 8b@#parercfoexesdiprpnoeieelcucmdvat/etc/remoteREMOTEtip: unknown host %s tip: can't open host description file tip: possible reference loop in host description file brfsdu%s: missing device spec %s: missing phone number hdraecbenbsctbvbnvtantrwdctip.record  dlclet㿐@# J /@% b̐#"`"`b̐@& 6A# `  N /?$`@E  ? `     # """`$  $a"`??0 8c@S0  8cА 8c@J@nL "H`@ 2 @(r  `!    @)c`0?$$ ! `8@)X ?# $$ `  $``@@%V :@ $`'  2 ` 8`H@@n `  `Ā ""``   |` ) 8`h@@m ) @%) : @  "   Ā`  ` " $@u 2$ $ "`@%  :  "a`@$ :  "b<`@$ :  "``@$ : " `@$ :  "a`@$ؔ :  "a`@$Δ :  "b `@$Ĕ : "" `@$ :  "b\`@$ : ""\`@$ :  "b @$ :  "b`@$ :   *` ` 2  "` `  !"`  `@ J#H  쀢`@ C#8  x`@ <#X  `@ 5#0! a@(Q ؀?"$ ! a@(H ̀?"$ ! a@(? ? $ HOSTtip: no host specified 㿘!"؀ 21  @G#  8@c@l C" ` ""$"1 "  @qf ,  "&"*@"`&""cuusage: tip [-v] [-speed] [system-name] tip: must be interactive tip: %s, unknown option tip: phone number too long (max = %d bytes) tip%dall ports busy link down PHONES/etc/phoneseventip: bad baud rate %d %s [EOT] tip: can't clear O_NONBLOCK: %sConnected connected can't fork㿈@ @  @"b @"h @"b "@K@@tX`    "<#  8@G`@lI @ِ   8@;`@l=  %! + )'`J -"J 0 9 v  8"8  $"8@W9$` 8@? `/cD  `)!@  #  8a@ @l ' @p , `J@ 2*@ " |`0@w !#@ @ @ @  ?@dj!8@kА ?2 @db!H @sb4@kŐ #@ @@!X "`!`"`@q@_!p`@2` 2 # `@d;!x@#  @Jb4@k ` @ؐ  @d'!@ @6b4@k `  @Đ J Ѐ`!  Ȓ @   @  #  nb!@kS!@d@ @b4@ka # b @   Lb  ~ ("      "L $"  " "L#* """ """ " " " " " $" (" " * !"  "(* "" "$* * * * @Y*  @ p @"(b@?  < !!@c@ ? "bЀ @@|a@c3 @j 㿘@ @b4 H H ` @ې @j 㿘! #  @bԔ $#㿘! #  @ b$#㿘 @bԁ㿘 L @ 㿘  @ڒ %s㿈 'H" l''La@א ' @Ӓ ' @cA @Ң# "H3Lc  H:  * 'H ? & @vKc  &c*`H+@ @  l  H   㿘 @   "l@b! # @q %c㿐-T!.  @@ %+ ) /? $@v  $b܀  `//L o*:   ,`   @n* `/ܖE* b< + : ` J@+ R`?": ` b< Ȓ@ T! @b! *`" \L @*`? "`@u   $b܀ " ` /* \@w: T #D ` *`h:  / Ȓ@C T!"{O@bZ8v㿐# a/?/ "@uq #  ## "܀`" Jcx* cx>  %`J@@ 2` ? Ԁ  ` O@{ @b%€0J@  O>  Ȓ@ ㄀  `" * 8J@ ` `2J@  n r t fEb㿘 / 1 HbXa ^ ? \"@'  bX>HH>.@` @ .@2 .@.@`.@.@`.@`/ ٰ .@*`8   ^#*#`@ ?*(#*#(#%c %2s%-2s %c %s 㿘. #@a:`Jx )x + ) '  "MobԀ 2 Mo¤В@al#L`  *@@a`  L ` h# `@@]@^?  JД`' ' >̘ Ԓ R^ :w''/耢'/d'`Ȕ@ Lost carrier.write㿘 "ܔ`   #X   @ + @N   n"쀢`2!x@De!noneoddzeroone%s: unknown parity value 㿘b ""b J 2"b " b0@p;    ;"b""b8@p/    ! b@@p$  bH@p  ap@p  ! 8bP@ @ #Xa( @  * $ @ 㿘 ,! "@Ҕ  p@Ք   @ a㾐% p@Ȕ O ! $!,@p@ O? `! R!.` ,@ " "@sJ@2 "!, y/@`]` "b n/ y/  "a, ,@   @ϴ 㿘R!` " @s@g 㿘R`?"   @ϛ 㻘 @  @ ` @ !!(@ c@ @ a`@  @g  / Ȓ@H$  b n"쀢`^@ 0X@ `  L  `,  ܠ @Ra. ; 6R` @gI 0,*   *` ``^: | " L?  "   ` * "@B * @M /var/spool/lock/LCK..%sCan't open lock file. Can't read lock file. Stale lock on %s PID=%d... overriding. Can't seek lock file. %10d lock write(А!@}W*@ ! L @  @B 8@c]?@ P 4 ,@B@ 8@`K?@1Y@  n"쀢`@;? 8`@  @  @B@t@v`@"?@X@| Q@_@E@X  @T@|@B[ `?㾀А@|ܒ!@|~%s/.tiprcrset %s㻘' ` `  @|@ 2$ `$@  !l@|$b@^ ) % @^@/ϒ 2*@o#@Q" "8@q `u ?*`uaccess denied out of core 㿘N @i  2 @^|#0E  "1N@  "  9 " "/N@3  " @mɒ -  P @ @e & @^S#0  ?.  &  !V @ @ & N  &   . all 㿘a@@m  ` L @  " @x  2L  !@0 2 @ ! @^!H$ record%s: unknown variable 㿘@i =  ,@ ; `  @Pe^03@mAb NP0%@iɒ ? "N,@Ɛ L`@  @0 ! @ 00"@]%s%s=%s=%-5d㿘% ! ``"$#c  ?`$  @ c* $c@@ `"$@`@%`   "V   &O`. 5I` #`?$" # !* ##@@| !*#`@]K#h  `#$[ 0` $@];#p`@]6#h  $N @@$`@]$` "$@]!H㿘.`2 .`.`   @ `?㿘` `@la   " @lX    n r t bf **`Q :`8K\ ^2A*J< *9  Є *8Kbp*bp*8H!H*J/ 74?(JЄ/  74?( ?*** *  * ?㿘 2   @N @kْb  parparitylelocalechohdxhalfduplexrawrawftpetetimeoutcdelaychardelayldelaylinedelaytatandemdidisconnectecechocheckHOME/bin/shSHELLverbverbosetabtabexpandscscriptremoterecrecordrcraisecharraraiseprpromptphones/var/log/aculogloghohostfrframesizefoforceexexceptionsesescapeeoleofweofwriteeofreofreaddialdialtimeoutbabaudratebebeautify starting call...K can't initialize bizcomp.... can't set dialing mode...D%s 7 can't get dial tone...ringing...1 %d second dial timeoutbiz1022  TN`@["@" '#c @g '@@v/р #(H (@yi  @ʐ@@#P 2TN#X@[a 0" "@[Z#p@}##c ,@yA P4c @W㿘a V㿘a@㿘!  Ȓa`@j @9  @ 㿘 a@Z 㿘  "c X@ʄ 㿐 `@`@Ga@ ' @] X @p` Ȓ@= @i @v   @ /Ȱ @j 㿐'Da@b D' "c@3 X @B` Ȕ @@; DK ` @/'D DK  @8 `?Using "%s" can't synchronize with courier couriercan't synch upAT E0 AT C1 E0 H0 Q0 X6 V1 OK AT D %d second dial timeoutcour'R!N`#x@Zt# x`@+ `'@ @l @Z_#`FS `Ȓc@ @8E `@4 `Ȓc@ @u# @#`Ȓc@ N  ,J@ ="*@`J@  =`@@`c@| @3c`%`$d ,@x P c``d@d㿘!  `x@Q @7  `y@J @@N ȁ㿘 c@C timeout waiting for reply 㿘@Yא"  "`@K 㿐'Db@W '"c`DK  @L   @  2@2` Ȕ @@+ DK ` @/'D   @,  9600/ARQ 9600 2400 1200 RINGINGCONNECT%s #Ȁ  `@7 @ @`Ȕ@ @ n b@ '  ???????? ?"#`'|'x @Ⱥ M`@`, Ȓ@ @Đ @ ` 0/n#Ѐ 5O Рc@h TaN c@~  #h`#h@h #   #|* x 'x`'|#@Y@   AT Z +++h%  '+) @ْ  Ȓ@I   ?????@6ڐ  Ȓb@6̀Ȓ@& ('̐@d̒ 0 2+ @dƒ O @d K  @6  Ȓ" @ @6  `x@ @6  `y@ `Ȓ@  㿘@@ @ @@`($''$ @ ؀ G#''''' @;!#@##$ @#* "@*`@*`$ !''''''Ԑ @( @ޔ ! *'''''$ @ Ѐ` @  @Ŕ  @    㿘@ 㿘@ connection timed out dialing...X  Ƞ'D'L'@/'Д@   @k' @X!h@i 0eR"`"@W!@V#L Ȓ '@@$'@$@$@^  `k `l@)c@[ @(D* @@E` @ a@ @5 a@ @DD@@ L $ Ȑ@ @@! OÐ A`?㿘!  Ȓa@ؔ @5  @u 㿘㿘  @  starting call...line busy...acu open error...lost carrier...dialup line open failed...`R"`'D@W\ @}  "aP n"쀢`2 ( 8@WJ 0 @ƪ!  @  sPb@Ő @D* @`  @1@ &  @  @  @ @5  aP@vD'D@\Đ @^y@  @|  "` n"쀢`2 P `@V @x  @Ȓ  ,P@o ! !P@ !P'Д@h  @o  @o ?@8# @1aPĀ  `Ȱ @'㿘@@  !@: 㿘@4 !  Ȁ `x@   @㿘@4 ` $ @v  !P ! @ Ȁ `x@  @ dialing...ATv0 ATTD01234%d second dial timeouthayes@ )~  R!N`"@Vn##@# `@" `Ȕ'@ `@C `Ȓcؔ @%@@`Ȓc@ L  ,J@ ="*@`J@  =`@@| %`$L@u@g*   @`#* :  1" @   $L `$L@ %H  x ,@s P H @㿘!  `x@G @3  Ȓ`y@@ @㿘 c@% timeout waiting for reply 㿘@Uΐ"  "H@B!X㿈'Db'@M '"`H @!X @B $ `@,  Ȕ @@%  `/OK@"' @D D   @ O OKCONNECTRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)㿘!@Up#А?Б* : `%*` | € d d d d d d@U\#0@UX#0@UT#0@UP#0@UL 0 @UH 0. :` @UA @U?#ЁATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 㿐!  @ @D "+ @3   @  Ȓa @R C!(* :  0 3@T!0@T!H@2  b@K Ȓa@6 @2  @Ӓ  `x@< @B ȁAT Cannot synchronize with hayes... 㿐%  )'`Ȓ"@ @2 `Ȓ@􀢠 !(Ȕ (@ '@` 0 2 @` O @` K  ``x@ ``y@ ͠ @T" Using "%s" can't synchronize with t3000 t3000can't synch upAT E0 AT E0 H0 Q0 X4 V1 OK AT D %d second dial timeout'R!N`#@Tf# `@ `'Д@ے @z @TQ#Ȓ`8S `Ȓ`@ @27 `@& `Ȓ`@ @u @#`Ȓ`(@ N  ,J@ ="*@`J@  =`@v@``0@ @3`%`$x ,8@q P ``@㿘!  `x@C @1  `y@< @@@ ȁ㿘 `0@U timeout waiting for reply 㿘@Sɐ"  "@="X㿐'Db@I '"`DK  @>   @"X 2@$` Ȕ @@ DK ` @/'D   @  12000 7200 1275 7512 57600 38400 19200 14400 9600 4800 2400 1200 RINGINGCONNECT%s  8  `@ @j @k`Ȕ@ג @ސ n b@ِ '  ???????? ?" '|'x @ž"X M`@`, Ȓ@} @먐 @ ` 0/` @ 5O Р`H@bz TaN `P@xє   ` @bd #    X|* x 'x`'| X@R@q   AT Z +++h%  '+) @  Ȓ@M   ?????@0  Ȓb@̀  '̀ Ȓ@ ('̐@^ 0 2+ @^ O @^ K  @0  Ȓ"@ @0  `x@ @0  `y@ `Ȓ@  㿘@@ @ @z@`($''$ @؀ G#''''' @!!<@#!<$ @#* "@*`@*`$ !''''''Ԑ @ @뾔 ! *'''''$"@x"` @  @륔  @ߔ    I  READYcan't synchronize with vadic 3451 vadiccan't synch upD NUMBER?Vadic will not accept dial command will not accept dial%s Vadic will not accept phone number will not accept number DIALING:Vadic failed to dial failed to dial dialing...ON LINEcall failed call failed0 !d$   ! @@@!@@!  ) @Q!v @N L@ " Ȕ@  @/| "@r@"  @Qy"R@X 2@ob@Y@n 2  @Qa"`:@ !"@B@?@S" 2 TN@QF"Ѐ "@Q9"@="@   @   @Q(" 㿘 @x`ȁ㿘 @r`ȁ㿘N  !  Ȓ@O @. N  ȁ""FAILED CALLX'Db'@`W  H'Db@`N/Ȁ`?' 'cx@j  @?" 0 @P , @L%Ƞ#  Ā@% " `Ȕ @    *'*D@ @%  㿘 "@ 㿘 N@@ ` N@   2   J@(: `  `? starting call...line busy...acu open error...lost carrier...dialup line open failed...㿐R"'D`'H@PW H@v  "` n"쀢`2 8 H@PE 0f @#X @   Xb@ @D* @`  @1@ &! @  @  @ @. D@H A@W{@  @u  "` n"쀢`2 ` p@P @z @ʒ  @q  @~ 0 @! ?   ` @=㿘@V  #X@P h@-ɐ # `Ȁ `x@! `@@Ғ @Ӓ `Ȕ@? ``@ `@㿘@- a ! @y !  䀢  `@  @!  Ȁ `x@  @/dev/cua1/dev/cua0Unable to locate dialer (%s) `@L@`<L`  Z!` !@^ϒ "   23 #@O[l K`@@`)`@a)` Ԕ ~''`@ƒ `@)  /`@  `/@z  `/@t L@ @`<  /`@g `L@  @ /`@[  `/ǒ@U @- `@W   M/Oǀ Bǀ G /@> @B /@N`Oǁ㿘 ` ؈ =!cD` _.`8<"  _2./. `.؁can't synchronize with ventel ventelcan't synch up dialing...#k$ $ $D$I$A$L$:$ %d second dial timeout%s...% @B  @N#al({00+`R!N`"@N#@@#x@7 Ȕ'@ @#PL  #a@ bȒ@  L @bch@  @ @  !@@1 % ` ,p@l4 P ('  @D ? <`R!N`8@Z 2,   @Z 2L  $L L  J cD `* (:  ,  cD#@M 㿘 @J`ȁ㿘!  Ȓbh@( @> ȁ㿐 * /' ! *:  # $ Ȓ@  / Ȱ @  @  Ȓ@  * / timeout waiting for reply 㿘@M#X  " @#؝㿈ct@~$ '/'"b + : "#  @#؀ @~  !+@`  @@  `+   ' @} + : 耠 +`?tip: ioctlP!  `x@ @+H  `y@ h +a)'@ @b@ @+1 "@ @0#```< < @s`< ;   $`<  Ē '@+ ``$ɐ 㿘@hHlms:t:/dev/%s%stcsetattrTIOCSDTRTIOCSETDX@}#%'X!`5S"*` € t h @@@ @,@ n@?c $ n@pc$@@"??#@*`& @ @}@b@rA   ! # @jf @r  6k@/ѐ@S͐ Ȕ '/'''/@d@ؒ  b(@K `y@  b8@K `@⸀ bH@K֐ @ $'@S '''@x0slipstrip㿘a`@[   @[ah  @?usage: %s [-t ldisc] [-hHlm] [-s baudrate] ttyname 㿘P`a@|c 8@Se 㿘@ (         @     @ forcedevmtimeatimereloadupdatesyncasyncsympermunionrdonlysuidexecdevcoredumpautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %s @{i#  m"#$c@'! o  nb@@i @O@ 8?퀢 ?c@* & @ @@@?'`' '' @@  n"쀢   H@@" ` @RU`@ @Rd usage: mount_ffs [-o options] special node 㿘b @{O 8@RQ %s,-o %s: option not supported㿘@R0 bpx@Jk =' n L  o  @V = 2*@J` " `   @2   "*@ "#`2 b@!  @~† 2L@ 㿘@d ` P H @ 8 (     updatesympermunionrdonlysuidexecdevcoredumpautorwrogroupquotauserquotaego:rcd9660%s@z4 '|#"  o ? e" 0 r" 0  n`|@T @;@wap?ဢ g#@*`& @ @+|?@  ''`''!x '|@㻖 a@Iu @Q? usage: mount_cd9660 [-egrt] [-o options] special node 㿘b@z& 8@Q( %s,-o %s: option not supported㿘@Q c@IC =' n L  o  @U = 2*@I8 " `   @2   "*@ " `2 c(@  @}q 2L@㿘@㿈@yj! @ bH@yِ @Q@ ?#@*`& @ @B@ N@ #D  `"J 2 @4aH?聨  @P @lGaPD@'B '@- '@Pn '@' @Ph usage: sleep seconds 㿘`8@!j"@PZ 㿘@y 㿘@Ҕ md m m m ؀m Ѐm Ȁm m  m m m m @m @m m xm pm hm `m X@8m Pm HmeewweofstatussetspossethposrewofflrewindretensionrdsposrdhposofflinefsrfsferaseeomeofdensitycompressbsrbsfblocksizeasfTAPE/dev/nrst0f:t:%s: unknown command%s: illegal count%s%s: %s%s: block location %u internal error: unknown request %dP@x,@eѐ! ! !" n t n#@@~y!(? f#@& *`? @ @@' '@G`bx  @o0@m 2 @ @=2   'J`"  @aH@T  '  @`? 6 a` @GS  !"  !u !pd!i!J!6aa d2"  7 '@5 a` @G7'@& Fa` @G 7'@ 7ah @F@  ah@F @^0!@ a` @F!p@GB0@  a`@FԐ a@ @N  p76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) 㿘!LT"*`: 2  !@FV V !@2  V @-!`?"` *  "*`!@F˓:`0@)  !   @F $ 4"  ( ,@F 0%s=%o%s=%x㿘  N 2#8#@@F`uN q!#`?"``# <* $#@) <GN? * @;`` ,?"``#* $#@) ,*`: & # :?`&  @  #* $# @){*`: 4 *`N *`:  `?"``# >* $#@)V >usage: mt [-f device] command [ count ] 㿘ah@v} 8@M 㿘@&-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%s㿐@v `@,@a@UD? ; ? `@ .@cD  ` @@ @;" J`@a@H  4?? (@@ ,  @E"@M @#@M  @@Ub 2@? `@CR"@@@Tb8 4 @`@ 60?+@J@ -, `&@#D `@ `  @K 6?@ @:ʔ @J` a@  @T?`  @ # '%@@: @J J`  @B@  @v ?2?@@X ?`@Lsig㿘aX@D  "  #`.  @D’   `?unknown signal %s; valid signals:㿘!@B@ 8@Lg  㿘 )'%#ณ,  @uS"X  b @uI  กusage: kill [-s signal_name] pid ... kill -l [exit_status] kill -signal_name pid ... kill -signal_number pid ... 㿘! 8b@ub@ub@u@u c@L 㿘@ -%c %s -%c -- %s 㿘@t! $#@ ) n'%#  @D`@D~`@z? ?@Dt##@@%#@*@Dj@ #@$#@@Db#@KȐ㿘@^        sympermunionrdonlysuidexecdevcoredumpautorwrogroupquotauserquotao:kernfs%s㿐@t!' o  n`@I @/@zb!?퀢 ?#@*`& @ @`"@ݰ b@Cj @K4 usage: mount_kernfs [-o options] /kern mount_point 㿘b@t 8@K %s,-o %s: option not supported㿘@J c8@@C9 =' n L  o  @O = 2*@C. " `   @2   "*@ "#̀`2 cP@  @wgH 2L@㿘@ x h ` X P @ 8 0 (           @      nfsv2tcpsoftnqnfsnoresportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforcesympermunionrdonlysuidexecdevcoredumpautorwrogroupquotauserquota23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UX-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsnqnfs only available with v3illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%snqnfs 1/mount_nfs:nfssvc err %m @rI'  #$@`|''@ H%`F!*` €  0  | x x P Ѐ c@\  "Ԁ c@P    ="$ # nc@7 J`6 cc@8 @$ 8m$ `Đ h"`  d$   ?`$ # nc@6 J`4 cc@ @$ @I$  (E$ # nc@6֔ J`4 c`@ @$ (.$   @*$ # nc@6 J`4 c`(@ސ @$ <$  @ n`ؔ@ `Đ "`Ā  ?$  ($    @$   Ѐ `@@֧  "Ԁ `@@֘    ="$ @@ @$ " ̀  *@$ Ѐ ``@t   !"$   $   "`$ '    *@$ Ѐ ``@L   !"$ # nc@6 J`4s$@c`@4 # nc@5 J`4 c`@" $ $ X$   T$   "`N$ # nc@5ߔ J`4 c`@ $ , 8$ # nc@5ɔ J`4 c`@ $  "$ # nc@5 J`4 c`@֐ $ 0  $   $ " @a@v??#@*`& @ @Q@@` @G  @ " a@? %5 Ā`@f  ?a@? @Gi @a@[ @Y @W @ؐ!! @Ɣ '!1 n # Q @ga(!@ٳ "@GD no : or @ speccan't reverse resolve net addresscan't get net id for hostNFS PortmapCannot MNT RPCMNT RPCbad MNT RPCnqnfs 2can't access %s: %sp ?'ܐ@K Z, Z@K @   @K :  " #<*@1 `$ @Q  2 "@) 2"@=* 0@-  Ѐ`     ؐ =% @&`   )  @; ' @ `'cH 85cH 9 Ȕ  o,a4b@5+-` Ā 2y @@&#t @ 4`''a`  bܘ @#  ''b8@6 ܠ  Ā 2N @@&#(I @@w4$`'耊d'  %`%`? #\P p   2Ā Ԁ "}`@%c8!@c  @ @ % @ 2  @@$c@@<|! @? #% @! Ā` @$ Ā  #?cP@>G @F @ @ @ @ @a Ē`$ @ < @ OcHcH Ā` n@E !#X"b@E֐ @<>  #82  &`&`&`  &`D&` 㿘'HH@;ݔ$㿐@: I @ "`D    =  &` `@; 5@9֒` "0 `  ?*@; ` %@9ǒ  @ @9 `@"` &`2    P`  P&@ usage: mount_nfs %s %s %s %s [-23bcCdiKklMPqsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘aؖ"Xb@n1 8@E3 %s,-o %s: option not supported㿘@E b@=M =' n L  o  @I = 2*@=B " `   @2   "*@ "!`2 c@  @q{ 2L@㿘@if%s: destination pathname too long(@mh!`@    i    "` "  "`"@@s ?逢 f#@*`& @ @@" .  @"?@bǒ  <   $`@k`@]@@Dv? @@xb /,?2`)@xW@@J?`/ ?   ,?L /@ @ /  @@x?@c @@:   @@@" 2 ?Ӳ`@D5overwrite %s? override %s%s%s/%s for %s?  rename %s to %scan't remove %s%s  `s@ m  `   8b@m2`  `+@  &@b6 2" @pВ@ @= O`8  # @l#\` `.%`? "`@O   $` #  `  $ ? $ @Om 2 `y`Y2K @  nC "쀢`#@9 @a <   @А   @Y #( @a˒ #8@ 0<  @@В%s: remove%s: set times%s: set owner/group%s: set mode㿈 @a 6#8@a&  ) #8@@(~  x # H @% x  $`|#8l`#8# @`|@ x `|#8@@Y8 "@@|@@H @# @&'$'(' @#'@պ耢 "P@^@ո   n"쀢`""`@O 3&@կ "x@C@ #8 @X  "@@0 /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿐'D@כ'H 2! D`H@} #8@@kɐ @ ? !@`H  !@`? 2  !05`@h 2!!`D`h@K #8@Œ@k @͔ ? !@a`  !@a`  2   !0a`@ usage: mv [-fi] source target mv [-fi] source ... directory 㿘! 8c @k@kc@@B 㿘@ Ô%s cannot seek temp fileout of memorycannot read temp file㿘 "؀'      "`  @"   a,< @n 6  nb!# 8@Ac@j!jc)"  I#%t a $t"  @ &t nb!# 8@Ac@j!@ Wct$t!#  @ # ? @$ ; %"?$a $t!#  @А #  @  !,!! @A  nb!# 8@ACc@jS!c@  0 >  B!<+!line too longcannot write temp file㿘@   nb!# 8@Ac@j&!PcN 2 #&!Bb)  Ԁ % , @   nb!# 8@@c@i!'c@״,% : <%  a, @A %  n??b!# 8c@@<@iג!b@  0 <`@ $`< @ B < 㿘! @0  & " `"& # $ invalid address㿘 "؀@    @@ @    "؀@!@ Z`?㿘ct"  (#ct ` :  ?!"`"@#"5ct"!$".#"" "@#"$ct:!" "@#"ct "!$"  #""`"@#"ct? #ct1#  @ # "@Ԑ "/tmp/ed.XXXXXXw+%scannot open temp file㿘  " "`@ݐ ?b  "b;" $ 4 , @V?"@Jc "a,?@#@t!@ c@ѳ?@ѯ %s: %s cannot close temp file㿘! !,   @Kb  nb#%!`8@?"@hŒ!@ ` ?$!,@U"    " :` 㿘 !, @K6@Uݐ"@?㿘 `#@o|     " ""ؔ"`*  $*"  " ((  #"     * ???invalid pattern delimiter㿘# aJ   !@ b8?@W aJ@`$a@!  )  ! #+ V ` `    @}V `?@! @ ! @  p unexpected end-of-file& no previous command%s out of memory㿐   @Fc@ @ ɰ?!cP!cp@ ?0#H@#/ -357++ %`쀦 @ # # bАJ?`   ?4 @'ɀɀ @Fc@  @Fch 􀤠V! @e )"  D'#ct  ☀$ct"  @Œ !ct n@>ib`8@gy@ ;cct$ct!#  @ɐ # B?@ >?%"?$☀ $ct!#  @ # "@ @! $!L @ & @ [ &  `@[ @ !J`@ Q 㿘' )  А  D# %tb`$t@T,  &t nb!# 8@=c@g!@Œct$t!#  @S # !?@ ?% А?$` $t!#  @> # @}   *``" $ര 㿘)    6 3 a(@ '@  ! !      ( 2a  ! "!(@!a @  *``"㿘!#t# `    `$#t""# @#`#t$``$#t!#  @ # @ r%s: %s cannot open input filecannot close input file%lu 㿘N !bX@ @ @5ْbX  nb!# 8@=b`@f!(bh@G 6N4? ! @  #|@H  nb!# 8@<b`@e!b@?0#|`8"" @e &newline inserted newline appended 㿘@ `/ 5 @  `?l`  %&L+ %`Q'ct `(z&ct  ct? J&ct1#  @ # x?@@ t?$ ` @ tct? +&ct1#  @ # Y?@! U?t? $t3c  @ΐ c "@  @O 3 9?    (      @@ T`8   "    &%l`&  " %s out of memorycannot read input file㿘 - Y/sȤ  J# )#t  %#ta(" @@ &#t nb!# 8@;c@d!@c#t%#t!#  @? # ?@~ ?%Ȑ?$a( %#t!#  @* # a(@i a(,*`  # l "`I? %`@Go@  %@ ` @ Ȕ  I# %t a( $t"  @ϒ &t nb!# 8@;oc@d!@@ct>$t!#  @ΐ # L?@  H?%Ȑ?$a( $t!#  @ #  @  2` # a(  * @ nb!# 8@;.c@d>!@c(? #   a( *  " a(* `  ` 2?wcannot open output filecannot close output file㿘N !c(@t @ݐ@3  nb!# 8@:b`@c!)c0@> 6N7? ! @  #|@Fd  nb!# 8@:b`@cɒ!cH@?0#|`8"" @c&  㿘/l` 3`&l- + )  @l @ ``  *@ @ 6@?`l    " cannot write file㿘") #%'! n)+cl  N@`  N@@j`  "@:7?8@cG!@ a0cl unexpected end-of-file㿘) !J J !"@ ?' !3'b܀ K't# $tbؠ " @~H &t nb!# 8@9c@b!@ctL$t!#  @G #  @  $bؐ?&b܀ $t!#  @2 # /@q /!@}&ؐ *1 ;@ *@ & + bА@J?` ܐ!@jb  F )#t %#t؀" @}Ӓ ##t n@9wb 8@b#!@G##t%#t!#  @Ր # v @ r &bܐ?%؀ %#t!#  @ # "@ ؔb@|`ؒ@ ܔ H %t ؀$t"  @}} &t nb!# 8@9c@b-!@ct$t!#  @| #  @  &bܐ?%؀ $t!#  @g # @ *'؁stdin: %s cannot read stdin㿘-  5 n73 ;9? %@D  %_)  ` D! 't  "Ѐ$t"  @} !t@8`8@a#@|#t$t!#  @  # P?@I L?% ?$"Ѐ $t1#  @ # "@4 "Г,*``  "` 2 `""*#"Р @ ?@8^?#@an @0c &a 4 @4 {`! "*"а&a%ld \  \abfnrtv\㿘 @0ߐ"H !"h%  `@ P@ B# # ^*`: \#`?"`` # #` \?"``#* $#@ɐ \N``"X@< #"@?L "`  #[* \ #2  0`"@  #* $# @ # 82  0`"@  #* $# @| #  0`"@  #* $# @e ``N?"``  #* $# @OM #`?"`# * $#@=  *usage: %s [-] [-sx] [-p string] [name] p:sxcrypt unavailable ? ? interrupt? invalid filename%s %swarning: file modifiedscript, line %d: %s unexpected end-of-file㿘'H@_'D@@k*  @J?`r `?"#x1- + n)! #'"%#| x pH 8H  8c % 8@` bD@`@7 D"@fH?ဢ s@H*  'HD'DHJ`-D  "#|"@H 'HD?'D@ @yr "Ғbx@_ Ғ`t@_  @_ Ғ`@_  @ǐ"  " @Ғ`8!@b(CD  !"cHJ@ D@ H f H@y4 "HJ@ !@#D "8@`8HJ !@Fb@@y ɐ #%#!5 /+') 97   p `8"X@_c!  `@."`@wW#h ?,  $#|` `88@Y!@ h@xؐ 2 p b☐ !@_4!  & ?5 ?z  "В J  b@! ? 5  @e"` ?@2 & ?  `@0 `8??8053`8J `8&8@!@h@x  p ,-@x{  p `8b☐ !@^ؖ!0 `8"X☐ @^Δ! `88@ڒ@x\ Y p b☐ !@^! J 㿘)  # ' % $$b$  !  !$"$&! J`,`; bԐ`;#!% @# "bԀ 4  $b  $耢 ?number out of rangeinvalid address㿘# a% ' D@ `  !J@  `#a `@ ` !aaJ?`U"|*` €  \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \  \ \ \ \  \  \ \ \    \            \  \ \ \  \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ a$a D@ ` cDJ@  `#! `@ ` a D `a  @"ɔ  # - n"쀢`" -!}a ^2} {&  `_ - ^2Z o?daa@"  #I  n"쀢`"D !RaKa . $aM1 J @@ / @ O`? <aJ@# ` %,a`$aJ``@$a  +? a ;Ԓ` $a" 1  "a  a ?  @ !a@? invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiterawcrypt unavailable%ld ! unknown command㿘+ a #D@ `   J@  `#a `@ ` aJ `p[%a *` € ) * * * * * * * * * * * * * * * * * * * * * * ( * * * * * * * * * * * * * * * * * * * * * * * * * * * ' * * * * * * * \ *  x * * * * * * *   * * * *  # * * * * * * * * * * 8 0 8 @   l L 4   H *    4 ! "  # % * &p  J`n" `p`l   2  $ $ $ aJ ` %a  ` @E @ Pa  !  @ǒ   J`n" `p`l   2  $ $ $ aJ ` %a  ` @  @  &?@  쀢 ?!  @   J`n" `p`l   2  $ $ $ aJ ` \%a  ` @  @ { S  `   2J$ 0H !`#|`"@? "Ԁ`!4ba#D  `!(b@ % J`n" `p`l   2  $ $ $ aJ ` %a @ %  &?@so &?* 6L?  !#@   J#`!גc# &Ѱ?@F? """"b "Ԁ`!ba#D  `!b@ "?L ! !c(J`n" `p`l   2  $ $ $ aJ ` |%aL #@ !"X@ #@*a0r!  !gc@ @h  bg G M WG V #  J`n" `p`l   2  $ $ $ aJ ` '%a $ {  "Ԁ`!bؔ  J`n" `p`l   2  $ $ $ aJ ` %a5 "Ԁ`!bؔ  J`n" `p`l   2  $ $ $ aJ ` %ap " "pJa ”a 8@ZbX0  !  !a J`n" `p`l   2  $ $ $ aJ ` %a  `! @! @ ?m  `@  |  J`n" `p`l   2  $ $ $ aJ ` U%a  ` @   a N@ n3 a J !  `%a!9aȔ J`n" `p`l   2  $ $ $ aJ ` %a! @ Œ  `@    J`n" `p`l   2  $ $ $ aJ ` %a `  @ _   ? `@ߒ - ! u!  "Ԁ`! !ǒc``  @!a%耤  $!  !cx  J`n" `p`l   2  $ $ $ aJ ` %a  `@@ n  `@ }  J`n" `p`l   2  $ $ $ aJ ` V%a `  @ Д  T R? `@P J  J`n" `p`l   2  $ $ $ aJ ` #%a `  @   ! ? "Ԁ`!bؔ  J`n" `p`l   2  $ $ $ aJ ` %a `  ` n# 2"  " "Ԁ`!ؒbؔ  J`n"  `p`l 2 $aJ ` %a !`?#|`q0a#D  ` !b"Ԁ`   " @  J`n" `p`l   2  $ $ $ aJ ` t%a  `#@Lc cL ! @   ` Lc `!Zc cj &S?Q  M  J"a#) /J` @`aJ`g" `p` "2`-`9,``0(!!`r `0!$!` $` $`!@f  $  n"쀢`"` ?$``a`  ``!c`!$ aJ@  )J` #t!c#t3 ``%#t``@ 2 `#t? %#t!#  @ { # ư?@  °? ' @ @r; %"`#t? %#t!#  @ Y # `@  ` ! ! @ 1 !    ?$ $`  ?$ J@ n" p l 2 ` ` ` "$" `@e _  J`n" `p`l   2  $ $ $ aJ ` 8%a !@`@    `@1 +- ! ! $ "Ԁ`! !c``  @6%! a$!   J`n" `p`l   2  $ $ $ aJ ` %a  `@]@ˀ  "Ԁ`!֒bؔ  J`n" `p`l   2  $ $ $ aJ ` %a@N aJqQa $?a#D  `!b@  "Ԁ` )     " " @  &?  J`n" `p`l   2  $ $ $ aJ ` \%a#Lc cL ! @L  Lc *`!Hc*`   cW#В# | 4  0"!!`,#|`(q&$? "Ԁ`!bؔ  J`n"  `p`l 2 $aJ ` %a!c    "`@  a ?ϐ a @2 ! @$ #@  n"쀢`"  !@a$   J`n" `p`l   2  $ $ $ aJ ` %a ! `   @4 @  ?  J`n" `p`l   2  $ $ $ aJ ` s%a "c !   @$Z 0k "Ԁ`!`b@ ]  J`n" `p`l   2  $ $ $ aJ ` 6%a` "X@$"` `@Y c| ,@$ 0(    "`@#   a  @ ?! `!@"a$ !b@?㿘 "Ԁ`  " "a    a 4     !@aȰ?no match㿘) 2 % + `  ?,  ꇐ0 ` ` 낖   @i0   쀦ڀ`ʐ!@bذ?filename too longout of memory㿐% J@ E @#D `J@  `#! `@ ` J` !#b@   $!J@ !`@$! '  "X@#J` s ?  ʐ!c@hh '਀`F1#t!b &#t@nԒ &#t nb!# 8@*tbX@Sʐ!@Ec#t&#t!#  @Ӑ # 7 @ 3 $ਐ?$ &#t!#  @ # @ 'J` !! `* `'#!J ! * @   shell access restrictedno previous command㿐#x`'ː!.b  #!J?5  I#%t ` $t"  @nF &t nb!# 8@)bX@Rʐ!@ct$t!#  @E # ?@ ?$`?& $t!#  @0 # -@o - ! *@ J  ;9 n7 J@ !] % ` C %t $t"  @m !t@)"`8@R"Xʐ@Z#tw$t!#  @ # ?@' ?&?&` $t!#  @Ӑ # a@ a *@a`J \)%a  `*@#!"` Q ` D't  $t" @m !t@),"`8@R;"Xʐ@#t$t!#  @ # Y?@ʐ U?&?&` $t!#  @v # a@ a  *%aϢ'  J  ) ːb  @ D%t  $t"  @m) !t@("`8@Qݒ"Xʐ@#t$t!#  @- # ?@l ?&?&` $t!#  @ # @W  ̰  oର * ̒@ `daJc c@r @\ @ D'%t  $t"  @lŒ !t@(j"`8@Qy"Xʐ@;#tX$t!#  @ɐ # ?@ ?&?&` $t!#  @ # @ ?? 'ର *@`??'a %a  J` }) !` P' %t  $t"  @lc -t nb!# 8@(bX@Qʐ!@Ԓct$t!#  @b # 0?@ ,?!c@?0$%!?$ $t!#  @F # @ @k< " *N ! % 㿘' #$/  - )   ?" ` А J?`  ` ?5` y w?N` `  " J ` "" N . ctN  ctY ct   "ctO `#t? $#t1#  @֐ # ??@ ;?$` @ c #t? $#t1#  @ # ?@ ?#t ? " %#t1#  @ # w@ܐ s 㿘  `    擐@"]# 35794 - ` C'%t  ഀ$t"  @kD  t n@&b`8@OX@#t$t!#  @I # ?@ ?%?$ഀ $t!#  @4 # "@s ഒ`@j)`@@ # `  I'%t  ഀ$t"  @j &t nb!# 8@&bX@Oʐ!@dct2$t!#  @ # c?@1 _?$`?$ഀ $t!#  @ݐ # "@  "ؒഐ"* *@? !<?#t?`# $`)$#t ` @ W #t#t? $#t!#  @ # ?@ ? ? " $#t!#  @ #  @Ӑ  㿘/  % @  - ? + +ct`  %ct倐}  "`Q @      @ ct? %ct!#  @I # M?@ I?P耦  JGC@@ `$@" "@$$ $ " "  `ct@ct ? " %ct!#  @ #  @@  㿘!  -   a  "@  U%쀦 S`& "@N  E1+ #t`@#&#t #t䱐$ @h #t? &#t!#  @ # )?@ %?#t ?%a &#t!#  @ # @  䨐  ` 㿘%t `$t@$ ) t? $t!#  @w # 9?@ 5? `@  x?u `  / &@t?" $   $`% "#!`$t!#  @C #  @  㿘   !@a$? `@  85@" # ِ $`` l &?@@ invalid mark character㿘#D@ `  ѐ!@]`? * a0 2" a  "a " 㿘#D `  ? a0*@ ѐ!@8`?     `a0*` ! "#!  `㿘@h     ": nb!# 8@$/bX@M?ʐ!@c 㿘"  N \2 `?㿘) `E 't!b $t@h[ &t nb!# 8@#bX@M ʐ!@̒ct$t!#  @Z # + @ ' % ?$ $t!#  @E # !@ !  N`\  `* 㿘#t` ?【 * @"@㿘#t` ?【 * @"@Ned.hupHOME㿘#` 〒? )  * * 0"!cؖ y  $@9ې! @Ws `@g2 @ÒJ /" /.*`@Ȑ T 㯐 㿘#`㥐 ?〒 *@*  "【"@`?㿐〰? **"`h @i/  `" `" ..㿘#x`" N ! Ғb@+ @' /  ː!@גb invalid pattern delimiterno previous pattern%s out of memory㿘 J@  Ґ!>ch `"J`   !"( FҐ!@c@"(@N !9 "(  `@Ȑ @f  &"( nb!#Ҡ 8@"c@KҐ!c@v 0""(@d  "("(@a!'"(@fϰ $"(unbalanced brackets ([])trailing backslash (\)㿘) !L #%ӑ*`:   [ \  L@}    ak8L c L !+$b0  I'%t , $t"@  @f &t nb!#Ҡ 8@"5c@KEҐ!@ct8$t!#   # 5 Ӑ 1 %b0?$, $t#c   c # #b,@et!b, * ` %!b,Ӑ!aX@ b, v J^   `]2 % (8 $[2 J .:=2  J  ]8   J ]*` 8  `]ۄ `] number out of range㿘&@&# aJ a " = @N a8?J@  0&2 @`$a @ϐ  @  &@#  n"쀢`" Ԑ!@F`&@ ?*:  g2 `$a & no previous substitution%s out of memory㿘%  $J % J*: @!   $Ԑ!@ a '!?*J=  ' y- /357  2 #ct 􀢢$ct"  @ee ct n@! b8@Jb@ܒcty$ct%?$ $ct!#  e # a a * *:`%a`  J `\( **@: %a    `# # J?`   ?4  " bЀ&Y = J@   I %t 􀢢$t"  @d 't nb!#Ԡ 8@ b@IԐ!@dbt$t2) !#   #  0  %?$ $t!#  ܐ #    " *@no match㿘; ) `9  ?! 'D@%  x / ` & D@ &?`!     i ct!$`&ct% `t? Y$t!#   # Z?ʐ V? ߐ $` @ t? 9$t!#  k # :? 6?t? %t!#  U #    ! ``"@@  쀥 % 쀎 Ր!@ꡒa ?  ? infinite substitution loop 㽸'Lِ   R 7 ฀ ` % `  @]ј W / - L` ئ&@ @]  Ϧ&@`@g$Ģ@@ J %t  $t$b" @c &t nb!#Ԡ 8@Ub@HeԐ!@&bt$t!#   #  ? ?%Đ?%$ $t!#   # ސ ฀ $ ߩ $@b @ _$ܰ?Ģ@@ I %t $t$b" @cR &t nb!#Ԡ 8@b@HԐ!@Òbt$t!#  Q # ? ?%Đ?%$ $t!#  < # { ฀  F $@b)$ M % &@@Ĕ  H %t $$t"  @b &t nb!#Ԡ 8@b@GԐ!@bbt3$t!#   # F?/ B?%Đ?%$ $t!#  ې #   $@ L`֐!@,`p?฀  Ԗ $@a$ * * @  㿘  'P  - + 79/ n;M &G \` `Ĕ" 2 't a$$t"  @bb t@8@G"Ԑa@ْ"t$t%Đ?%a$ $t!#  b # @ @  $`*@ UĨ M 0P 9OP?Ѐ K@ * @  Ē"@@ 2 't a$b$t"  @b  t@8@F’"Ԑa@脒"t$t%Đ?%a$ $t!#    # @L @B  $`*@8 @ / %t $ta$b" @a˒  t@p8@F"ԐaE"%Đ?%a$ $t!#  ϐ # a$ a$ *@     ؐ% &'MĔ J %t a$$t"  @a (t nb!#Ԡ 8@-b@F=Ԑ!b@t$t2'?!#   # ?ɐ ?%Đ?%a$ $t!#  u # a$ a$*%s out of memory㿘!'%"  d*@  *`@a6$⬖  n"*@ *`" Z$"*@ *` "Q"*@ *` $"& b!#ؠ 8@cx@E̒ؐ!@獒c@ @`$$⬁nothing to undo㿈'- / 쀢?%? !ِ!@m`ɰ?"   "a #ct" $ct`[?) b* ?  ? @  @  "  9 45`"@'"" "`@?"@"@`"@`" "?"  `??" 2  : 6?9  * @"2) **`:``@ @    ''@?'@#&?#@ @`     `ctށctⴐ?%$%$ $ct1#  E #    㿘'Ⱂ??!$)b* @*`"@ Ⱂ@ ``@ T@@_@Ⱂ??$   `"""$Ⰱ㿘@benstuvusage: cat [-benstuv] [-] [file ...] stdout㿘@DA# ڒa@ !k%ڀ`7aڐ!*` € k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k j k k j k k k k k k k k j k k k k j j j j  " &$c   "`  "  "`  "`   "c"#@K    "cڐ 8@D!a(@# @J1 ??#@c*`@   `  `  `  #` #`@0@@&#  ڒaP@& @`stdin-r%s㿘ڐ#% $#c/-+)  @"  @w `@H%   c $@@&F  %6d %6s 㿘   %C` 0   ` 2 `?"` * $@W"    `  #`  `ڒ`ؔ  `` ۦ`А@Cl @2 `    `` $?"`` $* $@ $Ò`` +  #`` ^?"`` ^* $@ ^` I?"`` I Iz*#`e`/` M?"`` M* $@ʐ My` -?"`` -* $@ -"d `#D@ ` /` ^?"`` ^* $@ ^E` ?`@`? "`` *:    * `? "`` ,`:    `* $@d"  ? & @%T  &ဤ  @  @    "`6  `@ڒaP@ 㿘ڒc% #$R -+)  @!^   @7 `@%  T` $@T` @_>  0) "` R#@\ "#@%  $$$@\$%"" %  "$$"$% '"@@^ 6P@B @"@^ 4   @{   "㿘@ddbusermachdephwdebugnetvfsvmkerniov_maxsynchronized_ioshortcorenamesysvshmsysvsemsysvmsgfsyncmsgbufsizeroot_devicertc_offsetautonicevalautonicetimetimexntptimerawpartitionmaxpartitionsdomainnameboottimesaved_idsjob_controlngroupsposix1versionprofilingfileprocvnodeclockratehostidhostnamesecurelevelargmaxmaxfilesmaxprocmaxvnodesversionosrevisionosreleaseostypeuvmexploadavgvmmeterfilecorecodaext2fsadosfsunioncd9660afsprocfskernfsumapnullportalfdesclfsmsdosmfsnfsffsgenerickeyarpnatmisdnpipinet6ipxrtipcntcoipxtplink_layerrouteappletalkhylinklatdec_dlidecnetibm_snaccittdatakitemcaisoxerox_nschaospupimplinkinetlocalmachine_archdiskstatsdisknamespagesizeusermemphysmembyteorderncpumodelmachinetzname_maxstream_maxposix2_upeposix2_sw_devposix2_localedefposix2_fort_runposix2_fort_devposix2_char_termposix2_c_devposix2_c_bindposix2_versionre_dup_maxline_maxexpr_nest_maxcoll_weights_maxbc_string_maxbc_scale_maxbc_dim_maxbc_base_maxcs_pathfromconsoleonpanictabstopslinesmaxwidthmaxoffradixAanw㿘@@! #  n A 0 w  0 $   "`  "`  "`@H@F`a? a#@ *@ &   ` @Q3  `.  @  `0@!  ?@ @ ` ? 㻘@  @d@K` . , `! @. @`"  @Q @`  &@%sMust specify -w to set variablestopClass `%s' is not implementedsecond%s: Kernel is not compiled for profiling%s: %s offrunningUse pstat to view %s informationUse ps to view %s informationUse xntpdc -c kerninfo to view %s information%.2f %.2f %.2f Use vmstat or systat to view %s informationUse netstat to view %s informationUse nfsstat to view %s informationIllegal top level value: %dName %s in %s is unknown%qdThe value of %s is not availableThe specification of %s is incompleteThe type %s is unknown to this programsysctl() for %s failedtick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s = %s %ld 0x%x %s = %d %s: %d -> %s %s: %s -> %qd %s: %qd -> %s: unknown structure returned%s: unknown type returned ޔ'$@,@ =  $   `ޒc@& @ =*, #D @ ` "    `2 @Iې`@? '@ , @ @ې   0Ғ`(@e?˓, @ 'Ȣ  '!* € 4 t  d    ̒?` !\*` € t L ` L     |     ''АȒ  @[  ` ` ߐ#`0@>j@  80| `yc߀ ` hߖ p `id x`d_ d b `[V ̀ `@    ߐ#`0@>0##\#`@>&`0;:5!̀  `Ȗ@ 00)(#!0 '& ̀  Ȗ@{Ȗ@C`̀ Ѐ  ``!Xߐ! `ߐ!@ 80   $'@'  ߐa@ $'ȠȖ @Z?` n"쀢 " -   2 !!""@@0  `2  ߐ#`0@=   ##\ȒbX@= 0 `!#ߠ#b'@k@=q0Ȑ#@=kb0?`w" *` € 4 H Ԁ  `ߐ#b@=O ` Ȑ#b@=A#@=;b0P  `ߐ#b@=.ߐ#b@=(0= ` ߐ#b@=ߐ#b@=0,  `ߐ#b@=  ` ߐ#b@<#@<b0 #ߐ#(@ C㿀 (`&  ("(  ` ''  $ %@'@'  @Z  ?" , $%@   %@idpudpegptcpggpigmpicmpipmaxflowsmtudisctimeoutanonportmaxanonportminmtudiscsubnetsarelocalallowsrcrtdirected-broadcastforwsrcrtmtuttlredirectforwardingmaskreplnewrenoslowhzkeepcntkeepintvlkeepidleack_on_pushcwm_burstsizecwmcompat_42timestampswin_scalesackmss_ifmtuinit_winsyn_cache_intervalsyn_bucket_limitsyn_cache_limitmssdfltrecvspacesendspacerfc1323checksumthirdNo variables defined for protocol %sfourth㿘@ b9?b@.` &"*``   @ N#?@ Ւ?c(@  & *`  '?doasyncfreedoreallocblksdoclusterwritedoclusterreadnfsstatsNo variables defined for file system %s㿘* c   @ ?  ?@Ib  &*`  '?confmaxtypenum㿘3 `lg ?@&b `  &`l*`  '?.%s: incomplete specification%s level name %s in %s is invalid㿘  @b 2"@? . @`" @7   & "(@?Usage: %s %s %s %s %s %s %s %s [-n] variable ...[-n] -w variable=value ...[-n] -a[-n] -A㿈P px c8cP#`#h 8#\@:#d@ 㿘@"W????*%hu㿘`` ?#@2 1  1  1  @([ 2bcast%d㿘` `  2 1 1  1  1 `!@(= 2㿘   "11 1   !8@(& 2%d-%d㿘   1 X!p@( 2!p!p@( 2!p%s%s.%s.%s㿘`' ``C,"*` € D L h *,!!o!!!!a}ᨔ@'ʒ 2 `!!ᨔ@' 2`"ᨠ@E@E 2$@!!w@'ᨁ-%s㿈`   !!!7@' d`?c   d2@ 7!$@#H|@@'|@  d#$aȐm@@'mActive ATALK connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-18.18s %-22.22s@ 'H@#?    @S H „@#- H  „<7 4X@## z) # ! 99; @ @ `5倢 +-/3'@ `c` ?"`c* $c@  #̀ x@ؒ#̀    #\`@Ța% #̀ !(@X h!0 D@H#̀ HX` @#̀HX  @c` ?"`c* x$c@빐 u%s: %ld %s%s%s packet with short headers with long headers  with no checksum too short  with bad checksum  with not enough data forwarded  encapsulated rcvd for unreachable dest  dropped due to no socket space p ݒ@"\ ( #@;1  H Ѐ  H!##`@"]@%  H Ԁ  H!##`@"H@  H ؀  H!##`@"3@ 8 H   H!##`@"@ P H ܀  H!##`@" @ј ` H 䀢  H!##`@!@ x H 耢  H!##`@!ߐ@  H 쀢  H!##`@!ʐ@  H   H!##`@!@}  H  !##`@!@h Ёifnet: symbol not defined %-5.5s %-5.5s %-13.13s %-17.17s %10.10s %10.10sNameMtuNetworkAddressIbytesObytes%-5.5s %-5.5s %-13.13s %-17.17s %8.8s %5.5s %8.8s %5.5s %5.5sIpktsIerrsOpktsOerrsColls %4.4sTime %5.5sDrops%-5.5s %-5lu %-13.13s none%-17.17s %x%c %25s %-17.17s atalk:%-7.7s %xHns:%-10s %02x%c(%d)%10lu %10lu%8lu %5lu %8lu %5lu %5lu %4d %5d耦`@ x0 "@$0@   / ( #\ `ȔЖؘ `!@HP!X#\#`#d#h `ȔЖؘ a8@- T !`@ah+ bX !p@ax)#`?"`# * %#@鵐 `V `%H@  L\@T  /`L@֐ 9`@d x *. .T!@^`!!@U!@Q(a@ d  .  "  `!8*` € @ @ @ @ @ @ @ @ @ @ @ @ @ P @ !!@!@@2w@ !@1Ԡ!@ ؀ , #!`@  $@1`a@!t `!!ؐܒ @!!Ԓ  `7\ 7^\a@@3!@ђ!!@3@ʐd   瀢2 " : @b%"@   ? N < ? (N  <  ? < N "?<  ?  ,   <@?@ "`#  ?`$  @ #* %#@蔒`( "@^ T"(@UT Wv@N"HbX @G"P` ?"`#* %#@c ``%s%s: %s: unknown interface %7.7s in %8.8s %6.6s out %5.5s %5.5s in %5.5s%5.5s out %5.5s %5.5s %7.7s in %8.8s %6.6s out %5.5stotal %5.5s in %5.5s%5.5s out %5.5s %5.5s%10.10s %8.8s %10.10s %5.5sbytes%8.8s %5.5s %8.8s %5.5s %5.5spacketserrscollsdrops %10.10s %8.8s %10.10s %5.5s %8.8s %5.5s %8.8s %5.5s %5.5s%10lu %8.8s %10lu %5.5s %10lu %8.8s %10lu %5.5s %8lu %5lu %8lu %5lu %5lu'D@@Ԕ  +  b#@; '<`a` <`&1  H@ $@\&&&@ !H@"b`"`0@ "`0`0@0L` 2 P`b 8@4ڒaP@ ܐ cT@4  D(aL@9 57 /!(  ap@^  Xa @U X ap@Na`$ *` *  *  *  :  !(  aa @5  Xaa  @+ X ap@$ a`` @`,`("?"?"?"?"?"?""@`0 0@ `0`?"` * %@+ !(  b8b @ Xb`bhb@  @bpX ap@bxa`$ *` *  *  *  :  !!(  b8b @Ș Xb`bhb  @bpX ap@bx`?"` * %@ϐ @L <$$$$$ $$$($,`pa`!`,`(@i H@ ^ @,!( b# @x#@ Xb(" # #@  @@f X bP@]" &&&&&&&@$ $@ $ $@ $  $ $@ $$(@ $(, L$,`0 0``0a`$ *` *  *  *  :  ,!(   "  bؖ#@ @  X b"   # #@ $ $(  (@ X , ,bP@" `?#` %%  % % % % %  % $% (% $,% (% , * % @ @K(@ aL` @ @t D@2(aL M<$ ل (LTIME_WAITFIN_WAIT_2LAST_ACKCLOSINGFIN_WAIT_1CLOSE_WAITESTABLISHEDSYN_RCVDSYN_SENTLISTENCLOSED2MSLKEEPPERSISTREXMTTMWAITFWAIT2LASTAKCLOSNGFWAIT1CLWAITESTABLSYSRCVSYNSENtcp??? Active Internet connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %s%-*.*s %-*.*s %s ProtoRecv-QSend-Q Local AddressForeign AddressState%8lx %-5.5s %6ld %6ld%s %d %s 'D`h@`?D'l@5  c̰ D 'p+ aX /    % @ p0/  %x@ \p! 'p ؀  t@_'t D aX@ l+ ꀠ`;% b@ ah C@Ր x -쀢`!')579@Ȑ ` ?"`* $@  c̀  @`  !!!(!8#`#l#p #\#d@#h'ah c̀  l`p@!@ ِaX haH  D!! @yaX` @    @ @ y  @ p   @ @ fl` قb`* 2` !`:쀦 !h:al:a,@ @5` ?"`* $@Q D@&%s: %lu packet%s sent  %lu data packet%s (%lu byte%s) %lu data packet%s (%lu byte%s) retransmitted %lu ack-only packet%s (%lu delayed) %lu URG only packet%s %lu window probe packet%s %lu window update packet%s %lu control packet%s %lu packet%s received %lu ack%s (for %lu byte%s) %lu duplicate ack%s %lu ack%s for unsent data %lu packet%s (%lu byte%s) received in-sequence %lu completely duplicate packet%s (%lu byte%s) %lu old duplicate packet%s %lu packet%s with some dup. data (%lu byte%s duped) %lu out-of-order packet%s (%lu byte%s) %lu packet%s (%lu byte%s) of data after window %lu window probe%s %lu packet%s received after close %lu discarded for bad checksum%s  %lu discarded for bad header offset field%s %lu discarded because packet too short %lu connection request%s %lu connection accept%s %lu connection%s established (including accepts) %lu connection%s closed (including %lu drop%s) %lu embryonic connection%s dropped %lu segment%s updated rtt (of %lu attempt%s) %lu retransmit timeout%s %lu connection%s dropped by rexmit timeout %lu persist timeout%s (resulting in %lu dropped connection%s) %lu keepalive timeout%s %lu keepalive probe%s sent %lu connection%s dropped by keepalive %lu correct ACK header prediction%s %lu correct data packet header prediction%s %lu PCB hash miss%s %lu dropped due to no socket %lu connection%s drained due to memory shortage %lu bad connection attempt%s %lu SYN cache entries added %lu hash collision%s %lu completed %lu aborted (no space to build PCB) %lu timed out %lu dropped due to overflow %lu dropped due to bucket overflow %lu dropped due to RST %lu dropped due to ICMP unreachable %lu SYN,ACK%s retransmitted %lu duplicate SYN%s received for entries already in the cache %lu SYN%s dropped (no route or no space) 㾈 @!@)! ,`!  H` 0!!@2@0  !4  !  H`48!!@4@@8  !<  !  H`@!!@<@@ǖ@` !  "  H`4 H!"@@H`!  H`4 D!"0@Ր@D`!  H`4 L!"P@Đ@L`!  H`4 P!"p@@~P`!  H`4 T!"@@mT`!  H` !"@@\  !  "  H`!"@|@x@A`!  H`4 !"@e@0`!  H` X!"@T@X  !\  #  H`4p!#@?\@;@p  !t  #P  H`!#P@$t@ @`!  H` x!#@ @ؒx  !|  #  H`4!#@|@@  !  #  H`4!#@ݐ@ِ@  !     H`! @@@`!  H`4 ! H@@v`!  H`4 !"p@@e`!  H`4 `! `@@T``!  H`4 d! @x@Cd`!  H` l! @g@2l  H` @% 耤`!  H`4 !!@I@쀤`!  H`4 !!0@8@`!  H` !!P@'@  !  !  H`!!@@@ז`!  H` !!@@ƒ  !  !  H`!!@@@`!  H`4  !"@ϐ@ `!  H` !"8@@  !$  "h  H`!"h@$@@n`!  H`4 !"@@]`!  H`4  !"@@L `!  H`4 !"@p@;`!  H`4 !#@_@*`!  H`4 !#@@N@`!  H` !#p@G@  H`(#@ (`!  H`4 !#@@`!  H` !#@@ْĀ  H` @̒ 쀤`!  H` ! @@Ȁ  H`4 8@   H`4 P@ ̀  H`4 x@ Ѐ  H`4 @ ܀  H`4 @z Ԁ  H`4 @m ؀  H` @` `!  H`4 !! @@O䀤`!  H`4 !!@@s@>耤`!  H` !@c@. %lu datagram%s received %lu with incomplete header %lu with bad data length field %lu with bad checksum %lu broadcast/multicast datagram%s dropped due to no socket %lu dropped due to full socket buffers %lu delivered %lu datagram%s output p @ߐ!@ $Ѐ !  H` !!`@@ʒԀ  H`4!@ ܀  H`4!@ ؀  H`4!@   H`#@ 䀦 !  H` !!@@耣`  H` @x" ܐ" ؐ" " " "   H`"P@` 쀦 !  H`4 !#p@@O !  H` "`@t@? %lu total packet%s received %lu bad header checksum%s  %lu with size smaller than minimum %lu with data size < data length %lu with length > max ip packet size %lu with header length < data size %lu with data length < header length %lu with bad options %lu with incorrect version number  %lu fragment%s received %lu fragment%s dropped (dup or out of space) %lu malformed fragment%s dropped %lu fragment%s dropped after timeout %lu packet%s reassembled ok %lu packet%s for this host %lu packet%s for unknown/unsupported protocol %lu packet%s forwarded (%lu packet%s fast forwarded) %lu packet%s not forwardable %lu redirect%s sent %lu packet%s sent from this host %lu packet%s sent with fabricated ip header %lu output packet%s dropped due to no bufs, etc. %lu output packet%s discarded due to no route %lu output datagram%s fragmented %lu fragment%s created %lu datagram%s that can't be fragmented ( Β@R p!@3 !  H`4 !! @W@" !  H` !!@@F@  H`4!`@   H`4!@ 􀢠  H`4!@   H`4!@ݒ   H`4"@В ܀  H`4"(@Ò 䀢  H`"@@  !  H`4 !"h@ڐ@ !  H`4 !"@ɐ@쀦 !  H`4 !"@@ !  H`4 !"@@r̀ !  H`4 !#@@a !  H`4 !#(@@P !  H`4 !#H@t@? !  H`4 !#x@c@. !  H` !#@R@   H``?"` * "@/  !  H`4 !#@)@ !  H`4 !#@@Ā !  H`4 !#@@Ғ耦 !  H`4 ! @@Ȁ !  H`4 ! @@@ !  H`4 ! x@Ԑ@Ѐ !  H`4 ! @Ð@Ԁ !  H`4 ! @@}؀ !  H`  @@maddress mask replyaddress mask requestinformation request replyinformation requesttime stamp replytime stampparameter problemtime exceeded#10#9echo#7#6routing redirectsource quenchdestination unreachable#2#1echo reply %lu call%s to icmp_error %lu error%s not generated because old message was icmp Output histogram:  %s: %lu %lu message%s with bad code fields %lu message%s < minimum length %lu bad checksum%s %lu message%s with bad length Input histogram: %lu message response%s generated @@ܔ !@@`!  H`4 H!!@@H`!  H` !!@А@!  'L@ , `1@@ @"   ``2!  H`4 !"0@@r`!  H`4 !"X@@a`!  H`4 !"@@P`!  H` !"@t@?!  '@ , `1@0@ @+"   ``!  H` "@L@ %lu message%s received %lu message%s received with too few bytes  %lu message%s received with bad checksum %lu membership quer%s received iesy %lu membership quer%s received with invalid field(s) %lu membership report%s received %lu membership report%s received with invalid field(s) %lu membership report%s received for groups to which we belong %lu membership report%s sent p @ $!@Ѐ !  H`4 !!@@Ԁ !  H`4 !!@@x؀ !  H` !"@@g܀  H`4"@"h"p @R   H`"x"h"p @= 䀦 !  H`4 !"@a@,耦 !  H`4 !"@P@쀦 !  H`4 !#@?@  !  H` #`@/@%.*s.%.8s*%u %-*.*sH #b0   !X`" @<@͒ P@̒  .`2  "@S2& P "@.`2   "8"@H@ "P @%u.%u.%u.%u㿈䀢  !X`H % "@桒! 2,,!@ . @=` , !X`.  *'@R.@RY'  `@T  2`2 @Y7  "@U .  c@` ",@``! b@! "@I 2"Ȑ `2`2`#\2`x `"@- 2"* 1TCP Protocol Control Block at 0x%08lx: Timers: %s: %u State: %dState: %s, flags 0x%x, inpcb 0x%lx rxtshift %d, rxtcur %d, dupacks %d peermss %u, ourmss %u, segsz %u snd_una %u, snd_nxt %u, snd_up %u snd_wl1 %u, snd_wl2 %u, iss %u, snd_wnd %lu rcv_wnd %lu, rcv_nxt %u, rcv_up %u, irs %u rcv_adv %u, snd_max %u, snd_cwnd %lu, snd_ssthresh %lu idle %d, rtt %d, rtseq %u, srtt %d, rttvar %d, rttmin %d, max_sndwnd %lu oobflags %d, iobc %d, softerror %d snd_scale %d, rcv_scale %d, req_r_scale %d, req_s_scale %d ts_recent %u, ts_regent_age %d, last_ack_sent %u P@  @!H@!xT!X #.  a @x  . @r!d*`2` !:`,:` !@at!@\|Wf!Wh@VWjl"n@Pp"(@J"P@D"@="@6Wؐ"W#\W#`W@*WOܐ#8O@$W#`@#@%s: %d esh sent, %d esh received %d ish sent, %d ish received %d rd sent, %d rd received %d pdus not sent due to insufficient memory %d pdus received with bad checksum %d pdus received with bad version number %d pdus received with bad type field %d short pdus received 㿀 -@ ܔ  (!@!@!@"@@"(@"X@"@"@"؁%s: %d total packets sent  %d total fragments sent %d total packets received  %d with fixed part of header too small %d with header length not reasonable %d incorrect checksum%s %d with unreasonable address lengths %d with forgotten segmentation information %d with an incorrect protocol identifier %d with an incorrect version %d dropped because the ttl has expired %d clnp cache misses %d clnp congestion experience bits set %d clnp congestion experience bits received 㾀 D@ !! ? #@@#@#@ @ H! p@ @@ @ސ @ڐ @֐!@Ґ!84@ΐ!h8@ʐ!<@Ɛ!%s: %u incomplete header%s %u bad data length field%s %u bad checksum%s 㿀 "@ Ĕ  !#@ Ӑ@!# @ ɐ@!#@@ @%s control block: symbol not in namelist tpprev %p next %p isop_prev %p isop_next %p??? #@f0G` @Ɛ  @@A0=a (@U06@ k 0% ¢@<  &' !@ W `ߒX` @ P @` ` ?"`* "@M Active ISO net connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld () *.* 㿐#b :@̐! `؀ @Ő!`?"` * "@ ! #̀ !@a#̀ !"#\bHPX"`@bp$b #̀`  !`b@  ٘!X h D"@` ` #a  a@<@r"` ’!` t@g"`! `t"h@;" "h "h@ s "h@̒ ` #`΀  `@@G"0 ’!` @="0! `"`@: "` "`@ J "`@ undefined tpcb state: %p %d %-12.12s㿈@ 3 *@;4 e@ )*@ @ [ P3/ - +)@ "K% @ ! ! @@ah ؀ 2    "7쀢 "4쀢 1 X@   `!  @- @     `a*` !@#` ?"`#* $#@ߐ `* @*@tpip0 cĔ \@  ؀   ܐ@M'  #̀` "@ ٘!X h D"@c`! TP not configured 㿘 @n (0 @j!!  "8!Ȑ@ @u %*sReceiving: %*s%ld variable parameter%s ignored %*s%ld invalid parameter code%s %*s%ld invalid parameter value%s %*s%ld invalid dutype%s %*s%ld negotiation failure%s %*s%ld invalid destination reference%s %*s%ld invalid suffix parameter%s  %*s%ld invalid length %*s%ld invalid checksum%s  %*s%ld DT%s out of order %*s%ld DT%s not in window  %*s%ld duplicate DT%s %*s%ld XPD%s not in window %*s%ld XPD%s w/o credit to stash %*s%ld time%s local credit reneged %*s%ld concatenated TPDU%s %*sSending: %*s%ld XPD mark%s discarded %*sXPD stopped data flow %ld time%s %*s%ld time%s foreign window closed %*sMiscellaneous: %*s%ld small mbuf%s %*s%ld cluster%s %*s%ld source quench %*s%ld dec bit%s %*sM:L ( M mbuf chains of length L) %*s%ld: over 16 %*s%ld: %d %ld: %d %*s%ld EOT rcvd %*s%ld EOT sent %*s%ld EOT indication%s %*sConnections: %*s%ld connection%s used extended format %*s%ld connection%s allowed transport expedited data %*s%ld connection%s turned off checksumming %*s%ld connection%s dropped due to retrans limit %*s%ld tp 4 connection%s %*s%ld tp 0 connection%s LOCAL, PDN LOCAL,~PDN~LOCAL,~PDN~LOCAL, PDN %*sRound trip times, listed in ticks: %*s%11.11s %12.12s | %12.12s | %s CategorySmoothed avgDeviationDeviation/Avg %*s%11.11s: %-11d | %-11d | %-11d | %-11d  %*sTpdus RECVD [%ld valid, %3.6f %% of total (%ld); %ld dropped] %*sDT %6ld AK %6ld DR %4ld CR %4ld %*sXPD %6ld XAK %6ld DC %4ld CC %4ld ER %4ld %*sTpdus SENT [%ld total, %ld dropped] %*sRetransmissions: %*sCR %6ld CC %6ld DR %6ld %*sDT %6ld (%5.2f%%) %*sXPD %6ld (%5.2f%%) %*sE Timers: [%6ld ticks] %*s%6ld timer%s set %6ld timer%s expired %6ld timer%s cancelled %*sC Timers: [%6ld ticks] %*s%6ld inactive timer%s cancelled  %*sPathological debugging activity: %*s%6ld CC%s sent to zero dref %*s%6ld random DT%s dropped %*s%6ld illegally large XPD TPDU%s %*s%6ld faked reneging of cdt %*sACK reasons: %*s%6ld not acked immediately %*s%6ld strategy==each %*s%6ld strategy==fullwindow %*s%6ld duplicate DT %*s%6ld EOTSDU %*s%6ld reordered DT %*s%6ld user rcvd  %*s%6ld fcc reqd B㿀+-c`@G! @@; ! @@/ !!@@# !!(@@ !!H@ߐ@  !!h@Ӑ@ $!!@ǐ@ a@ !!@@ H!!@@Ԗ L!"@@Ȗ X!"8@@ P!"P@@ T!"p@x@ `!"@l@!!"@`@b@ D!"@N@z @!#@B@n \!#8@6@bc`@\! !#x@$@P!$!#@@D!c@=!!#@@1cؔ@+!(`@$!( %, , @ , @#`#\c@  $, c!l`0@!t`H@!p! `@Ȑ@`@ ,! @@ 0! @@֔ 4!!@@ʔ !!0@@!|!!h@@!x!!@z@a@hX#`#\b"8bH@!!"  ',  c@  #d  #\#`x@| ,  d h"c' /0B/T'"/0Bą"?   <#`#d#\@M # ̤cb#\#`  @> ! Р#  #\#`#d  @/ lc` 8@'  #\#`  @  #\ #`#d  @c@  |#\ tc x@  #'  /0B/T'"/0Bą"?  #\@ה  c#'  /0B/T'"/0Bą"?  #\@c Ԓ`@@p ܨ@m ؠ@j  '  #h#\#d #`@ `h@@R @O @L #h #` #\#d @r ! @:@f`@`!! @(@T!!!@@H!!! @@<!aH@5ah@/!a@(!a@!!a@!a@!a@ !b@!b(@!Đb@@{}[]<>㿘 @L  2   `2    ` `  @9  ` 2   "  `  @  @'     `  @@  @`?"`` * "@h %s㿘 @ $Ȁ@ "8 .@*`  :  ** *@ *@(! **@ȁ_mclpool_mbpool_ddpcb_ddpstat_mclbytes_msize_viftable_mfchash_mfchashtbl_mrtstat_ip_mrtproto_igmpstat_file_nfile_cltpstat_cltb_rt_tables_nimp_esis_stat_tp_stat_tp_refinfo_tp_inpcb_clnp_stat_ns_errstat_spp_istat_idpstat_nspcb_unixsw_rtstat_icmpstat_imp_softc_ifnet_udpstat_udbtable_tcpstat_tcbtable_ipstat_mbstatigmpicmpipudptcpddpns_errsppidpesisclnpcltptpAabdf:ghI:iM:mN:nP:p:rstuvw:nsinetunixlocalisoatalk%s: unknown address familyinvalid PCB address %s%s: unknown or uninstrumented protocol%s%s: no namelistno namelist%s: no PCB dump routine %s: no stats routine 㷐@E'D@;' @1'@ˤ   $Ȭ ; + 5 / 7 9 1`8!*` €                                                  x        ؐ "c  "`  "a(  "bX# nc@+`X  $c@"``  ~$c@`h gc@`p ac@ `x  i$c@`  `$c`@}$  Y'ch n#  "bR%`  O%`  nL# I& nF#  B"aX# nc@+  nJ`쀢 " c`@| ,%# n@c  c`@| &⤐ '#P `H "`H ِ "aT $ ِ  "b n@c ْ "%` @ D@ 8??c@* @@cDJ `@٤  ـ "b@ %` `@``   ␀ @@@  @ݘ1 &"`@| 2 ) )@@z""@ג  `  `@|c a@|`  " a`aa@7a@/  2 @# `@0 @洐!@ ⤀    ` * *  0 @析!0@ @ @ ` `"#P ߤ`P@    H`@`t0@ a@ ch   H`"a|aX@aL0aLad@ap@֐ Ȁ  % @ @I #@ "        @E@ 2`@Ȁ   !@@3   Ȁ   !h@#   Ȁ   !@   Ȁ   H`"@`@s 㿘  H`  * * b@  * * b@     #Ȁ` %s 㿘! "@"  ?!@"p@㐐s Ёes Ё㿘b b@       2 㿘  @*@@ 0 @   @( 2`@ usage: %s [-Aan] [-f address_family] [-M core] [-N system]  %s [-gimnrsv] [-f address_family] [-M core] [-N system] %s [-n] [-I interface] [-M core] [-N system] [-w wait] %s [-M core] [-N system] [-p protocol] %s [-M core] [-N system] [-p protocol] -P pcbaddr 㿘#P! 8 ``@ ``P@ ``@ ``@` @|a@~ socket optionssocket names and addressesfragment reassembly queue headerspacket headersancillary dataoob datadata%s: unexpected change to mbstat; check source %s: mbstat: symbol not in namelist %u mbufs in use: %u mbufs allocated to %s %u mbufs allocated to %lu/%lu mapped pages in use %u Kbytes allocated to network (%d%% in use) %lu requests for memory denied %lu requests for memory delayed %lu calls to protocol drain routines 㿐!"! P`  8@bH0ŀ  `P`  8@bx0  '􀦠 + ('+ `L~" ) "w Ā ' ؐp Ā %p`   `@`* `  "@@ p` 3   ha` 5 `@*`" *'@* @' `"  @ &a`  ha`% ,`` ",``"@ "`@&,` #  c ,$ @, <@" 8 ,+@  8 , *  @  @,"    " @,ސ  @,`* * @0v  `# c@Г:` `L  @ː#P  @ǐ#p  @Ð#%lu%c㿘  # k2  m21 ! @ ip_mrtproto: symbol not in namelist no multicast routing compiled into this system multicast routing protocol %u, unknown mfchashtbl: symbol not in namelist mfchash: symbol not in namelist viftable: symbol not in namelist Virtual Interface Table %s%sVif Thresh Limit Local-Address Remote-Address Pkt_in Pkt_out %3u %3u %5u %-15.15s %-15.15s %6lu %7lu Virtual Interface Table is empty Multicast Forwarding Cache %s%sHash Origin Mcastgroup Traffic In-Vif Out-Vifs/Forw-ttl  %3u %-15.15s %-15.15s %7s %3u %u/%u Multicast Forwarding Cache is empty Total no. of entries in cache: %d 㴰 'H @#x0ؒ$ $`` @ݐ#0 @ؐ#0H @А#0 @ʐ 0;  @Đ H0aX 'aX'x֔*   3 9 / ?`"'.2 + % `p @⥔? ? ?@g`@☒?쀋` @[?!@*`2    TҨ T2H @}! H     S O  ,`  "A9 / ) 5 3 + 2 (Hap@Ua (k P0@ !@I@4\8@?ؘ :1 .2  "@1!*`2  @)"(`'`@ )  @"0 "0@@"'aXmrtstat: symbol not in namelist multicast routing:  %ld datagram%s with no route for origin %ld upcall%s made to mrouted %ld datagram%s with malformed tunnel options %ld datagram%s with no room for tunnel options %ld datagram%s arrived on wrong interface  %ld datagram%s dropped due to upcall Q overflow %ld datagram%s dropped due to upcall socket overflow %ld datagram%s cleaned up by the cache %ld datagram%s dropped selectively by ratelimiter  %ld datagram%s dropped - bucket Q overflow %ld datagram%s dropped - larger than bkt size X  @o#x0 `` @e#0v @`#0q` @Y!0jp 4 @R"! "~@I! "Hu@@! "hl@7! "c@.! "Z@%! #Q@! #8H@! #p?@ ! #6@! #-@!  $@dropresponduseroutputinputspp??? Active NS connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-22.22s %-22.22s %d %s8'D 'H b@ D,`? T@+A T ,D , T  @k"0' ؀  ;   2    ;  aXs  (    ِh d+~ +c8% 8#  @@"5 `- / 1 3 '  @4"` ?"`* $@P c̀   b@c̀  " #p#\8@H#P@c`%c8c̀ aX #x@aX  h D@H „H@K @ „H@C @ ل`  #,*`  @` ?"`* $@  ,DS%s: %d %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation %ld %s%s%s -- %s initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  h "@IW* !##cq#(@7cHW4 !##c_#P@%cHW* !##cM#x@cHW, !##c;#x@cHW. !##c)#@cHW0 !##c#@ݚcHW2 !##c#@˚cHW8 !##c @ݹcHW6 !##c 0@ݧcH< !# Xcϐ p@ݕcH@ !# Xc @݃cHD !# Xc @qcHH !# Xc @_cHL !# X` @McHP !# Xcu @;cHT !# Xcc @)cHX !# XaQ!@cH\ !# Xa ?!0@cH` !# Xc-!8@cHd !# XaX!p@cHh !# Xax !p@ϚcHl !# Xa!p@ܽcHp !# Xa!0@ܫcHt !# XcӐ!@ܙcHx !# Xa!0@܇cH| !# Xa!0@ucH !# Xa!0@ccH !# Xa!@QcH !# Xay!@?cH !# Xbg!0@-cH !# XbU!0@cH !# XcC"(@ cH !# Xb@1!0@cH !# Xb`!0@cH !# Xb "@ӚcH !# Xa"@cH !# Xc"@ۯcH !# Xbא"@۝cH !# XcŐ"@ۋcH !# Xc"@ycH !# Xc#@gcH !# Xc0"@UcH !# XcH}"@CcHĀ !# Xck#`@1cHȀ !# XcY#@cH̀ !# XcG"@ cHЀ !# Xc5"@cHԀ !# Xc##@cH؀ !# Xb#@ךcH܀ !# Xc @ŚcH !# X` !p@ڳcH䀦 !# X`@ې!p@ڡcH耦 !# X`Xɐ h@ڏcH쀦 !# X`!p@}cH !# Xb @kcH !# X`!p@YcH %d %s%s%s  smaller than a header smaller than advertised with bad checksums㿀 8T "@5耦 !# c]@% 䀦 !# cM@  !# c=@! too large to be forwarded forwarded too many times while gatewayed Refused due to lack of space at DestinationPacket at SocketNo ListenerBad Checksum at DestinationUnspecified ErrorNS error statistics: call to ns_errorerror ignored due to insufficient addressingerror request in response to error packetserror packet received incomplete received of unknown typeOutput Error Histogram: Input Error Histogram: 㾰   @z" !# c@j# !# c @Z#( !# cP@J#`p !# cr@:#l !# cb@*# )Б, `, @#Ȥ ,  @/  ,   )Б, `, @# ,  @  , in transitat destinationUnknown XNS error code 0%ox<  @ `  @ `` @ ``*"("8H@ @ <*`   ! @س㿘c2`  2` 2` 2` 2`  @2` Routing tables rt_tables: symbol not in namelist Netmasks: @؉## c̀   8` @ @x#00b   ! )' . @ "  t  #c̀ " #Ȁ 2 @X#0 2  @"@w$4@  ޑ. InternetXNSISOAppleTalkX.25 %s: Protocol Family %d: 㿘?`%!x*` € Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y  ! !!!( `!0!8@%-8.8s Address%-*.*s %-*.*s %-6.6s %6.6s%8.8s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface㿀 #̀`"(@ϒb0bx"b#\#`#d#h#l#p"8h   @״ 㿘! #Ɣ  #%-8.8lx (root node)%s => 㿘% # ؠ T Kc̀ #@ׅ c̀ 8 `###@s , 4`! ٠! |@c̀`@P   @g ,`?"` * "@r   0   4`#@8@'`` mask (%d)%6.6s %8.8lx : %8.8lx %d refs, mk = %8.8lx {(%d),%s ,  ->h ٤"T"  @!XR  @?``j'0h@ !p@`'K+ ٲ!bx1/-   @Δ!Ubx ; !@̐bx  "  @Ő ܔ   @ʖ?` }?"``* $@Ґ }`@֢Ȁ``?"` * $@ route sysctl estimateout of spacesysctl of routing tablex   ?''''   @$ c@ @!ܢ c@k   @# `@ @ @   %-6.6s 㿘 L% `Ȁ" $ 2    $ @8  L  . L   @,  @ْa`?"` * "@2 defaultlink#%d%s%02x: %02x%02x%s %-*s %-*.*s   `sx"x*` € c d$ b d$ d$ d$ cL d$ d$ d$ d$ d$ d$ d$ d$ d$ c d$ c\  u!`@o `@&h ` ^ˤ Z@V `2   2   @ G   `   @ 7b'%@ `@ (x@2$ ah@  z'%@   @(  x "0@R0!X`"8@I0"@@B pR#Ѐ`#  " 8*R@"` `*`R@ " *@# 㿘  @  && & &  @Ӑ%6d %8lu %6lu%6s- %.16s%s => expire %10lu%c recvpipe %10ld%c sendpipe %10ld%c ssthresh %10lu%c rtt %10ld%c rttvar %10ld%c 㽐-   " $V 4ݖ  0  ז V 4aV 6!@Ծ 8 P`!!b@Բ L   L#c`?"`` c* $c@  <! #x  b  <$#x b ""@| `?"`c * $c@  "`- L X"   L \  L ` L #\@T L d"X   L h@  L l L #\@>%u.%u.%u.%u㿐`< 'D1 "`< @;! 2. ,!@ . @ג` .  !X` D @8  `@ .  `@m` ",@` 1 #@!,!D 22#\ 2 `#@!# 0? ??&0x%lx/%d㿘 +.?  * "`  ` * ``* ?`* ? " @%u%u.%u%u.%u.%u㿐 !X`( `%`?@   ?@ 0 @@2>@` @6``2 @3  2 1 !@l!1!?@2 ?1 !!@Q4`$!#@2 `1 4` !!@B4`!1 4`4`4`4`#\ `!!@.4`!@@!"@Srtstat: symbol not in namelist routing: %u bad routing redirect%s  %u dynamically created route%s %u new gateway%s due to redirects  %u destination%s found unreachable %u use%s of a wildcard route 㿈 @!h03 @!W!!@ڒW!!@ђW!!@ȒW!"@ҿW!"0@Ҷ*.%xH*.*any*%02x%02x%02x%02x%02x%02xH.%xH%xH.%s%sp 7  7 7 * 7777%7+  2"+` 2 2,2  1 "@@l 2@X"1 H"@b 2P" F@  +#P @@  2 !#X#  b #d `  #\#` `@9 Lb0  :  K 0  ,2  # b@! 1 ,b1 "bА@ 2@*0H.㿈   7 7 77 77 7 7 777b!@  " J(8f4 a& * J TP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0)Out of memory (file table).  b! ¦P  @J Ș  @+!03 *` *   ) "`̀(% Т  h $T`  T@  *   *  Ѐ    @N Ф(`( ߠ (seqpacketrdmrawdgramstream#0Active UNIX domain sockets %-8.8s %-6.6s %-6.6s %-6.6s %8.8s %8.8s %8.8s %8.8s Addr AddressTypeRecv-QSend-QInodeConnRefsNextref%8lx %-6.6s %6ld %6ld %8lx %8lx %8lx %8lx %.*s Ȕ 4 R؀ P j 2'!!( @Л"p#\#`#d"bДؖ"@Ѕb$!(Va*@ ̐#В#\ h#` D#d@r؀P#@@iR`?"` * "@ 㿘@ = y y yx yp yh y` yX yP yH y@ y8 y0 SEPOCTNOVMAYMARJUNJULJANFEBDECAUGAPR㿘  Ā @  virtual memory exhausted㿘@(  Ȑ @ @e 㿘  `@ 0@  Ȑ @d @G -%s㿘b@7 @ܐ# 2 # n"@@ @#   "`error closing file㿘@c X" @⒐  n"@@ y@  ?6 write error㿘@  n"@ ^@ %s/sort%5.5d%5.5d%ssort%5.5d%5.5d㿘# @ `x] Z  `xJ?`/`x!@ 0 p "p `x!@ H p "p@l  $ $" 㿘  @ޘ "    2   @@ @$ 㿘D t1   htt  tx`     &  2& 8& &     2& 8("(@( ` ж㿘& && & read error㿘!   @n"  #&    * &  & "   @L` `@  n""@ $ @   & `  " @  " ` "  "  J?` "    *  ~&  & + &  㿘.``& & &&   (@` :C`??>  8J    *J * 0쀢 :-` ct??& "ct (   *  ( ct    ("  *ۘ?`  t (@   * 0    (` ` :J`??E 8J    *J  2 `耢   :-` ct??& "ct (   *  ( ct    ("  *ۘ?`  t (@   * 0  㿘    #t g&`` @m$,@``@2 @*`@*`{&``&@@*`"`$@@*` ="   `@* d`@*@ "` `@* @"`   `@* `@*@ $"` "` * `  #t  * `2 `@* @ "``@* @"``@* " `` &` @z$ 2`$&  .; @.8. ct*  ct ` @ ct**ct;" ct 0 ct  0 ct*'0 ct` @0`ct.  0  t* @  ` @0` t*`? 㿘 ct*@  @ *@ 2 ct@+ @ 2`-z -  #t*   ?߰ `0 @ 0"  0@ 0"`  t*@  . `@ *. .t+ @  . *t `tH t +  * `   * ``t t `@* `  `@* `  {`y w# 0 #t* n `* `h f 0"  0 `@ 0"`  t*@  . `@ *. .t+ @  . *t `tҒ5t +  * `   * ``t t `@* `  `@* `@  @ `"  㿐 `  #t* ``` `( #x   @+ $ %/2  : . @ @ 6$@ С, @@א ` 㿘   ` `  ``"`  2C `  VR @  ܒؒ(` #@  #t @* ``@* @ #t * `    % & ` "`$L  M   -G,,-B "`,`(   >:"`,`(LL~"@  M Mx"@ 0/@pn@ @* ``@* @ * `@* @䀤@ဤ@ @ `M M ͤ׀@,@A?@ @* ``@* @ * `@* @䀤@ဤ@L@L`@ـ@@ @ `M M @@ 2l`(@"`,`(  `  㿘  `ْ )  `%   ` `@$@ @@   @͒ 2 $  |` h!!4;!4%8@ؒ "8 'Ȑ7oVܠ %  ؑ, @@ 6D 4A ܠ `ؑ*` ? $ȧ,4,Ғ'ؓ*`@ @oܠؕ* '̤ ܐ&e ` 6  @5@3@1ȁ    a8'耧@D 'd   !4,`,`@ @@"`@ ꀤ@ .`@ `!4 @!8 "ƒd$` @Ǯ @6  h,`"@`@,` @&`hl* * ** *  *`@ܒ  ` $$?` @`7  o`!h** *` 耢  q ?`&* & @ h`i(@( *  ` (/  &/ ݒh'((@ * @`'@ * @qh(@( *@  (@ "@'(@( *@   @ "@h'!h*`*` *      ?` &* h& @h(@`$@h( @2h (  h*`  h*$@ Vh @ hl@`?"@h@`( h*`@ h*@ h@6' `, @ ,` @ @ @ " "  "  ,`$  ,     @ &$ @?`h`*`,` @# 4` @  l( * (* *  *`@ h `h`@   h  *" * #@`  ` I? & * &@ @Z㿘`!p` @'`' `' ` ' ``&@`&` `&`&`&` &` &` u&`7`@: , '@Д ʔ.     %3 4$$@ $@`%?$$ $@%`ܨ "   $" "#@ `@   $ ""#@ `r%s: disorder on %s 㿘 @ )'''% ?!p 2 px@ `  wX`j /' ( ,`)'* !p,   $ O 7 *`   -`&````: @Ԡ ,`-' * p, $  `` ?&@N,`ߒ  *` p `` ?&@@`-``& @ '',`p`@$ @,` I`@,`x!!0!08@ ؒ` ]- m;''apX̒܀@  - 4- S- ܮ  `` Ϫ`aaܢ @-1  ?  `ؒݐ ؒ    ?`$ * $ @8ܢ`@ۦV9 N2@@@`-` `Ġ` ,`$`ؐ@o ,2 ," ,invalid field specification `%s'㿘(ؖ @? 㿀''''''@y @i@{U(8%S(( 8 l |  "` "` t"` x"` t "` "`$ "`  "`(J  TMPDIR/tmpoption `-k' requires an argumentoption `-o' requires an argumentoption `-t' requires an argumentoption `-T' requires an argument%s: unrecognized option `-%c' fflush?c('H@('D@?b# "ap' ! )@ ?c ?@# @!    `x) `x(# ''''''  @ @   @ @   @ @  @  @ ?D''''''''') D  H? L@ +a-' ɐ 0H$ $$$$$($$$ @t `*``Ő `* ` `+   (+ * :`@  ?Ѐ .   + #t`` ct+   +` + * :`  ?Ѐ`2$"$$$ JDD -2L`  `' t*`B` @  `* ` `+   (+ * :`@  ?Ѐ .   + #t` ct+   +` + * :`  ?$ $T JHD@D  + :  o  t c ? k  T) m)"L  u s) y )#L   2 `) @3 @Ӑ 0$ $$$$$($$$ ct+ @`@ + @` +   (+ * :@  ?Ѐ2 .   + ``ct+   +` + * :  ?Ѐ`2`2$"$$$   *`:   ,2>@`=  + ` ct+   (+ * :@  ?Ѐ .   + `ct+   +` + * :  ?Ѐ`2$ $n J@K7g ?# >!L  DD)`W  /"`    () 8)8 @i  L     `x/)` @Y     "`H* 8a@/:@=    ԐD  @9 D @ (` ! x. & D Ɛ  ,"2 , 2), 2%, 2!,( 2, 2,$ 2, 2,$$$$$$$ $(,2 ,`2 䀢 Ѐ  ܀ 쀢 耢 x " | ?# ?c@@` @ɟ@ @ј" I  -@я -2''1aapD/'>-'? 㠠  @ɦ  @  n"@z @] FD&!!#?c@@`۔0`@ 8   n")@M    @Ե#? # n"b@= #` @ n@ԥ ? n"@. @ Usage: %s [-cmus] [-t separator] [-o output-file] [-bdfiMnr] [+POS1 [-POS2]] [-k POS1[,POS2]] [file...] 㿘 ap,ch@ 8@error %d:㿘`- 8@ݒ` 8@ؔ @א㿘@9iklnt:only one -t option may be specified.retrieving information on mounted file systems%s/tmp/df.XXXXXXffsWarning: %s is not a local %sfile systemWarning: %s mounted as a %s %s(@C!-``5Z-!*` € \ l |   "b  "b  "b  "b!耢` n-`@Vb @#@@D ?2?#@*@ & @J|  2@-`@S  @7@ Α. @'` '-+- ) /--- @F  @@ Jr@< @  @@;@ 2h``!@25@@@ 1-@Ԑ @ 2@Q-%"  @ZH" ,@Z@Y@ 2@!* L@v<@Yo @Z0`@Y@ % "` @  @@a `@R < 2 !0@<@a `@@v`@    .  @q 4   . @ @i 㿐@I  6 ,  @V   L 㿘!耢   ! `?@囔     ! @ empty type listcan't allocate type array㿘 .N  n.b@U?   N  o   "a "!   @˖ , ` @ * `"a.c@+ $@ , `$@  @| , 2*@, $@㿘+ b  !耢`2 "`@I( /-( /-  < b "o  @ !a L@X~a !!100%1K-blocks%-*.*s %s Used Avail CapacityFilesystem iused ifree %%iused Mounted on %-*.*s %*ld %8ld %8ld %6s %7ld %7ld %6s %s 㿘` $  a  ,"a "` /a8! $# $!x $a@M!  $!| ! !|@L!x# $aa//!Hp@+ b "//@ِ!/@֐!/! @Ж    / &@  |!`!  + !x@ !x@ V@ S !x@ N@` !x!x @ A@ >@ :@` !x!x @ -@ *@ &@@/a@Ӕ !@tb/ / !Ȁ`"@@ !@^/@Z!/!@V L㿘 a  "a@WD@ ' $-@t# K?  @J 26@<?6`4&`0&`(&` @8̢@ &`( d<@" @  d$" &`&`,@ &`Ȑ&`&`  &`$ 0 `L@ C Z`@ ? Z-`<`@ ⤰ @ R df: %qd: %s 㿘! "@ M "@ 1 n"쀢 80bH  @"@0  usage: df [-ikln] [-t type] [file | file_system ...] 㿘0b@ 8@ %lu%%%%lu.%%0%ulu%%%%x @ d,`@ * ?@@@`" @ 1 0P!@v !0X@m @ d@}@e1 !@[ !㿘@7md5summo:ps:txsum mutually exclusive with md5md5 mutually exclusive with sum12illegal argument to -o option-p-s-t-x%sstdin㿐@;!P1`@) 1 @́`         1@s` 355!`| 5"`4/1`91",*` € T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T  T 8 T T T T T 01@v @K ! n#11@k @#@a #55!7`|1@a 155!,`@Q! 0&& 1@!@! ! n1@!H#@ 1@z!P@9 1@q!X@ @@?g?c@ * @@  /1 `@; .0  @ @r+`!  @2@ŀ  `1!h@r  @@ @ @ÈMD5 (%s) = %s p@$Д 2@!  %s flag requires `md5' or -m㿘2!@@$usage: cksum [-m | [-o 1 | 2]] [file ...] sum [file ...] md5 [-p | -t | -x | -s string] [file ...] 㿘! 82b(@82bX@42@0bp@2  ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@?c'?: @ $Ȣ  )2"ȕ4 2  * **  ,  Ȁ@ 4@ ` &2"bȔ `2 4 @ * *`*  , 4` `#bȒ< &@Ȱ : $ȁMD5 ("%s") = %s p@ː!4 0@#:Д@fMD5 time trial. Digesting %d %d-byte blocks ... done Digest = %s Time = %ld seconds Speed = %ld bytes/second (4 #@=#@# * #(*@@#J @#T# #@"@4@ 4@ 4 @" 4Р`耣 "@ @# @ MD5 test suite: aabcmessage digestabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz012345678912345678901234567890123456789012345678901234567890123456789012345678901234567890㿘4@"4M" 4J"(4G"04D"84A"H4>"h4;"stdout%s @"' X @$4ch@1 @"㈐ $@* 瀦 !4#p@"x@%lu %lu %s 㿘5 @q "55 (@j5@g 0㿘5 @^2 "55 (@W5@T 0㿘5 @K2 "55 (@D5@A 0?c?   '?@ 2 4   @m 4@  &@& ?c?     @K 4  ?# 4 @ 4  &@&  㿘@]instinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0ipdstbroadcastmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupinetAadlmu'%s' requires argumentSIOCDIFADDRSIOCAIFADDRSIOCSIFFLAGS㿘@% ' $h$ # V!5`4Q6 ,*` € T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T  T T  T T T T T T T , 8 T T T T T T T D  "cА $   "`  $`d $h  "``@ @#??#@`d*@  &  h   @   `d "    @@ "`@     "c* "5  "c*@@S 4@@ @)  @ % ?`  $@@ $`? 2R R"4! $#! $#5  @Ɣ @א  @#  2 @t @  2 "0$  `$#<,`?#%# + -5`  `@@ "  2@ 2 `p 2  "? @ 4`@M  € ?`€@`x  $`x? β`@ #(` @e  c@  n"쀢`15  ؀`5@m/# X` @F  c@ 6 5@m# #̀`   a@ 5c@ @ 㿘b0  b0@~    㿘!"p? @cc @  "c?$"p$"psocketSIOCGIFFLAGS %sSIOCGIFMETRIC %s㿘 c! # 07b8@z a@1 6V 7@l"@#? "$#0a@! 6  7"P@l "l " l#0a~@ 6  "  "  SIOCGIFCONF?c?# $ $c$ c 07b8@0 a$@ 67cX@&  @ `` ` @>  2   2@@&?cp?# $ $cN$` c  7b8@ 0a$@ 67cX@ 5?ئ ,  3 1  `   " آ@  /  #Ѐ`"_  2[@cW@ ' $` $` $`  $` $` $` $` &>  `#$ 26  ``#$ ".`d ``!#` ?"``#* $#@ @H# 2  @   @ &`d `?"` * "@א 㿘  pX`" p "X  ؀   "c(  : 2`㿘 `  㿘 `  㿘@7    ""("`X㿘  p`  ؀``6"    @  `"   "#("X "#(Note: trailers are no longer sent, but always received㿘9@왐 㿘 `  SIOCGIFFLAGS㿘% # `0a@w  9aX@  `@ T  `"c$ "c$c$ ` 2@Ya  5c@  "ćSIOCSIFMETRIC㿘!   `@ @j$   a@9 9@j"0SIOCSIFMTU㿘!   `@Ք @O$   a@ 9@j"SGIOCGIFMEDIA%s: no link type?p  x`$    `?????@  0 a6@   n"쀢`9c@.  " t  t`9 c @J SIOCSIFMEDIA㿘  x`  # # `t! c, *$`t $`t `@n  `t0$ a5@ :`@ only one `media' command may be issuedmay not issue `media' after `mediaopt' commands㿘  x  :`@IƐ % :`@I t `4`@,`$tonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'㿘W  x  :ax@I  :a@I t@  "only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'㿘%  x  :b@@I_  :bp@IY t@|  ",only one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s㿘  x  :c@I' ' :c8@I! t?c  @ `:c`@I *` $tFDDItokenTokenRingetherEthernet100baseTX-FDX10baseT-FDXCDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4Mbit10FLFL10baseFL10STPSTP10baseSTP1000FX1000baseFX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselectdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplext`  2;#X`";  @2` ` `2@;#unknown %s media subtype: %s㿘"@D? !< @@G strdup,unknown %s media option: %s㿘@  <`@ސ #< <@?2 !< @G  @5` @㿘 `"?` 2   @ 2   2?%s %s%smedia %smediaopt instance %d㿘`  !<!F@+<a<"<"Q@ܐ< 1?# %< 7 %s netmask 0x%x broadcast %s㿐  d` %     n"쀢`+x7b8@?   " `$ $ $ $ $ $ $ @ 0a!@ 6   n"쀢 1Y /W>@eg"ذ  @(  M #0 @N @@v `@1 0a@ 6   n"쀢 12 /0>@e@" !>"'@a6@R% $ " >`$!>#'@a(@D>`4@@#$" =`$!># '@a@3=@0! inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿐 ) #  '  n"쀢`+7b8@ ' $+ $ $ $ $ $ $ $ `@ #0a!@F 6 n"쀢 1 /2 >  $ " " " @d"ذย`@ڔ  !?!X'@`@̐@̔ #0a%@ 6 n"쀢`1?@d!h& $ $$1 1  P" % $ %0#a"@  n"쀢`12? $ " " " @dz!xฐ`@ `!?!'@`l@ P?@!$(#0a#@Д 6 n"쀢`1? $ " " " @dN!ฒ`@i  ` !?!'@`=@Y`?"` * "@t %s: bad value㿐 ԓ.`  `, ,  @< @ @ 0@֐   #@ @ $ @`@C %s=%o%s=%x㿘  N 2@.`@!@,`!@2t3c`?"``c <* &c@ * &c@ >usage: ifconfig [ -m ] [ -A ] interface %s%s%s%s%s%s%s%s%s%s%s%s [ af [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ]  [ metric n ] [ mtu n ]  [ arp | -arp ] [ media mtype ] [ mediaopt mopts ] [ -mediaopt mopts ] [ instance minst ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig -a [ -A ] [ -m ] [ -d ] [ -u ] [ af ] ifconfig -l [ -d ] [ -u ] xAAA!A#A%A'A)AО!a0p!AAAAA`H `#\#`#d;h;p#x@Q 8@S 㿘@ޔ%s㿘@  2" AAb@o "㿘@  A@ & AAb@Z  &㿘 @I @G2   )"@'  J-`?`   `D * * (JЇ8 `2 "@ 㿐  ǒ 2  @ $$ %d㿘 @  BAAb@  p@H  & &㿘 2  `?J@    "   |&=<>+-*/%:()㿘 `    6"`"`L`*L   =B!H@ " #" L  `<"  `>`!  0  0  "`  "`  "`&   "`"syntax error㿘Bb`@Aq 㿘!  耢    @ 耢` h)  耢` M-A+AOM`@S "  @Z!@A1  @. Ȁ ؀  *@ "   b А@Iܐ 耢` non-numeric argumentdivision by zero㿘% /3ސ Cِ  C`H@@ܐ 2` @B`& ` C``@@ΐ @ & @ & }耤 Ҁ Ѐ 㿘%   C  C`H@@  ` `" & P耤 ဤ 㿐'  D B? = C",  € P P 0   P P P P P P P P @   P P@4g  0d@6a  0^@&[  0X@$U  0RD F @GE BC#,  € l l <   l l l l l l l l T   l l @G 4%  0" @G: 2  @G2  @G $  0 @G| `? @Gv@ @ڡ e c a _ ] [㿘O# `耢`G   ~W x`耢 㿘# `耢`ѐ _[`耢 %d %s 㿘@`Ab@ɐ  "  `耢 "@ 2DD`!`!@@N㿘@;rshunknown user idmalloc8KLdel:nwrlogin/usr/bin/rlogincan't exec %sshelltcpshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrforkX@ٻ P  D'b'@      '   `J@ -' @B@-ʹ Db@?  @ 2&Db@ ,`S'D`?NE p*` €                                             p        x              n# @@@ߕ⸀??!#@` $#@*@$#@'@#@* @ `2D"&@!D"В@>2Db@ @ @ @ ,8 'L `@"@WDD"@Zb 2 Dc@>[ 3 `@ǔ@Y`@&  `Dc @>E #?c @Ԙ  6`D@^#8`c @Ș  D@^#P@A n  !'''' , `2` *  `+@  "  ,   @:Fآ!  "  , @  '@3   ?@D Dch@ ! `"~@"~@@4@ @ 㻘  `8 `?# n$b@$  b쀢 #?  @n 谦 readpollwrite㻈 R耦P  `@l  <4 '# n%F)F'F`$b @L$ 32 b쀢 - `!@  @*??2  b쀢 @~  `8 `@w @ 6 &@b쀢 #̀`@h ƴ@A @-  @؂   97''7 # n%F@?? Wb쀢  @E   a ?W?7W  U ? ?7 ܐ㿐 `/@͔ 㿘@`   @֐ `@`@ Db@  .@` @@⾐``, `@ ,usage: %s [-nd%s]%s[-l login]%s [login@]host %s [command]㿐P GGGG `!#\@ד 8@ 㿘@㿘! @!t"!t@ @ !``$  *` * @ ! $!d ah!  @ * $!|unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 / @(   Ga@  0`` @ ~#D@ ` `` @ ~@ ` L@ #"ِ ֐@ A &-?*  @$GL@"@4  X+@ -  @$   @ ~#D@ `" L@` @ ~@ L@ ,29$` @ ~#D@ ` ` @ ~@ @  @s$   @ ~#D@ `"L@` @ ~@  $$L@  @Gb(@   @,Maa  aL@*`:  ` L  `2 GL@b@@   GL@bX @ ` ;H#d*` € $ %L # $ $ , ' (D '< &L ( )Ȣ`" @ ~#D@ `" ` @ ~@ 2  `` *` $`"$ @ ~#D@ `" $` @ ~@ $L@    $Gb@ "`"L@ @ ~#D@ `" L@` @ ~@ L@ ;G GLb@t `"L@ @ ~#D@ `" L@` @ ~@ L@ \GLb@T `"L@ @ ~#D@ `" L@` @ ~@ L@ GLb@6 @z$ !G`'  @ ~#D@ `" L@` @ ~@ L@ #HGc0@ #H@~\$ ?Q$& @r!?J$ nb!G@ #X@ ?`"L@ @ ~#D@ `" L@` @ ~@ L@ 2GGc0 c``"L@ @ ~#D@ `" L@` @ ~@ L@ G$ cp@$$ `G @ ~8x#D@ ` x` @ ~(@ x@$ @߱ Gc@ @|֐`L@  \Gc@ @6 @H$ 2Gc@t @@ "L@ @ ~#D@ `" L@` @ ~@ L@ ; `@Ғ "L@ @ ~#D@ `" L@` @ ~@ L@ ; `zGc@- t\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D *` > `e'D`\` J bpD] DJb@ D J P> !JJ [ @KD AD @ߒ"<D \2 J@J [2J@.@$ \2 J@J`2J@`!'D \2 J@J` n2 J@ .@D``'D \ @J` \2 J@.@`'D`J@".@ @`.@'D`DJ    *@J`^ *@ `]*@ `"CJ (8]<*@J[( J . : =!( `*@J` ]*@ "J& `(8]*@ 2J (8\2Jn*@J`ÆJ]2 "` RE error: %s㷐&  @E &@@ڐ  &@@삔  !K@@"0@ @ `h *"h123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘*   k ,@`$@ @ b&` !l`&`&`@ N@ <7K5K/K*:  \$= N@q耢 "N,@N``   @`&&` & \2,@ ` 2 @ ,@N``$@$h1 ,@9!@( 2NKcH@w  more than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐 ?'D&@&` &`&` #L!%GD ? ~8J#D  `  'D ? ~ J g"  p 9 ; 1 j hLhJ wLbJ @aH ^&@ [&` @ aHD D@# &@O 'D  ? ~8J#D  `  'D ? ~ J J  *'DJ`*Lax@ѐ @ a\&`& @3!? &`  n@bX@  Da@ D i'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \M`X@t g #?M+`c?\ 2M ` ~8#D@ `   ~(@ c@c@@`M`@@  @  +@  (+@Oc   +@J &@㷐`@Ԑ8   ~ #D `   ~  * :  \2+ +   J#`\+$(, @@( Ƙ@ @unterminated regular expressionexpected context address㿐N 9 \ 0  $ /McM ` 2&@Mc@ &@ &@ &@@ &`c@  whitespace after %s㿘L@  #DN     N ``.N`@y & @+@sundefined label '%s'㿘J ?* : `8@N!*` € : :4 : : : : : : : : : : : : : : : : : :4 : : : : : : : a` "a` & @O & N aX@( @{  2 duplicate label '%s'㿘    `,` ` *`!@ @'N 2  @ 2  @ 2 @ $$ $ $ $㿘 ` ,`  `,`  `a* @ "   2  @ 2 $ 2  unused label '%s'㿘 ! , "'O  8 @ @`2 ,ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@H # X%O`/NO!t*` € > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > >4 > > > >D >d > > > > > > > >  "a\ n# $a@ʐ  n# @Ð    "axO 8@?`@A @OȀ??#@a*` @  @`@ `@  @`@ 0@ @" t@ @#   nb!O@!0@ߐ @ r%s: %s"%s" ..."㿘)#耢 U!   v  # $' $` `"!l! @#`% O@c  "c$ n !Ob@#@ $  %#$X ` O@K  % O# #  `,  `* `* `* `**$ ` $X"#%##@  al  "alN #2W N  nS  "!xO  `$#@ "`$%#*l B ll  #J`# J  n   "ax    #J   @  $#`"f@@# $*al #al**#al` ###al`* ؖ stdin㿐%  >' @ (`$(( ;  ! Pc"$!X$ O c@$!X  $ !X n!Ob@#@  `? "`@ @  "@ @s / p   & c  "ap_  [%p@v ` @ n"! O!X# @ @ @ !l`P"#!l# 3O1O' n@F `(` $`(`! $!X%  $!X@Tc  % !X@ @|# `? "`@Y @  "@ @s  㿘@ " " ""@"㿘@  " " ""%s㿘@(   nb!Q@Q!@> 㿘  @   nb!Q@:!@' 㿘# ` Q@qQ@㈖ ʠ @$``sed: %lu: %s: 㿘#'L`8Q'P'T'XbL@ 4 `8    !lQ!X@ b`8@Q@c @ %s %s: %s %lu 㿀-  %l'  $`/ ) t@  " ?Ƒ* : `CR H*` € O0 O0 O0 O O0 O0 O0 O0 O0 O0 J O0 O0 J J O0 O0 O0 O0 O0 K O0 L O0 O0 O0 O0 O0 O0 O0 O0 O0 O0 O0 O0 O0 O0 O0 O0 I` IX I J O0 O0 Jh J K O0 O0 K O0 K$ O0 K L| L M@ M\ O0 O0 M| N< N O0 IX O0 O0w#  `aD@  ! **@ !d"`%*`aD$!d*` !d* $ $  " " Q !H`PQ K# M"`` H `@X k `?$ " @.$`5t  ! !` !Qc @ !`` !@ ` !@ Q #@!x  ` `@6 @ْ  2$ @  @ϒ 2!x     @ @ ` 2`@  ` 2` @ٔ `?$$``@  2$`!x  ` `@ @@ #  `aD@  ! **@ !d"`M*`aD$!d*` !d*  $ $ @֔ aD$ `~$aD@ L@w"L aL "sp"aL `2k? & @Ɣ!? $ n !Qb@_#K @K   K n !Qb@L#8 @# a aQc @ `'`'` '`''a $a $ "` "`"`$ "` $ $ $ ` 2`L @, Ql#@3!x  ` `@/ @ђ  2$ \%d not defined in the RE㿀 / ` !P  `  `"lSc   @ + ܰ a0"   @  ]?0J )   @y :` !|!|@!|   !|a0`@n   @ߒ!|@`` `   a0a0 @S !| ` $¤.a0( # a|`  $   @, ?2a|# a|a0 $  @)   @a|  $  @a0' a0%a0 % %a0 " $   ' $  $ " $ " "  '''` @V  `"4   20 ` ?2  & @k! ?"   n !Qb@#   @     n  !Qb@#ِ  rstdout: %s?c- D 4)3 1T /?ad   D#   @#D@z# D@ @# @ @IDդ # `@ n"T cȐ @  "!L%DCOLUMNS\ \ \abfnrtv%03o㿐'h?2NU@! @$h`h @r  < 2$h <$hN  k#U!8+U)Uh*@a  *: #D ` \c`?"`` c* $c@|  7 cU?a( \"& c* $c@{ \N@ c"@?M " `  c* $c @{ڒ  @!H  hc`?"``c $* $c@{ $c`?"`c * $c@{ c `@ n"T cȐ @ first RE may not be emptyRE error: %s㿘,   q :` & \ ?#D ` *: ?? #' : \2  N \ &2   @   5&  &  &,  5& |* ? "+`?2`` ?""`` "@  "?@*  &  & | &@ @7  & ,  ` @   &  &  &,㿘   @ $  & && "&  @ & * %s: %s㿘?'V% n?N  w"!  { s" /"* + ?" @   @` Ւ  " ?"& @ "&  @ ’ & 2N 㿘 1 &!H  "a  `"a 2 ")@  ` !!` @s  2 G    !l` "  [ !p`"W  *  &!H$ 1   !! `@M  2 #    !l "  5 !p`"1  @2   !l` * &!H $      !! `@     !l@  `?!p 2 `?㿘  ! !P  V`P  $!P J?` "? |   !P:: !h`  |@K  !P     !V̠ p 㿘@&HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %s%sfts_read㿐@Ɛ Wc@=       h%W`9cX x*` € a a a a a a a a a a` a a a al a a a ax a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a #         c@+ ?J`-J c@J ? #c@@@~c@&*  @@ ` Wc@+{ 2 ``? `"P#@ ?А  ' n$@1   "$쀢 Wc@a J` Wc@+J   @ r  Wc@+> ' n`@$! Q @@@ ?` 6X#*` € c d` d` c d` d d( d` d` d( d` dT dT2" @&9   #X @Т`@8  !X @Š @- `   <@ŀ X @K=  @$ǐ 2 6쀢 X`@ @usage: chmod [-R [-H | -L | -P]] [-h] mode file ... 㿘Y`@Ś 8@ 㿘@ / %s 㿘@8!Y!`@ @b@ˑ!`?#@& *`? @ @R@'Y%YN  (ph@@c @ /" ,` "? N 2 ?N /"? .@ /"`? :N`@  @2@/6 Y"@@1 ".Y!x@ƒ@, usage: basename string [suffix] 㿘Yc@ 8@ 㿘@:/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s |  ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !! @Y"@ϒcY#Ȁ` #Y3Yc"@  c"Y@lː# ?G"쀦   Y c@ī :""` "`@ "  2` 2   Z`@ď` ?"쀢 ZJ ZZ @) (  @) 8   @uǐ#   ""("aЁinternal error: unknown type %d.㿘!  " % (5  h``"$""` "" 2  Z!@0Z J`0 `0Z@)W ( Z@)Q 8 "$($"type㿘Y#bp"`B 㿘Y#bp"`8 㿘Y#xbp"`. We only support %s mode, sorry. 㿘 Z c@ ?"We only support %s format, sorry. 㿘 Z c@۔ ?"We only support %s structure, sorry. 㿘 [ `H@Ĕ ?"local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘'D'H  ` &`'D    D[D@DH D  D[D@DH D  H H[`@y ?O"``@FG` H ?D"a@"""J`a  #`[ [ [!    |` @H"`    `"@H"`  @ @*H @@Zlocal-filesusage: %s local-files Continue withmput%s: not found`'H 'D[D@DtH H H[c@ ?i"H   ^#`#!Ԓah@ ' @!h c ' %+[~)[ y$Ԁ vH@Ej p !䀢`1J  DJ  @ `"J  *` / (D  `*:  +  *` +  |` @Y   ` @  #`[ [   ! `   @)ڒ# aԀ H !`1 !  &! c0@D#@ aԐ $a&! H @D8 2LD ; 9  7 5[/[-   `JH Ԁ DH@D D`| H@ @H @  H    @)| 1 !Ԁ D !`zD# a  [[$a #0@Dc@ !Ԑ &!i$a   ?????'@Ȓ( @  HȀ  H[@B#HK`H+[)[@`A Ԁ :H@Dl 5`| "@@ @ @5  @@    @) # aԀ 2` !`1 !  &! c0@D<#@ aԐ $a&! `2@@ DI@  "ԁr+w㿘]`@( w㿘 ## ]!`]!@ usage: %s remote-file [ local-file ] local: %sRETR㻘'D'H  ` &`'D    D[D@BH D  D[D@BH D H H]a@3  ?"``@D` H ?"a A` !䀢`< `J  #D ` J   `" " ` *` /#D`(  `*:  +  *` +H"     |`H@ `H"    `H@ 9`H"#H@  0H]@F<"(3 >cHH @D H H]`"` 3 @ @+ɚ  >c@㿘@H  b?`" * " @sA ) !Ԁ  !` ! #   ! [`x$! #0@B$`x $!  $`x!h@u $`x %!Ԑ!h@o remote-filesusage: %s remote-files mget㻐'H 'D^@D@AH H H^bP@8 ?"H   ^#`#!Ԓah@Q ' @%!h# '[i%^ 2ad$aԀ aH@B \  !䀢`N #D`(  `*  +K@`*  |` @    `]@ O ]]"a@  ! `    @+ ! !Ԁ   !`1 !  &! 0@BTh "&! !Ԑ $!&!  # @AH 2N@א  "ԁonoff __Connected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %d. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. Command line editing: %s. Macros: %s 㿘! #`+ _b!(_!@Z# b @  _b@f!P #` @0` #`_ "b@Ӓa`0_b@f!@0P  _aآ!b aJ  _!c@ b!_b!Д@_    ba㈘#@a b!_" ` a  `@ b!_ߠ"P c@{ b!_!Р"x@q b!_Ơ" a(@b  |  _  bb@VT _b@fb"  `  _ bb@D _b@fP# b!_`p#  c) Ę@+ b!_`P#X@! b!_v#p@!_b@f"#!   #%_b@!  ` "!usage: %s [ on | off ] %s %s. 㿘  `? & _`@%`   &  _`@a   &`@@͒c?  "!`#Ж@Bell mode㿘 a #!Editing mode㿘 aܖ @F$#!Packet tracing㿘 a@ #!usage: %s [ on | off | bytecount ] mark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). 㿐  1  p`?5& p a@$a_`@` _1 # `@a 2`1 & p@: J`   a`a@2 ?$"1  "c& p3 b!a p!Д@  pa #b@aba@e%" p` "! "!Verbose mode㿘 ax #!Use of PORT cmds㿘 aP #!Progress bar㿘! b!!  "a " pInteractive mode㿘 b ՖX #!usage: %s [ on | off | gateserver [ port ] ] %s: bad gateport value. Disabling gate-ftp mode - no gate-ftp server defined. 㿐  b@<`  1 !3  `?E&! _`@ǒ`  1  &!73  _`@a  1 &!*3 ! `@d ?c J`   b``@Y ?6"3#! !`@ 3 1  &a&!, !؀ a  J    b@8`&! "_!aaJ` _!#@$! "!Globbing㿘 b#( #!Preserve modification times㿘 bh #!usage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿐  b@'c-1 _`@` _1  && h`@ a 2`1 & h@ J` 1  b`c@ ?$"& h h`?& h h  b b ?"b "!c h  h@ h  4  "aremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'H  'DcD@<̒H  D   Hca@S ?$"Hc@ p! !쀢a "` c@cJ!Hc@ Y!  "`tusage: %s local-directory Local directory now %s getcwd: %s㻘  "  &`   c@@ b ?1"`@=ؐ`  ?("a@Nx`  ]`@@s" ?"@H$   cc@ c`@@^#0 "!`@usage: %s remote-file DELE %s㿘'H  'D[D@<.H  D   Hd`P@ ?"Hd@Ґ hmdelete㿐'H 'D^@D@< H H H^bP@ ?H"H   ^#`#!Ԓah@ ' @!h- +d)  %[&#d ! !%!Ԁ H@= @`h!ԀH!  1 ! 0&! @<` !Ԑ $!&! H @<( 2N@t  "ԁfrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'H  'DdD@;H  D  dD@;H D  H Hdb@ ? "d@1" Hd@*"-usage: %s remote-directory local-file dirLISTNLSToutput to local-file:㿘   &`  !d#&`    d@@Ւc ?J"d@@͒cȀ !dd#d#`#@ " `@<` 2` ?."a#@ ]`J`|"`@<~` d`@<5# ] ? "a``መ @$Ś `@@Իusage: %s remote-files local-file mls㿀'H  'D^@D@:ݒH  D d[D@:ђH  D Hea@[ ?"dH*  ?c'"?'@L HJ`|e@< d@;ϐ# H ?_"ae@1aH'@   "^# ah@M ' @!!h aԀ ;  w%[D?@4` a//耠d#d#H,`@  @$1 ! !Ԁ   !`" 1 !  H&! @;0 !Ԑ $!&!  !Ԁ`ˢ`@  䀢@"!@  SHELL/bin/shsh-c%sTry again later㻐 @  @ @$ \ @ղ   @ڒ  @ג f@ H f P@Yl / " - /@:#f`X@/  +/  h`! "@`"?`" * " @k@  f  `@r f@l f h@= ?"@e @@ @} ? f@=ϐ p "a"!usernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: EOF received; login aborted. ACCT %sLogin failed. H'D'H  fD@9~HD?   Hfb@ ?_"Hf@$" A D  Hf@ "DH`"'DHf@"؀ - D #H3 fb@_"@b@y O  fb@Вb ?("@?.DH`" 'DHf @#   f@_Ȑ#0   D 2 ?Hf @ϐ# ?"cPWDPWD command not recognized, trying XPWD. XPWD㿘! " g$"@! 2$" !쀢a2 $" g@_!g@!H$"Local directory %s getcwd㻘@E2$   ga@c g@<ސ! "!directory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'H  'Dg8D@8H  D   HgbH@' ?"Hg@D"h  !쀢a "` g@_!"pHg@0"RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'H  'Dg8D@8ZH  D   HgbH@ ?"Hg@#  !쀢a "` g@^ې#Hg@#command line to sendusage: %s line-to-send 㿘'H 'DhD@8H Z Hh`@ ?"ZD#@.Harguments to SITE commandSITE 㿘'H 'DhHD@7H h Hh`@x ?"hD!h@H㻘@#` /@Y#"@@@Q  $#, ,@ @@$@A? f h/@g @ modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'H  'DhȐD@7H  D  hАD@7yH D  H Hhb@ ?"h#@SITE UMASKSITE UMASK %s㿘! "  $"h#h#@`$"SITE IDLESITE IDLE %s㿘! "  $"i 8i H@`$"HELPHELP %s㿘! "  $"i i @`$"㿘! #  @ @'% #` @ @ QUIT㿘# c i@!@!  " @ #?"<$ $c "!@?usage: %s [password] Account:㿘   i@@fa ? "2i`@ w!ؒf@~#㿘@=  c  @&А  #`  "b ""@&Đ  !0@R commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'H 'DiD@6H H Hib@  ?s"H@.)`? ' i@]" d" 2 K  i@]"0     i@\#& @!0  ?G"aibH@ @&X K `  #`  _@\א!P@&G @  ?("# ic @  `@"@ҊDH? `    "b ""@& @ Case mapping㿘 jP #!Carriage Return stripping㿘 j( #!Ntrans off. 㿘    "! j!@\s$ | | "!| ! !"!"|`@  ,   * T!  T`@ , 㿘 T @  b`4N`O@`N,    .`8 TaH2   .H2 . `ܶ .bNmap off. mapoutusage: %s [mapin mapout] 㿘'H  'D "! j#@[$   B"!쀢  DjD@5DH D    Hjc@ ?)" 1  "a "@S  `  L " & @E ,  "@J# L "  !В@@#nmap: unbalanced brackets.  "    " ?XN S @ *`:  J $ \,*``*K@: )@K` 0"*``HK`@K@?ϕ(@ ` @ $ H  K`*`: "# H # `H:  2 H 2K@ 2`H  H (! Ja%  ,a#kK@ [ @ \ $(2(K` ` @(` @ $0 cD ` `") `K@ 0?N  (J`l ( g@  "a  (  X  *`:  N ,L!*`:  ]E \ $`8 @0 `#D ) `K@ 0 @N & (J` @?ϗ(@ +  +  (   @+ (` @+ :   ,*`  ` @* :  ] \2`K` 2`` @  >` @Zxa(0BK@ ,X ]"3`TcD ` `"((`K@ 0?N   (J``( И@  " ` (  ``K@  (L Passive mode㿘  "bl#   #!Store unique㿘 lx #!Receive unique㿘 l #!CDUPCDUP command not recognized, trying XCUP. XCUP㿘l@# !쀢a "` m@Y֐ m@ 0  "`tusage: %s [restart_point] restart: Invalid offset `%s' No restart point defined. Restarting at %qd for next get, put or append 㿐   m@@` ?+" `@c  J`"   m"`@r` :#  @  "m@Yv!0m"a @^SYST㿘m@|"0Limit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘% 'H  'D m@Y"P ?"쀦  DmD@2lH D    Hmb@ ?"! `# mb@X"' *`H 㸑* @| * * *`  ! "@  m@Xܐ" |" "  " %p"*` *   `" 㸑*`  *  a @ *!  #`? $`@^#  $#?Ƒ. :  .@* * @ @ –N Ò.@`@2`## ) %m?&#`? &`@0#  $# ?#`?  "`@  b`#  ` $#b@X`%!filenameusage: %s filename %s %qd 㿘'H  'DnxD@1H  D   Hnb@' ?"H @3%?    Hnb@ "!%s %s㿐'H  'DnxD@1jH  D   Hnb@ ?"H @3M'H "!n`#x@L@P@֔ "!STAT %sSTAT㿘 o `o h@`Local file "%s" is newer than remote file "%s". 㿘]ሒL?  o``@`PAGERmore|%s㿘'H  'DnxD@0H  D   Hnb@ ?F"H @2R  o ?;"a@͐! oL@ o!(@_ @9Oo@0' ! # H`] p]b    "`$b<$ p@z@yH = $ p<$b@nusage: %s size invalid socket buffer size: %s 㿘  o@@~Ð" ?"@8`?  `o@~"  "쀦 ""   "bp ""p㿘  o@@~" ?"@7`?  `o@~"  "쀦 ""  "b, "",?verboseuserumasktypetracetenexsystemsuniquestructstatussndbufsizesitesendportsendruniquerstatusrmdirrhelprestartresetrrrenameregetrecvrcvbufquotequitpwdputcproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendLmputmoremodtimemodemlsmkdirmgetmdirRmdeletemacdeflslpwdlessllcdimageidleChelphashglobgategetftpformexiteditdisconnectrldirdeletedebugcrclosenrchmodcduprcdcasebyebinarybellasciilrappendaccount$!㿘@@㻘@  e ` @@7$ #@@5?2P 0N5  @@  . LJ@   @** *@&@@7h$ #@@?   "`" * " @`| p @h @5  㿘@Z@a< a<@@8  @ 2 @ZА  m   q@?`?" @ZӒ ...%s/%s @N2 /  .// ///$@,@O ~'@0$ @@$@u/@% _ @Ze@.@Ԑ $-q+q @+Ѐ @&a؀   @~ @7"@ZV@ 2 @ &q$@@; q <  @ @// // @??" @Z< complete %s 㻀r 0'?'@M / 2L .// / @$@L@ /@$@ @R,@)  t  '  b@ ;' ∀ @Y @Y!  $$!'䀢 L@  $!@MS / `@6 @Y∐ @.T䢒 !䀢  r`@@r 8  "@]% t@Y  `! . @@S @P@K@ @Y ` . '@Y   Must be logged in to complete. 㿘@CҐ@`" $! # @,@' `% "  ! # "a$#X@%k$c\쀢d#X c\ ! # + #  @_b 2!   ! # # b@* @b쀢 * w # @@%?s "r @  @     ?D@ ` 2% @ 8\  @ ?*`:``/Rs ē*` € ̈́ ͘ ̈́ ͘b  # r@S" b b  macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'H 'D  sD@,H  #  Hsb# a 7 H@ a a-  Hsb(@ ?"0@\^ ,7 㸖 *`   @ ׀; ) 9 @D@ `2` V +,* :  $ \2C.`@?.`cD `$ `@ `D+ `@,  * : ` ?А!H,  @\H  *:  i2.D  `H@[H@ N@ @`@ @#.c @@#? s"@R"@V'!2L s" "X  #`  s""p@R?A'! "1 `# "@R " `?"`@* "@@]% c  #` L  " `?"``@* "@@]  @[0@#c #'D'H * @2`@22D㸁auth_url: challenge `%s' BasicUnsupported WWW Authentication challenge - `%s'realm="Username for `%s': Password: %s:%s%s 㻐&@@4 `h  ?' tc@tc8@Jtc@@y;  t@t cx'@y-   t " @[' t#H@wk"@3 @W,@P#/! "tc@@"@kĒ# J@?,t@#@@@3st@@s@ @m* @  @3V t@&@@Y@@@R@˒  `@ă`@~@y )  @(8  *H@ (00 `*K @(0<  * @? `* ߔ *  =  *㿘 CN?;`%2/. `*#D@D"%.  `@D ɄЇ(D2ЀɄ. .  2.parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid port `%s' in %s `%s'parse_url: user `%s' pass `%s' host %s:%d path `%s' 㿈\ ``  `?v`@  &$'@'&v`4@wҔ  v& # <4`@wŔ   v & c .4`Ȑ@w  v &#  В@u "@{& "@@t'@ "@m'@ ?@f{$N "w @ / '@21$@2  @,@  '@2$@ @ "'@ 2& "!& @2,'@@ :  @2,'@@H :  ,@l ?c J`" 4v @u6  h`v "av!8@v!8 2v!8 #\v!8#\@ URLlocalhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'Invalid URL (no file after directory) `%s'got savefile as `%s' copiedrCannot open file `%s'Copying %s retrieved ,proxy URL/Malformed proxy URL `%s'Invalid IP address `%s'%s: %s`%s': not an Internet address?Unknown port for URL `%s'Can't create socketConnect to address `%s'Trying %s... Can't connect to `%s'r+Requesting %s (via %s) GET %s HTTP/1.0 Pragma: no-cache Requesting %s GET %s HTTP/1.1 Host: %s:%d Accept: */* User-Agent: %s-%s/ftp Connection: close Cache-Control: no-cache (with authorization) Authorization: %s  (with proxy authorization) Proxy-Authorization: %s Writing HTTP requestReceiving HTTP replyreceived `%s' Content-Length: parsed length as: %qd Last-Modified: %a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %Yparsed date as: %sLocation: parsed location as: %s Transfer-Encoding: chunkedUnsupported transfer encoding - `%s'using chunked encoding Proxy-Authenticate: parsed proxy-auth as: %s WWW-Authenticate: parsed www-auth as: %s No redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s %s No authentication challenge provided by serverAuthorization failed. Retry (y/n)? Error retrieving file - `%s'Unknown error retrieving file-wCan't run `%s'Can't open `%s'Unexpected EOF reading chunksizeUnexpected data following chunksizegot chunksize of %qd Writing `%s'Unexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s'h& ?'#\#`w'P'L`' '' '(','040,*( ?''''''''Ԧ '' '4  ( J  w @t`Ѐ w  "4J 4 + w "`w!@/ x' b  @FB /  @/'耠4H   4 w@Gm'!0h h` w@Wa`4! ???+w5 n쀤 94( `.l'l@%&@)x&@     "@%'l@@  @lĔ '܀` @)"`0 (@)b0ܒ@-ɔ ?w@ܒb' "` wb@w b@ ᘀ 6w1b "` wc@ϔw c @w(c8&@w@cHh@9?wcX@hw@cp  wc@P  "` w@cwPc@L x "` w@cwLc@x@`@}?xx@( 08 @i& \' @ J?    '*    h` x@R`X@~ Q @hB J@  @#D `Ay@-D쀠'@e' ) +x-x `8@hݘ ' # @ J?   '*`@  # `h x`X@x`h@r^  "x@g : =!! !y  yJ``h x@``@r7  8x8x`@Ĕ ?x`Ȑ@  ?x`@ ?'XJ@` @&8'  h`?~@@@ua@q x @,`h`e'xLa(a@@q  xxaX@qÐ o`h L'x@uaGa@q̔  xԀ@@,n`h`2'xaa@q  (Ԁ@@,V`h`'xa@B쀠/@l'쀤/ ,؀D 1:؀xH  x@on"0# `"#x@od"801 "` x@bXLP%'"` x@bp@' x@bԀxH x@o2"00P,L @ x @ɒb8@c  O8`(*  R `y   LPؒ@'@@ @ @$@x"x@n#0'x'@c( #)'H |x @ 'xc0@ 'x#8@&0yf#@qc0 'x@&#H0k!' @\! 䀢 @z  X@s 0Sa@o    '  ::c@%z?@+$$')xr+x% M7 1 #  @ C>#@xK  #  p`5 !Ā`1#)@# #`?"``@* "@@SĐ # # :`@ D 2`@@&@d$@x  ' $@b ,@͒  x$  $@b @e @    h` b>`@c`2r  p`C !Ā`@ #`#2:   (6  # c :c `@  "`"@  #* "@S5 # "`" * " @S%  @x@%ؐ#0`@$ @Q@x #@q #aȀ" ? 8@i 'Da'@@?' "!y @<ܐ@@@$ #`#2''  (#'@&r 'x@% @0x!`x@%#0@m^#0x@mZ#X0 x@mV#0y( (@mP@)􀠠@| ܀?@"耠0@ 0 ",@'0, "(@',( " @'( @' Ѐ@ " @' @' 쀠@ԐԀ@ΐ؀@Ȑ܀@ HTTP fetch aborted. 㿘@'  @G!p !@ސ Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'fetch_ftp: user `%s' pass `%s' host %s:%d path `%s' dir `%s' file `%s' *?[]{}%dCan't connect or login to host `%s'fetch_ftp: unknown transfer type %d dir `%s', nextpart `%s' cd%s/%sgetmgetPv`''''7Ɛ@nr    Y Ɣ#\#`w`ȐԖИnȀ?Ѐ`J@ ̀ "J  Ȁ "J !@l@ڐ  5@? ; /@naЀ  a@n a@n  2@l!dȐ"@l^,@('Ԕ'@zF :  @(,'Ȁ KK F`L@ @?c / Ԁ  w ! , Ԁ 3 `hv3 `h * "b8Ȁv!8̀ v!8v!8#\v!8#\`#`v!8#`#dv!8#d@S   ` Ԁ - ` L@ b@`%@  - L  b@` 2 -   蕒 P '''䀢  @ '' ! Ѐ  $  @  $  @@̀  @kS"   b ܒ  ` ͒ `@ `:`9#/ )v% -Ԁ  @yh / , Ð`h`h  `!8 !8@L@   '''$tJtQȢ Ԁ"J?L `D? @+$#'`''耦 # ! ! #'$!  ;$! b   @>D /  $b$b b'"`' ߒ   @ d " Ȁ "@' "@'Ѐ "@~'̀ @w'́about:ftp%s %s This version of ftp has been enhanced by Luke Mewburn .Execute `man ftp' for more detailsnetbsdNetBSD is a freely available and redistributable UNIX-like operating system.For more information, see http://www.netbsd.org/index.html`%s' is an interesting topic. 㿘b@lG  ,v b@l$   b@֖B c(@l   b0@Ɩ2 c@+ `@l   v`Ȑ@l      Ֆ #`v`@k    Ė w㿐 'D'H"8'@ۊ   #`  F b@ b@  ' %  !xD ,  :H*@w # $H*` n$3 b`  @{T#( bJ`|2&b    ' #`? 榒 %s: %ssocketconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt㿈) !%!$$$ @]   % ,@E 2 `  nb!@ߠ"@iA ?",`% @=` @@wy , ! - % @d 6 6 @!J" ?"a+ ?9577/1 n"쀤 2`,` `'`@+'&"@!*"``$`@`  "`@'@@` @dM  @!r%a@! l%a@%S  Ơ  cp'@dm 6'@ #?   @d/  @ #c0@}K! $ lc8@}E l# `$` 2 @h#@ l"` @GcP@  l "`@}`  @} ?"a '?c!@c    h` @ #h@ 㿘@#  b?`" * " @M̐ @aD "@ #8@ ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘  h!'H'L'P'T'X`5$!@3 b@Bݐ#H#Ȓ@'  b@BА#b#@  bb@BÐ#b@b?`" * " @Mc 3 `  @g# ?"a& c<@ `@{H`@B @`  "@y{`(@%`?!@`ƀ @ %c%c%c421 Service not available, remote server has closed connection. %s:㻘 b'D @uc</     9 7  % ޤ F? l`? "`@| @  "@ ˀ   l# l#`? "`@|ߐ @  "@a  `? "`@|̐ @  "@a  @@ lD`@ "` @Ab!%  = "4 4 530 "`+ "`#  b2 ` "b@bHb`? "`` , :  @* "@@Lm#D `  a*` * ?А#a쀤쀢 "   #D `2    )"-@-@`-@  - 2% "  l-  l`? "`@| @  "@   "  # ? 5` "``# b`?"`@* "@@K@1b`% d! $"x@tƔ, 쀢#! 1- "  @;쀢@!@` c<@`" ?П@  ?`@   % 㿐''   @0 send aborted waiting for remote to finish abort. 㿘@!E   "#!@@@  "@ sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %qdr+w%s %snetout   Ē ;`' x   ??  $;a'D'H'L?8'|` LM@ - `@xL  `@o #`DH@ L0A  a"(    c8'h"'x'p'l@S't * `    `1!< p@8?&!<p`@^ l @X t`o@"F l `4@M 'paD@"< 'tH@w` H #'["aM | @3  'lc0@r  ' @~p@# l f c"!;'xH@gc0 'H@h p @ t@!  ?"U`'x@& <   H@ǒ`p@ t@!ݐ @zK ?"a :@ p@ڐ t@!ː l @ѐ x ?m"a @֡" 6p1 ## @DD@v`؀   D@v` 8L "(?  @>%    #U  @t   H@ 1xc    x "2. 'hL`D!s n p@k t@!\ l @b x` @@jh '|@i? @P  (`'l`` n"" 7 # Q% >` B>|U @  &@`  p`: !Ā` 4! b #`?"``@* "@@I #  ;  B?   b @bU`@$ 4  p`J` !Ā`  ! @` #`#9`  5` # c :c `@  "`"@  #* "@II # "`" * " @I9 `H@  n"w# [|  p! `7 05  4   ,| #`?"``@* "@@I #@6  ;`   pB?`  !Ā`! | @B  ?`%  @||@* %@@HԐ c`B c !Ā` 2  " #`?"``@* "@@Ei #  ;  B ?##   "䀢 @" `T@mT X  p`J  !Ā`  ! @  #`#9   5  # c :c `@  "`"@  #* "@E  # "`" * " @D @ n"쀢` @# ??:@M`GH@_v#0F @ ##  :X @8 %   X ? $ @tX  $` "` X @8  6TH@g ` "\ P"!ĀX0T7   '쀤 vX5 1 3   p0`# 4#  b䀢 ,#b #`?"``@* "@@Dn #@b  ;`   pB?`  !Ā` #``B >#$`@tIT@  $@ X  X @E ?`$@XX* $@D* ?  X? $ , :  X* $@D `B >`? $`@sT@  $@?\   p`? !Ā` ! 8T c c  `䀢    "`"@  #* "@CƐ # "`" * " @C T @  n"쀢` @e# ??:X @H@X @ PHXH@ L@ D@ @sNTm 쀢` ! "c@"@8Đ  #`:# 6`    @  !`'P!Ȁ2#`L@ ?'dh@Ym dH'p@3't?` "! 0@-.d@1;H@u` \ "!G"a` "!\ D"a@  @   T ?)"@#a< ?`"!@F $a<PX"TT" @rȐ #`# H  @ H@T L@E setsockopt (ignored)PASVPassive mode refused. %d,%d,%d,%d,%d,%dPassive mode address scan failure. Shouldn't happen! setsockopt (reuse address)bindlistenPORT %d,%d,%d,%d,%d,%dp ' 5 % {  @X $<@_"  "`? c @X  6@L## 1 !   @<?$<&!&@7Ȑ#(0 "c@#\#`@  @7#X0 1  `"&"" * * " "  ( '( `! n( # * * "쀢  <1 ! @b0<"@C   ' cpcp #  ! $b b P#`#`#` 3` #sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿈 % ܀  "`" * " @: % L '쀢`"N, dK @/# ? $ @jg'c  '$c쀢 ?0c "@0좒 쀢 ?  ?'L@  d  @/#`1 # @Ӓ c, @Ô @1 # `# c @@?  @/j#R2L c  :@b 2   c #@- > @/Q 9܀   #` c  @/C (+c  "x## €  " L   " `"@ * "@9Ґ  b@#܀ l  !#`1 ! @/ "@"# c$@I  C @ ('b@  b@ 㿘 / <   $@g ?L@ ",@  # & 4  &@%s/%sftpXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘 !Ԁ`  `! 5" "  @`$"  `) `  "` "`  ""`" j "@"H@k$@k "X@kh @% ?$$' p`$p # Z`?`@"1!"  `@ " @ d  "x&` # 5`?$$pb@MT%b@jݐb`2   @%" "&  b@?$ "@` %"@Y 2*%s %s? Interactive mode: off. Prompting off for duration of %s. 㻘# a 73 `x 23 ! "a@}^@Z"@?{$ O! `(*  R  n"  p a    "$a @%N!  &`x"a@}4 %s: not foundh  `% @  ?????'( @ 2@Ȁ  @@Jc"@0  @@$@@(SIZE %s㿐# % `h ???$#   "x@Xy 0 @. J & #D ` $??0"$`h 2$!  "@$Ր"x"?`" * " @/z $MDTM %s%*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H! # +  hb a?$bᵐ ;` "x#\#``Ė@ĚĬ  8????'''''''?'@4Ȱ?2,$b`  h "$$ba@|U$b"$b h 2$b!  "@$Z"x"?`" * " @. $b?"%a㿘@K㿐!"? @$" "R`w@? " `?㿘@O  %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5qd %c%c  %3qd.%02d %cB/s --:-- ETA - stalled -%2d: %02d:%02d ETAh?'D% @D    #" ";  !Ā`3 a a` @D 1 9 ##@ C  `  `"@" ''Вb@ ??  ``#`; ` "%  $@ "'< @# 5% !aD@#?ЅB' & d4 dh!@hږ !Հ`@Ԑ@t d` #\!"@p#@h$@ @  ;a"b (0  8   a" ;bJ@!" `(  B#\  @h@`" "@ '耢'Вb@ ??7Є  腠č# B?## `  5؁#@#X؁ ?@1   (0  8   4 # !"@ 8@*2 @: @+ 3`  ; 2`*  *` ` 3`+  +`@ B 2`* *` B 2**  cC b+ 3` J ; #\@h##`@ 7؁ aa` !"@@gޔPY@  !"@@gӔ`N@#a@ @"Đb #!@"?_ А"?ʅB' !"@@gP/@@T.  !"@p@g @!"@@gx@@D.!%$@@5 <@7 <@g@! "R@ϒD DcP@ @P 0 @ @H "?`" * " @, @"%qd byte%s %s in s%d day%s %02d:%02d (%qd.%02d %cB/s) ETA: %02d:%02d (stalled)  "``@B}  `" "@ '耢'Вb@ ??51 腠Ɖ#  B?p#` 7p#@!p ?@Β # #`x #    p J!$#\ '@fג dT@s@ux d"@`   @f@Z.@\.  x d"@p@fx d%$@@A <@C <@f  - 5`  =   4#@x d"@  cE *2 @:  cE + 3`  ; 2`*  *` @ e 3`+  +`@ B 2`* *` B 2**  cC "+ 3` J ; #\@f9`x# #sx` ox5pg `c ##@ D 4\x2U d@ @!b !@!?hp. hʅB'@@.x$@e؀  $p@e! @ <@ <$@eږ ``" "@ ''Вb@ ?? $@ex d"@@e` "R` @x㿘 @ ,`@ 4`@* a @7 " ?@ @J 6D`5 @,@ @  `?"`@* )"@@* &`@Ȑ6 1 "  ?`"@ * "@*~ "Ħ`@ 㿐 "R`h@?` "!  P"a㿈'''' @ઔ emacsftp-completeContext sensitive argument completion^I㿈% ܀ Q# c K! # GP c"@ `@$c$# @ d#c@4 cx@/ c@* !!rcᐘ" @ c @ c@ c @쀢?쀢 $ @ ܀ ! # # @$#c @ $c㿐cD ` @< `J` "J@ ? k"* m"*? unable to get default sndbuf sizeunable to get default rcvbuf sizeunable to set sndbuf size %dunable to set rcvbuf size %d㿐' ਀ "ਤ !?'#@?  c@E #'#`ଘ@?  `@Eސ  " !?`'#'#@?W  6 @ 0 " 2'  '#`@?B  @ P p    ,   1 . \ +J "* " 4 & *" *\ "* 2 * : *J  ׀ *㿘f@8 㿘]@ߺUnable to allocate %ld bytes of memory㿘@ѐ c@EF xstrdup() called with NULL argumentUnable to allocate memory for string copy㿘 cp@ @L c@E  h ''''''@v>Ȁ ?ȁ㿘@1botched keyword: %sUsage: %s [ -fnqv ] cmd [[ - ] args ] 㿘 "P@C  pP` 8@u`@L fnqvdt/dev/nullsocket㿘@uO !  ! [#`7V!l*` €L\l|  "c  "a  "`   "c $   "c @{Na??#@*@ @u&    "c! @jo    @=ٔ  "cc 6@a@DM    #`P ?@ ?`'H#*` €@@@@p #` @M@6 @ a  @ 0 @= @ route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) write to routing socket, got %d for rlen%-20.20s done x/ ) % 4@m R N`@J@ -I@ `?`*C!*` € % 4 % 4  % 4  % 4 % 4 % 4u@   ?''''   @[ `@CL  }@ `@C@   @B  - `@C3 !@@w 0aܴ` @C! 4`@!(@C`N  " @   > 4`  M 28 #`23 . & @   Ȁ`"  @ܐ #ap  L%@<@ߐ@C?@@2@@C9ap@C7    ` . 0 *@ `  *@`*@`*`defaultiso %satalk %d.%d(%d) %s㿐c 1 "c!@5! 2.!@N .  @N!,a.! 2 1  a@N 1{, 1`k"*` €444444444444 '  !   !`  @   @@N .  a@R   ",@ 1 @{'1  @N 1 )* 1@&@"!!@1  Д@`v 2 1    !!آ `D1  Д@`a 2 Ёaf %d: %s㿐 `q  *` €TTTTTTTTTTT8T  $!!`! 0?   ??   2:@` 2``2 @Q  2 1 "@N 13, 1'@1 "@N 1*"@ &@m "!!@1 "@_ 2" 1  "! p ` 1 "@_ْ 2"㿐 `!I"*` €hXHx  <   @   D   H   L    P    T @  X   a " `   `8  "`8` 2"`@3$0%s, %sold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gateway%s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐@% '$4M 0`g ( @w ? - 5 7 9 `@J@ - @ ``+!*` €\8D$4phtT  , "#$4         *  "c$4 % 7$  "``  "a &  !"(?2`@E `@ ?2`@; `@ ?2`@1 `@v ?2`@' `@l ?2`@ `@ @;@a?2`@ `@ @- ༐ R&༰?2`@ `@qG?@ B?!    @7  0@2 ? Ȁ @@O`8   @`H@=` ͐  %  Ȁ 2% @`x@=̔%@  @? 4` 2 ༀ 2    "  # n 3 2!M4 2MM "M` `"`  @ `$bM@/ bM g @G1 0b   А @?M   @?` 4    ! '@@?  @? `" `7`"0 "0  !!@FҐ@?~!0      ?* ??* ? *  ? ???"` d"`(dJ`*` ` H  *@Internal Errorbad address: %sbad value: %s㿀% 4 '  ! $#$4?$`F!!*` €(@Xdp4  c,`4  `,`  d #X4  ` ,`4  c,`! # ,@a@N5 24 ",@   0  0 ༒"༐   ,@?`#\*` €t,̀ c  c2dd2 2  *d$2 2 2 2 2 2 2 * #@@V  4`4`4`*`4``4` 44` `  @`@%   2  ` @,`@J@ ""@,@@ ]  @~| ,,@@Òu @J. . a(@ӽ @0?c 4`@0!,` c $ް ` OM @H "&@0? 2$`  ` $`'@ݐ䀢  . @? @     d @ '&` `  ,` @0a8@T  a f"a?(*(  (d *.**.%XHany*%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sp 7  7 7 * 77777+  2+` 2 2,2 21 1U#X"H`@[c 20M#@[  +#h#@[  2 !#p#  b #d x  #\#` `@[; Lb0  :  K 0  ,2  # b@[# 1 ,b1 "Hb@[ 2actual retrieval of interface tablex   ?''''   @ `@< @ܢ `@<   @ a@< @ @j *got message of size %d 㷘 #  "@D. ' %㬒@ (@<@Cuwriting to routing socketread from routing socket㿘  n!X"b @ms"L a c  g   `      +   +`"  8 8 `$/ ` 3 " `- " `  b * `" `" $`" (`" ,` * " 0" 4" 8" <" @" D" H&b" @    c܀ ?   cܐ@# c @@mc8 #   ` ?   `@lc@@Sc8    `d ?   `d@Rc@@9c8   cX ?   cX@8c@@c8   ` ?   `@c@@c8   c ?   c@c@@c8c %@ 5 @= #`2. % @  @ #@!?  ' b@`㌀@ @ݔ"L 4`  c`@;!  @   dd@ *d J@@8 M #&( d"@* d͔ ͔   ͔  ͔     ͔# d 4  d  d? * dd #ކ@  ? @@ *@#"(RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘 #`D `" @:j#0;* @:a#  "   @:U# #@ @ T0 @:G# #@P @ 0   @:7  #@֔P@r route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %d RTM_GETdestination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8ld%c %8ld%c sockaddrs: 㿘! !`#ܒ@9Ȑ    ` @7z!x0@!@7r  @!0 + L  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀ `` `,` !!j@9q # a !"$a]@9d$a`   !"O@9V " "0@9N @9K"H# P@c"X@9@b` $ 4"`  L @94 $  8 L@9, $  < L@9$ @#@-! $`@  L@9 D#@!! $`  L@9  $  , L@9 $  ( L@8 0"  $@r  0"@ & 0 $"`  L@8  㨀 " @%0?H@8ܐ" 0@{ $ c * $c@  locks: inits: 㿘@8"!##` $@X@8# @Q @  L sockaddrs: %s㿘`@@8#x#c0@9 $ c * $c@  %"t@8{ ?  @ c`?"` * $@ @c㿘`[ A>@ 8  , < ?`&  @  * & @g "  ?`&  @  * & @O 4  8   ?`&  @ >* &@* >㿘a  a@GY "    %s: inet %s; %s: atalk %d.%d; %s: link %s; %s: iso %s; %s: xns %s; af %p: %s; 㿀 ?`F*`" €<۬۔\| !"h'@鐐- "x @7)!"@!"@-  !7 " 7 7 7 77@!"U@7@ސ#㿘@@ @hL    `@"А *`: ?А *`: ? *`: ?ɀ`2     ,  €(8TLL* ͢,`ɠ * Ģ *".@UGHRD M@dmCXLS1@2route-sysctl-estimate%ssysctl of routing tableRouting tables x   ?''''   @ @Y!@>U @ ܠ a@6~   @ a@6q  @6ѐ!耤 @,  %-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐c(0#\#`#   @6 %-6.6s 㿘 L   " "@G  2   $@  L  . L  @y  @c`?"` * "@ InternetXNSISOX.25AppleTalk %s: Protocol Family %d: 㿘?`% *` €,hhh8DhhPhhhhh\ p       `  @6link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s  x M   "8 J2H `2   2   @S ]  `   @ PaȬ +) %@Sʔa `@ !>x@ΐ:  `1X-*!& z $@@S )'$@@S!Ȱ  $@@SР  x !@50!`!@5~0!@5w pR!hЀ`!h R@"` `*`R@ *@5] xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1osinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoinetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeatalkadd㿘 @e * * .`.@L p r h,`N p" *` r"*` h`,*`:  p h r .`2 ` .` L p r"*` h*``,o   `J``*`:  , . :2Ѐ\ @'6` .`  А /- .L   `C 6`  ``* ,@8`6`  ` V` `6` `2V`"   `  L  ,@L ` V` 2 &6` J\ J/7$*@!J ЄД ** 8?А ?Ї+ 8* Ѐ4*@*@ 㿘@ݔlost+found㿘 "l *`  @@ `" `  " `@ U $  $ " `@*@@ K    # *@  #J 2    "  #wrong type to dirscan %d㽘M 0" $b@I  5   B 6+ B+ 3` @; 2* @ * = 5 p 4@| @    =` b=   "L`">%  @ $/ - @$@`㰀`4` ` `,`,```X  @ * * 2 & , =`@ b =   r p   8l 0j@p "\ - 3 X `@d *  * 2 @xc2 X "  , ,  % (@ ,c /  "@`2  X "   , ,  @  @H" ,h @ApXp @5 ,  @ X  4       DIRECTORY CORRUPTED㿘 bp @{4 @H A   4@=  7@66 @@ 2/  }b@3Ԑ @% bX @ɐ"6 "6 &. . .  , ""  ~B?< {$   4  u   q G- X` @ * 2 $ X` @*  2  @  c aO< @K   E  A@A <  ! # ""  <` b$ `< & b@3V @X@  @L X @*@D2 6  6  , ""㿘 ` a >"@' "X"@@@ "̀ :n ``aX  @ * * 2 4^ X `@    2R @  L #  `X `` ?`` ?` #  X    X  @ܐ * * 2 <   `  `   ` J``/     &JJ`?㿘@%s  NAME=%s %s=%s DIRFILE㻐@"̐#@ ǐ@1n @1`$ "̀@ !@@-7  "X`@w< @   (@"0 @"UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘 @% X `@? *  * .`2 <    @i ra@  0l#`  a X @@ < @   (#@@"C@ > X``!0@ ` X* `2 @ *  * 2`<?"@ @ @0ɐ! "|  6 @0 @" !H@0!`"| 2 X@,ߐ!p  X `@͐ X "@.`@ő2 0@ 94`0""㾐 (@k , /`  `   ?  ' X  @ *  * 2 "XL   @ X "@*`@2 X 7@4 4 X  @l $ $% `4  "0 , ,  ,  ,@~`   "@` X   , ,  㿘 (   ,@M̔   "X` @- #`$ "0 , ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u `  ???????@#- X`@< @ `?a  (@ ڐ @ Ր+ b|     b| 2 @+" ' e @/f"' ` F@ !Ȓb0#@  ''/'@ ,$`@ "(b|`@+q"@  cD @ $`#@@ސ  b|  "H`@` b|$` @/#` _"X@`X`@9< @ 8@ Y"@+6"  "" cD `@J $`@ D"= #@@  @ 9"2 @# ْb bȐ /'ġ,'R`b#`@`2 #`J @ " @#`@m  # #@ @." "bD bȓ.  ?<2 #@#`@9 #`@J@(`X` @X `*`@2 0 @)4 `bȗ* #H3 @ܒ#`@.}b|  @.v  `  !l???? 'Đ'/''???@'@X [ "̀W`U@S  #???? ''/'???''@Ð! "X``@W!"X `@O *  * 2 !"X :` *`@B2 * *` * 2 @>`@  @.@@ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘) "X   @ '   ' p@ P 4# - ( "   @" @- 8 -"X$ @֐$$"X   @    p0 :@ "XC@ "X>   h@  p 0"X:`  @& h-"X`@ p P*@  :`  p @pp  0p e<eD `L @ސ``z-`@{"p@0``l-`@{""X"@o"++cHp2`0 bcH@{ p"0`   ,`-"X  @C  p P*@  :`  p @pp  0p e<eD `L @``-`cH@{E "(@X | "@,"@ @) "P - @,`6 $$"X @ p0 :@ "Xc@ "X>   h@  p 0"X:` " @p& h8@-) " 㿘 @% X  @ː #Xc``2 @!!Xc``2 @  !X#x`2 @!!X#x`2 @  X#x`2 @   ##x`2 c`X @yX &@@r&` &` @ސX` (@e' p@4`E@z X"@a"##cHp24 bcH@zr pb4 @  .X` @D @4  3 X  @9   "ȓ. 2 @0<c @? @~2 @c *cJ@X  @   "ȓ. 2 -   2 @jX` @X `*`@2 0 @k4 㿘@N! "X `@ "X *`@ۑ2 0 @O6`@.㿘 "̀` @u  ?$,@e 0?,@u  #,㿘! "T ?"@($"TDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ 2&@/ &`$X   @b >`  >`X @s < @ /,(+ bp%(`:`! ``` h " x@u X+   @+    bp0 ;  @ ;`@cvDЀ x pbpX  @   bp<  :@L@ B 8T @ @ &`bp 8&``9XN`0 2I &F ` "@+V Ð @$@' @ 26 `@V#Ø%bp `; 0@s X: `!  @Œ >   > @*`P @O$"  "N`0@ N`0 &``@ ݐ 9 Ѐ bp 8X&`@ Є bp 0* * : :`  p75`X  @ &`&`@[ ?bpLN`0 9bp4`25 t(2 t` "@*͔ @@&z@ #bp`@#ðX! `  @F  Xb  @< >  > @*.`P @$"  t @[;` d    PARTIALLY TRUNCATED INODE I=%u㷈M0  ' 20"'@  9 "p 0 @&"p0 : t@<`  "p t @;`8"p2 "p  tF@B@b*  "``,``  @$   -`- @'#ѐ @*,`"p t@6&``* @@-  9  " $@G@* "'"$-` *@&`:b`9-; "X` @ %%`Q ";@`M0 251 "@)Ȕ  @@%u@ 2%@# bX   @B  bXb  @8 <  < @)*`P  @ `  f *`  ?%`blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock->fs_fpg %d 㿘 b,@' n p @u@q  @qے,   7  @qђ, ` @N #`#`a@q’`` @q,  @(p#༢a@qp@q, p @(% @q@ #`# a@qp@q, p @(p༐"@(  bad inode number %d to ginode㿘  "̀ - ƒ`@  ) "p`x 1"p) "p+ @rg༢ @qN@qI,@  @bC@rUx`c*  ?"0@%D"p%cx@rC@q-%"p@b(x * `bad inode number %d to nextinode㿘 " ` "" "̀ + ƒap @+ b* ) % "p @r $ @p `@rb`@p*@ "pb @a"p@qx"p `* d, @b}#   " @  "  @ H%b c5 t@&ٖ # Lt3 bA&c/ @*SX @Ր < (  cX`  @    "pe(:  㐀@ (  % ,``(@@```("@㐰 b $ bt@'t "# # `"#Cannot allocate space for inode buffer㿘 "p8< H@ @4   "b"" + - ##"%b%H@s) %#@a ! * " $"%#$"" ! "t  b@rRH $"tǒ`X@ b ""`㿘! "t "$"t@r$"tcannot increase directory list㿘% X   @      p0 ;  @ D@_U;` 8 , @r  $ B @`ߐ d* `$@"$` $`$`$`$`$`X  $` @ג ,   , $` ( $` @u`$ 1 "l$@ `d! "$"@r]*` $"ǒa@> "l *`"`" &"lcannot find inode %d㿘 @` d* @     2 ǒcx@ 㿘% d  "l# b*`  @r b? @rd@rb$b$d  * %s %sDIRFILECLEAR (CLEARED) 㿘  "X`@j< @ 2  @@ 3 b|  @"\  b| @&&  " b@pޔ  㨒  *0""㿘 ( bX @   @2    ,@t= 㿘 ( ".  ,@5S  2( # bX @   bX @   "̀  bX @ &  &    I=%u OWNER=%s %u MODE=%o %s: SIZE=%qu MTIME=%12.12s %4.4s 㿐Ȑ#@% _ "̀ [&@%## bX  p@ 0 @ " #bX#` p@@%}bX# `@* @%q2` | !@i#0@%gbX `#8 @f    @%XbX  @h ''@Ȕ`#H@%G`%d %s I=%u BAD STATE %d TO BLKERR㿘ɖ!@~@%.! J@ "    4  0   *@*@Ja@ 㿐   #J@    ̀   #J ̰  *J̀<@ @! (@ #_ @! Z  # *@`@$Ґ % X  @  $`(# *@X .`@2 4@4@@4X @Ȑ !  ! "p$`$`$` 4X :@ "p<` 4X:` @ $`h ," c  "06` `*`  ? ْb ??/'????'   @o/b # * ?"B:b:c:dfm:npybelenumberAlternate super block location: %d conversion levelmodebad mode to -m: %o** lost+found creation mode %o 㿈@TG  @nْ ?@ @#    ' "b,b($% )ʀ`7ʐ!ȓ*` €*, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , *+8+d, +x, , , , , , ++, +, , , , , , , , ,! n#@39` # V$@3/` N$N$ n#ʒ`,b( b@  "@# ? n#ʒ`,b( c@p  3#"D c ."c,,b( n#ʒa m@_ ʀ"#Dʒa@! a @#   #d `*#d*|  $|  " `*"*d@@Y ?[?#@*` @ @ @S  a@S | a@S   ?@@'`  @ږ ? "8`2 @*-%c flag requires a %s㿐@J `@ starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** (+ b| b,@R b|@d-  "| @!h@g?p  b| k@!xh 7 pː!@"J`@J "@"B!@"?!@s/ h 7 b| "@~!@"."@lb| @"&"8@;"| @""X@ R"| @""@ "| @" "@ !p`̠"`) `8% @j"x@U . p* (!ˠ"@n* p. ("*2`@ *: @n @\ @!ܔ`p ̐ ""@" `%"@!ː# Qp! ,@j" xp  $x ? 4  @nO$xxp 8@j$x",x"@" `$x@!#0h @!#Hbh  # @!cp 2 #@!cx! " @!#"  #1 @!~# 2 @!xcx  ""%h"c) "Ā p@  ch @op X p @#  ,  "D` J#`p #`!p `, #h% p@j;```@j6. ` `d, @ ΰ p ,p@f @lb4 @l @lb"Ā4b| 2 @!# "`@!#@ "̠`@C b|`@@ ̐ '''@Ӗ   b| @  @ 0 Usage: %s [-dfnpy] [-B be|le] [-b block] [-c level] [-m mode]filesystem ... 㿘P`͒bh@Q2 8@(4 `+ bp/ p@i   @i,     p  @i,   bp    :"4*$ +@@ * bp , Ѧbp4?@m*     :"4*$ +@@ *   ѐ ??   /'"x"?????p  ,  p ``bp@mbp  `p`,& ) ""`PARTIALLY ALLOCATED INODE I=%uCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %u(%s) of size %qd bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUEINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%uXɐ- X`@<X `  @ܒ    43  c (@=p 0 Β 0 X@=i      ΐ!@@ڐ!(   0 b@jh > "" # *bp0  : DB?#"P 8 7 8 |  #`ΐ!0@u| ,bp<2)0@!@ "bpbp`4X ;  @`  bp=  4X :` `@o2 0 `2 5bp0 ;  ;`@WD ` #`ΐ!P@. (`(j! "@ <:89bp2 h;4bp h / #X` (@bp `d"+@ @  Βah@ #` Δ , !@p (@m%}% hbp%(:     h  D* 2`  ` 2    bp t@g? `  4 ( Α, `  ! X , `  bp t@k6    X Α, `  !X @ @΀ , @S !  "X` ""@   "ȗ+ . 2 @i  2  "b@!@! 2 @% """"" # #  *3 # * "05 *"@ Z X  @N *  * !?2 # X  @> *  * 2 # ; X` @,X* `2 @X % p?@2 ?X5   @ X X* `2 @X % t?@2 0?u5   "#"c&kbp4$@fœ:` &$X` h@$ DX"` h@$@| 2 @ې"H  ,""@"8-X`$@06% h0ΐ"P@! # *@!(  #*@ b@hF ""BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘   f  `   㠒 ` " @ ( | @C @ I! `$y+ ) -/3р :  b    b4: K *$:@ `2  bx  %bx * @ L+ Pݔ#   %# @c`X |  @h!    "b@F p@# 1 @$Y - #Ě "` ##"h"@""@hcĀ@ `c@@ 2`cĀ@2 $`2## $ & $` `    ?? 'bp/????? "h  ,  "c ) bp `@'  "p# "p'J@ "p ) "p` @  bp`,ݢ DUP㿘 3/ + z  2 㰀 "c)%   c *$ "$cĀc 2 cĀ`@  Ӣ`ROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'%  `?* : `v*`Ґ" €JKLtL\K K@ !@!  @#3   !퀢 _Ғa0@O @ !P@!h 3   !퀢 JҒa0@: @֐!x  @#   <""@ !@Ȑ!h #   ߔ!퀢 *Ғa0@ #@a 2 @"   ' "X`@@ /"X@@ 4@  J a@  #` * b0 */ ! ⨖"l@'p "l  ⨙+  Ԓc`$ @."( 2%  X`  @ 0  <`@@ @K X@7@7@ X @?H h@i $ ' f'̤* bL 0⨀-"bL@  "$@ @K # bX @7@7@ bX @?H h@h $ ' 3'̤*⨀M- +' 1/ "@  "<  "8?"5 #Ґ $  "0@a b@   ȗ*@ ?2@   H@a 2 %b@ȗ*  3  * ?3    $ *=.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀 "@ `& (% X @@  `X @@ ! "̀@X @@ %  % 0  @,` $ 2 $@ B% !Ԓ!@(` <X @@     Ԑ ߒaX  @{ $@ $@!@!  `""-  " $ `  a0 !,`@t!  "" 粒aHX!Ԁ  @M - 㰀 ' //! 7 /X //@  ?` `5Ғ@@(w Ԑ!X@ Z l"X `@( *  * 2 X@ F! X"b `@ ` * 2 -   X7@g%!Ҁ  @ * * X2 `"@77@g  $& $X @@א +  + bȕ*  @2  @IX,@Б2 4`4`!@Ӑ!  `"" $`4@ % X- `5@ ' //@  @/7 /X // $  ?`K  `X  ?`` @ *  * 2  X+  `@{ X "@*`@s2 X 7,@k2 4`4` $ & $X`@@Pbȕ*  @?2 X`@R* 2@I 4`@ $@@'`  X @@/  w% ` s 恒a !,`@5!  f`d""X @@  ``Ԓa@'V 0u Ԑ!@ 4? 0%X `@ *  * 2  Ҕ0[ @ "? % % M0`7@e@!  `"" $ & $@`X + @ bȐ bȓ*  ?2 @ "ɰ` `" $L` .2``2L`  Ԓb@$@@!   ` .2 ` bP""`) & $"X @`! @ @ "̀@   hm"x5  ;"X  @i @ "X ` "X  @\ @ &"X ` ""X!Ҁ  @N  Ԑ廔"X" @A   $@,`@Q! 6 G`"X / @/ 㨐  @?* : `א!*` €^a(` ` ^d^d $ '"X!Ԁ  @@Ԑ}"x@  "" $ "X @@  J `! @ ""|  @"!"X  @ސ  L@"x"X+  @@̐ 0 :"X @@  "X @< @   ,"X @@  "X @  bȑ, 2@d@"X @@ 0 `5 $ 1 @ "X@ ! @z @ "X  @p @ђԐ"Ȕؒ@"| "@H#  $@q"xi $  %+  4@"X % @E @ ` ` 0 #"X!Ҁ  @4  Ԑ䡔"X @@' 0! @8,`  @`@"""X  @ bbȓ*  ?2 "X@`# @ @ "X`J @  @h ` $@`@$$"㿘 "l1 "*`  G >" + cJ `5"cJ@ 0"  - / J@ 2 )   ` `  cJ `2 "؀@ ` $ $ * c?3 z*@":UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d`'   P" ??  /'Ā@ ????V? #' @* : `3ِ*` €eeeeele "ȓ,`R `"% 2P .P  2 $P쯐  @ 2`0`@*ْ`H: @`$  @`$ْ`( P`@ 㿘  `E + )    7  & @`%bh %  4:`J *`$ : "# "h   "bh 2  2  :4* $  * *+ "x%"x` cannot allocate space for cylinder groupDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %dCG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKnewcg map:  cg map: BLK(S) MISSING IN BIT MAPSSUMMARY INFORMATION BAD?b bp?cH@_a 9?! #0$#ȸ 'ْc8@ ; c *`ࠐ@E  D຀ 5`X 40X$ +! "| @q#h"| ?@># ?c,9 @ @ 'b<%$)  #h bp@b@- X9 "p @ , X`$L$  # ` `ٲ#`   %$P@\ΐ*  ณ, @,: @@\|@`_ , $:`0 @`@`R, ,  :`@!  "|@! ِ#@b%$"|  ;?@Ȑ#Ȁ X"|;?c, @'@ ) - ِ#@P@\* ,`ฐ @଒$|:` @\p @` , :`  @`@`, ,  :`@L@ @ 8B 9? @ #,%࠸ 'b<#h  @abpX9 "p @i , L#xc;?༺c<@ T9?'@#8" ' 5@U%c?Pc0;?@:`c4 @a@ '@[%P %`Tഡ,  %`X@\ P* %`\ฐ`,`: %``$` @[@_| , ``:`  @[@_| , ``:@ %`h$ * @%`l@[|`@_{* , :`%`d`\5@`d?`TUc49?%`"@ @#8;? @" c<' @'@@P @ @C     p "@ *"@ 8 `8  ??$8 ? 6,    :4*% +@ * , 63L@[@[z.  ; a@ࠐ@’@  @]8! ?#c,;?9 @c8 @@@;?c4@@@?c(@;? @c$`@'@ "X`" 9 2   "X`" 9 !@ U  ##Ԁ ڐ @# ; a@ , ༒@['?@$c@ @ @ %` %`,?2@L5`5`;?c@@'@%`$ $%`8@^ %`p%`%`$%` (`%` %`(%`( ,`@6%`,%`,U` 0@6%`0%`0`U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@@B L2ฐU%cฒ@Z̐ F c @* : `/ܐ# *` €ss0s$s$s$s0` %`` ? %`  `U@:@`\@   ? % *@ * ฀(  *ڒ`@:@  %9?@"U    ` :`b@`\@   ? %*@*`   %` 9?#@Ҩ 8 @ 4 @"U  @ 4:`J *`" : 2 `:`c@``@   ? "(@*8` ֖@@ g``%`|@Z;@@]bU`-`T@`T@ @"@@Z|ଢ@K@]@Y@K@K@Y@KP@Y@]`@bU* - Ԑ@ `X@@Yْ*  2$`B;?8@]m`l  : @]d@,` $ *@ +,*;?`$ %`$ `4 `9@"U:`c@``@  8 " ?% ::@   @ ;?c8@@@@2$ 4 `l`h@ `p@ @      $4*    `p  *     瀈  ?$4*   ?c$`$@9?@ '`#(@ '`   '` 'pl> *`@ . * @-ߒ "ڒ``@P@ ?c$@@@^h  h9  @^a"p X "p @=  ,  "";?c,@@b< @^I9 !`U@b`\@ U@" \;?c4 @@-@ F #` #@ `U@!b`\@?c4@@@@א  U@" \9?#4@`@x U @" \`U@b`\@;?c4 @@]@ a@ ,  ""9?#<@-L `U@`T`T@ U@ T T;?c8 @@-5@ "-,ڒ`@ #?c<@@@] U T T`U@`T`T@9?#8 @]; a@ ,  "",&L??c0@@%P@,  !ڒ``@f@ @] -- #h9 "p@]x  X "p @T  ,  ""%u: %2x 㿘 @)%'ߐ!x@ @  `@ ሀ@ !x $ ,$(㿘'H'L'P'T'X 8@@IH@X %s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. 㿘  ",`$@Ӑ"P@F  ",` @Ɛ"X ",` P`$@"`@ 㿘'H'L'P'T'X ͔H㿘'H'L'P'T'X H%s (%s)㿘 nb!@#ݒ㿘'H'L'P'T'X H@ %.*s/%s0@ߧ / @4 <  L` r 1 #` @,V$@0%.*s/r%s㿘@߀ /  1 # @,>"0 /Can't stat root Can't stat %s %s is not a character device `!%$(@3͒  @!0L@3(  0}! @>)< @@#@@( $(@3  `@ ! !  @ !0@ `câ @А ` malloc failed㿘@X b@ _ realloc failed㿘@Y^ c@ N strdup failed㿘@ cP@ ? p`XH@80( Linux Ext2FILECOREHFSADOSbootISO9660HPFSunknown4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%qd IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%qx IN SUPERBLOCKINCORRECT QFMASK=%qx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead  J"(?;  'b*@1   nb!@6 @  <    $@ ؀ " @1|    c nb!@ @ q / | !@  J#d` |@1\   'b|?`'b!@ !| 5 @ !(5 ?  - h""$`"c`, $ $ ,`$`@V$ @V3 &bp@V$`@V  ` ""` bp  a0@  c@ "" (  "b"@  M %  2 | 2  c@J( @s!X T @@T6D@@T1,@ 0 , $@T T`@T@@#\!xaؘ"@ b ư "`h  #`bpJ@ " c2 bp р`|ဢ`"""H ?|  bp <"bp  $ , b, @S9  0*@ *`   t:`:'"̨ <` @  D   bp `"@# `bpbp"`h @X1 "X bp @  , bp <`c#0@Ȑ# `bpbp "`<h @X1 "X bp @  , bp `$ @(Ր#Xbp | "@ s#|  h@# bph bp@X1 "Xbp @  ,  *`bp  @ *@(#bp|`"@ C#|` h@i# bph bp@Xu1 "Xbp @ R  , *`bp`0`H *#w bp0| `"H@ #|` h@:# bph bp@XF1 "Xbp @ #  , *`bp`4`L *#H bp4| `"L@ #|` h@ # bph bp@X1 "Xbp @   , *`bp, $L0204,bp0   bp| :0@ #|  h@Ր# bph bp@W1 "Xbp @   , *`bp%(`<( 8bp <|`"(@ #|` h@# bph bp@W1 "Xbp @   , *`bp H: %8: @ %< "0bp%8 h  bpH: :|:8@ K#| h@q# bph bp@W}1 "Xbp @ Z  , *`bp L: %@: @ %D 0 %@  w bpL: :|:@@ #| h@8#  h bp@WD1 "Xbp @ !  , *`   "cH; ;` ;  ;` 8@88### bD 8bp%,`5bD| 2 @ ؀ bp * bp `H`L8: @8:   <#@"e,:e0"e(:e8:e@h @V1 "X bp @   , *`bD dbp%La| 2 @ː!( bpK  bp ` <, , `` #\%` <$eL$eP$eT$eX1 : @`@Qtbp@U | , %$:` *@Qe  ` |@U*@ , :`bp`Le@ : B $`h @V"Xbp @ q  , *`L`  "`bph bp@Vz1 "Xbp @ W bp h@Vn`b@bp    l1 "p``0"4 @8A"p"ث-" 8@Q   d* c@  I!P@& ؀  @\   c bp "إ4@ @v`$@  bp"@P 8  d* b@m"X "pbp4"آ @ @v٢`$@  p 0   b, , :`` @7ؒ   "b4!h@Q  b̒ @7ɐ   "c" !"̒ @7    "b0"!@`5 "̒ @7    "b"`!@x*`% bp  #   "b$"l$b@7 ! $"b@7 " `""d b"@X*` @  0@"" MAGIC NUMBER WRONGincompatible options -B and -pincompatible options -B and -nCONVERTING TO LITTLE ENDIANCONVERTING TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %ld, original %lx, alternate %lx VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘7   "Ԗ :` @7@  c) #h @ 2  $ $ e\F!T@# b` ဢ@  ! %   ""L"b`$"X-$! %   "bL"`$$$"X@ue\@# b ဢ@ !  %   $"X"bL"`$ %   "bL"`$$"X/` ' "|``@  J#d`a@ bd2!0 ဢ@ !P@ "X  !p"X "X@M! #h`"X@j#h- p`@Tp"X `@\pp`, 4`ߒa`ؒa@O`  `,`@O?` ǒa`h1! a"@O`d`4 @R- $"@R%` *"`, `@Np ,  @N*@  @ h@ @-2  "p@@p# `hb@T@" @b |b"% "  " "  " " " """ *b `* b `* b `* bВb`X X`< <` `@ @`\@S \"bВ`cT @S##TbД $\@S̒d\bАd d P PH H888@8@H H080@# h $ #`@i" h ?b'@ " p($ @W:`  `bX@" 0 `@S@ @e`-` ,  *b %s: BAD SUPER BLOCK: %s 㿘  "|`" !"!8@ !@i%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘@ ?" J ? (JD 5! @LcD `*:@ `逢`!#*`  ( k   g c @5%h &4 &8 &&$`0&`,&`8&@N`(&|``4 ?@N 8?@N @M8?&&<* &@"* &|?@Q8?@Q@Mt&@Mn@Q$& @Q ?@Q&,&dd< &d`( ""԰ ioctl (GCINFO): %s %s: can't read disk label㿘  E`e@Q 6  n b!@  `@ bad file type 0%o 㿘! "X @sE < @@",  (@"&  @" 0 @ #@  #` "X!X`@s* @2` INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘 "|`"Xbx@,-`?@Ð   J#d` "` @"] J"`2 ꀤ  + J#d`)@"K )> n< N:b@#@K?`? "`@ ?  $?*`<  y#c ?  $ @ 2  <c  ` $c  2 < yĀ Y@\< y Y  cannot allocate buffer pool㿘- p  `0"T@Nb"㬢 p`@ɐ p !+ ?" " " * b$ %b0@O($  6#b3?@N> p@N:`0 `"`@ $ $ $" $ %", $ b" deadlocked buffer pool㿘# bb  "p d.   "  2 b    b  2 bb@` @ b "@ "$ b$b" $b"\ ` #"\$ 㿘 "p`d .@  @   c" @& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` u`  ` @OԀ##`Đ``.`` @ &` #h@ V/ p   N - 5   p``0"@4X bذ 4` @qa $  p" 8@K:   0"@ d * @ΒX "bpp4`"ذ  @q: $  bp 0   CANNOT %s: BLK %d㿘 "|`2@"!N+"x @ a UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN ***** cache missed %ld of %ld (%d%%) 㿘+ b   c- h. J 4) " :`:  @2 @ %! "|`!! ̐"8 "Ԗ:  @2! $@O"p X "p @ ,b! !b @M) " `" @ b`@M`@M @" "bX@ ! "  ""T5"c' p р`/) "| ""p"r" "$"" p * Ѡhp@Oy  X p @U , b"|2 @$" #` " ,`b\* !"Б* @M@ @Nicb@NfSEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘/ Ԗ>: @ @ND !ʒ @N Y "@N+ 6! @1@" < ' ;9@M ,< @ :`E @C  @N Ԁ`Ԑ@I@M*@M&@b8  @M@"H ˲@@v"WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 ^) "Ԗ>: @蓒 @M !@ @M  <"bĐ @1@M 6!%@/ H $# +bԐ@MkbԀ <  :`D @C  @M{ "@L@bH"Ԡ @ @"㿘 m3 bp8i 1 ", 6b "p8 R     b48H(&> 2:p 6 4@``8(H@&@> @6 "x  > 4.  @/@.@"x""xp 8 "pb,8 "p `?ꐐ/?..`@ #2b ##b   #  `` ##. M.    $b?? /'?????#@-.#'̐"0c'''֐ "Ȓa'Đ '''ؒ @:$@Mv? / ,ȀȀ$b? ?,<@Ma" 㿘 "@` O""@{ returning to single-user after filesystem check 㿘@!Ȓ  "8 @/ 㿘@  @/  @/|  (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d㿘' !#bpL 0 A  "  "|` @"X $ "h   $ $@> 㿘 "p! ` @Ij# X #@ 㿘@m &@@m &`@m &`@m &` @m 6`@m 6`@m &`@m &`@m &`@m &` @m $&`$@m (&`(@m ,&`,@m 0&`0@m T&`T@m X&`X@m \&`\@m| `&``@my d&`d@mv h&`h@ms l&`l@mp p 4`4&`p,@mi$@- p%L2+` ,@m[$@  T`T Ԩ`ԡ,@mO ,%@  @@mV4 `,bԒ"@Lg!@m9#E&c/@U@2 T`T`X X @@ p `p,@m p$@ , ,@@m"5p@FPU`@2 h`h@p e$  ,@lp$@$` ,㿘 ,`@l``3&@@l#X&cX@l% &e @l%$&e$@l%(&e(@l%,&e,@l%0>e0@l%8>e8@l%@>e@@l%H&eH@l%L&eL@l%P&eP@l%T&eT@l%X&eX@l%\&e\%L@l ? ?%L #\%T@l%L @l ??c\eT@l@ @l6@#X,` @l %P @l@Fe@ `㿘@l6@@l 6`@l 6`@l 6`@l` >`@lk &`@lh &`@le &`@lb &`@l_ &` @l\ $&`$ (>`( 0>`0 8>`8 @>`@ H>`H P>`P X>`X `&``@lI d&`d@lF h&`h@lC l&`l@l@ p&`p@l= t&`t㿘6 @ ,`@l0`@ &@㿘 8 !+     *4.`"b܀    ?#=@ "!, @2  @k @k& 8,,@ , ,` Հ ffs_isblock㿘 8>0#  @ `?>@ *  @ *  *@  `?>@ *` @ `?"ȁffs_clrblock㿘 8 >  0 .@>@ *` @ *` * * .@ >@+ * .@#ffs_setblock㿘 8 >  0  .@>@ * @ * * @ .@ >@+  .@ P㿘@㿘@,K@-@ 㿘@49Failed open to read on %sFailed open to write on %scan not gzip while appendingFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s.failed to open directory .failed to open directory %s`- ?@#b?@I*+c%?)    >$b" H"c##" %"`n$#D+` €XX˸8̼ !p >"`($" @!P! "$" n"x@D̐  >  !  >"`$"&@!7! $" n" %" > t`0"@$"," > t`a@    !  >"`$" @!! $" n"@D  "" > """ ' ?@E 6   n >" @Dm b< @  > b(@D3 b@H??$b%"@2 ba@Hr   %@b $  @Hr ?2 $2 $ n"쀢`2$ $ 2%"c  # > > H > ""b# <` *b ? "`@  %  ! n"h@D  ?"? `@ } $"   n"`@C |?@`m#0*` €PPDPa"c   > H >""X"`< Ha? ! >"`< >"`<c  8`<"<"bc ) > H  8@H>  ) >""'"`< % >" $<<> @4 > $<< c $<c "<""" >"b"< "b %s: Waiting for tape drive close to complete...done. 㿘'     >" "c"#`# 8) > !"`% > p` > ?`$  * $ @1 > `@*e@Ba%  c@D <`   `<`8  >@`$@GA `"`  !(@M >"p@B5 А?`$ #Ԁ` ># "Ѐ"cb  "b  # > >" `p  ?`$  * $ @Β$`p@ @B >"` ?a"`)" ?"%#@FՔb 4%"Unable to truncate archive file㿘""b 1"  @FЖ     @ "    n"@B ?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘"` `@B6 ? H`  > > < `@B) ? Failed read on archive volume %dEnd of archive volume %d reached㿘!" 7" @FG  ><   &"#Ѐ!#"<  " H@F5   "c $" n"" @B  0  > `" a@AԐ Write failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘!" #b@EŔ  "c" 6$"$"" A ' ; !  @EĖ  . > @ c b @  $  $"  n"?倢` E0  n"쀢  b@AA $"C    $"   "b  "c"` %c " a@A 0  n"" P@A< 0#``"@2 cx c @@Cannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐 #؀`d?' _c? UbH #Ѐ  "cb" 4<##Ѐ8  ( ##2$b7  a'@D 6&$% ##b %"%  @D  > @N@ d@Dߖ   $## b@@t  bx@@n ?Foward positioning operation on archive failed㿘  >2? `(< #b 45"`21 !"  @D    @`8C4 2 >`<(>8@ b >8  "@D    n"@@H ?$b?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.㿐% 6" D  | `(z$Sa؀ !r `(p$"  @D    n"b " `2b8    "@C L  n"`@? ?$D?@z  >?$;? " <4 `(2$ :`@4  b@?h ?$"? 7@&Ŗ  'a@C    n"@?v ?$?$ Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blocks?a3b  #1?!!b @CA" 4 # n"(@? ?# - 7 b'@C1   n"H@? k? 7b'@C  ? n"p@> Y?!b'@C  b n"@> G?@B 4b   n"(@>ѐ 7?7b '@B   n"H@> $?"&b@0$  b@> ?7@B'b@BƔ   n"@> ?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳀 >`x @%D  n"@= D @%6  )  n"@= ) #؀ ?"` > `' >@=6 # >`@a `@ap }" y w  b `@=  !b `@=!@!h@=c? 8 ! $"$ !@<973;1/5%+@<a@<!@<@<b@@<,   @k`  O ?%#'b@<ؐh >"p`O `Y"x@<̒ `s`S"x0`y"x`  >`@<@<b %@< @<"%!#@<@<@<#(@<, b`@ 2O ?%##"@<"h >8"p 2@<}#8cX@ @`,@F `@ %lu secs (%llu bytes/sec)㿘!" ? @#] @ܐ%llu bytes㿘@Ϙunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) %s vol %d, %lu files, %s read, %s written in %s 㹀#`# 8@' >`\" ' '+c # # >!`"x `!@$   > b@"0NK# >` P@!"x @_$@? # >`x ! > h{  h` @ ^!c@ > #d #\#`?@7$   > b@"0@-@?w 㿘 >@`Ѐ K%`H D`  >@ϔ `% @'" %2@+W 2@& @'ܐ 2@ @ÐB @ǐ ( > `x@" @&Y( >@C`Ѐ +1#`H $#`  @2  > Ȁ`@0R  ` <`D@& #4@* ! >  >`` )@W $  >``  @@`` @ @@& #@'J #! >@. 4  > 8`+@ '' > 4  > 8` @@4 4 @ ' >x@' >q' >  !`8@ɟ > "p  0 .? @H@G @B`@.7 J! > p F8` ?"`8* "8@ 6$ p@  # @B@.0(@@! > p 8` ?"`8* "8@ $ p` @B@  #( >`x @!r z@2:@%'Unable to open %s to read㿈'? '@-< @ `,  >Ȁ` 0@/  +@)ɐ  > ? '@.p &`@A"@-% `   ` @  ' n @9ch0@&% @֒@-m`  > $` @  # >@Ò@-Z0x# >`  ! >`8@Ț  > "p `$ @g` ` ! > p 8` ?"`8* "8@' $ p@0C`D@`# >`p 8` ?"`8* "8@ $`p %耢  쀢 @}耢  4   `@m `@9 6``4@ >`x @ d l > `@1'@Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. 㿘) >#@`Ѐ   # c@8p 0r#`H lc`  f+ >` c@, ]c - >@. T   >` 8@c > "p "`@( 2`  @-* #4 "@.| # @B #@ #(@,p @Ւ   ! > p  @p`8$ pU 㿘 > `@, @  cH  > 9 Cannot access destination directory %sDestination is not a directory %sDestination pathname too long %s ? >% > '̐@0,M? / /, `,̰"@-@G   n"̔@7ː 08<  ̒b@7 0-@+, )@ $@/  > Ȁ`@-  @ <`D?'@' ! > 2L` >`` 5L` /@`?"@@ c @7V`0@ @M/@ -   >`` @@ @`` @@@@@*  >@#  >@$֔ ! > 4 ` > 8`!`@Ȓ ' > 4   > 8` @@@  4 @@@' >! >  % >`8@Y` > "p  `$ @- @J  a! > p ]8` ?N"`0Q @  ? @ @ @*ؐ`@ @R  ' n"@h@6ΐ 0 @, @$@*0!@˔@\@! > p 8` ?"`8* "8@Й $ p@  >`x @% -@.@dPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐/+  `к? '3 >5-1>9` ``8 K `-  D @6!@  @;9 `@d  `` <?@5 7?  ' @5  `@a• ``$€ c` " >`<@  >%?a`@5 ?`   "` Cannot identify format. Searching...Sorry, unable to determine archive format.㿘;b@"   P *` * " * & 6@ 5 o?* @*`"@*`@"@1a в" 97 S@ M"  # "J? @5V` @Ԓ 4b@  H   а *` *" *    `2 ?# ? @5&` ?  `@:X""ǰ"à c@5 ?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multiple㿘1 >  H ! = $"#` & H" a   ! b0  "@4Ӱ?0 > >`""<  "5 " ? > H = =  ""b; h Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘# `1 =&" > H" c` c "@4?0 >`   >  >?" =< =  >  "#":   = >"""`<"Cannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿐 > ``  >`H ' ><%"`H<%$ u) =+ ="bԔ"  :@  ; F@|@A? @  : @ C ?. I@b ?* =`("# =bЬ@%"؀@ %b"< /"bԐ $""Д"  : !b  %%b"%"ؒ@ %b > >@b  $<:?; h   "c a @3?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘% L #`cx@3 C? ! =  >7? >਒ ; "Ж B  = =""8#b(   : ! =#  :  "Ob    c@3Q 0{ "  >?㿘 =bؔ" "b@4㿈  x?+ =) =b"ؤ" :  2 "ؤ  "ز@f_%" > < :`@ז @r@7 ? C?A  >蒢@ b  D B 8."ؐ" : ?耢 쀢 8  @: ? 耒 ٔ2耢@8??  "ؤd  %"b"ذ 㿘# = =bbЀ ! ="Ԑ "@} "b@$b؁㿘`$" ' =# =%bؠ"@  @@ @?bؒ@4Fbز&@$b؀` 㿘`$' =# =bؠ"@  @L &@ bؐ@4bذ&$b؀ 㿘) % ="ؠ"  @bb !?< @آ ؔ@ < ز@ f $؀  =`% = Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archive0 P(  ="ؐ" @ b &E>:  @ؖ ؔ @6$  ؑ:@ d $؀ % =` =   n" a@3e 6  n"@1ِ >? <  b@1 > Unable to obtain block size for file %sActual crc does not match expected crc %s /P ' @3% "  ؀ 2 0 N> n"А @1  ';> ="ؔ" @4 $7 :@   "#\@ X  > $` "ؔ   #" ؐ $ؒ :@ d % =` =P`4   `@ } 4  >`  $  >? $`2   @c@0  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s X/P2* @*     '?  @ "2  @ @2U  n؀ 2  '"А @0Ɩ'% =+А@4ϔ #\@ @<` B?А@4b 䀥`P n x @01 @  @  b@2   n @0v  <   b @0;P`4 `@ 㿘%  0( $% # = !  >  : b"  > > "`?਒> bЖ B = =""8#b؁User specified archive volume byte limit reached.㿘 >PP  5) >` 2% =) >P`h`h@ P(% =@4!bX@/ǐ 4  % = >   "`g<`h!" =Ь   <`h"b[ &%@ ) >% =!  = h J" =Ѐ "b&%@ ""@ ` h<` B= h# = ="Ԕ@1>" )$b$ $$b hЕ<`@ C %@! == h$"@1# @ $"ؐ@   > "`?㿘@"TRAILER!!!㿘a@   ? P`  ?㿘` < ` &    > -& -` 5 ` / $"*` ((` (0`     (&  #&  &  &  &  &  P   & `  & > @" ? #?ch@  $$ $   $  ?#l$$ c$ , 4 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘lc@. ? 2 L 2N   c@.n ?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘! P`  4 2  Pl(  P P `@.; ?,      `&,,@N,   `@.$ ?070707㿘`K  a@ Ԕ   ?㿘 L q`  > ` @ & `  @ & ` @}  &` @v (& ` @o ,& `$ @h $& `* @a 0& `0 @Z `D& <4& & `A @ P>`; @F ` &+ < (  @ &,., R i?  W㿘@#File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@$ %ΰ?`  >  0&",    A  AP  A @    c A @   !ǒ @      @   }   @ ֖  s    @ ̖  i(   @ –  _,   @   U$  $ @   K0  * @   A<  0 @   7 ; @   / L      `      2 ,, 6   `H@,  ?  `p@,  070701㿘`m  `@ >   ?070702㿘`m  `H@ .   ?㿘 > @ "$㿘 > $` n ђ n    >` @ ֔ & ` @ ϔ  &` @ Ȕ (& ` @  ,& `. @  `D& <4& & `6 @  P>`& @  $& `> @  `F @  !#* ,#?    `& `N @  `V @  * , @ @ @ 0& `f @ t & `^ @ m  ??&Q 8 n  "  .< ( 2  @    ` b >&,., c &?   @ b n ` ?k  |㿘 > @!"$File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@"? +*?`` 0& > $`!’ @      ! @     @   ` "(,  (`% #`P    `@ c `>  6 @ b    ϒc  > `  >   6 @      @       @   (   @   ,   @   <  . @   $  & @   }` 2  > @ w  o%?  2   F @ j  b`0 N 2  @ ^  V V  2   @ R  J ^ @ J  BҒ n  ͒   n  $  `  #`    $ 2" ,, & , $   6   `@@*;  ?  `p@*3  ` (8((aDž0 : 0(0  ? >@   @?㿘ے   > @)   Z> ``*  & ``*`@& `'`*   & ` `*(& ` ` *   ,& ` ` *`@$& ``* 0& ``*  `<& `* `*`@  & ``* % P>`3``(+ +`  >`Y```*  & ``*`@& `'`*   & `` *(& ` ` *   ,& ` ` *`@$& ``* 0& ``*  `<& `* `*`@  & ``* % P>`3``(+ +`  >``+ `<`D4& `@& & 8`  1 < @ (@ PP @     ` b  > &,., Ɛ &?   @ b ђ ` ?  &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@ 3K?`` 0&M  c ` ^ +`P* 2`* 2`@  `   b : * 2`%:   `>, :  ` + 5--  (`(`(`(` - bH,; , ; ;  * *   *`  >  (`(`(`(`    >(`(`(`(`  q 3  `*`@ ǀ (@(`(`(`  2 *` @ (`(`  2 *` @ (`(` ( 2 *` @ (`(`  , 2 *` @ (` (`  $ 2 *` @ (` q(`  0 2 *` @ (`c(` < ; ; ; * ` *   * (`(`(`K(`<  *` @ (`@(`      _ ` #bp    % 2# ,,   , "  = 6  b@'  ? b@'~  Unable to create %s㿘`    .@ & @x  ?H@' ? (`, ) n@ &@ &"Unable to close file descriptor on %s㿘`A @+   > n"0 @'R  > Ā` ( , @  > ` `  3&    @ # `#$` `4  <  @ Unable to link to %s from %sA hard link to the directory %s is not allowed0, @   n" p@& ?<   @k b@& ?㿘 `  `  @R  Unable to copy %s, file would overwrite itself0 @E  D!h`   2     c@&t   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s0@ I# n D!h`2K @@`@ `x@&; :?<   @vې (# n  n@ !# n%  n"@&I ?@&A ?`@U`   @v b %s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)0-  c  +"` @ߐ L ( , @ `` 4#t*` €GGGH(HHGH(H(H(@P&$ `0`0 @@vk@vn b8, @u bp@%} ? n > Ā` ( , @M% >   3&    @T``G@P  ,@  n" @%la@9  c@3a &  @%Q )?  # `#$`   @N# `#$` `4  < @  Unable to remove directory %sCould not unlink %s0@ ! D!h`2&?<  @u 6 ` n " H@\  n  "h@$ ?0L /? 1 /,@e (@X!  >,(? Ā` @}@  6,@I 2 , c@a$@Ŗ , @q / ͢Unable to obtain file stats %sAccess/modification time set failed on: %s ''','5 3c$ $@   n 3#@'''c$ #@'''"@ @$d@u耢  n"`@$X Unable to set file uid/gid of %s㿘@u  n  "@$= ?Could not set permissions on %s㿘o@u   n"@$% File seek on %sFailed write to file %s㿘\H% n-+  '&@4"&`"& N    L "  2'<`  @(   X@'bh@#Ґ ?2&Failed seek on file %s㿘??@'   n" c(@'   n"h@# 㿘@ @'?&@ >   4 `<   File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c(!?#  ?`  &n  ` 8 8 !?B# ? @@ `@@'?@@'U ## P      "? `c @$    n"ؐ < $   `@"ې ?  @'2    n"@" ? & Unable to allocate memory for file name buffer㿘 > D = "  " > X`А " > 0`А @"#p`@$, = "cc0@" ?@  > ? ` @Ȱ? 6 Invalid file name arguementUnable to allocate memory for filename㿘 N `X@$p `x@"R ?@?`$N /". cp$ $ $ #t "#t"`"#t"cp 㿘#x` "` > ` = "c D!l` ` #|`l@i WARNING! These file names were not selected:%s 㿘 > ` @^#p )  4 #% @!! `8@ D  2 㿘!#l '@h$#l%# =p`1 =#Ԓ,@N #@乒  =*x ""x  "x?x =&#А#@g  $#l File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐 =c܀ %"c܀  %#@gl  $c| ? 6?` I *` €XYDYY`YXYxYYYYYY > d`2.,  > `c| < @ c| 0c| c@!5 0c|  c| @!T 0c|  ., `  >  >c|&,<@ >`; `; ` ; ` <; `(!; (`0; 0`8; 8`@; @`H; H`P; P`X; X``; ` @>@6@XZc|@c|U (@"3 @&Ic|0@>Cc| > ` :&   `<4 @A-c| (  %  P` & >` & , @Z, 6 , nc| @  0&,    &c| @,&,c|` & %s %b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9qu %s %s == %s => %s 8 > `  @@L }#` `@  >2  `$;!@@ H X@G`$@> @ "/`@M `@Mܒ `   h #\ #\  @ !  ? `?c 2   @2` `8  @  @     `! @ߒ, !#`?"`# * $#@ #@.%s%s %s @ >  #`<;a @5 4 H X#`<@@ @ "/`  @ "@s  J@ @*  `0  **  J@ @*  ` **"    J 0  *J- 1 Є *`(8*`8( Ʉ*`8(  0*`8`7 (А  J/ @  #  8W0*2    0 0*2      0* :* ? 㿘@  @ O@ 0`@*O@A@F@Є  2`.>* а*`>.>).>2`* >` *`F @`@*@(87з2`* *`? @F`@O@/@ 㿘@ * 4  `0 8W.W.* 2`@2   02` `2  0. *   0.:. ? %s: unknown option %c %s: %c argument missing 㿘 =% n  $`4`G?"J@ - = c *c "c@ =J#䀢`@ 2# @* > ` ##"&? @  :2J @ 8` :2> @ @ 8`@k ?*@$"@> abcdfiklnoprstuvwxBDEGHLPTUXYZustartarsv4crcsv4cpiocpiobcpiopax㿘@@ /! > $  @$ `@:"H @Ē0 @0"` @0bp$ @Vab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedH  5`; *` €nnnlnm|mnmnnnnn(nnnn@nnnnTntnnnnnnnnnnniiiininnjnjj,nj@jTjtnkkkkkllnlX# nc@! >$ H`PccH@ 0G > "`(E D "al@ n# >"`: > "`5  D "ah0@ > "`+ > "`& nc@(  0 n#  "?* : `/"*` €jk\k\k\kk\k\k\k\k\k\k\k0k\k<kL"#   > >"#$""## "#$ > "` >  "`*c`:@ @H  –դӤ n@Ec ˤ > " Ť  > "   >  "  @! n# H'!̐ @W L "c#cx@o '#8@ת )- 8@#`` L@Ȓ80# >  >"t",# nc@! >< P P  P 8  Pcc@> @ P a c @2"@\ > " `V # nc @|  !?I$"@Őc D$"`@ 0< n@ &c 77 > " X1  >  " D+  >@" D&  n@ c  n@ sc  > " 0  > " 4   > " 8 @n@ A?_?B (sې"! '$#BqȒ`!   @ @ a!    a! b! $# @8!@X@1 ## `!"c#`C ,*` €p@p@ppp!#@4#@*`@@ #@@ #@ $#@0$#@@`8@` @?. @ >"`#c@!c@*`@ c@@c@ $c@$"b:cef:lmoprutvwxzBC:HLPX:Z014578write_opt=nodircompress/dev/rmt0/dev/rmt1/dev/rmt4/dev/rmt5/dev/rmt7/dev/rmt8TAPE㿘 %)`J" *` €u<uHuuuTu`uuluxuuuuuuuuuusxuuuutuuutuuutuuuuuuuuuuuuuuuuus8slussuuuuussustLututttttut# nc@4! >`$ HccH@ 0 $ n# >"`!$" nJ -  >J "`t  p"` > l"`0i"$  >@!P #!@!xY$c = "cT" =#` > > "`Đ "$# E"  B$@$ > <"` > 8"`Ȑ 5$# > ."`X > *"`D >'" D n@|c "0!` >  >"t",!p ! !!!! >"`@<ʔ!(??#@*` @ c !"c   $@@ @=` 6@@@ 0  !` 6@@@ $"! > "J @!Ѐ $ J !$ ABC:E:H:I:LM:O:R:SVabcdfiklmoprstuvUnknown -H format: %scpio: Known -H formats are:H  >9 >" d  ' /7`5#*` €xtxxzzzzxyzzyzzyzzzyzzzzzzzzzzzzzyzzz<zz(zzz<zzzDzXzzlzxzzzzzz %"b# nc@!`$"ccH@[ @n! n# H'!̐ @' L "cn#c@? '#08@ )- 8@#`` L@8@=Q nJ@ - >J` D"A" >  " D;  > 7"`@ > " 1  ,"c > "`('% > "`  "c$@B > "` % '  >  "  @.{?&?B (sې" #%BqȐ    @ @ !    ! " % @`@  ` H"c`D#*` €|||||`!#@5#@*`@ #@@#@ $#@0%#@@`8@l @?.  >"`!#@#@*` #@@#@ $#@""%s: Invalid combination of options: -%c㿘 > %`8@ ) ' J?6 `8@! @ <`8`?"`8 * $8@= 㿘@q@@   @These format options are not supported %s = %s 㿘 @`b@ !1 8@I"0 2@ Invalid option nameInvalid options formatUnable to allocate space for option list㿘 N  bbb@ 3?@  ". %L (@ڟ , 2,@@ڙ = @ ․`."@ "`"` `@ D"D"@$D"  2L 㿐@   \ 4W`U@Q J@ k" m b x0- w'J@4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`$  @'J@ x  *` @W @   usage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-o options] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...]  pax -r -w [-diklntuvzDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘! 8 !@Β' @ɒ%  @Ē# b@@ "`@ "p@ "@ "@ "@@ # @ #0@ #`@ #@@@# c@ #@ #@! @! @@}@z! p@v@f usage: tar -{txru}[cevfblmopwBHLPX014578] [tapefile] [blocksize] [exclude-file] file1 file2... 㿘! 8!"@T!"P@P@@ usage: cpio -i [-BcdfmrStuv] [ -C blksize ] [ -H header ] [ -I file ] [ pattern ... ] usage: cpio -o [-aABcLv] [ -C bufsize ] [ -H header ] [ -O file ] usage: cpio -p [ adlLmuv ] directory 㿘! 8!"@!"@!#@ !#H@!#X@@ Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘 !N` !c@u   ",N@l "N`@W  `"`(@8 [?,@Δ @Ֆ$"``@$ @E?,$@ $`L + '"*`:  P"` g G" `0  p"`0` $` $`@jW@,@ ? L  bp $`"t ""t"`""t"bp Empty pattern stringUnable to allocate memory for pattern string㿘 "N  b@Ԑ  "b@ ?$@$ h$ `$ $ "l ""l"`""l"h WARNING! These patterns were not matched:%s 㿘"h  )" 2 `%'" @}# 8@Ԓ  2 Pattern select out of memoryPattern list inconsistant㿘h #`   > `   X$  DS !l`23h 2 * `2)h2*@҈   $#`h@1  ` /*@1$  ` /*@$ @u?$ J `/ * $ $ & h       @"@`& #`@ ?㿘"h% & > `. > (`3?1    "  L@ /2 @ @      2  > ( `? (`&  Z &?& 㿘&* : `?  `[` `*"9N@-N@6: N@  D!l`1/0?&- N@ ޲`'?  **  "  N@͔ `N@ ?` `@ 2?:  `?J !`?`   ( 8]# 82J" - J  ] 4 @$   : " (8]   㿘"p`  @C  (      >, ,@3  > Ȁ`@i     ,@ ,  ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐 >$@n"X-$+$)$'$%$#$Ő@c@ab@_"@n, %@ @R0@ϐ,O@Jc(0〢  .$@C#H"  O  $$@8#X ?$#@0 @˔,&? 㿘 @ ? ` ,, @ ? File name %s/%s, too long㿘N@`/  "@, %ap@ ? &@*@  ? * . *@ .  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s ?#Pbp@P DP-%1   @   ,@ `@*X@m 6 @ ^@@ ` d@\" L `  ` X@! \``2`>@ L  ,@`@  @,@L  $%b` @sP$ OP OP  % 8b@ OP% 8b@POP  Pɔ,&@ 㿘 J*:`D`&`\!:N 0 94 :?Ѐ., @: \2 .N \ &2. . ` `  " '@4 ?*&㿘@ @v / >@ ) >@^ \c4@j `&"*` € >  >K  > >Ց > Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘  > >"` "p&c0&cX@ `@  > `@@ LC_TIMEUnable to set up signal maskUnable to set up signal handlerX @   ?@`Ւ @   ?@`ʒ @    ?@` @ 2&?@` &@# ># x x @@ `@ ` @ @@ #@ x&ct'' >#`#`#` "'''' @      @ Z @ڔ 6  2  @ϔ H @Ȕ 6  2  @ 6 @ 6  2  @ $ @    2 В @  Р'А @ @     n"'@ ?㿘#p`@ 2 #t`@ 2  #h`" @=   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "Q?N ##cp 2 N!=@  $cp'7cN # \N  #" @Jo 2 (`@R *?  @ @J@7!=cp* @ " 2@N  cp(` @/ ?"@ ""@㿘 (!=@p* @`"  @ 2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "Q?N ##ct 2 N!=@  $ct(7bN # \N  #" @PZ 2 (b@@ *?  @f @P@!=ct* @ " 2@  ct(bh@ ?"@ ""@㿘 ,!=@~t* @`"  @ 2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N )`P@@ / "N,@`N &) А (, *: * :  .2`h 2`h @  )J 2 @  `)` L@ 2$  +$  @ &)* :  M"  c C *` m *   $    $ `:@  Q)` @ ޔ@' N$`$ @ 6 )` $ 'L #@  6  )a@  @$)  $  @ )a(@  @ ?ch $ "#l"ch  #l "#l"` aP@ h ?h`C<D`  & %  @ '*  `%   @    @   ` ` `2` `?㿘N  #D  `2 .2? 2? J 2 @ @N` ?L??Г* @L?*`В@ $ $@:"?`  *"*` €TTTT0T N? ?Г* @N?*`В@ *` *  * 8$  N?Б*` N?* ?А @$N??Г* @*`N?Р@ D4$ d$ N??Г* N?@*`@ $ N??Г* @N?*`В@ $  N??Г* @N?*`В@ $ N??Г* @N?*`В@ $@&@?? Cannot allocate memory for hard link table㿘1# 2 )@  &# +`h@ U ?Hard link table out of memory㿘/㴀`e) `-$`+Z `)@$* @ / @  2   @    2  , 쏔,  `&,  &  ? $  $@@@# @  +@J  $ `$  $$  $ @ $  "@@s+`@  ?㿘#`3 $`.  ) ' %`@)Ǔ* @  @   2   @    2   "@7@5㿘'㴀  㴑,@ ""@`@!@`2㴁Cannot allocate memory for file time tableTMPDIR/tmp/%s/%spaxXXXXXXUnable to create temporary file: %s㻘1# 10 !G@  &#,`@ W $?,@ @ , H,, XP@3$@I?"c@ϐ   n",h@ ` ?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐+c 2  1G@ݒc* @`:- n/,@2&``!#̒  @I `  ` @#p@  Y?@C@琔 ```2@`  <` $? $`< @ Ր  -!#̒  @  <`#̒@  n <c$`$@ $`"", n",@   ` n",,a@  `?@ ?Cannot allocate memory for interactive rename table㿘1# 2 "@  &# -`(@ c ?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘#c -`@ 8 F @"c* @`@@І ```2@``@y * @ `@f &`-`@ & -@Y &@@T &`c @&` "@@ @@ -a@  ?㿘!# @@ǔ"#*  @: 2  O,&@ 2Cannot allocate memory for device mapping table㿘1# 2 !=@ߒ  &# -b@  ?㿘 @  ? Device map table out of memory㿘%`"* @!=* @`2` " @   ""@ ""@-c@ m  Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘# `  +` @ 2 - " *     -   2 " &`U& ``Pz  A`2#"#@  8.##  # $ #cд  $c]  в @ T  .   &cЀ .@   c##  # $ &` & . `@ː .`@ǐ  Cannot allocate space for directory access time table㿘1#Ā 2 !=@ђ  &# .c @ ?㿘%Ā  đ,`@ " `  )   2`a<āDirectory access time reset table ran out of memory㿘%Ā 1@b!=*   2     2  @ s  /@Ʀ  $$ $ $ $ @$ "@@ ֐/`@D 㿘#Ā %@*!=*  @ 2      2     "@ & &@ @ 0?Unable to create temporary file for directory times: %s㻘!#Ȁ?! ,@ܵ @ , H,, XP@$@  $#/a@ ?@v Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sx!#Ȁ 0  @   ?/#b?#$ @`''c'' '@ ؀ /#Ȓ@ ٔ / >` "`b@ Unable to set mode and times for created directoriesp)#Ȁ V+ >` @E#Ȓ??@ ̖  >Ȓ@  8ؖ Ȓ @  0Ƞ@ Ѐ (ؖ Ȓ @    > %쀢  > #$``͖ ``@ #@ #`?@ %#0`@$ 㿐`@  @6` `   *  @`'  * @@ 㿘 $ԙ $ J$J ?`   " @ 2(* ** *( (0(2      0( :( ?   @  2*( (( (* * 3` ` 3  0* +   0*:* ?  !    ustar㿘a$?N 1a!@    演 Ғ"? ?write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘+ >'1)1-1$%1@P !1 @J!   !@  !c?  @ِ  ? %` ۢᘰ 㿘" ?  +& `$`&& . d&,`d : ' / &`l 2 (& `t + ,& `| $ !  P> `  `D& <& 4&   > `> N` `1$`22#.,   , &` d&,,(  & , &`Ք d&,, @+&., &,L / P  ` & `$ & &  " a  b ` &  & `>> L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐'` 72"*` €$@X˼ˠpˈˠˠ˼ > `$ɰ  2a 2a 2b 2b , d2, b@   d2 b`  d   ` >,` @O d? /,@ ` 2  1,`, Ҕ d l   l!,` @/ dPl    2Zb " @ b a>  `d r B( `l h 8, `t ^ .< ` T  $!` I  l! &?  ѵ ?       2b@    ustar 㿘a$&?N  !1a@  3?bx@    > "`  V l"? 㿘Ԓ" ',? $ & & `& NaY  aY @ /,@  d?"@,&`d  % / & `|  + `P> `  D&  <& 4& `,.aHa)@1ڒ `t  & (.a(a @1p `l  &  >`)>  0& ., &,N``7`4!*` €ӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔӔllӔ  @ & x&    & & $ & M /2g &c,@*:  4     & & aI d aQ _ * , ? @   0:& *:  2    (  &   ` & $ & & , `" d&,,`P  a "  b &` &  `>>  Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠)    5I`    , d5, <`( @= '5`H1  > ,Y⏔  /, Y @ ⃔ d  ?` n5!*` €((||| 5,`` @Ԕ d>,aI ` 4 3,`` @ǔ d0c 2 aI   ?  2  aQ   &  6,`` @餔 d,aI ` 1 2,``, + d,aI,aJ,aK,aL,aM,aN,aO,aP,aQ,aR,aS,aT,aU,aV,aW,aX `|   71 `  0 7,`` @r d P  " a b > ,aI,aJ,aK,aL,aM,aN,aO,aP,aQ,aR,aS,aT,aU,aV,aW,aX`|    5s`h1aaؔ 5`aӔ   `d   [`(`l   Q`,`t   G< ` }  =@. @. `a 5  ᚔ a)5  ᒔ Β!` Y  |! &?    ?       5`@  `d a  H *`8/*` J*`" `4 ` rcan not open %s: %spathname too long, line %d of %s㷈6b@ϐ   nb!6@ "@ S? /H96 "Д@J?`  '쀤 $  .1 \L@*?,#D,@ `2 @@0U 2 @,  @,  ` - -  ^// $- -  & ?@좒  /dev/ttywrFatal error, cannot open %s㿘#7`@  7@ɑ`!  $ P7`@ɉ  "`T@' P@ > Ȁ`7 ``@2 ?㿘! P'H'L'P'T'X H@p@y P㿘`  T@ 2. ?@ 2* %s: 㿘 'L'P'T'XL > "` > ` ! > p `8@u $ p > ! 87b @>@-@e  <%s>㿘'P'T'X P > "` > ` ! > p `8@J $ p > 87b @@` !7"@@@0 㿘@ fhns.%s0@% D! D#7"  n ? f D0 s  0   "a| $t$!p@@c?• h#@ D!p*ax@& "" "@  . " `. @7@c@I @ @D@@t`?@ < ( 2  n ""7cД@ @ǒ 7cД@ <  "@@@  @ `@ @i%s/%s0 D!p` @ۛ 7M#Ѐ"@ۦ   D<   D!t`  D@}  D<   D@ /  8@Ӵ$ D!|`  D@P  D n"쀢` 7 Dax€ 7#В@k 0 Usage: %s [-fhns] file1 file2 %s [-fhns] file ... directory 㿘P`8 c@ 8@ 㿘@HLPRfhthe -L and -h options may not be specified together.%s%s: %sfts_read㿘@t/9 @""(@@ / `@ D"!J+ D`o `?%a   ) DH%9`)C9!*` €         %! D "a @@v0??c@&*  @@!   2 ` 9`8@Jo ? "0#a?- D+ D%a`%@@Œ . `@@ : `@l*@@@`@f@`@C/ M 9`p(@L ?` 59#t*` €,,,,,,,  ! .@EE 0) #9 @ݢ`x@E  !9 @Ҡ x@:  Āa   D!`9 @jO p @Cِ 2 6 n"쀢`9`@ @Ðgroup㿘N  Da@> 2 :@"`$$user㿘N  Da@8W 2 :@ a$$%s: invalid %s name㿐! n$"@Ք "쀢`9`p@ J`:aX@I usage: %s [-R [-H | -L | -P]] [-fh] %s file ... [owner][:group]㿘 D D!a: 8a:":  @K @M 㿘@unionsynchronoussympermroot file systemread-onlywith quotasnosuidnoexecnodevmtimenodevnocoredumpnoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿀@[ #H  ' p':`8k;!<*` € $,<HpxĬ ,  D ("a%@! n#J@  @g`! n:c@Hm @ ## @ @ D "a @@E??#@ *`& ^@    0053:1;+;+);@c "  @  "   @`  @  @Ē    `? #\@$ 2 @GP 2 0@<=  ;`@  ,  <@ 2 @[ @̐@@d@@@@ ';@`(@Gߐ @GC L $ <L, @G5@  :@G@ 2:;@`P@G  @c ; @`  ; @` " ;@`@G    #\2 `;@@Y` ; `@#\ @@%@J  ;; @`Р ;`@r쀢 쀢 @ⴒ ?  n"쀢`;`@v @Ȑ@>,㿘N@ n N` o `@  #< n J` o  `@_ "   @X 2 `?  @峒b 2J@@:/usr/sbin/sbinrealpath %s/%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: %s vfork%s/%sexec %s for %s%s not found for %swaitpid%s: %sstatfs %sx'L@n 2'L<L(#`'@Ӓ @Β`2 < 2<;`@Đ<L@c \@7 4@:   ;ؐ *; D#<%<, @L`L@ Z 2 @`<@  2 a c<ДL@  ݰ <c@~쀎:c@x@ @<c@pH   @L@J%?24 @'@!'<@Ғ$' "' @l D*``"`L*`"+ '" `'=@  =1=,  @   =@ @M?  7 =@f 쀢 i @+ D!`"@F #L7=5 n3=$ @y@E쀢L`(@f]  2 n"쀢`L= 8@'@! "@@fQ = P@f> 0* `2   D0" ` != X@䈐 L@  D!` L@Iu =L `@f 0@" %s on %s type %.*s%s%s (, %sunknown flag%s %#xs%smounted by %s) 㿘>!X  L @  < "X  ->+>)>`@` " ? 2 , pax!@@,  ` >!>!x>!>!>! @ϖ ( >!>!x>!@ @4  ( ";>! ( @>!= @㿐@9b  @6 ,` @  @ L `@ ,%s㿘@ِ@֐`@>@e&@Ð&-o㿐@')'<,@,N  -2;, $@ @D =  ,  .$@`@  , ? `x, $@$@  @j⸰ 2Ր&@&&usage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | node㿘?????a`Ș!ؚb@S 8@U 㿘`2 @  D!@E `@  D! `?malloc㿘 2N4 n N  o2J@ D "a J@ ," `J@  @ @ґ*  ?@d" $@ , `$@  @ , 2*@, $@㿘@+㿘@@! G# F@ 2!@`$!@@@-Đ!@$$!@!@ 3c, 2# Ga@ `$a@@-@-$@鹐@- @$ * , $$a@?$a@a@` F#̀`@i㿘@ "0 # G' F @ 2#  *a@ $a@$@ @ @a@$a@a@  ̀  @8  2  㿘' G@ G $@aP @  $@@ @ @ &`@?$@@` F#̀`@㿘@ "  @7 2 `    2  alias %s=%s alias: %s not found 㿘   G!P ,`@ "`1@ J@ " @C# 2 ``&,`' `@`")'@%@`@ =  2 "4@CĒ   @Cʐ`*`@``a㿘!Ad 0@4% P  a E@   #@#$# #㿘N  *  *N: ` @7 '1 G* !PHOMEHOME not set.CDPATHcan't cd to %s(% F@3 Ec   A!0@Gd  2LA@!8L  A !H!H`-2LL  2L E"`     2LA!HL /A!P@G=  '''<$%@ґ  `N . N  /N  2 @6@  @  ڐA!X@@ ..%s 0@@,  % E$@e@3 G&b N7< / ? &b @,,@`ؐ $ب 1 GK / H . L  A  +A" ? &" @,,@ `` % G ? $ ,@@, ,@ L `@Ȓc b 2,@@,p,@<@ < (  @A 2L! G!@`$!@@p" !@?$!@!@`+? F#̀`&@X @?!@$!@!@   F#̀` @E  J !`  `A@B\#   E؀ J/ *` H/*`2("؆"؁PWD㿘@ V "1 E- 1 E"` #@q! G!@` &"`$!@@$``B@)@+"  E"a@~@% G$ N+`/"c<N "N?b ? $b ,@+, N  N? /) G ? $ ) G /3A@/A@c 2Nc<7#< G ? " L`/- + ? &@H !" ? %" @+,N  # Gb ? $b ,@+x, N  Q c< ? $  /,@+^ /,  2,@+T! G*! G!@# Eb` $!@`"@ɐ c<@*z$b`B%"X@D !@$!@!@  F#̀`@E㿘@1@@`"0? "@@Đ "0  * " getcwd() failed: %s#` 2@i! )B@ȫ"X  nL /bA!H@Ј? n@Ђ(? (@ n,@  nb!C@"@G@*$`-n-e㿘   `@ Cc@ C  @c 2@ `@:  \v#tb0 ?Б* : `Fj C#ԓ*` € \\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\`\\\\\t\\\\\\\\\\\\\\        L?Ѐ  . а@  L?#b0`? "`@?ې b0@* "@ .  x @ !"0?  "@?Đ "0 * " *@`"@ ߲`!"0? "@? "0  * " 㿘 E" 2 G@"aL@ 㿈 G!@` Fc̐ "c0 F"#'''' @څ  E   J !`" א @C @ %s: 㿘 F"# G@``"@! E! D"@?cH"@@'3b4? "@?H b4  * "@?㿘'H'L'P'T'X ˔H㿘'L'P'T'X”L` H8((Ep` HF0<0>argument list too longsymbolic link loopremote access failednot enough memorytext busyread-only file systemno such device or addressdisk quota exceededfile system fullfile table overflowis a directorynot founddirectory nonexistentno such fileI/O errorpermission deniedinterruptederror %d㿘ER`P `P`R@ `V?"R@ R@  1 D!Ep@?2 㿘 D @`)#@' G#<$ `   ? $ @(*L "@1 G" ? &" *@( * L @ ݲ` ? $ *@(*#@ @'ِ"@@ E" 㿈@(@& 1 G@ @(@0   @Y@( Node type = %d 㿘 2 E""  E "aF ؓ* €<  d xx Ԓ  E܀ w EC  ʒ  E܀ 2l` E" `"6 e`   E܀ ^ E E" `Y E% @c  @:0  @;K E@#F E   E܀ > E Eb 2   "3"b 0 E@F, E@( E@̒# E @   E"  r  E `?" @Q E@   EF @>  @=Ð! E"``@<`  EJ `  E" `` E@=b 㿘' FФ  $# E! E b -  ( + !܀ b  $ !܀"!܀   Eb$? "b$$!!܀   Eb$? "b$$!$b ?$Ё㿀@& ' # E' E% Eb $В@  #܀9  b ' F"@$b   ($% E# E  @@  ג ܀ "  b$? $b$ $܀ b$? $b$$ 2 А?$@&㿀@& Eb  E "В '@    !# E " @' "  a܀  0   a܀ " @&㿘  @.`?@ @x  2 @8  f` ! G!@`$!@@ R!@ E$!@!@` "  F#̀`㿐 '% E# E'b `$Ѐ` ` @ K & 4   "  @ > @13   2'Pipe call failed㿐    `% G@$@@{?  S+H@ ?' "  @B 6 @ѐ`@  /`@?$@@` ` F#̀``g`$ @ @: @ & @`"  @ @9 @ ’ `&@y@v @?$@@`2   F#̀`" /  @`$@@@ E$@@` "  F#̀`㿀@%?&@&`&` &`  E2""  E"b @B 6HS @ @w   G"!@ Fc̀@`" @ @9 @U @&` &@@%S%s: not found _'H'L@%= E"   E"!''#" 4 %`'  ` !`_D@ `D@ `" J ` `_J =@   @    Ҁ`'`""@   `` '``@$*   'dd $ 'dd$J !` '\ E",``d'\`,dJ A$ g'd!"`?  "`@:Ր " +*@`$"" +* $"؀ "#b ?  $@:b*@`$bb* $b@:  2 "!#b ?  $@:b*@`$bb* $b@:q  2!"`?  "`@: " *@`$"" * $"@:ː"` E '<'"؀ `% @u  2   2 d@ Ȁ?  E "b @:"02 ̀ 2  dd@ '2  'd`'`  Ȁ H"=  ̀  6Ȑ@x H  @@Ѐ  Hؐ @ q H G"!@ Fc̀o@Ԁ` H@ @8  @H'HȀ   @6W  G G E'p't 'x'|'a@H`#a@'la@`?#a@d a@ * H""  * F#̀`-@<   G!L`# G@)5p0a@)1pt$ax$ |$ $ $ @@l E E"b"H@   E"""' " ! E@?  ! E", m$",# G",% Ga@ $",$a@@?l E"bH@(p Et$x$ |$ $ $ @7,#"a@?$a@a@`  E F#̀` E Ea܀ H E"a""$H\ E@8b ̐ H@ 2    @"" "   @5 E  E'?#"('h@   G!L'hh   E""  E␒d"'#H* E  E E"`#! " E@9M" !b"0@9h"4h E ""( EH"!  E@8b  Eh "bh h  ̀      Gh7"!@ Fc̀:̀ H@6HW\"L$"" $K"@6 @5 ؀   @<  2 @=d E−̔@d( ! G!@`$!@@q!@ E$!@!@`!"  F#̀`\\d!"Hch@9 E " @8Ɛ0 \L@$$ \H#x@< @"P㿐   @4    E "@ 㿘 E@<b( E 㿘  @%` F#Ѐ4 @J`c   E E"!"b$ 㿘  E@%`! E",` E   E ""$  㿘  * %@&s*  Eb(   @;  2 @<` E−@  %s: %s㿘'L@# / @6 n % G! n  @'"쀢  2@!@6L 2춆  ~  "`#LaH z 㿘@eƒ nb쀢 2"b@HG! E@< @!+@ G$! "b@&` 㿘 F L@ `L@  @ :`%@$@!#@ @@!#@@ #<@p /, @[ G"L@ % @`" :`:` @` `:2&`&@ rv㿐  !L v@T 0"`@(<#耢  r E` E E!L |A "  @C  *00"  '@ " V   2  ܀ & @ @ ` ?@| @@76`$` ؐ builtin %sfunction %s㿐V    E" ` 'B@ @6?N  M!`@7V 7N 25N M!p@7N `-# Ga@3` $a@@"b0`"@6 b0  * "@6p@va@$a@a@ 2 N  F#̀`"N N 3b0? "@6~ b0 * ** "b0? "@6m b0  * "builtinfunc%s not defined in %s%s: %s 0'P@ / # n?b&`&@@1 ?&`&@&`&@@’ !L` "T` ܀ `@Ð `! G!@$!@@ !@$!@!@ 4``$` F#`?T` 2` ܪ ?% G/ F|7M@Ԑ) G `"M@##h  @ &% G@$@@x @$@@ 4`$`P`@#tp "% GL /27 n4 7 n% GfT` ɀ 2Ǫ% G@ŷ <    @\@U @@= MT` M#xn@v6T`@$@@( @$@@$` 4`2&T`̀ ""T`T`P `@Y "4!M#ݒ @5?&@T`,` &@`&`㿘cЀ cNJ 2   @ 2   2? EL |"  P2܀&( 2P  *㿘 E" ` ?)M2 N6 N#h@"  2N :  `L@N@ `:"  `:2*  * :  ـ %! ܀ 6$  ܀ & @$ ܁㿘' G@ E!L`|`$@@%@%R``6 `2  ܀&  @$2R`@*@@?$@@` F#̀`㿘' G@ E!L|`$@ T  2 $@@F @n@@ 2T *@?$@@` F#̀`㿘L * JJ  ?*  @N  E* aL    @ `  `$ 2# E! G!@`$!@@@ $@?6 &. @: !@$!@!@   E F#̀` E E"! 㿘! G!@ E! `$!@@"!@$!@!@  F#̀`㿘! G!@`$!@ V `@E !@`?6 $!@`!@` &  F#̀`a㿐! G!@  $!@'@Dʐ'Ӓ!@$!@!@  F#̀`E㿘Y   R` `@E  is a shell keyword is an alias for %s is%s %s a tracked alias for is a shell function is a shell builtin not found 㿈 |  E"`/P@3c@ucĀ c@JJ@2   @* "  2 P@3F!T @ؒ  "@ @3I  "`T''@  ".P  P0+""P(P`'P ?' @@@ ?<@ P"0P"H @3 @2"P  @2"h @2"  `㿘"cD @   E"L<@5Ҕ" 㿘  Ec<"!0 #c@ E E"a(! E1 G$"L&" "P@A`<" ? &" "L* $"L@A$"L *$"Lc@" # E@z"@c $ @ "c@e$ 0 @ @e "  "@$ @0c"c``"&`㿘N` ~ `@) G# E- E, <? ?N(?"G?," r? { :?E? " f?C =A" `?N? `N  @`N  ="`"" ? Q%" RbL ? %" bL@$bL* $bL" ?  :%" ;bL@d @(%(@" `? %" bL@$bL* $bLN ~2< =`" @ %" bL@x$bL* t$bLHOME㿘,  ``: ?_ /?Z  :2`2 , ,  : ,N   R@6_ "A, L@@ I  ":, L@ 5, @, `/`"!1 G3 E?`:`J` " ? &" bL* &bL@&bL *&bL" ? &" bL@&bL* &bL @, `ڢ`㿘) E"P h' E0`*0 " `# G- Fa@0`$a@@ka@$0$a@a@  a0̀ a0a0 0`$"`<%"P:%"P  %"PP@"P #"P"P`#"P# G+ FPa@@ $a@@1a@$a@Pa@"c̀ PP`P"P`4"`missing CTLARI (shouldn't happen)%d㿘) G"  @ E" "bL+ EbL%" *@`%bLJ#< *L?L?L?S͐ (L L??2L *`: ?"  L? L $ "`?H @ 6 @86 S8@1 L  L  bL`$ @ bL" "@ " %bL%"  EbL'Hc<'D&'T`! # E#@9 Ga0!@% 3 G ) E - E `D?a0'!@b 'X"P ('\'`'d@6$DD@X%"P$a0%(\`$Dd$ $ $  8'  `h@ b2'h, :    `"b N b ? &b ?.@?.b ? &b @.? '6耢 # n  ? G ? " N` 耢 &@쀢 "@  H@ E"b H`c< T@& !@ E?'!@!@` bL F#̀`|%s %.*s: parameter %snot setnull or 㿘'D?/ E$D(? ) G"   @E% E$L% EL*#<$D%(``T!*` €QQR\RSdT@3g L`" ' " $L%" ( N? T"`@0A{ &T?``T  F# l}`L,@ x`,"  *L  e`L,@˔ ``,?L?? J@?"``@*J@@8?:Ls  ;`@ M`?L?? J@?"``@*J@@8?L `@{ %`" L?"   4 @ɤ,$L &@" " "@ $L %"  /   L" $ " ?@ $L%" *@ $L@Y$L *$LL "  $L%" 㿐N 'H `   '􀢠_ #D ` @ = 5 E'`@  @3;   L   L <c"@``H @B XL# G<b " "@"$b L&L  !    `> L 7 3% E# G?􀠠* : M@` b ? $b L* $L@$L *$Lb ? $b L *@` $L@$L  *$L L  `?  N @  G!`   kV( €XLX|X|YHYHXXXXX8L@Ґ&L VL<@" MC HeEA# Gb ? $b L* &L@b&L *&LL<$    Lb "` " $b &LG    6 ? `@U"  EN  `| "N("(    2N2N㿘N ! @Ra: 7@  *? G! `* J %`@ 2J  8 @O Gaa2 G"* ?`  J  㿘ߑ* : `V#t*` €\bd\ [bdbdbdbdbd^bdbd\8bdbd`bdbdbdbdbdbdbdbdbdbdbdbdbdbd\\ G ! E! G!R!! E"L@א $"L   ' G# E N " ? $ bL *@` $bL@r $bL* $bL  0Հ` G! ̦?- G) E<`! L O 1 E# G*`: L` b ? $b "L* &"L@:&"L *&"Lb ? $b "L *@` &"L@)&"L  *&"L L   L "# G1 Eb ? $b "L *@` &"L@ &"L  *&"L L b  b ? $b "L* %"L@%"L *%"L 0S G  `     G! F-: ?7 G) E<`! L O 1 E# G*`: L` b ? $b "L* &"L@&"L *&"Lb ? $b "L *@` &"L@&"L  *&"L L   L "# G1 Eb ? $b "L *@` &"L@&"L  *&"L L b  b ? $b "L* %"L@e%"L *%"L 0 G="`! L  1 E# G?*`: L` b ? $b "L* &"L@8&"L *&"Lb ? $b "L *@` &"L@'&"L  *&"L L  0L # G1 Eb ? $b "L *@` &"L@ &"L  *&"L L b 0m*: ?Ѐ h@c c Ga_a* =?`! L N 1 E# G?*`: L` b ? $b "L* &"L@&"L *&"Lb ? $b "L *@` &"L@&"L  *&"L L  0L # G1 Eb ? $b "L *@` &"L@&"L  *&"L L b 㿘! E"P  E!0@ "P"@" $"P" " " 㿘 E"P` E!0   G  ` 2Y   h F#W /YL?   *`:`@6 B@L@.h@ @2 ,@ ",@ 3@~ "`` "$&`'YL?   *`:`@ "L@h   " *L *L2L  @= "`@8 "``"&`㿘' E0  E# G+ Fa@0`$a@@`a@$0$a@a@  !0c̀ !0!0  E""P$0㿘 X E' G c) EM 2< J@ 6` * ? [ !2J@a@# Ec %a@`2 #@ g( @$c#@/ @#@%#$@@ 2  F#̀`"2""@@o  $@*$@ 2$ 2M ./0   ? / /2`k + :  *9 ?6 [' !J ! @J@ ]) @*: ?*`J@? @*: ?*` @*:  /΀ `ˀ /*`J ! *`" J /*` :  ?`#! E#2 J? ?2. .J  `#@ @#0 / EJJ? + : ?2. .  / E　 `Z   J@ /2.?Z .?@ [　 /.?L@  ,@ `J J? + : ?"  ." - F̀ 4 /@ .N` .` #@x @u'@"0`* *` `  * *` *̀ @ /,㿘@Χ@ @t@  E" c`""`㿘 `@㿘'D`( >`,D?D$&@D "&@ @s  6&@&@@ 2 &@D㿘@㿘* ;    ???"ހ" [ *0h0Ҁ"N@N@?"`N@N`@а N@?"`N@` * :?"  *" :0 .?+*(['@ *`:   *`: ?+ N`;`@+ :  ?"``@ *`    N@?"`N@ `  !  @*: ?*`J@? @*:  W?"`` @]2*!   @  `*`: ?*`@`*`:`̘ *   :?%?2N * N -:N  ]: N?*: ?"  ; N@$  " * :`]԰ @2 "N@N@?"`N@; @`"  N@`? (8 !  (8J@"*@(8  2*@  *@ ` (*@㿈@lc<%  E@# G E"a(! E $"L$b "PŒ b $b "L* $"L@$"L *$"L@b @"@ @Lx6 /@= 0?,@0 ` -?,L  1 G" ? &" @ .@ `L  sh: can't initialize history rwsh: can't initialize editing viemacs㿘+`J `) G!H $`! G!@`$!@@OK!@%!H$!@!@  !H F#̀`!Hg!H  Ec`@ `]@&ǐ 8`J`U # EJ`M F`bX B`@ <' G@% D $@`! D]`X@` $! D" ]``@V $"`" G@W $bX!H@X9 bX0@X4 0]@& h@?$@@``J`U # EJ`M bXbX ! G!@`$!@@W!@$bX$!@!@  bX F#̀`bXbX`3`JM  ]JU (] @W 0"! G!@# EbX $!@`"# G@W $bX# GaH @N$aH!@?$!@!@` F#̀`㿐! G!H    dN !H@ !H d@P5 sh: Can't set terminal type %s sh: Using dumb terminal settings. 㿘 E"X   @W  !^"4`8@&^"4@&`Xhistory not activemissing history argument:e:lnrsoption -%c expects argumentunknown option: -%ccalled recursively too many timesFCEDITEDITORed-16-1too many args%s_shXXXXXX/tmp/can't create temporary file %scan't allocate stdio buffer for temp%5d %s %s( G!H'D'H`''''''^i D`2 ^b  m"c@g"D@TH?i?Ƒ* : `9V*`^" €|||||||||||||||||||||||||||||||||||||||||||{||||||{|{|||{{ G"' ' ' '  ' m^!  m^!@#@H*`@@ ^#@`H*@ 'HD#@  'D`2'`"K'/@  O`"!h@ E"b@  E!h␐ "' #!h E^#!h"a帐!X`$`2K@^!@)u   '^!@)n  '^!'K@ -2 K`  ''`DD` =H@@ 'H@'D'D*`'H`'HD "HD ^0`^0`^!^!^!@` ^!H`@P! @2 @. `  `  G@ "@^^a@`ܐ@ ]^!(``@ '@^!# GaH@NT aH@NO ?A'^` `@$Ӑ@$(` @f`# Ea @$a` H  @N @fҐH@N?`*@<@ɥ@ɡ@  ^b @`g Ga@?"a@a@  F#̀`U@ ѐ@`  Eah ?"ah Ea 2"a 㿘@n+c@) G%" c>>>&<<&<><<...???㿐 `i#*` €X  lLX,dl|   i " i# i#@ 0  !i  "@# 0i@# i#  0i@#( i@#0 i|#8i#@i#H@| i@w#P ik#Xi@o#`@m ic#hi@g#p @d`iZ#h@_ iU#x  " #ir  "@Oc   A1i@D#_  904 i# i# i#  i#i#i#    `0/@/@쀢` `0/ /, 0i#i#@}-+?=㿘; EcQ  E.H jH $ { } .8.@( =.@c`'c.@`N  >   @ .@>| .@c'c.@`c 'c.@`.@`.@`.° "you have mail  E "cp) E#p f@ Eb8` 2 E` c '|#p 6Q%#p E! + F|Zc蔒 "G%#pJ >#p `J@ 2`J /"*@V @ 6@  ?@:  4    G !k @"4`? "`@ "4@* "@$@#p`%#p@/etc/profile.profileENVH'D@'H'@  n G!L     G!L G!L@y G E  G #!#a"x'  G  E"b  E "b  G!L`  J !` E!` E@b @( G!L`!"4? "@? "4  * "@"@  G"a@ F#ؙ̀ &  '  @0a E@"b G E "@(r"a@D@HH  J - k'@" k'@" '@>@H@?@E2k@]"  J@ '@ J 9 ' G x`" ! G" ,  @  , ! G x "ّJ 9` x  E@   E@kb Use "exit" to leave shell. 㿈@ %) E)' G 2 `J `Al@w"`! E! EJ -` a  `?"a q @t!܀`"$$!" @J `   א c !@ @ Lऀ ̀ `1@J㿘! G!@$!@@G    !@?$!@!@`  F#̀` ׭ #! J`} J`= "J`E*`= J`E *`E z  J`}  ` *`= *`EQCan't open %s㿘! G!@`$!@@ &mՒ 0 Ȓ!@?$!@!@` F#̀`eF )%s: not found( E"`'@! / %< # @Ȓ  @A m!8׎㿈 E"(% E  $ @O @    @`M  E"  @ 㿘    E@?` E" ! E" @A Out of space㿘@ mD"ȁ㿘@e m8"ȁ㿘@ @bd㿘% @?@!a!! G!@ `$!@!@$!@#8!@ "<##8"` $@ F#̀`<֮<@""<$@stunalloc 㿘  n`  @Ͷ @<@"@"@"<8<"@" " 㿘# Ga@8 $a@  8 @$#8#8#8a@?$a@ a@"c@  ##< F#̀`]㿘+c@)#8-<, g " ? D"! G!@ `$!@%#8W`!@ $!@#8%<!@%c@"%#8 F#̀`.(Y@Ôc@%<%c@c< @ ? "c<"@㿘#D! #@c !#<@b G#< "" #@"<? G"b 㿘!# G#@b &#@#<"@$b <"@@   G "@" @ a@Ӑa@?$a@a@` ` F#̀``X`> o"ԧ !@O t¸f¨d˜s€cpmXl@p(nnofiles(descriptors)process(processes)locked memory(kbytes)memory(kbytes)coredump(blocks)stack(kbytes)data(kbytes)file(blocks)time(seconds)HSatfdsmcnplulimit: internal error (%c) ulimit: too many arguments unlimitedulimit: bad number %-20s unlimited %qd ulimit: bad limit 㿈     f%p"   a H" " @M؀  S-p  L " 2L   Ep" E#@ >`2p  p#pc(@Đ `!#?0+  L 94`, @,`B?Ї2**;@ C  L / pӷ#8: @ej `3 c#-p+p'p?@͒耍  2@eP2 2@]cX: @x h@P ۰ 04@Ǥ 2?耍 2?@W #pg#p  2#2 2p@$#X0 : @@ p#h@  (*@ `4 *@ J(J@8`  J  Illegal number: %s㿘@  q#@o (8Ѐ   (  quietprofilenounsetnotifyallexportnoclobberemacsviverbosextracestdinnoexecmonitorinteractiveignoreeofnogloberrexit㿘# E $c`$c% }  *?@} c@   G x`2N  *`5N  N 5 2J`%@' @"  2. J`% ` `*`% J "*``J 5! G@`$" G x` c E "! $c Z$"c  G x` c`$"$c G! *"`  #a #a##`#@㿘! @2L v&L %Bad -c option㿘  G"x- Ec _  #%#L - L ` `-*L  * F`2-`=A-`E >@ 0: +" 6"c *:  * % E'r c o  G `$x ""x؀ o @/@ "L`%@`L ܠ c #Current option settings %-16s%s onoffIllegal option -o %s㿘 2s@ϐ `s   3s%s`N @`Ȕ@}   `0  , @  @  $, s ї@J@ Illegal option -%c㿘 . :`   J2  `+@V E" * M0 ` s!o:`* U㿘   ,`2*   " $`! G!$@ $! ,`$`$` 㿘    @S  @M can't shift that many㿘   `% Gs#@# G&a@?` $a@ $` "?@&?  `""  a@?$a@a@` "  F#̀`Л 㿘 @S !1 G!@ `&!@ E#`l!@?&!@!@`   F#̀`r㿘` G!* " Usage: getopts optstring var [arg]㿘  tЩ!(`  G  G  " "*` @`OPTARGIllegal option -%c No arg for -%c option %dOPTIND㿈 ? ` L@ % @`2@ `" L@ -2`L@  ` ":  &x &L@`- @L` "N+ : @&` !ttN 2 : /!/@ 7a@:0!N : *:  2NN  :2tL@ 2!`2+:  : t/!/@ $ :t"a@ȕ:t!@ ?@@t`&t!@  t!a@ ":   & t'@Ȓ t"@ @//@ &@M'h No arg for -%c option㿘 E" EJ   E@"G J -2C J  `"J`- J *3 *N; @ s*` 2 aώ:N : *`  N  :2 J  G Ec "cu q;  G"" ; ׸װרנטא׈׀xphXPH@80( "!""esac""case""}""{""done""do""for""until""while""fi""elif""else""then""if"wordredirection"`"";;"")""(""|""||""&&""&"";"newlineend of filexph`XPH@80( !esaccase}{donedoforuntilwhilefielifelsethenif㿘 E"#t   @ Q E@"cl  1 G    G `@" 㿘' E  $!@ L`_  @^@`   $ `  $x "` "@ "`  k "`"` "@```0%$@l` G@, 0` "` ! @Q$L`0 E"t`@$ƞ G@ ?` "`㿘@% G@=``   $ @  " "" 㿘@1@   G  $$ $$` @$`@ $  $@ G` "`Bad for loop variableinexpecting "in"㿐) E %! '! E!%@@Y @ 7 Gऐ &ऀ`?@ ऒ`@&ऒ`sw *` €<<<<<<<<<X<<<  $ @$ @  $  & & @&  @ߐ ސ & @  E#|`ѐ & &  &@x "  @Đ ^  Ec|  $ @e$ @  @\$  @ @U  v! E!Ԁ v# E@ccx v@#0 cx $@=$ &!Ԁ #vcx@/cЀ   % E cx,& & &$ @"  E$#|`$@g?  Ec| && & & $ऐ &ऒ @%!    @G?F @$ @>ؐ  @$ @3 ͐ 3 E5 Ecx$, && & & @ - E|  vvcx@ÒcЀ v@;#ؒ @%!    $$@`@` '$%!cx"@,"`@"` |`" @   $` @%!   E@ @#!| Ϡ`$`r  $Ґ $@}$  @ɐ Ȑ @t  @  %! @?ऐ@0&#@?! E!%@@ɪ @T ऐ &%@`  " $1 &  &$ %  && 㿐`'H  H'`?@"  G`  5 E"` - E+ E) E @  | xa,& & &&@   !$@q 0 @ @ @= &&  $&@$ϐ  H&& & & `  " "㿘  Ecx E, "" " " Bad fd number㿘"& N@?Ѐ` @N` *& *:  - N` ? & y@ & Illegal eof marker for << redirection㿘 E@a "@א? <? E! Ea@ $`  ExJ`  ! E x "xJ  x! E@d#x  y@T#x  Oy@Ґ!P#x Et$@#x`$`"t@ 2 "@  Ex 0r$ 㿘# Ebt +% E1 E/ E-+ tl $t@ $l @ a!  @I  #x"," " "  bt"` 㿘@ G`"㿘' E@Oa`I`$  @A  0 4  E!Ԁ`/ %uĠĀ # EcxJJ@2   @̒ Ġ  2cxƂ   `@?%a$:   E"c| 2$$㿘 G`  E#|"` "c|  "c|  "c| + Ecl @ %cl!- E%' E% E) E! EH? $HDJ $DZ H ? &V ; "Fa ?I HnH #hS \ (X )Z] |<W ?H a#t %`$a@ H@ H3 #t $a%cl$#|1 $#|.  &v E環  $$#| |p E爰  $#| ;j E~  $#| $#|   $#| ` @# Missing '))'Unterminated quoted stringMissing '}'Bad substitutionEOF in backquote substitution!'Ha E" 'L'P@ 'T 'T#@c< G'\"" 'X'`'P'L'H! G" Hy'\HK@` <{!$*` €X<x`H @> G \?" +@ E#t``"ᬀ'\  @  Gb \?"b L`T`  G G" ?\"" +@`'\ Gb \?"b ?  G"   \T E#t`@א  E@Ӑ  E` \ ` $ " GL`" "  \\"" +@`'\"!N` L G" ?` X G" ?\"" +@`'\X Gb `'X\?"b L`  G" ?\"" +@`'\"!'HL`  G" ?\"" +@`'\! 'H'TL`L` P`L Gb \?u"b `#)L`X 'H'TX`g'XP`  G" ?\"" +@P'PV\ Gb \?O"b H Gb `'H\?F"b H`  Gb 'H\?;"b )!L'L G ?\?" +@@'Ha@ \`'\ "'T 'T Gb \?"b +@ G"  )\""  +@ 'DP`" \?$" +@`'\ EaH? "aH EaDJ "aD4! GH#)@2z@Đ# @  E!$` PL`P{@ P`  G! E{"`@  \?" +@<`#@ L`'\ > <X` \K@ b?Ѐ  0^ E "c| X E` E"!"a,\ E E "cx"| L`D! GP`  Lh LK@3! G5 P ",! GLK`  `JJ@2JJ J J   E#t` E""l ?@; ! G  @ > &$  > & 6$1  1$$  <  > & "$ ${  $$ u 1 E" &!@ -!@!@  "`  "  $ $$,`:  ?$  EY"! (% {#?   _cD  ` ( 1 `` ( G"  $\"" +@`'\ E (  G ( L'D ?\?" +@ #<`"  +@#@ `'\ {  #2   }2  #?1  . _ cD  `&?! G #H _cD @ `A G" ? $" \+@'\*\``'\?, • ?Ѐ ! G" \?$" P+@\?К`` '\ G 1 ``  Gb \?"b :+@\`'\{@1 0 Gb ? "b \ =+@X'\ =*\`'\`& %" # : #  2  @| "{"   `T`2 L` #<@` *P`'P Ea$h@7'< ! G " E@ Ed E"a$"@+ !@1#< \$!@#@ '`  E'#<@ E␔h'd!@"␐?$!@!@` D F#̀``D`}#@ Gc<"" % E5' E+ E){l @ $l 9 \?: >? `9 A G}  \t `&@ l@ l ` $T` "  ? & .  t &$l H@J%` ? & v. b ? "b k. c<&   Gc@ " ` ` 2 $D E"`"a$ E#t"#t'8 D`8 E "#t "@ڐ D`"   G" c@  #@#@1 G&" c<!'\\@! G!@\ " $!@@"@'\@&" '!@?$!@!@` < F#̀` E < E"a$d EL`"T`  G G" ?\"" +@" ?\"" +@` !'LH G '@\?" ?+@`'\T#)` 'H  "\?" +@  \?" +@ Gb \?"b  ( 8" " H 2  (   @  _D  `J@ @D _ `2J@ J@ @ %s unexpected (expecting %s)%s unexpectedX  E#|ubh. +`@@ @ @0  Ec|u"h+  @ @@ %s: %d: Syntax error: %s 㿘 E!  E`"@Xah"ax@RČ 㿘 E"X E"c@ @ E" G  G  "  "%d: %s㿈  *@?<*@``/ ?`  2@ ? E!"!%@ hO) G7 F-9 ?쀢   "U D.``T@??@ %@ @@ ?! ' n쀢  @Y !@ F?%!@!@`̀ ë@t"4@@Ր!@?%!@!@` `̀  `Ó`@Đ` 4 %42 @"  2O逢 ""b0Oꀢ ""b4cannot create %s: %scannot open %s: %s㿘% G@ `$@.@?`8!h*` €  @̐ D0% & & " @! +0 `N@  .@ @ϒ0@6@1@Ð@N@?$@@` F#̀` P nb!  X nb!! NPipe call failed㿐@   ="   @`"  @00& S  !@ @.  @+  @(  @%  @" 2  @0.@@ @㿘) E! 'T@?"  4?$4@АT@ & @=@T@  `! G!@%!$!@@!@$!@!@  F#̀`z4@ 㿘 E!? T &4@4``   㿘@Β 6 n"쀢 !?@sp"›%d: %s %s: bad trap㿘 4`) F# !. @" !@N  !. 0@i`  ``@ 6) F' G-+ FN  !@b@ $@#&#.   @h $@E@?$@@`2`c̀ `@  㿘% F )' F"! J " # Ga@ `$a@@9$$@: a@?$a@a@`2 ̀  (㿐 F#.  ' L    E!`;`: G?`5 d*` €                      J`2  G x`2 J5   G  J !J )`2  G {N`@;   J )`     , ,.L `  ``" ' " "',@' @㿀 @? &@ 㿘 G`|? @? @m  ,@㿘b@d   E F#`" " G`? *@ #"㿘 G F #`# EL    耢 J` *b , 0 $b  E""㿘! D"Ȁ    $"ȁ('D@ː @Ɛ  F E "bJ "  E@y""̐ @,D㿘0@ 㿘4@㿘N? &`@@*@`&@ N 2`"4@ @V㿘V 2    Ea  && 86  ! G!@ `$!@f!@&$!@!@&  &  ! G !@,`$!@ ]& !@$!@ &!@"@& & 2  F#̀`"  3 @ ?& 㿘@!@"㿘 ` V  @k" 6   6   && 㿘# Ga@a  `$a@@f $ $ a@?$a@a@` F#̀`㿘'L'P'T'X@DL㿘b0'H'L'P'T'X@7H㿘!"4'H'L'P'T'X@*H"4㿀?7'P'T'X?7@P '<*@`'* ' @*?(@:  %  ?  & *@`&* &' ?  `N@ -@` #`' *?д`@ .-`N@** ?Г:`@  .*`N@ *@`@?Ѐ  -``N@** ?Г:`@  *:  l q`@ `@ * : ` m"(*` €x|(x ?:    ` -    ? & o 0*@`& ? & c x*@`&   ?  /"8 @ @?-@ 2'`? ` N@ o@$! `%?   ?  & *@`&* &?< "%@ ? &  -*@`&%@,%M 0 ?  & *@`&* &< M? & Ԑ *@`& M 2 ?   ?  & *@`&* &?< u`$ @N`4`%? `  ?  & *@`&* &?< `"?M "? ? & } *@`& ? 4  ?  & k*@`&* &?<  ` ? & T*@* & ? & E@*@`&`@,  `㿘 % n@  $@`@ 쀢 ?  &㿘! n  @?")X,w) ),)8,) <<) )H,xx|) hOPTIND=1TERM=PS2=> PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binMAILPATH=MAIL=IFS= HISTSIZE=PS1=PS1=$ PS1=# 㿘 ؀  ئ   2@`$"`$ @$ $ ` ! G ` @!$ @" !! Ȑ $`"`X E"'D'H'L''@   ' E"DH@L E""%.*s: bad variable name㿘   _ #D `#D #D   _ `2*:   =2  "#H`  @ϐ@奐?  ?* =*`* @H@ %.*s: is read only㿘@'@ M E' G#) @1 "@  @r3 =" @  $@` `@2  @r# = €  ` @    E"8@$  $   ⾐ @?$@@` F#̀`,0 2 2 $ $ @$ $$@㿘! G!@  $!@ 6   !@?$!@!@` F#̀`㿘@ "  @ "      @q =  2  㿘 E"(   @ "  2 @~ "  @ "  2 `2     @q =  2  㿘! E" `" ` 2@`2` *Ñ* "`"` "@`"@`2` *"㿘 E", #   $@   @   2@@Ȑ @ w  $  $ @ 2 *%s 㿘 E"  " #  2 Ta 2  * p%s %s 㿘@J`r   Eb(뫐"  p`? 2`1 E Ec `r"c @pВ =  $ @   @ 2  2 c `$c0J E" E/ E "= - "3`(@ + #?  "K b0* "*@`" N =b0b0`? "`2 b0@* "@ 2 4* Not in a function㿘 E",` Eې h Ec  "c @  #@`&# 㿘' G@ `$@vN`-N   l `$` @ 7 @  @  2 @p = bĒ  f  $`$` $`   =$`  @o$  H @ E?$@H$`@"H` $@ F#̀`㿘 EbH ' % ` "bH @ @k 0  `$ 2`@]`0 2$`@]` $` $`@WbH 2List assignment not implemented㿘  @ ` ` #(vf㿘   !2  P#  f E`"  E#`h`" @   򀤠㿘@F@ "? ' G) F @Q "1  22 @ = $@@oNJ #   ?  $  2@ @$@@?$@@`  F#̀` [ 2  㿘` *``=   @ N  @ '1 E* " (8=   J@*8 `= J  㿘! G!@ E` E"!"$!@@@7!@?$!@!@` F#̀` %ld 㿘 C C`)#@' G#<$ `   ? $ *L "@1 G" ? &" * * L @ ݲ` ? $ **#@ "@""ڒ`?arithmetic expression: %s: "%s"㿘 E E?"b\@"x Ec#㿘+ Db    Ȑ#4,? #. 4' E! G . Đ " :@ ,` ) G$ $ @.   ,` ? F E%b""%  ?syntax errordivision by zeroyacc stack overflow㿘7 G3 E- E9 G?%\`' &bx  G ' E# F$c$Ī2@ l. R\  @S %\%\#R.\ +*#*R@ # E cĀ q  R$2c E"T$c"bx?`%\&bx Dj D|) "ؐ&.#8? $` ! D#H  #$"# $ "< |@@$<@= |<  $<<S, @Y " ! D   D<" D<@j$"  D?2  |: $<J "  D@cH D|@@$<<|#8" @ @$<<* |@#  Dfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflow㿘%8' D- E) |#<@@\ 8|#< "@ n l ? @6 8`, @ 8`$ 2` "`;$ܐ"?`) E+8#<  "  *` 4& 2`@&   @1`& &  8@` 8 "@`%#< E!8 `** 8@ #!"$܀   `8cH@ ܰ " $8@ $* 8 * 8%|㿘 E<1|@C#D\310b! D DH@@( / TR#b#"(T\b!S / /`Q(VR`(@ T@㿘.`P < D D P@▅(V \Q` .`.V(W2QP1"0(V`  㿘!% D#< *# G"bL G T㿘 G"`@/ G"b G ĝ㿘@% G"b́㿘@ G"b\conv option disabled㿘`@ %s%s: illegal numeric value%s: %s㿐@& ? G"`@TԐ @2J@ G"`@꽐  k m b x0 w J@. . . .  G`'J@ x 4 G  *2 G`@ G"! @\H "@ꁐ "`@| 㿘 G"  G"<  "@   G  * G G"b<``$   $ @(   $`$` GD G 㿘b@E 㿘b@@ 㿘b@; 㿘b@6 㿘@;@53ct@) c@% @!c@@c@??&c@@@[ stdin%sfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONV㿘% G<  #$ $  @z  $  c@S <@c@  ) G  "`@Ր "   0 $ $ &# G# Gb'"& @yߔ! $ b" & @yӔ! $ $ "` "` @Sc"@db @2<< ` @(? $<c8@S %b' G 8@   @  %< 8@ @ %bc8@S <<"" " $ @F b@b  2   @;    @fT b"" G`@@D @10" @bX ` c@SB <     a@     @ ?   n"쀢`  & 㿘- G ' G G Gb<"x3 G1bpx  }@ / G@ `` @:`<  @  g$ 6- d# @R # @ /@<       @ @ @ bp``$` x@  $`$x   $ x@  $ $x $  $  $   % ` `@k&$`@@! G<`"`  % `@'`` " €$`bp㿘 Gb"`@% G# @*  G#H@ G, G"   G"  @ "  @  $  G"`@ %s: end of device%s: short write on character device%s: short write on tape device㿘7 G⬨   5 G M#   G"3/+-  ?# "`   G( 2 ` `"(@P5c8"` "$` @`@ x nc @ "쀢  @Q x >  B; Ǥ@2   # "" "  @~"@  ⬐ $ %lu+%lu records in %lu+%lu records out %lu odd length swab %s blockblocks%lu truncated %s %qu bytes transferred in %lu secs (%qu bytes/sec) @/% Gx` "@`' '` ``8#\x@o d@P @7`!`!x!@oؒ d@:@! x !!x! @o d@"@  x !!= @#\#`@o d@@ 㿘㿘@Y %sskip reached end of input㿘 Gb< 2   @9    @ ?@>c@Q  6 )-+ G@<   "$?@ " ? bc@ ?"c@@ $  @/#<  #@Pߐ  2㿐 Gb      @9j     @ ?WU c@P     '7a@m D c@P   @; % @T  4/ 6  @P   7 'a@K?2  @P  `% G' @)   "  @Pw  `0`@* 㿘@sigactionsetitimerP@! ''@Q@,"?#@*` @ @C(@'?  @< @迒 D'''''' @Z b@P'  ''@ 6'c@P '''̐ @6@龐0㿘@jusage: update [interval] 㿘`X@Ő 8@Wǐ 㿘@AaFfRh:t:vonly one -t option may be specified.nfsgetmntinfo%s/etc/fstab㿐@P @2 ' Gf#`5a!\*` €z4zzzzzDzzzzzzzzzzzzxzzzzzzzzzzzzzzz<zzzzzTzzdzzzzzzzzzzzzzz& $  G  "c G"c n# $ G "c  n`@i @# G "c@V@G`??#@*` @      G# `@8  @V  ,   "<@0=<@Z  ?@z 2  /.  <@ 2 ?@m L 2 ? 0@ a@O @ @U 2 `@ @Vʐ/㿐@  2a@N   ',` L@u  Z "@ѐ < 2 @  L 2 %s: not currently mounted%s: unmount from %s Cannot MNT PRCBad MNT RPC G#  ` {p@  !@t  < @  @"   d @ǔd %d!X @d d!X @ dp@  d!X@L~ 0@Q 2 d`@t}   @Z @  ,@_ @ ,@Z : @T, :,@ "u  G#`!x@N G#`2g ! G#@矐 !@a 0Yd`@t>  2S `O#@2L ,  ? /?7`@`  ?h'`'h'xab'|'l @EK` @6!( @x$ 'h'p't'l #\#(  @4ْa   @ @ 㿘% G  @֒  G "b@ 4  Gb䢂?,/ ,```@]e  ` <& L2@]Q L 2  <& נ? 㿘 ! G# @Mw ", @YÒ . "  *#@Mj 2  `" @M_c " @Y . "  *#@MR    㿘'HH@K$usage: %s %s umount [-fvFR] [-t fstypelist] special | nodeumount -a[fvF] [-h host] [-t fstypelist]㿘c@}א 8@Tِ 㿘`2 @  G"@\ɐ `@  G" `?malloc㿘 2N4 n N  o2J@ G "b J@ ," `J@  @ @V*  @  $@ , `$@  @Y , 2*@, $@㿘@Ehalt-haltdlnpq %sreboot???halted by %srebooted by %s: %srebooted by %s~shutdownSIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die%s%s(can't restart init): 㿘@|!P- @\1  @\+aȀ  ! G $#    Q%`2L#D*` €XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX X,Pa  `! G#  h@ @@Ѐ??#@*` &@   @   @@p , 3 @. @. aؠ  ,d @B  !!@S @Ố  @a@K 0@! G  #@@d "!#  @ "a! @ٔ " b @|b @u '"0b8@AJH` @ @| ? bP@K{ @|i  @|f  @|c  @|` ?@| ?1 n"쀢  @"`#@I"x@) `1 n@@)  @),  ?@| ? "쀢 @pb" @|p ?H"@R@" pusage: %s [-dln%sq] [-- ] 㿘 G#`"#"HP`c@{ې 8@Rݐ 㿘@ xp h `XP H@8 0 (  !"#$%&)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operand㿘@z@@Zb؀ 2??. @@Zb "&@b@9 ?`W#*` €\` `J [`?`J@ !B! GJ` ?``J M@ `J@ !J` 0! G@H` Gc )! GR  &`` G@"c$2`?`J@ !! GJ` `@-`  Gc ! GR   `` G@"c$@ ! G`$#$@`@'#$@`?  `$#$` @b%s: %s%s㿘  J a(@߹ a0 @ߴ 㿘@!! G#$$#$@ $#$#$ $#$@ 2  ` ?$#$㿘@! G#$$#$@ ##$#$ $#$@ @ ?$#$㿘 " G@ c$"c$@`?argument expectedclosing paren expected㿘  %b %# G! G#$$#$@~#$$#$@v &Lbp 0Gc 0! GR -#$! G#$ $#$  [bЀ " #$ #$ ##$@@!`?#$@p@@r@#$@:`c  #$R  @ #$@@@ 㿘! G#$@`$#$@`#$ G$#$`c b ?* : `z! *` €d|8`@X``?@XZ@ @XU2 @X{ 4O  0L@@D`?@@;@ @@63  00@@4)  0&@@ݐ$  0@֐@Ӑ&  0@@ @@y0`  @n} 2  @n^ | `x#d*` €0DXl(((( @& 5@& 0@& +@& &<  < < < <  < 0< ( %`?6 ! 6  6  Ȁ  ̀  @M@M@ `? 㿘   ` G"#  T "#  `  G@W  G  2 G"#  '%s: out of range%s: bad number㿐! n$"@=c "쀢`a@݊ #D  '  @ ` J aД@s  Ȑ@m   @m( L@4  Ȑ@mq   @mk( L@&  Ȑ@m]  @mW(  (@, `?㿘@ LP%s%s 㿘@w  #"  P" @o@}c? L#@  @a  @ @ `2c@G @Ge#@Nː PWD.0@e ": L@ /26 @l?. @l?&2$ 2  @ `  n "b쀢  n " "b@J  "  @e. usage: pwd 㿘a@wy 8@N{ 㿘#. b@@i!# @f?$$@㿘@[ @w  .  @: @w{ ݐ n "b?@wr  P".  @'  =L ",``? `@2O  `  L   `A@98  nb"쀢 " L@@  OL F2??@9  n "b?RCMD_CMD/usr/bin/rsh-l/etc/rmtexecO%s %d Ȧ)# "p0 ,?2?,2N n "b? ,:" *@*@ N` @*@ N? @2* @RO ?N: *@ N` :*@ N, N  #,@n@?˦"@i@?"c?@? D@| @}@w @t@@r @t@n@l@ @d@@ߘ@c#Ƞ #ؐ@' / `O0  c#\@Q0 @I @)J @MF @:@7@ @@cǖp͐???eC 㿘c??אR%d XH@c @? ??  ? n "b?",`@ה @W%d X@cl @r? ?@u  .  @ @u M n "b?@u sL%qd %d X К@c7 @=? X:  ??I%d %d SX !@2VP@c @?"C?6?!@ n' aX ?"2?%? ". @@H  $  V    ܐ n "b?  *. /dev/㿘@PȒ :   b@j    㿐'P'T'X'L  8?? @j\㿘֐ 2 @" 4  㿘 ?@ݔ0ݔ㿘 ?@Ŕ0㿘ِ  @Ӗ? 㿘Ð @0?㿐'P'T'X'L ?@0㿘  n@ޜ -"b?㿘  n@ޒ -"b?㿘N  n@i -"b?㿘> @0F"㿐'P'T'X'La  n@a -"b?㿘P 2 @㿘  n@i -"b?xhP8(pXbad parametersfunction not allowed with other history-functions-set the defaulthistory size negativerequired parameter(s) not suppliedcan't write historycan't read history from fileevent not foundcurrent event is invalidno previous eventno next eventempty listlast event not foundfirst event not foundmalloc() failedunknown errorOK   " ̒ ""? ""   " В ""? ""     " ؒ ""? ""  "    "   ? 2 ܒ ""? "" ""@"`  "@  ?"`     "  "    " "    ""?㿘`@m$@~ @~@Ð  "`@$R @$_`@,`"``&@&`"Ȕ &`&@?㿘2@r " " @@ & 㿘@  $ @I "` `` 2  "Ȕ &`&@?  $ "@  "` "   "    $ $ &@&`㿘̒?2 ? ? $     4  㿘@C $ &" " " " " " "" 㿘 " &   2 & & 㿐@! ,ٔ !$`ؘ!b,἞#8?& & & & & & & & & $& (㿐 !$@ $      ""? $    " ""?㿐` &` "# ` " ` " ` " ` " `$ " `( "  ` " @ 2&  !$@K `ؔ",b#8$ ($ $ $ $ $ $ $ $ $?!$@?9?$ ` $ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (r㿈@A;a@ ??@첒 7@fch 1@<$$#  @ J?` 2.@ '.@.@ 쀤@ c |@@.@  $ @첒 @@Sݐw%s 㿐@@bh  2?#h@N@$€$?'@|%* * # c@g@# @qp ?@D@S㿘 2  €?2@" &`&@?㿘 2  €?2@" &`&@?㿘@{֐  @f; 2  €?2`" &`&@?㿘@{  @f 2  €?2`" &`&@?!"'P"'T'X&`P&@!D. €<\lL|,hP8 dF7($?@&?(   €ph €b ?[" (L ސ?Q" ,B H B0<F6 ??'p ?&'x ?p'| ? '? '? '? '? '?''?" 0 &` &@ `? &`&@㿘&" "  & @)&  , 0  (  *  , *  (:  , " ,㿘 ( , 8" `"`"d@  ͔ ( ,* , ( "& ,㿘 ( $" *" `"`"d@"  ( ," " * ,( "& ,*?_-.[]~=㿘#D `   !@J  D 2   㿘??  0 "?퀦 *㿘 "   "  쀦8㿘'@#@@ @2"@`@ "@ "@:cD@ `"`@*@ހ@㿘2@#"@ @ D@ `@8@@@ @2`@`@cD@ `2`2"@@ 㿘"@`""D"\&"`"D +&"@ (@ "@"D@& ( `"   `   ``&" &" @nH (&"(&",< cD  cD    :"cD "  : :cD 2   :  " ̀ ?㿘@$& $ @n$ $$& 0& (@& ,&"0 @n$ $&" &"H&"$&"(&",&"@&"D@ː$&"4 @n~$"\  $&"`"4 "?&"<&"8& <. D&"L& 4& 8& @&"T@ (&"P  $ "\ "?""<""`" <* D""L""" (" ,"" ""$""("",""@""D""H" 4" 8" @㿘@  $"0& $@& 0"4@&"0"P@&"4&"P㿘@x "? , 0  ?N@ @ (`* & (N@`@ 㿘` $ (@  ( $" & (& (㿐 /@̒ @W = *`:  3    -`#)` # 4  ( $ *@ $$ ($ ,*@$ ,$ (@.@?$.@@#b0 ( *@`$ ,$ (@/ `".@ $ ( * J " ? :J ?㿘@ ,*@ 㿘`"Z  , < 0 Q  4   (  "$"0* "0&"$d+ I  (*& (@o& 8. 4  6"0 ( "$ "0*  <` &"$"0"$* A < < % < & < (* < & (& <@E 4 2 @.ߒ  㿘 ( $   <y ("4   * (  (&"8"@% $& (& ( 㿘 ( ,@2 <"p  $@& (@ & ( < ( ,@ *  $@& (  ( ,@ "4 @* ,`@  (""8" , 㿘 ,"p  & ("@`& (ǐ  㿘 $"p & (#D @@ ` " "@  (& (  `2 ("@ "   ,(@ $ `"($@8J   *(*㿘 ( , * <  & (& ("p 2  "@ " n 㿘 ( $   <"p  & ("@ " V  㿘 ( $ (  <" & (& ("p 2  "@ " ; 㿐@*,@@*f    㿘#D@ ` "9  8 " , D 32 < А"@@4* *` * ?А& <"  0  * 4    (  "$"0* "0&"$+ ǒ  (*& (@& 8 D@"  8 <@(  (Є " <Є " 8" < 㿘@!e@#ΰ        㿘@ , *@`& ,*@"p  $&"H 㿘 ( $@8 <   ( < $" & (& ( 㿘@ @ǐ  㿘)  㿘 ,&" *"  "$@F $ , $""  "&" < @ |&"  @ u@b   㿘 ,&" *" <"@ `&"@ a &" 㿘 ,&"@&" *"  a&"2 ""$@Fn $ , $""  &"" Q""  ? " D @" @ 2 ""  ? ""`@$"!  ,@_"   , $" L@ 2 ""  ?` " 2 $" &"@   㿘 ,&"@&" *@" G " C""  ? " "< @c" @ ( $ $ ,@_"   , $" L@E 2""  ? ""`@ހ 2 &""@- 2&" @  㿘ѐ (J`  $* <J 2 <? & < :J < $ $    :J  , :& (J    *J& ( 㿘 , (@ J@ 2` <? & <`@ *J@ <    ` ,@ :& (J@   `@ *J@& ( 㻘 $*@ $ & (& , ( *& ( :*& ( *& (@ $,* $& (@& ,?  㿘@8" %  @i"V`& & @@b& && @@@ p@ @&?  & 1@3@@@㿘 @@E@ Y@ @%g@$@@@@j@h㿘@'v<bindtelltcsettcechotcsetty 'L'P'T'X L?` #`.` €אפ׸8T@z@:u@ p  e c ?  + `"  $`9 D*` €X|ؠb' @  Db' @!n ;c' @!Ô 2c' @" )c' @'h  @hy@@    ? &  ?㿘 $'L!```?0 ` ?0@(L@ L     2   &? $rHOME%s%s㻐`#yb8@7 @U"@ H@UΒ$@7b8 ?@J? J?` 2* '*  @?@P @J p''''' @he@Ѐ Ԑ@В @hW 㿘@onoffedit: Bad value `%s'. 㿘`2?c@Fݐ   ?c@FԐ  c@g͔?  &  ^D㿘 ( ,@2 < $@ `@| @ " 0 @   , ( 8& ( 㿘 ( ,   <p (@  "4 @`*@  (&"8" ې , ( 8& ( 㿘"8"4 "  , 0 * (   &"<"4"8:  < ,"8   < "& (  $ ,@ "4 @* ,`@  $""8" (" , 㿘"<`2 () @  "4 *"<  (&"8"    "4 * ( "<&"8" "<& ( "<" (   "4@ "4 @* (`@ ""8 $(@ J  *(*㿘 ( ,   <"p  & ("@ " :  㿘 ( , < ( : , D `" *`h:  * *  ,& (& ( 㿘 ( , < ( :/ , D@  "  `h*`:`@ `* * : , D `" *`(:  * *  ,& (& ( 㿘 ( ,B < ( : , D `" *`(:  * *  ,& (& ( (  <( < < ( <Є@4 ( " <" 8  " @ `4 `?"`4㿘 ( $@   <ϐR$@ : & ( ,@: & (  *@ `& ( 㿘&"@8  㿘&"@0  #Editline extended commanded-commandMove down one lineed-next-lineMove up one lineed-prev-lineSearch next in history for a line matching the currented-search-next-historySearch previous in history for a line matching the currented-search-prev-historyMove to the next history lineed-next-historyMove to the previous history lineed-prev-historyFirst character in a bound sequenceed-sequence-lead-inErase current line and start from scratched-start-overRedisplay everythinged-redisplayClear screen leaving current line at the toped-clear-screenDelete the character to the left of the cursored-delete-prev-charExecute commanded-newlineTty allow output charactersed-tty-start-outputTty disallow output charactersed-tty-stop-outputTty suspend charactered-tty-sigtstpTty quit charactered-tty-sigquitTty flush output charactersed-tty-flush-outputTty delayed suspend charactered-tty-dsuspTty interrupt charactered-tty-sigintIndicates unbound charactered-unassignedDigit that starts argumented-argument-digitAdds to argument or enters a digited-digitAdd the next character typed verbatimed-quoted-insertMove to the left one charactered-prev-charMove to the beginning of the current worded-prev-wordMove to the right one charactered-next-charExchange the character to the left of the cursor with the one under ited-transpose-charsMove cursor to the beginning of lineed-move-to-begMove cursor to the end of lineed-move-to-endCut to the end of lineed-kill-lineDelete character under cursored-delete-next-charDelete from beginning of current word to cursored-delete-prev-wordAdd character to the lineed-insertIndicate end of fileed-end-of-fileEmacs incremental reverse searchem-inc-search-prevEmacs incremental next searchem-inc-search-nextCopy current word to cursorem-copy-prev-wordSwitch from insert to overwrite mode or vice versaem-toggle-overwriteAdd 8th bit to next character typedem-meta-nextUniversal argument (argument times 4)em-universal-argumentExchange the cursor and markem-exchange-markSet the mark at cursorem-set-markLowercase the characters from cursor to end of current wordem-lower-caseCapitalize the characters from cursor to end of current wordem-capitol-caseUppercase the characters from cursor to end of current wordem-upper-caseMove next to end of current wordem-next-wordExchange the two characters before the cursorem-gosmacs-trasposeCopy area between mark and cursor to cut bufferem-copy-regionCut area between mark and cursor and save in cut bufferem-kill-regionCut the entire line and save in cut bufferem-kill-linePaste cut buffer at cursor positionem-yankCut from cursor to end of current wordem-delete-next-wordDelete character under cursor or list completions if at end of lineem-delete-or-listVi repeat current character search in the opposite search directionvi-repeat-prev-charVi repeat current character search in the same search directionvi-repeat-next-charVi move up to the character specified previousvi-to-prev-charVi move up to the character specified nextvi-to-next-charVi move to the character specified previousvi-prev-charVi move to the character specified nextvi-next-charVi repeat current search in the opposite search directionvi-repeat-search-prevVi repeat current search in the same search directionvi-repeat-search-nextVi search history nextvi-search-nextVi search history previousvi-search-prevVi cut from beginning of line to cursorvi-kill-line-prevVi list choices for completion or indicate end of file if empty linevi-list-or-eofVi move to previous character (backspace)vi-delete-prev-charVi move to the beginning of linevi-zeroVi enter command mode (use alternative key bindings)vi-command-modeVi undo last changevi-undoVi move to the end of the current wordvi-to-end-wordVi move to the end of the current space delimited wordvi-end-wordVi delete prefix commandvi-delete-metaVi enter insert mode at end of linevi-add-at-eolVi enter insert mode after the cursorvi-addVi enter insert modevi-insertVi change to end of linevi-change-to-eolVi substitute entire linevi-substitute-lineVi replace character under the cursor and enter insert modevi-substitute-charVi enter replace modevi-replace-modeVi replace character under the cursor with the next character typedvi-replace-charVi enter insert mode at the beginning of linevi-insert-at-bolVi change prefix commandvi-change-metaVi change case of character under the cursor and advance one charactervi-change-caseVi move to the next wordvi-next-wordVi move to the next space delimited wordvi-next-space-wordVi move to the previous wordvi-prev-wordVi move to the previous space delimited wordvi-prev-space-wordVi paste previous deletion to the left of the cursorvi-paste-prevVi paste previous deletion to the right of the cursorvi-paste-next 㿘&"&"@{P$&"&" 㿘@{"&""""" 㿘" 2" $$@<""" $" "pM& ,L& ( F""  ? "`: "6 $""  ? "`")&"" &" $@;$@k? $ $@ & ,J 2 ,& , ,J 2 $& , $@*& ,"p 2 , $ & ( %d %s㿘" "!?"  ? "" # c@` """  ? "2  㿘@z$&"@&" 㿘@{ "&"&"*"""""㿘@h"&"㿘"@key_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed 㿘N@ @ @_`H02 " 2" @_`x0 2*`@P: &"@㿘@ "\@ "X ` "X@ @key_delete: Null extended-key not allowed. 㿘J@ 2" @_ka? " @" Unbound extended key "%s" 㿘" 2"N@ " "*@"@   b @_A㿘N@*: @2``  @n  . ` `&`  .``2N@& 㿘N@N @   N    2N 2`*@: $ `N@`5 " @z&   "    "& 0     " & @z& @^&  "0 0& @5& @^ 2@n &  㿘J@L    J  2J$  `J@ 2 ` $` " ِ 2  2 ` &$`@$   㿘 # &    "    0    @y@^.@y㿘@y   *" " " " 㿘"1?N@`2N@>(   "@  `N` 2?" "* " *`"@b 0`Ѵ ?Some extended keys too long for internal print buffer "%s..." 㿘 ""*@"* @]cX" @]c& `2"!?@j@` `" "* " *"`@``А``ʔ %-15s-> %s ""[]no input㻘3 ""t0#"!0   @d@` ` @2`0@]a !0 !0@]~  ^*  @4*D   ^* & ?$@^\ \* * *"* \2*0 2* 0* 0 *㿘N.@`N  ^. @.ND ^ ? \D   / .N*.'@8^\ .2...(80.00.0.  ŶN" .N..㿘@w!&"X@w!&"\a888&"d&"h&"l@w$8-&"t@w#$8@w}!h&"x@w!h Z&"|@h 㿘@w"X"\@w&"X"t&"\&"d&"h@w&"l"x@w&"t&"x"\  D2*@  D㿐"X "\  /   $  $/ @ /   $ @ $ "p   //  @ "  " "   / @v   `O , 㿘"\ &"p"X&"`"ld"h , @ , $  @C@E㿐"\&"p"X&"`"dJ " @ , , ``$ @  //// ( V@ @emacsvi㿘’cx@; ː  @:c ? `"?"p  ?0x„"@ %s -> %s 㻘N N Ô8"t@  20  `@@[0X%-15s-> is undefined %-4s to %-7s-> %s 㷈@///耢`"/逦?!  S@[02"t@  '` 2`  <7@@[m0@ 2`@[< ! "@@[YStandard key bindings Alternative key bindings Multi-character bindings Arrow key bindings 㿘 @[6bH"\  @"   ?"\  $ ?  @[b`"X  @"   q?"X  $  ?g @[b!à 8 @Zb@%s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. 㷘2? "\  U J -R,` * : `=Đ ؓ*` €0`@pH8P'"X% # ! Dð \ "t!# @Z 2 * c@Zu:`,`2J,`  /  @ ` Ac` @,?L   @  "Вt q-@ ,`` @&f ]a " (0UT@v   ` @Z?0I .@В %I  3-@ @y  `H@Y?0%   @  L   !   -@ < -@ @Y 㿘b|` 2bx$?@u, $bx, @bt@t*`b|$btbx, "@, bt*"@ bt  " bt  ", @bt*`" b| $b|historyedit㿐@֐ @@'@㿘`$=?@5 : "#$ @t1 @5@U,@t`  @  8`"? @8O   `?J`{ `J@\y @` @Ѕ(8Fń(LLLLLLLL <,4$6 4 2 0 . , * (   J@Ѐ`* ??^*D  *`J@? *8`"㿘'HHJ@ \ ^ ". @ @SH?2.   `.'H 㿘 "t@7 2   ? x㿘"@L *`:`@ L  ""&"&"Ƅ"""""" `2""Ƅ"""""" `"?" "@`? 㿘"T "!@sf&"T!   㿘` "L"L  &"L`* "@@!@㿐@Q " @0 "& @?."` ` 2"X!  0 `Ȑ"X@W"X  "\&"`Ґ .@?㿘 # n2 .@ b쀢 2.@  ? @t ? 㿘@2"L"* @ J@  @$.@`#@  + J@ ?$ 6g 2@  㿐  /@R  ! $ "?L  ? " 0& ,& (`, ( $" &@z $@ p@̐G?Z"|@T?"x*` O A. Dǐ"* €$<4tL & <& 8@@2?@@Ӑ & <& 8@'? & <& 8@@ &? & <& 8  , $"@@@z & < & 8 & <& 8@ @t?@D@m  `@`2&@   $㿘#D@ ` ` 1`  ` @/ "&"(&" ` @% "0 @ ^` ?`@@ \6` ``0@6` ``0@ ``0@ (*H " (@*""㿐?'&"&"' $ , (2L""?L ,  * (?2"""?"&"’ " @4"  ,` @`  @N H"@$ " @@ 4"@ ,@   ,`@a=`@  *" @ "@ &" @ r㿘" @ @ @ @̐@`#" @4`@ " @ * *@ *?*@ @ @  ` (    &@ *@  @ : *@  * *@  J@ @*` 㿈'HN@H'L  KJ@  K  M@    K 2 @  ?@ *K? /@J 2   J   *J / @M  ?KJ@8?* :  /,J2$ %@" KJ@2 "  *K" @ 6 *`"@$   *J+:  .@,K2$  &" JJ@2 " *J" @ 6  *`#@$     *K'@ `P%$ $" "$$ @  &$$ @& 4  $ '@$%'''&/-H"`H 'L@ %@ H`H%@ &@ wŐ@4@ n06) H%@@ؒ @ o`HH@ R@ HHL'@'@ *" 0hH&@@ @ F @ / @ *HL$'@ " 1.+L@%& @ vH`H%@ &@@ @CL@a% @ N @@  J@ @*`    *  *㿘 ( $ H "3"#D J     2     2   "         $ `  ` *J@@@ '㿘@   *`  * H   & " &   `&" & @  @  㿘 ( ,`<   ,@0,#D `@ `  `@ ?˒ ^, :`   \<  ``0<  ``0 ``0@ L @" "*``*L@&" 㿘 P @ "  @ H@"   @ 0@ " @  @  㿘@m$?&"&"&"&"." 㿘@nM"&"㿈@n  @lL 2    @h. `?@㿘"㿘 D? ""p  "`"X `? ( $ " #&"#&"" "@.v $""* @]"&"*[]?㿐" ,/  0@ ( "@ ¦" 2 , :-" ." ** `"&"* `&" , *@`& ,    L   , * & ,L`  , *""`@  & ,  , *""@ & , ,*@ :  "` `'K̐"$*` €3 34234234343434343434343434343434343434343434343434343434343434343434343433"cj`"* &" ,*@`& ,*@g , c  ` " 8\ 0Q+ :  ""  J*`KF*`H )` #@2 ,@-`p 3 ""@ *L ( , !& (Ŕ  (: ,J  "ݔ"*  (&" @ ,`*  & , & ( ,& (*@8  ,@ΐ ,`   , $(  ,J * $ & , ,*" ]"?@ /L[ ]2?/ 8L"xO [u`$2#"M ?#&"&" 2 $ , "" (? & (" .*@ "&" *+ "&"*  ( $@  ,@ "`@ 2". Dp ؒ   2 $ ,& ("`@ؔ" ?"&"*@@6"@  ?&" - ?-& ( :-V ` M ? .`:  :"   -" &"&"{    & (_2 "6"㻘 .,@ $  *,@*@ $$"$ ($ ,  ( *$ (` ? /*86  @ .,@" 2 " $*@ $ $ ($$ ,0SJ@ .' *%@,P#"*"#+ "@,G ""$"+"$"* "$" * ,@ ,@ ",@@,0#$" $`$ (, D $ ,婒  - :   -  :    ڐ , *@`$ ,*@7 㿘 ( $* C 2 & ( $   2 2& (N 2 0 㿘 $. D`& ,`   忒  N 㿘 $ ( J@"@ ( J@"@ 8J@2J@@ *   @*: * *: 2"@2`"@ & ( `& (M 㿘 , ( J@"`@ : J@"`@ *J@2J@@ *J@ 2"@2"@ & (ː `& ( x?'''' n  "b2*  * @#   @O؀  !0!@   s  @ s @       @`@?* @O  @OĔ @Oѐ x''''' @O@j $`&"@  ? ""  2" @O  㿘@jo"&"x''''' @O?Ϥ Ġ  @OK@ ""?`"` @Oo x''''' @Ob?  "" @O ?`"` @OH cursor up multipleUPcursor right multipleRIcursor left multipleLEinsert multiple charsICcursor down multipleDOdelete multiple charsDCvisible bellvbend underlineuebegin underlineuscursor up oneupcursor to status linetsbegin standoutsoend standoutsenon destructive spacendend attributesmebegin boldmdsends cursor upkusends cursor rightkrsends cursor leftklsends cursor downkdinsert paddingipstart insert modeiminsert characterichome cursorhocursor from status linefsend insert modeeiend delete modeedstart delete modedmdelete a linedldelete a characterdcclear screenclcursor to horiz poschclear to end of linececlear to bottomcdaudible bellbladd new blank linealMTTab chars destructivextHas meta keykmNumber of columnscoNumber of lineslihas physical tabspt㿘!  & P `  @? `& P `  P " \`@ \& P " \J 2` \& P  J 2 `x " \J " \` \& P`8  J 2 `4 "`J 2  ` " PJ " P  P  \& Ph  J 2 `  " \J " \`  \& P`T" PJ " P`p`"  PJ@ "  P@,M   ?& P \`TJ `\` J@   P@,2 " & P㿘@g(& T@g(& d@gߐ @& h& X@gې & \ @M @gԐ  "b" & `"" " " " @I @= 㿘@h6 T d@h3& T \& d@h/& X `@h,& \@& `Out of termcap string space. 㷘 &@ \>`.`N R$@Wѐ`@Wː 4 X@@0?' T2 ` @ @"`@"`J   +J`  (``@*@ T@f(`& X @Lc0  T@$@ X& X㿘 H@? `` @h& H $ @㿘 H  @g.*   @g' , $@   &*`$@&   @g*   @g , $@   &*`$@& 㿘 `& @  @go  @gi `& @  @g^  @gX㿘 @ [ L@W&@ ``  \ |` J@  @&I'6?& @k  7&  \` "`hJ   4 ``h "`J 2 `h`@&#ג@%<& `h "& J "&   6 & % \ h@%< & \& 㿘 @   H @`&@ @ z&     \ ` J@   @%ה<@%pd&  / $ P \ `"  PJ@  @%̔0 P  ` @  &  &@  * @8@ 4&  `$ P \ `" PJ@   @%ג@%*<&  P  6`` @  @ @ & 6 & @  & 㿘 H  N@@` `& 㿘`T P P H@L \x  J `4 `x "`xJ 2 ` `x@%Cג/<` `" J@  ה<@$Ē  \ "$J "$" $! @$!< \$` J@ א < @$㿘z P v Hr \  J 4 `4 "`J 2`8`@$ה<@$xl0Q`8`-!J@ "* \( "& \J ! !ג @$_!< & N@@`2N@ \<`" (J@   @$J!< \( @$E!<0" \ 4`" N@J@   @$8!% % & l% % % % % % $% ( <4& l/ :g% % P"$"(" ` % ?  <#& l% P L`"   @ܐ `?㿘 nc @"c"P L`l  L n L"c"#""`  @ `?㿘 nc @"c m"Pc L L n"`"#""    @ `?㿘 nc  L@"c L   L`" L l L @"P`#  `@y `?㿘 nc  L@"c L  L "c L l m#"P`"   @V `?㿘 nc  L@s"c Ll L m  @c ` P`" #   #` 　   L @. `?㿘 nc  L@K"c Ll L m  @c ` " P# ?#`    L @ `?㿘 nc  L@$"c L L mll@@ܬ! %`aa#P#ܘ  ! n l @% %`%$"䀤`   L @Ր `?㿘 nc  L@"c L L mll@@ܪ! ~  ~` "P#ܘ ? ?# n  l @$% %`$b䀤   L @ `?㿘%@J|# L`8  L mc n@K! L*  $ <$ <@M' < $`8$ < L`<`8@  n!! ! @ * nD@ % 㿘 n @R"㿘 L`@L `?㿘"P`   L@U `?x'آ'''' @2@'''ؒ''' @2u  @2 @[ @2l 㿘b@21 "㿘@2( 㿘 L`@LQ ! n"  n 0   na @  "0 ?"0    @  nt!! @   n\@  !#@I̐  @' "P    n@ݐ `?㿘 nb@L  P    L@Ȑ ( n@b㿘 nc - n"c- n+ L ``?`) L% L5a 5! $  " 0,` $: `" `  @*`$  `*`:    0@   0`@ " n n 0`@ nb @ ' 5a  5!0 "0"@"@ j 0 & 0 nJ"8`2 0  !#`?"`# * $#@  2 0@l 0 (  %    $ ,`: @2`*`:   #`   :  @3  H    $,`:` `$ "  $,`: *@ -` @v "q  $ V @@    #@ $ *` :  @:# $  @` ?#`*  :`@ ✀ !Ua U! @ 08 0!#U!Ua "`"`a  "@!*` :"5a 5!  *: & &  :& & & & &      Ua  @U!  "   "@Hp# 㿈'H`' $.` ?@ 1 LV! / LU @r ! 5 6! H $(`@ @U   @  0[ @*` :` S  @6?; L Ha`'" + n+ nb$(`@   @* @ n@,` ` ?bD' '"@a )  $ * `?J` J 2  ( J 2J  `": 'a   nD`뀤@ n"1 L  / LU!@ V! ! @  ܀@ na!! @  V!  U @m ΀@/ L@   / L@b0`@@  a   LPa @ U7 n@  L0 i5r hb   2b @&^ L 2Z M 2V $*J    K@ bK`  b+ $ n#@ :`"@ bD@:\&*  *  b H?@& b`0  !ᜒ @ ! b0 ?"0 nD! @    L0aQ` ,,`H  b 0`2!  n!x`ᜀ   @ b0  0` ᜀ   @a b0 ?"0 `@ sH ?n@ a j@  0 eb 0` nJ" ` ᜔a @ b0 ?"0 00ba  #, ,*`?:`"` # #L?" `  #* ## @} b `@      L  P @  L  L   @  ?0a 0@ 1 n H?@ a 0 7!|a  #, ,*`?:`" `  #* ## @3 #`L?"`` #* ##@ !| " ` ?"`!`* "@ !|! @ @@t  @  LPa@@* n *␑: ␀  5 nJ"`"  ?5 @ @  L@ P  LPa@  L ?0@4b 0`  na @’ b0 ?"0 㿘! n" 0` nJ" `  na @ "0 ?"0@q 㷐     $ # n $,@ b $@`2  *@` 2   $@ ?"  * $ ? # n $-@ b $@`2% *@` 2 % $ "%9 3++ n $.` ,b`$  `   *@` `" $ڤҀ  & : @Đ%  & : @&4  & ,%   *+ *  @*` n'`$`_"@7M n✠$, @ "@ $ & $  $  1"& ` 6! 4 $ `  `@#* "  `@G5*$`  @   n✖  $*  `@" @@E㿘 n"&@```) n!Ѐ e+ na a5 n !# na   n"` ` n   N! n n"`H!В @!!  @A  @  a @7   @   @ @( !д  !; nb @! &b!В  @!  @   @ܘ a@ ] ! n!  # n`2 ! n @Ƙ  !! n"  @ "@h  @ 8'! n"`  @  6*'1"` @̔! "`'1 n" ` @ @ !" @! "'@+'   @t a  @   @  ! n"T   1"T @! "Tܐ @+ؐ ) n!Ѐ c+ na _5 nT !# na   n"` ` n   :L n"`F!Д @!!  @V  @! a @L   @ T  @Ô @= !д` !3 nb @3! ,b!В  @!  @(   @ a@ t   @  naT`# n  n  n"  ! n @  @ , "` % 1"` @!  "` ! n"   1" @ؔ!  " @*   @ a  @H  @ ! n"T 1"T @!  "T@* @v 㿘  m#"@ ` n""@ @   &6 & .` $.@ @ & ** `@ @&&㿘     @   @`"#@ "" @D  2  &$ &   ("  @㿘  ``"@`(@  6`  `$,`"` $@ *` `` * $?$$ ` @Ǔ*`$`@ 㿘@D 4 O @D.  $ $@E_F . "@D*  $ (@ET $@EQ 08 2-$ @B@Dґ*   $ , $@EB @E@ (@E>0%  (` ` $(" ,+` #?# #?#  `$ $ $ $ $ $ $ 0@0 n "0"` "0 m m`"0 m㼄 0"0㿘  @3  $,` `*  @ ? `J@ J " ` $ : ,*`@ "   $@ $ :@  `@* $ @  unknown  <J * 0 *J  㿘@ 㿘 L"! L L L"a "$"@ 㿘/ L3 n b  @E' L$ b$$@3 b% - L ^' L@Ep ) L!b@3n%! nJ`B% >+ n% n#b䀢  n!Ȁ  @a ` ?"``* "@͐ ܀  @єa ?` ?"`* "@۶ ? b% m#! $ " "@%!$$+ mc$@ @) L! $$% n䀢   nJ8 "& u% c@*$1 n% n#!܀` 䀢   @a ` ?"`* "@j 䀢 ?%c!$!   nJ8  n!P`"$$J8  n @$b  @3t@7   @C $@* $ %!%㿘 L!,` La(?"a(`? "`` . :  * "@㿐 n% L+ L5 L7 La''H&( v&, nK!  ! L!  :`*`"@! !   : ` `K!: `" *"! "@"@   nJ!Ԁ`2  n"0`# L # La$a ,     nP   n@  !@ $+$!̀'a$! m# " `@ 69 nP 9 n @ #$%a n!P` 9 n# La$O!n?9 nO!! L  # L!  : *`" ! 3 n! Nb"  n"䀢`' naa$@>' nLᬀ aa$@] n  n! @* nJ!Ԁ`'a n"0`"a n!Ȁ @B L Lᬀ  n!܀ @3 a a %a$aa$@' n/ n-) n!ܐ `&!  @(ݐ ( Nb 2$"䀢 $a$@! n!؀ @2"! @a- n)( !0?`&!  @" ! @(aa$@O!) n'! !P&!@͔(!a$@!O! T! " Q! ' n #p  @b$y $@ !  "@ 5 n" 2# nb0  n nJ!Ԁ`' n!p @ ! S ! $)!b0?`&!  @x"> ! @!! @L,' L)H`/, (?4$( n"a$*` + @ 0  ` K@ `?"`` * "@.a n!  @/"a a( `$a! H, %a$(㿘 n" @Bw@>Ґ& @0r&㿘 g DN `  N, +  * :`  ?Б,  .*  ND ` ?Р ` *  N ` *   @>  *  ƀ: N`  mc* 2  * R: *`2`:`@ : @B  1 nN!ƀ? N!OOPS㿘 L!8 1 - L-x%" N, L!x:1Nۀ`M ! *` €P\x(4\d$X``.`` `cc@A| d 0, Lax @/x d@An  0, Lax :v1@/i  0, Lax j "`YWN@ N O@M N @``` 2&,` n!P``  n n"02 L !P L!x@/@/ 3@M`` , L!x ``@A , @/  `` ?$@* $@N x@/ Lax:1@ ?curses: __tscroll failed㿘 N% L8%2,@Nۀ`K !<*` €(4\t lF``` `c @@z d 0,@@.{ d`@@p  0,@`@.p  0,@`)N@$ N !@N @,@``,@`@@O , @.P  `` ?&@* &@ N^ ,@81 ȁ㿘@* 㿘     @  &  㿘     @  &    `$(`@"@`$(` S`     `$   `$    ( `$  *" 㿘`? "`` . :  * "@O   * "$(+ @ "@$" @"@ 㿐@~"P?c@, ^@,  a?@ BQ *J?a@D?a؁ F8 @ݒ 9?a؁ 2 +@ @ɒ @Ē  @,y   a B@  @  @y0㿐@"P?@,N  b?@  B0    @N㿐@,"P?@," @,  bX?@ B0@& 㿐@"P?!@B b?@   b?@  @ 0㿐@"P? @+Β @+ɒ b?@ B? B @Ζ0㿐?& >`'`-'`6c@B#HD`@3 ? >3: 8@:c@B#H,`8@.@% `3d"&@0$?0c@B#H`` 4 `  (*`/?&'㿈??01  7 #`0O`   =P" # #8< 4"3+@   "8+@ ` " =023 А#! 0#`2 6$!  탠%聡 D ?@0܁$%`26  26  #`0"0?x J #! #`#4 ! # ` ! #`@0! #¢`! V@!#` ȉD#`@!ĕJ FƹN B HȅZ '"##   ! ؞?ˁ B? ;   @@   "y@ ?  ! '"##(!F Ĺƽ Z? ?01  ; (  ?23Ʊ^! #`腦 B! !!#D! V!!a^ BƉ@N BąP X BPF BTL BJLHN '"#ȑ؍VȹV ^DZ '"#ܩ#!a !(@F#ac@ B#'BHJFLV '"#։̉ȁ#`?@@!!0 ?01@ JJFN?#@  /@ # a8!!@΅Ba80$2 @ #@͐@ !!H B΁  #aH@Bw B @ : ;@ :  :+ ?01   "`: ֥N? ?01!!P#!aX!`@B#ah!!pF@!#ax! J#! aF!!Z@ @܉ąBL DBFNBXBPB‰ Jȉ ȝƅ?+ ;`4'@?腠 !"#@㿐?$?%$%  ?  @ 2    2  0@ ;?@60 0  @ A# ? 0  =8 !   0,  '#b(0j"00h#b80e!"@0b!      #bH0P"P0N#b0K!"0H2 "#b B!"0?:  <#b  6 €?6 !"H "?@ !     !"X!"X? ?$%" #"X#b#b㿐@f"P?@(   b?@  0 @ 㿈 H* @     @ 0*#@?"#!Ē@   "  0 0  @0 @ A0  @@ 9 * 0㿈 H* @   @ !0+#@?"#"Ē@ Ք  "     @ 0  @@@;``<    * #@=@4ZZ@|@@:?`0B 8=2Z:f;@:@ Z`8 @@ ƉD`8 B߄@  HB`8 ‰F P ڱZP @ XH08L (LRFRFDNDNHPHPJTJTL VB@B* Bƅ#acosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error ynynfyn: DOMAIN error lgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10log10flog10: SING error log10: DOMAIN error powpowfpow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanhatanhfatanh: DOMAIN error atanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error p??*?`+?*+?!*` € ,  , Ddx$|(d l DH,x  !8!"p# #$D$%|%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% ,  , Ddx$|(d l DH,x  !8!"p# #$D$%|  c'!!'!"P'' a n@ \؀ ^"P 2Y n"@ђ`8R n  c'"" '!"P'' A n@ <؀ >"P 29 n"(@ñ`82 n ??耧 c'"@"H'!"P''  n@ ؀ "P 2 n"P@Ï`8 n  c'"h"p'!P #8?x?P  n "@ ؀  n "  c'"x"'!P #8?x?P  nА "@ ʐ؀  nɐ "  c'""'!P #8?x?P  n "@ ؀  n "  c'""'"P''` n "@ ؀  n "  c'""'!"P 1#8?!x?P n n@ i؀ k"P 2f n"@ޒ`8_ n  c'""'!"P 1#8?!x?P C n@ >؀ @"P 2; n"@³`84 n  c'""'!"P 1#8?!x?P  n@ ؀ "P 2 n"@ˆ`8  n  c'""'!"P 1#8?!x?P  n@ ؀ "P 2 n"@]`8 n  c'""'!"P 1#8?!x?P  n@ ؀ "P 2 n"@2`8 n  c'""'!"P 1#8?!x?P  n@ ؀ "P 2 n"@`8 n  c'##'!P #8?x?P  nl "@ f؀ h ne "  c'##'!"P #8?x?P I n@ D؀ F"P 2A n# @`8: n  c'#8#@'!"P 1#8?!x?P  n "@ ؀ "P 2 n#H@`8  n  c'#8#@'!"P 1#8?!x?P  n@؀ "P 2 n#`@a`8 n  c'#x#'!"P 1#8?!x?P  nŐ "@؀ "P 2 n#@4`8 n  c'#x#'!"P 1#8?!x?P  n@؀ "P 2 n#@ `8 n  c'##'"P''`o@t؀ v#@`8 n !n"  c'##'!"P B#8 +???А@ВЁ F!"P1#8?B!!x ???А@Ё F"P!x?"P  n! "@؀  n "  c'##'"P''` n "@؀  n "  c'##'!"P ''bP!x?bP  n@ߐ؀ "P 2 n#@T`8 n  c'##'!"P ''P#??P  n@؀ "P 2 n @*`8 n  c' ( 0'!P ࠁ #8?1#8?!x?  P%?P  nz "@t؀ v ns "  c' 8 @'!"P ''P#??P W n@R؀ T"P 2O n H@ǒ`8H n  c' ` h'!"P ?P#??P . n@)؀ +"P 2& n p@`8 n  c'  '!#?"P ?@؀  "P 2 n @}`8 n  c'  '!#?"P?@؀ "P 2 n @\`8 n  c'  '!#?"P?@Ɛ؀ "P 2 n!@;`8 n  c'  '! "P ? n@؀ "P 2 n!@`8 n  c'!0!8'!x?  %?"P` n~ "@x؀ z nw "  c'!0!8'?  @ "P?  n^ "@X؀ Z nW "  c'!@!H'!"P''  nD "@>؀ @"P   n! 8@!P@ n0 "  c'""'!"P''  n "@؀ "P   n! 8@!P@ n  "  c'!`!h'!"P''  n "@؀ "P   n! 8@e!P@a n "  c'""'!"P''  nϐ "@ɐ؀ "P   n! 8@>!P@: n "  c'!p!x'!"P''  n "@؀ "P   n! 8@!P@ n "  c'""'!"P''  n "@{؀ }"P   n! 8@!P@ nm "  c'!!'!P #8?x?P  nP "@J؀ L nI "  c'!!'!"P #8?x?P - n@(؀ *"P 2% n!@`8 n  c'##'"P??   ?@؀  n !"b㿐?4?54? 3 1(#@ 5N'2N.,/N! a( B!0a8D!@ N BF BH BJaP B!H@ą B @ҁ BaHB @@㿐?4?54? 3 1(# 5P'2 P!0B Pa!؅Ba!腠FaB!̄2HBDBJBL BBb!ȉ R@ā@b ? ?45"Baȉȍ R@ƁȁnND)'W4b<CAQc޻a$n:BMI. ђ)>5.Dp&_~A99S9_(;/Z mm6~' OF?f_-u'{=9Rk_]V0F{kϼ 6a^e_h@؀Ms'1Vs`{k?!@ !@|@!@jz@"|@%@)!@,F:@/jz@1G\@2|@4k@5@7@9!@:@>ܰ !{@1NH`H!@„ƅ>> H!@BBF>F>?!@\&' BFB' DH  ?!*` @ >02ș;`>?2  '#`&⸙*B+Fȅʅȑ‰>?2  '#`1ؙ*B+Fȅʅȑ‰>`ą>MG #@ >0A?? ;`;+ #@ ?01  H*```: J?D   ? D   `@ `  >>㿐?:; 9#@  /@`c0#c?ʁ B? @?`@#1W@#d@3? 1@@?:;#`@0c @~'#c@B@r@# Bc TDg'#c@@BY#B#c @#cؐ#@'c @?zㆭQ @@ X HDRFDPJFDNLF DBc BTF @F#Bc @BD  #Bc @‰DƁ @㿐?"#   .4 ? @0? BƁ 7€@ 34?   / ;퀧`(  <(49   ) ;퀠`( | <(||<   ? 7@//@/@  <   ? 0@)(@(@ &@'@'@7`/ /`?(6`.` ?'@'@, 7`/ /` ?(!?<    /7@?? /7@ 3H(0 ??"#!;` ` 23   0 !(A"!?  (@N./a !(0a0 B&( ȑ*†؄   !8B* F؅B#hh D H a@B!H=NTD NaP!X Ba`!hDap BF BH BJ B !xFaH 1!xFƚaH@…;``  a   * ;``23@;``*     ;``23"##㿐?&' ?`'<`C7``.@G?/@ 5?36 @? @?&'3a) @D?  ) ?&6'8@6`@ `9/@8`3d $D;?06`$%/8?&') D `a/ @ @,   *` *  &@ $  *@:@`:@``@  @Ȅ- +` # **` DB+``8@-,  /- L+`* `F JB#  @?@U /-! B??@ DH'–?*  ":+@ ""@# :  -?* @: 7 >  @ ?#@  @" `" "@  "@`@` 0?*` ??*` ?*" - ?Ȕ@?- BH-?@  +`@ :-* `  $@ * `"  @%Ȅ * @/ *` 8+` # **` DB+``<@   B ?, `*?, `0"?@ /! -,  D , D B@‰B" " H, "  @_ /Ȕ+`+` B:  F  h5- $ Ȁ  @ **` DB(;<-   6- / ? ` h+`@B>@r !>@0m`h+`@B>@!>@h @ h+`@`@B>`K !>`0F`$h+`*   `BD: : `/h+`*   `BD: : /` h+`@`Bh>`p>@ >`h!p>`>@>` 㿐? $%  3BB>. "~#>y ?6 ?봖. .  6  .?.<  @. @9 .    1 &@@6  . 1  @@ @ "&&@ @6  .` `@8``7` ) ?$%㿐?&' @:   +@0'Љ B? @?ϕ:ఀ 'N @'ID' ?! <#"a'?+@ +  ?&'$/%? 60#P ?! <#"a?!i["#0<cY@? F?+@ +  ?&'% @㿐?& >`' 0' 6`0B 8H`  C .@@3/< 8@<`0B 8.`6.@8@.@& 3$"'@0%?0@ `0B 8`6/@  4 `  (@*`/@?&'  +  ;``"##can't read fileheadcan't read kfpinconsistent nfiles㿐(<(4  @   /?(4* * * *` (( @@ Ж ( (?آئ@` (  @˰ kvm_getprocskvm_getfiles_filehead_numfiles%s: no such symbolcan't read numfilesX( W  ?'Đ  Ę @)~ ?2(4'2(<@ Ā   @3&(4Đ&(< Ę @)[ ?Ā 8 (4@q  / * * *' ] [ '`' (" b0'''@w  ` "@` ` 2` @@6@8 А@   @(X* ` *` * (4 'Ē @o (<   @&(4Ēܔ&(< '&(4(0  (,@J h&(0` ` ( @Ԗ < <\ Ā耢  @O`耢`I@ ( (2L (,&@% @7* D@  27 D@  2/ `H@ 4 42% x(  (0(,(,(0(@#8@ (,  @$&(0can't read proc at %xcan't read proc credentials at %xnprocs corruptcan't read pgrp at %xcan't read session at %xcan't read tty at %xcan't read tpgrp at &x @6Ȱ-+')% @-!@!@ 0@#  `@ P P 8@'?```@0 @0P@@ `?p8'@  cp68'|7 'H@ $ $%|H *T`'`@ϖ 䀢 #T'܀ '@  @Ȱ?0A'?'?'PL@ @'Ԑ '`@ @@ 7'7Ѐ`7΀` H @ @ @$!@!@@$!p"`@B(cannot read allproccannot read deadproccannot read zombproc㿐(\@T  *  6@@  ($ & @+  @@7?0. + #+ #+  $ ؔ & kvm_getprocsproc size mismatch (%d total, %d chunks)_nprocs_allproc_deadproc_zombproc%s: no such symbolcan't read nprocs8( "(@$&(( ;  ?'''   @& ?@0 &(  @& ? @c "@  @"U @""M' ؒ`'''''ؐ@Ғ  ` "@` ` 2` @@+ @v  @( *` *" *" * @' &(#\Ȑ'&(㿘( @$/&(out of memory㿘@$3 @J㿘G?($* ((: (@`2 (D & * &(D@  *  & * &(D̐ "&(@(4 2 (8(,@l &(4(,&(<(8 2 .(,@`  &(8.(@@ؘ"(@l  (4d"a$(,  (8@(, ?(8 @ #'8 @q $ (<@ *`(4 &(<o &(4(@ " "*@  @"@$ $ $ (@* (@2 $-@$ *$(@"@ " "@ "X@k!@!@ 0耢@ O倢 2 N- " 㿀N`- &h @9  '   h  a@Ŕ  㿘ϖ㿘Ɩinvalid address (%x)㿐 %%  `@   @" & %s: 㿘'P'T'XP! 8a@@@ 0 @c(: %s : %s㿘'P'T'XP#`8a@r@a n!@U!@e0 @:(@S nb(#$  @?a@㿘@"   n@@.bLseek㿘! n@$3$"?  "쀢 ??Pread㿘! n$"@ʔ "쀢 (md init failed/netbsdexec file name too longbad flags arg/dev/mem/dev/drum%s%s: not physical memory device/dev/kmem0?&(&(&( &(&(@"&(&(,  &(0&(4&(8&(@&(`&(d&(H&(L&(P>(X@; @  @##? v`##@ &( S@  I<  9c@偐  ِC``@ &((@ &( @n * @ $&(  @  &(Đ `@ @1  ` @є'@ x(     2t??##cʐ  2k?2 # 2f? 2b?’ &(H"""(    2=(H# @#@26(H2` 22(H  &(L '&(P(  Ð䀢 2(H(    2(H   2 2(H >(X (H "(P@ &(H(P "?@ &(L&(P?already has a dump headerdon't use on live kernelinvalid magic in cpu_hdr㿐(H  w?( m?(  ^ 2d??c# #ʀ@22 # 0Ò P  &(L 8&(P`( 8D 2.(H(L  @ D  >(X(    ?"(H &(H 2`(H 2(H "(H"c"@  2(H(H "(P@ O&(H(P "?@ H&(L&(P?clear_gap㿘  ` ? @ +?  no valid dump header(s)kvm_dump_wrtheader㿐(H`(P   ;U?  @ H(H”??E#(L`# ?  @ 2(H ?"/?(P (L@Җ !(L " ?##''  @۾  (H ? ? ?㿘@=(p     nb@^ @'%s: %s 㿘@#(p   nb!# 8@Ga@V  "p 㿘( &(@!=( &(@!7( &(@!1( &(@!+( "(` @(` "(P@ (P &(L@P(H "(@J( "(0@D(0 "(4@>(4 "(8@8(8 "(@@2(@ @,@* /var/db/kvm.dbVERSION_version#Ȓ   @! $(a?#ؒ ?   2O(`J􀢨G@'(c ''   27(`2 20( @?/ `/ `/ ` / `/ `/ `/ `/ `/ ` / ` / ` /@2 (@ϒ 2( ( @?$(bad namelistsymbol too large㿐h 2@h@K?P’ 0JD? 41` ` @J@ ",$@@B @'$?h'  2` `     ,? ,? ,? , ,@ Ԥ $@*` . .  .  > &clearing dump on live kernel_dumpmagcannot invalidate dump - pwritex( YH2?#h''? H !?@܀  n( ""ܠ'@  @y ? xJ ?kvm_readshort readno valid dump header㿐  n "b@`  " @?>08H P *?$$!@ ۀ# n@  $b@" &"$@$kvm_writeshort writekvm_write not implemented for dead kernels㿘(  n "b@  ( ? 80H?_kvm_freevtop: internal error㿘(` s&(`Unsupported CPU type㿘(P  "at     L "8 &(, L "c8&(,H`?(,@ L"c< 㿘!!t? ΐ !t? " 4  @ @a@invalid address (%x)㿘(P@ < 2`!" 6`" 6` `?*  *    * ?$ L<@& at? >`  ?>` *  (, Lc8?+@ *  &(, & ̒  cannot read pte for %x㿐(P@ G 2`!" 6`" 6` `?*   *  `6at?  >`  >` |@" @p (   ( @     `  (, ?@* &(, "@p  㿘(P @ 1 @:&@ 0@  (,: : : * @"(,6`  : *@    @ 1? @@ 1  㿘(P    !  2 8 B 82  @ D (X@ F@ F@  f  ??P"($"(("(  㿘x`  !x $!x?@!x !x㿘 m#Ȁ #`     `@   m#ȑ, @@?, @!㿘 LcH  "cH$NetBSD: setlogin.S,v 1.5 1998/07/01 02:16:28 tv Exp $ 2 <b@ m c$NetBSD: exect.S,v 1.2 1997/07/16 14:37:55 christos Exp $ ; <b@%m/%d/%y%H:%M%H:%M:%S㿐@'+` B D:  ` J `"-` 'J@ ` !`%d`@ۑ* : `Te` 8*` €}}}}}}}}}}}}}}}}}}}}}}}}}}}} ~ }}}l}}}}}}}~8~$}$~|}}}}}}} }@@}}}`4 }l}~d} }}D~+`J:` @ '      !] Z' cHR O' cXG D' !; 8'} c`0 -'r !$ !'f ! 'Z ' !!*`@ @ !*` @i !*`@  !*@ @Z "  '`u5&( ' !!*`h@ @ !h*` @7 !8*`@  !8*` @& "   '` A&'  @ c 2`@ d*@ *`@ *` & *` *  * Ұ    ʰ ǰ  w    @   "&@  @!n ?&  M ;  @ ?& 1!@͇  ! 4{ !@z 2r ` 4n ` !&@ "@^'a   =Y    5Q   @M 2C@F C  @? \8 @5 c x`@% d* @*`@*`@ & DC A d DJ@ `" @D'J@ ` @+` 㿘 @?А " / 9L@* ?Р@ ` &@ߒ , *`@2L@$&@  㿐 '`v@㿐`w@v ?㿐` ``" '0'@? " `@Y㿘`^@P " $" ( " ( " $  ? ? @  gc" "" "  ( $2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ ` ( + 88 " ( "   (8 J2J " X@V+  2     " *@ `2" "@ `2 *@ `0* @  "2 2  "? *@2" ?"@? *@    LX 2H* HJ  " H L X ?J   LH  2*? ##X 2HJ㿘 Lch@h < 1 b, c$ ?&*@ ? *@( l  ?*@0 8  ? *@  d - s p w*@!` r -*@ ` w -*@ (@@` 0 @ 0  - x S s*@`  r -*@ ` w -*@ $` 0  0  - x S s*@`  r -*@ ` w -*@ "  ` " "   *@ - x T t*@` *@*`sh-c/bin/sh`##!a?Ȁ ''D ''''' @؀?7?@gk? "    @ '?@  n#!@@ @f  @b @  @ @U @R ??ā?㿘"`'"4"@+"b  b  9  )q`@@"m$  `b"* *` * ""䀦  "@ b*` * 㿘㿘#!b" """@ :`*`  "A ""$""#"􀦠?        ""#" $"  ? "b$"#""`* "b#bw" &@"b"@ :`*`  &@㿘 @@ 'b """@ :`*`  "`4, `#,`c#@ #$ %$"b#b b   b( @~"* @"* @"㿘"`"qbm@ 9  * $b@#  2`" "#b 㿘%s: illegal option -- %c %s: option requires an argument -- %c 㿘 m  !#DJ`(# m@" !+ @$#DJ`-"J$# $#DJ -#DJ`  #D$ #"@$#Di?#D# mJ $#D`:$c@G 2J c-#DV?J`c@ "c@#<`I ?N :EP`$ 80c : #D n"cJ6cc@ 0"c@#DJ@  n""#@ "@$#$#DN`: :#<` P`$c 8c@c  ?* @ n"c@$#`$#D"@c㿘@ 㿘! n"2 M h$""*@ " ?""$" *"@" 㿘#@㿘 @? @fz㿘  @fr 㿘 @? @fh$ x@%cؔ  ''''''#'@֒耢  ?㿘 @朔   㿘'L'P'T'X@ҔL㿘`? "`` *:  @ * "@@ 㿘 ? & @r  & @Hp$(authunix_create: out of memory@S ( J @N! E n&!$` $`$$ H$  $ $`  $` $`$ @\$ H0P' '''''@~!@ 4@:`€ $@$  $ @4$@ $` @$`0&@š!` @v     @m@k P@ے!?@@`/@`Ң @a @㿘 $`` a㿀@( $` @`   @-$ @ " ' & &   & @$ & &  & @e `$ @2 7  $ ''  @ݖ @w @ ''` @g  $ $ @1$ '@W`@㿘 $@   @@ $  @@auth_none.c - Fatal marshalling problem㿀 $`!@ @)  @$ 2 '@! @$a  `@`   ` $  @@ @<@: <  # >(` @:`@?? D@4 8`8 >>`@ ` "`@`  @㿘#/.> @@" @ @  #$ @.` 2 > @Ͳ` @"Ȱ @"ö @)@"@=@a@"@@@$@ @@?@ f_@@ޘ?@И 2 8@@?`)> ?%". @ . "@2 &  :+` ;  &  +`: :&㿘#Dc ԑ. > @8 @"A @!@ @C @!@  @"@" &@D(@"d  , N@: @` ` * @z@@@  @ `r @2   "} @ :g N @   "o@ :Z N@ 2V   dP  @    @ @  @ N @   @ @ (: N `24 _0@ :/ $N@@   @  @ N@ @   2 @ : N@ `2 _"  @(  N `_ . c$ .  .2@  .@> @P@"Y @>ϰ @"T ɰ @>@> @a , ,  `? ` ?   "@ &@  @ @b 2   @.@ 2@ȶ 2>, /` " `/` @>, " &  2d[# ?#$!" G/  > @ @A /   @ /  "?, ,  &@  :`:_ 2"  :, ,  &@   :`; G 2   :  㿘 @ N * @7    -@-` @ N@"    2       ,   2     `   0  "` `@ ? ` D `_ D `2 _ D ``_{`   `{_  { @ 2 @2x&   `㿘  0@ N * @   -@` @ N@    2       ,   2     `   0  "` `@L ? ` D `_ D `2 _ D ``_{`   `{_  { @ 2 2@2x㿘 փ(`>!+ @) "n`"N. (NR~@ Y @"j@@`@耠 $@  V"m {&(`r8@2ni ``2gb 8b] `2]X 2YT 4UP `(`M@@ `"GB (@ @0@@0:@@"8  2((@@ (+@@")(   5>@(*(@.  @@(@(@3(``   ` $  @@ @<@: <    `$`$ $` @ $` $`(  @$`,$`  @  @ $`0$`  @   @$` $`4 @` ~ $``@W "`2` H {`` @`D @ * $`` @`D@4 H??`+` : : @`D@$` H 2 L`$2  L`@`$`` ``@ Z*  L$``$`` "``@v  -`@ `@c `@  ` @ ^2` H 2{` ` `&@ #  ; 8>>(` @:`@?? D@4 8`8 >>`@ ` "`@ a` "`$@ [`$ @ W㿘#/.> @@" @ @  #$ @.` 2 > @Ͳ` @"Ȱ @"ö @)@"@=@a@"@@@$@ @"@?@ f_@@?@ 2 8@ܘ@՘?`)> ?%". @ . "@2 &  :+` ;  &  +`: :&㿘#Dc ԑ. > @8 @"A @!@ @C @!@  @"@" &@D(@"d  , N@: @` ` * @z@@@  @ `r @2   "} @ :g N @   "o@ :Z N@ 2V   dP  @    @ @  @ N @   @ @ (: N `24 _0@ :/ $N@@   @  @ N@ @   2 @ : N@ `2 _"  @(  N `_ . c$ .  .2@  .@> @P@"Y @>ϰ @"T ɰ @>@> @a , ,  `? ` ?   "@ &@  @ @9 2   @.@ 2@ȶ 2>, /` " `/` @>, " &  2d[# ?#$!" G/  > @ @A /   @ /  "?, ,  &@  :`:_ 2"  :, ,  &@   :`; G 2   :  㿘  ,@ 0 ( N@  , @g @ 5@@@N` @ N@@Z "    2       ,    2      `   0  "``@ ? ` D `_  D `2 _ D ``_{`   `{ _  {  @ɚ L @2f& L  `㿘  4@ 0 ( N@  , @  5@͐@Ȓ@` @ N@   2 ,   ,    `     `  0  "`` @S ? ` D `_  D `2 _ D ``_{`   `{ _  {   @ L 2@" @2h㿘>!`+@ "@) "x`"N.`(ܞPV~Ӟʄ@ e@ Ȟ@"{@@q@耠7$@  k"@&(#`8@2@ ``2@~ 8~@w `2w@p 2q@j 4k@d `(`a `"[@T @@  @.@@O@I/@("F A@@ @.@@6/@O@2@(@   >@(@@@@/@@ @.`(@ "@@@/@@@(`㿘<"e @ @4"E@ `( "`    "  a \ԸԘԈhX8(ӸӨӈxX H0    Ҹ ҨҀpXH Ѹ*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x`> @4 2!4 耢`   !   !" @1 2/5@ 2@ @!*0%d㿘4 耢`   @p  "  2 5@15!8ذبؠؘphXP`X0( 0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumxph`XP@8 0 (        ߸߰ߨߠߘߐ߈߀xph`XPH@80(( !"#$%&ް'ޘ(ހ)p*`+X,P-@-8.(. //0123456789:ݰ;ݠ<ݐ=x>h?X@@[0\ \]^^__ܰ`ܠ{܈{x|h}P}H~@DELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(   " @@h!S 4v * @`*`@]$` $` $`@͐h @$`$`$@$`$` ` `H*`"`` "!  $ $ 4$ 8$ $ $ $ $ ($ ,$ 0$ <$ @$ D P @!$ H@  `$ @:  @d @z @  `$ $@ :@ @ @ l4 (< DbE$ L$e$$ $ @ϒ ` @T4`㿘     "@ i  "@ G  " @  "@ <    : " @+ @ :  @ |*  @ @  @  J@ |`&  " @ Y "@ $㿘 @ܑ* : ` X&9 t* €HH\H4 @ @   D`" D D  ,  " @ @J@ )  )  ,  H" @p J`)]&@͒ Y@^   ( "( ,`J",@P  ( "( 0`="0@ 9@ 4  `@+ @1 &@" @ @  @`,`& @ J@D @y ,`:`@ @ ۘ @֐ ,`<  ? {ϐ` J`D  &,`@R <  +"(  ? *"  , {J"@ "@ "@ "@v"@Ԗ "@i "@Ɩ "@  " @"@  @ $@ I@ J ,&JD  !@@@ݒ @4 @   J@ }@ `&@ : J@ }`@ & @ @ @  @  @֐ ,`:  ? {`  J`D @ 㿘  @    J&@ *J㿘   @ , J@ ^(@ `&@  ( "( ,`",  ` : J@2J` `@"  @ 뀢@ ` & @Ԕ  ( "( 0`"0 @@/ 㿘J@ ``\ & @ @   a&a)xa{`." `[`*`0 a(&0 a}a9a1 ~a?Z0} `@=y @ t@?p@ l  D`" D D  ,  " @j @ `  J@ \J` ) \H )  ,  H" @L @ ` J@ \ J` )`)&@ %,  H @+ @`@! @    "`H@~ @ ~  @ " J@ *  `"&@ "@ "@ "@w p` n`$J@ \j`$J` {f`$`&@g @ J@ ,` &J`D !@P @& !@z  @  `  J@ \ J` } `(& @    `J \`J } @ ` &  @ @ @  `$  㿘  #DJ@ `  . J* ?а  J `  @ [:<:]][:>:]]㿘@    <c0@k  2&   <c8@\  2 (@ &  J ^ &   J ] &@ ` ] *] ``]$ J -! &@ ` - *- ``-,` `  J@ -J` ] @   J ]耢@  J - &@ ` - *- ``-,`  J`]&@   s ` ,`?,"` %@  `@ D `"?@* : @ `@ `@ + ` ,`?<@` @ - `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @ݒ@  @@א@%0@C@@ 㿘   J - [2     @ 0* :  : ="3 0c  &@ J - ]@v @  @l      J :J ]2@Y 0l &@Q J - ]@G @  @=    J = J ]?&@' 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@ @@ ` ` + ` `@.`㿘  #DJ ` &5"8"8"@ @՛ 2` @J ` @ 2`@ 0$L  @ ` `@ + ` .`L ` `L  @@ L`㿘@K =@ @ ` +@ `@.`㿘 @ @}  @ ` :J@J@ [2 J@J` .2J@`$J@`$@ . @ ` J@ . J` ]`$@L . > 㿘 @  @  `  J@J` ]  & @   6a@" a@@@ 2`@J`"N``@   @ 0L@D(* : h*  H㿐  ]& &///7& &㿘 ` `8#D@ ` ͐* : ے0@Z`  `4, "`4㿐  ^  ]& &////& &㿘     .  `?#ؓ*` €(000Xo& $@`Ĕ  "@  " @<"@  @3 $@ 0K$@ "@  "@"@є  @ $@Ȕ ` @ 0$$@Ӗ "@0@p0@f0@  ""  M" " 㿘 `  "`   K` 4 & @` @,  "`@,  "   @ "`@{  " , `  :`@` $ `  ``%@ @ދ    `-   < @`, % &*,,$$    (  **   +   㿘  * @ *`   `2  "    @@`  @ @  @     ݚ` &@>    `@ @" * :       `@ @2  㿘`@d`  @&`@! &` @ &` `  0?@` ` *? ,8    ` "     ,8   `  "     㿘  *`8?? 2!`Ē "``4` &`4 , 2  ǔ 2,   ``ܤ㿘  @e@ .` *  @;. $ 㿘    @&   2`@:`*` @F  *`@"`& 㿘  ( ސ ,   H   *  # @  " * . " @@@o* "    (@> "@㿘   @.` 2&  0& 㿘 &`  @*` &`  &`㿘  w `#` >+)'%$ "#@ `5+`@ ". * !`@" `@ " "`@ * @@ 2`( `@$ &`@ 2@`@ $@  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`( 2  *2@ 2 : : *2@ : 㿐?&p' x +1  0?@I `0、  ? @I  1#?shelltcpRCMD_CMD㿐@ 2@ ?0&CC&!@ va .``2 @,`C@ȣ"#\@ ,`#\2@a㿐@  &#\@P@߰?rcmd: socket: All ports in usercmd: socketrcmd: connect to address %sTrying %s... %s: %s %drcmd: write (setting up stderr)poll: setting up stderrpoll: protocol failure in circuit setuprcmd: acceptrcmd: protocol failure in circuit setup.%s('H@*'L' ''''Đ @#?-#' 5C3C/C<-C@@`0?1'@`=2 `4@7$,`` 1@@\'@X@"@ $@g @\' 8@ځx@ܐ @`#@̐(ؐ @_cHԐ  @ǩ  L//7@> @:  \?  'Cc@1 `'@ '@Cڒ C@ϒ @2 @@+ @C@_# 7'7@`'"Ȓ @? ր @S`"CC@_#q@f#m@D/@ D@_ a'\ #ڀ#!D@I L@ @ː@ސ @Ő@ؐ @@”  HD@_Q @,O   @ O @    @ 0!C@#@ 8@٨   \@@ @ ?/bin/rcmdrshrcmd: unknown user: %srshrcmd: socketpairrshrcmd: forkrshrcmd: dup2rshrcmd: second forkrshrcmd: setuid(%lu)localhost/bin/sh-c-lrshrcmd: exec %s㿀\`E!H@-  E!X@?  @B* `E!x    @B耢 6E !x'@@E. E!@^?0}@&@C  E @C  `E@^!@o @C   E@^!@d @@0  @B  E@^!@U @D E@^z!@L @H @A "EE@^k!@= @a @  J@  E!@y /  E@= E@y /  E#\@=E"@^5@ @`@ @^4 㿈  //'  @T 67?@耢  $@İ?@@"@ ϐ 2 )?'   h " @K  `  . h"  .   @< ߰  ". ?/etc/hosts.equivr/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner0`  FF"`@bx @s @j @`2e?#Ā``"^?@+ X @#!F"@#"@@@@@@A @  @AFbx@@A @A2@&  F#"<  F"@-@  F"Ȁ` @F" F"  m"c@+?x@T!x ߨ @&  0ؐ@Ɛ Ҁ?0L "  #D`(*:  `*   , L   *L  , L`  ` " J`  `  `  "x  * :`x ,J  Ox + - `* :   @`068  @ %z @0:x(# `* :   @`0? @ z @0x   @O @KL@ + -L`  @`0 # ` @0x L`  @ `` @/x @А  ?@ɐ`?   ?? 2   !@ה ?㿐cD'D@ ` @D D `?@  2     D@Ӕ     rcmd: address %s not listed for host %s㿐'DD @   / 1 M"@@  @ , 2`! `D`D@Þ  ""` $` 2`D!H!'@WŐ@@\_  %x.0.%x%02x㿐+ M c  77Hb@w @? `  @` @ @@2 @- `H@w֒b Hb@wА`@1HL 2  @@wĒ"`@*L@- 4`Hb@w@ c @  M υ(858C`ID(%(%(%(%(%(%(%(%(%(%,%,%,%,%,%,%,%$%$%$%$%$%$%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%,%%%%%%*@  ` @  H*@`*@ `@@' 1/@ #  #@ .@  :  *  . : .  N,   `' N` 4`6 `6 ` 6 6 6 @G 4 4 4 4 4 4 @Ԑ `*@ @.  @* 4 4 4 4 4 4 %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dxN -   #\Ic@B=#!Ic#\#`@B#!ђ!I#\#`c0@B!!IcH@A@!`iӑ* : `K\`J!$*` €*|*t*t*|*|*|*|*|*|*|*|*T*T*t*t*t*t*t*t*t*h*h*h*h*h*h*t*p*t*t*t*t*t*t*t*t*t*t*t*t*t*t*t*\*t*t*t*t*t*t*t*t*h*h*h*h*h*h*t*p*t*t*t*t*t*t*t*t*t*t*t*t*t*t*t*\   0,@  ,@L@  @I#X- I`0#hI#`"#h#耢`L@  ` "  4 ?@X  ,   ? @AY,@?@AP!@㿘`!  @ @쉒` 4   @ $@"@/ @/`@&/㿘@`@ `@>  .`   @:Y`А  ?*`: ?А *`: ? `*`: ?   2    ' K!\,  €-------------?,@`".` ,@` , ,@ ` ,@``$@ @$@.`.@㿘 ) N @    @    :, @  .",   @ ` 2  , ,  , @ 뀤, 㿘 N!!`    @ӑ @@ NА *`: ?А *`: ? *`: ?ɀ`2    K#ؓ,  €/0/0040,0,,@` ͤ,ɠ ,@ `Ĥ ,@` N!  $@ *!    N8 *`ؚ . *@  ` 2   *`*@` *@` *  N*@!9 02  "2 2 㿐 @?.@ .  ?#@.   ?#. ` '@   0? (?#2h2X282 2No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x N   n@/'$ Lb '' n@ b@"$$  L"$ : $$ @> Resolver internal errorUnknown resolver error LL #0LL#H* 㿘# nb@Tz0  `b @ b@T 2 b @Tw㿘% n@T\0@ؐ `  @ΐ   0 ` @ @Tb 2 @TG8 ? c N  ش ` $ n ` @ ` O/ O, <" <"` A  =@" 6@ 0/@Ò *`  @ *   ` 2@" &d @0 "_ $@G  @' ŀK`$` ,@`, @" 8%,, @ %,/J@ @ .  N .  0@ "@  @` `@*@l``ג @yƐ,"` ,`  "` n "b 㿈% n@T0 @T 2 @T&  n "b 0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpap     *2#"N NH  NB `h@rUN`@rM`@rE `@r<  @>$  `2 " `"" 2```" &  n "b :7:8:=nisdnsfilesnetworksgetnetbyaddr㿈"` ?@;? n""! n$"NNN#\b\⸘!'@  $" 㿐% n@S0@I `@B    @S 2@ `@S`&  n "b 㷈@/  @>$  #  &  n "b :;d:<:?pgetnetbyname㿐"` ?@? n""! n$"ONO`ธ!'@  $" %u%u.%u%u.%u.%u%u.%u.%u.%unetworks.byaddrp /# O` ` @ "` ' O$  @$$   *2#"O OA  O; a`@q ` Oah@q` ap@p ` a@p` !O!@ O $@:I`( @F$ &  n "b networks.byname㿐! O   @~ ' O& ' O$$  @( $$!O#`@ O@:`( @$ &  n "b  㿘' O%P$,@@ 2.8  N "  " @@ ,@`@w} O,`< " ""`  N    $ @@ .  2N$,AxApfilesdnsgethostby*.getanswer: asked for "%s %s %s", got type "%s"㻀 O@'䀦  H 2 #ߐ '`?` O"c ''` @ 쀢 ` O@6 ` n O"@'' H OH O O"\""\"`"`   53@ 쀢 " @`* 2 @[* 4 @V* 2  }< 9  O䀥@@$  %@@֐  `˪`@"'@' @ 4ب `4ը @ O"? H*'@V$ & @ " @ء @ 4 `4 @~"''' @Hʐ @H@HP %@S > O0}; O0z@䀢  %<@ &j @;쀢  O H O䀥@%@`?T @A `K "@'E'HH@|쀢   OH %@SL9 @2! W O @ H "@''" ``"@ @ '  O"<:% @f"''@ "  쀥6!" !d%@` % O O@ OH H@͐ @  n` @~ O" H?"  @ n"" n "b 㿘!" `2  @" n""   @   2@ ApQHAxUI[8nishostsgethostbyname㿀``   n ?@"b /"% OH"` "`@ . 2@ W# $  ,`@`,`,L` `/ `N@ /@ `/ L  ݐ$` W# ?,`@p ` @C  @= ``@ %s/%s/%s/%s/%s㿐` 1 X  @Gࠢ )\ @  `#\#` Ȗ`  @'@ `  POSIX%s/%s/%s㻘- W+, c@@@{ N[a @u \ap@o ([2!c%D"@@"%@ݒ $D%h!耢@"%@݈ $h%(!(@c@~ $(c@ @  p, X  \x@̒$  @ @ @@Δ 0 rBSDCTYPE㿈\@ʒb  y   @P h\c@S  a  @B Z쀢 W  @8 P耢!M@ܰ! H`,@ @(耢 ? @ܢ*  :?4 @耢 0 @ܓ*  +4 @ 耢 "@U!#D"@@1@ 1 h!耢@$#D@ ! (!(@& h@ $ (  @ې@ِ@א@/ w㿐]@Da 8 \# @ . '  @ $!'  @ ` !@! !@!  !@!@ @ 㿐?@  @ '$ * ? ?* 2 c  2 * 0* * 2 $NetBSD: _setjmp.S,v 1.5 1998/07/01 02:16:27 tv Exp $" " " @" `&"`@{6 0`$NetBSD: __setjmp14.S,v 1.1 1998/09/29 05:55:48 christos Exp $  !% " !H P """  """㿠   @" & !' @>㿘@T,?㿘? @T$ ` D@2+` `  `  `  +`\ @ +g` e^D*`zzzzzzzzyz@yz(zXyzzzzzzzzzzzzzzzzzzzp \+  no+ \+  ri+ \+  bc+ \+  a]+ \+  vW+ \+  tQ+ \+  fK+ \+  sE+ \+  0+= + 8+ ` @ \2`+0 2`+ 0+ ` 0!+ \+ ` M+ D@   ^+`  ? +`@+ -+ +  +㿘@N@:`-@*``2`"*㿘 N@`N@8N@N@ "*㿈`  `'@'''@(w㿐А"? . "* * ''@mS  @? "㿘@ ̀? _\(}x}0\`\+ +͐ l_(xxxxxxxxp8++? ?+; - + ) ' % # !   "8 `-`^ 20" "- "   '+`?  `+" Ѐ`   ( +" " Ѐ"  (+"?㿐@*`'>  "   " @? "@? @*` `>   " $,㿈 !'''  @۶ ? ? ''' a @ۧ ?"? ''' b @ۙ ?"? c'''  @ۊ ????' ? 쀢 (**??'  !?'d  @c ?"?/var/run/dev.db@n` @a 5 <  `, #(   @=    ?HH 'L?P'H PX 2  1#uX\@°? 0@@/dev/0a@ @ & @0"#u`@ @۝@  @@`@@N 2@ xph`XPH@80( PWRUSR2USR1INFOWINCHPROFVTALRMXFSZXCPUIOTTOUTTINCHLDCONTTSTPSTOPURGTERMALRMPIPESYSSEGVBUSKILLFPEEMTABRTTRAPILLQUITINTHUPSignal 0㿀 @ 0` n?#@j  "2*  * @#  ??#@V  "2*`  * *#  '@n  I `H@g" 8o-"DXH+"B0D< 0Au> !00  ` `  `**`**`` *``+ `+ `"  *"`xM K ?'''' @@%` @%^ @ @N @>` 2 #D  ` /`0 @z А M   @׮ `  =@/*@׏ *  *:  g"8 o a *=  u* =  =  + - =֐=  ="   ?* : ` b# *` €LLLLLLLLLLLLLLLLLLLLLLLL$"ά"Ǭ II `-`@!`& ? ?@ = @ =  ="  + `-`@``& ? ?@  X@j  `-`@`H& ? ?@ M= @RA2 = =  =!=  ="  `-`@’`"& ? ?@ @, `-`@֩` & ? ?@  X@* *:```,.@T`g"*`o`= -`X`+`-0>0;`u06*" -"   +* ("  %" *2 ?* "  * " +-  =  *  㿘 - + X  & &@N+-X   `(8-+@8@@X@8@@ @(@`.&. `.&. "N.&.İ longjmp botch. 㿘da @~ 㿐  ?  @ϖ ?? 㿘@@㿘  N@2`*`@   @㿘1"D 2 !"T != ?@&  &"D "T? $"T㿘1"H 2 !"X   ?@   &"H "X? $"X㿘1"L 2 !"\ != ?@  &"L "\? $"\㿘1"P 2 !"`   ?@ؒ  &"P "`? $"`%lu㿘!"D  L @Ê!="D*  `$! $2 !``26 4 !"<  @ Ԑ "<`$"< @ԍ ($@     d& $@S  `& 2& $  @R  &. #㿘!"H S L @3 "H*  `$! $2 !``26 4 !"@  @ "@`$"@ @6 ($@Ő    d& $@  `& 2& $  @  &. #㿘@I "V?N Q#bL  H!=bL*    @3  2 # 3? $#b<  @  b<`$b<  @א ($   @ ͐ ?` &@@ @ , #  $` $ $&@ $?㿘@ "V?N Q#bP  He bP*    @ג  2 # 3? $#b@  @^ b@`$b@  @{ ($   @ ?` &@@N @, #  $` $ $&@ $?r+/bin/shsh-c㿈'H'D@# + fa0'H   @!c  ' HK@ r'耢 w HK` @$K @֥  l"@" ' @$p?  HDJ@@Ӆ @J@H0P X!  H@ @> HK@ r@4 @"* @,耣`"f @"!  f@! "f@" @fffD!8a@H@ @h  r2@@H@ X! #`"! #@#`㿐% X      2  ?@r  @` ` @=f ?`$ $@@??h㿘 @  ?@@Բ㿘g  , @ €?  , ?D  D     D  D  D  D  D  D  D  D  D  D (   ? P '@@ d ? 㷐`&`&&~@ & &&   !`  2@`@ @    \2 2@   \? 2@`@ *`2@ @0 @㿐 {  }   @ " @Z { @ے㷐@ @`2@     [ { ` `] `"   }`2 `  ` `2 ` @Q&@M@ [" { ,`>` }`8`` `@ ] ", +`(``$`,"!` 2   * 2` * 2` [&``@(@& HOME㿘 ~A (=     /" **`*N@  h@" 2J@@  @ Ր  J  + : 2J` * 2`㷐@`i   [`!   ?`*`?"H` `[`*G `R4O ``!    [@L ] 2 4 [4`!; 9`!  4   - `4 -  `]" 4 ` 4 `]` `]!4&` 4!&` ` ! &` ?"44 `4@. 2#@` 2 #"?@ 0  `- `*` i #@  㿘@"@㷐 @ 0 4 6@@ " K " /#< !@(@2@ 2  2 /6@6`&@$ `/ @2 3` ` `/ 6@ /` @㻘@'6@"@* 2   @c@ € C? "? 0=< @ ( %" . ` . ` 6@` @4 ` @e ? 6@[ 2 Ā 2J` @ @0@}㿘`@`` * @ʐ @@  "3?` 2&``` *`,&`??$&`  @ `"@@ :   @@` * $&@@``  * $?㿘@k   ?`*   [`!@* 2 @`@@@P"L"T  "K   F  4  * 3  @@`? `@*` ]2 `  - @  2 3 `@( `@" *`2 `@ @  2 @° @*@`?㿘 ` * ?? @@ ?@?`@ .㻘 k 7@:` @2` @0@㻘@* @2$@0€㻘@ @2(@ϒ0€    (*@ `㿘@0@n @ 2@offonsecurelocalrtsctsdtrctssoftcarmdmbufwindowclass㿘# Xb 1 X@ "1 X!Pb@ua Ȁ ;@̒  %0!P@lb 퀢?0D L ` * :  "ߠ!P #"ܠ!P1 X' X&!0@,!0$`L $`$`@$`L $`ް @ސ!0"` "`L L kb@Q   kL D k` ?$` b @?   kL D k`  $` b(@-   kL D k`  y$` b0@   kL D k`  g$` b8@    kL D k`  U$` b@@   kL D k`  @C$` bH@   kL D k`  1$` bP@Ӕ   kL D k`  $` bX@   kL  =b`@$`b`@  LL  =2 L@r$`@%L`2NkL #" L #2 !0 L "  " !0& L "& @ 2,J D X"62 *`\2 *J "2*  *'# +")*  2 +"* J "   "   J "  "  " 0   *`8€"*㿘@g =   /etc/ttysr㿘1 X"  mm p@g`&"@ @X 㿘1 X"  @7: &"@  compat㿈! ,    "X @ј $ , @ ,''''  : `?㿈! , " @k ,''   `?㿘' Y Z"%D$(D` (L@   @I @,("@AD (" `(L@   @1 @("@)  ("  m(b" "  "" `(L@   @ @`("@  ("  `(L@   @ @ڒ("@  ("  `(L@   @ߐ @(" @  Y("  Y( Y $x"$#"master.passwd.bynamepasswd.adjunct.byname㿐! 0?.@d$ 0 ) 01 Y" "@`Z " 0bn`X@ݔ   $ 0  2  0"n`p@͔  0 $ 0 0##:㿈 ' 0'@8 X (`  Y"`& 2`` (& ` "`(& ` "` (& ` 2& 25 n @aX ".  Y!n" p@B@l쀢 2 쀢( X$'$ X@Ր"0n`@Q "  @P 2&  X# Ybl  @h 2J  2 / 3 1"0$"0! Yp?p6  "p@ـ  @Ӓ  ''@˔  '@'@_   Y 2"t Y?"bp Y"t` 2bl @$blpasswd-%upasswd%uuidx2 # Y1 Y1!o0%30!bN 1 Yop"@;#b!o $b "@>$  o"@($o @g",c@X܀?) ܔ@Y 2@ͻ`2  Y?"b@$ܒ@Y,c Y"Dߒ 2# Y0 @X܁passwd.bynamemaster.passwd.byuidpasswd.byuidh' Y  @^   on X"  2$+ Y 3 1 Y0" 0"@̔$+ Y Yo"@$^ oo"0"H@+ Yb 2.- '@@0ؠ "  ܀ g@,ጐؔ$+ @ @". Y"D_ TR ) Y" 5 YK % Y|''܀  |ܒ#\#` ‒@BР@|   0&|$ %"&|  ‒@B@ؠ  Ԁ "@ؠbܐ* @B$@,# Y"D | h`  @'1 Y"lȒ 1 + '//''   "l ؟   nsswitch.conf passwd_compat database can't use '%s'㿘1 Y"4 pa@4u  &"4 ˜˜ˆX  nisdnsfilesˆpasswd_compatgetpwcompat㿐 2 p 3 1p0&p0#pppbL"  2pp#\bL"   1ppp#\bL"  3@|@x Y"l`@F  b?! Y" ; "  2 5 #  0   $"@ߔ܀ @|$"݀J ؐ 1  1 4 1 @ 4& 4 ǀd @# Ybp?bp[   2$bp/@˃  ''@  ?G$bpEC YDJ`+`-J `! Y`@1   $" $"@` 0$"@q & 4$J ``@@M  䀢` J@ ǐ @f܀ @g c`' Yl  @ İ  2  1  3"0@ 0 '?DJ`+`-F 10eDJ   @ D* 1ܔ g0+2D@ ̒@IJ @?UJ  1  䀦0  '  <eD #`03J ``@@  ̀` J@ , ̒@˔Ā @h 1  1 3D@  3 `D @`  ' 2/@}  ''@ "s5 Y Y"t"`(l @$l3`,  @&`,˜ˆX Øgetpwent㿘rormaؘ! @{P 2 2 1 Y"D˜ˆX Xgetpwnam㿐 " N rorm#\b0p! @{# 1   Y"D ˜ˆX Xgetpwuid㿐rorm#\b(! @z 3   Y"D㿘! Y"| Y Y Y"bt""p"@, 1 , Y Y$"|"""b@ & ," ( 㿘 㿘! Y"l Y""p@ $"l! Y"| Y`""@ #`, Y Y$"|"""b@ $`," (/etc/spwd.db/etc/pwd.db%s: %m㿘 Y@X"b ss    @  Y "bls`   @ژ  Y "bl 1 Y"8  s`@1  &"8 㿐 Yl    Y ? 0 @H Y<  ! Yd"@@Ʃ"< $"@t  Y"@% Y$D* ,@` `D" *`,@* ,@` `! Y"L@!   @   @ $  * ,@` `D" *`,@* ,@` `D" *`,@* ,@` `D" *`,@* ,@` ` Y"h@ߔ  &  Y"x@Ԕ   Y "bx /dev/ttyw+ Hss#@zc  8P ''''' @,@@@#Ԩ` '@6@ߒ @R1 [#0@Q 0 , @? ,@t`@Lj   Ԑ`@'Ԓ @Ȑ @ ㈀@ "#0@#0шрnisfiles㿘L@  @#D `2` `L@  @#DL@ @  K  `􀢠  *:   #D `2   *  *:    *: #&   `&@ `@y` @ą@* & 㿘@Ր  2`@yJ $ ,  ,   )~    "@) @#@! p' \4 1 @Ր @Ė 2 `@y  .@/4''  ؟а@ "  ?0 @  % netgroupnetgroup.byusernetgroup.byhostx# \`0`0  @Y(  5 3  2 u 3 1u0 u0  !@P&`0@m@܀       @ē @ďшрlookup㿐uuut#\#`b4X!h@x/  `?netgroup: Syntax error `%s'㿘J "_ #u%J #X   #D `  &J` L (  &@vbb8?6  D `@ `2J@  `& `J``D `" "L"`@à &@@x @;@  * 2J netgroup: Cycle in group `%s'㿈@V>  @v `@v02@U'e 1  &@ݞ3'r耢   ?0 0 @0 `&`" ǐ@_㿘  ` `@}  `  @q     @e   㿈@UՒ  @Èv `@uT @U' 1  G @s ' 耢 "8 ?304# 1`" @U  `" @N  `@G @D ` ʐ@6 0@3 0@%s.%s㿘@³ v`@w(  #N  `N@  @m(%s,%s,%s)㿘w @w P w P`w P@P㿐  @` @ Y@֐   ,㿘 ۔   Ք  ̔  ƒ "$ @r7w"N@N ,2`N@`@( `@˜  @ 逦@@Ž 㿘#`! $   $@{   `" @t   `@m  @j`Ѐ`$ ! \ 4  @$ 4/etc/netgroup.db㿘@TK%Ѐ ! \ 4  w#   @M $ 4@~ 2`@v= =Ԑ$@TZ Ԇ   #`" "Ԑ 㿘! \ 4  `w#   @ $ 4` `  3`  2(  2 @S@}R @T 㿘# \`D    @l  $`D% \H` ! \ @@` $`D! `D! \H `D@`D`*` @:$H $ @H@F % DH* @ @&`D㿘1 m#   \ P@!     &# \J P P`  x  'ܰ''ܘ @Å  ?8  *'*`H <@*㿘 6?&@ 0.,`   &,  @ 2`   , `@  􀤀6?`,&  ,  ޕ, @  2`@&㿘 \!T` @Y   @Ɣ 1 \ !X㿘@H  @  \ah  @^  \!X 㿘@/  @  \ah  @E  \!X 㿘! ^  \`"!l@Ð  ^ ^ ^$ " "`"/etc/groupr㿘1 \!T  yy!@u"a&!T@ @Kְ 㿘@ 㿘  \"!h  㿘! \!T @$!T㿀# \al ' ) ]5 \ T@gd$    $al@ɒ  0 @iT 瀢?0@+   %ugroup-%ugroupx `  ^ N @N;܀?% ]G C +y@$ܒ@O).@ `21 `@$y $@p ! ^y (@g$  $ ܴ.@Nޔc8 2@``  ^?"`@N9܁group.bynamegroup.bygidh# ^``  @T9    `H! ] @6$ `y  $@ ` *#'z z ȴ @w@ؠ  ܀ | @ w @ܐؔ$+ @ @.@` ca - ^ \ 'z1 ^5 ^ '܀ 4 ܒ#\#` `'ธ@8ZР@l  Ԁ & @b܀ " @\ % "@T܀ ) @N& &`ถ@7؀ @> 0! ]ؠ *ܐ@$@1,#@   nsswitch.conf group_compat database can't use '%s'㿘1 \!P zc@)  &!P @xxcompatnisdnsfilesgroup_compatgrscancompat㿐{{{{#\#``<ธ @r : x% ^+{ 6 " 0  0۔ f $1"  $͒ @" &" Q`  \!X@s H !X @A @;1 ]5 \ T@e$ 3 @~  N 0@T ?0 + J` :"  4      $$'ܐ@Da@z' "b @1  T@x xgrscan㿐{y{{#\#`c8X#D@q  `?㿐 ]J `+7 #{'@CĒa% \  $X@ 2T a@CX$@C  @D& J`2= $􀢀4   .  \!pX%"` J`, " *" `` `  " "+""  '" BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %ldG%s: minimum blocksize is 512%ld%s-blocks㿐|@!`)|b!XL ^@gU T|" J``MJ  4|`M*|`k`G|`K`$|&!|"!|`m`g|!|!|!p !|!x1$|!$ !1 !@op"  @|!@og @! 1 ^|!@o[!X""1 ^!P|@ %@&@.㿘 @"  "@ ( `& & $&& & & & & & & & & $`& $@֐$$@ѐ@ g-|@i ^?44@ -  @ J@@W`@&`6`4&` $ @* 2``6`66`6 &` &`% `@ ؤ@ؐ@( &"  2 6 $|# @ &  $ & $@ "@0@@ @ 㿘`&`@* 6`$2` `@,@B / 2 L    @7@`6`& `,&`&`& 㿘  T 4   ` @T T 4`6 @N  " @  @B@@  $` @4v  @=@ @0` @3?"..㿘 ; $"7`: `4`:@ؔ +4`6`2) 6`6?* 2  !@ɔ * 2``84`6$ |# @  $` @ 4`6$``8 !4`8 6 2X`"  8$@  , @" 8 "@  " @j$ 4 6  @]$$$ $ 2'@4  ""@ 8`4 8$ `"X$` $```2`@  $$" A$``U@T`4`2`:$ @3 2$$ 怢 2$`@2 * 2``4`6$  |# @x  $` @c $`4`6`8 4`8 4`:`R4  $ 2 J`/ /$ /*`&@`@Q$@6 T`42 `$@0@6"$D *@T`42 `8$ 23`@3Z(  $ @3O` @ @` @"$b$$@` `2`$ 2 `}@3C#Ȁ "`$ " $$   4`6$㿘 6`:@  "㿘` a@ڰ  E"@" $b2>  6  8 26   a@Wa  $ !& $T 4   J`/ $ @& |# @ @& @2А 2 @W  㿈 $'H   @}9`  H:  @}5`6)%` $   2? `0'H2' @2  H2`8@W%``8'`@P5`8 $'  $'`$  U`4" `4` ? `J`/   / *@@`4`+`:  '    2 L .2 L ?  } @  @@ "@ @@@}@"  $ "@  4 $$ 4 4   8 4 8􀠠  4 6$  4 6`5$ "  $$ $     $  @  $ #4 6 $    &$ @] @ @$ @m  4 6* 2  *`2    $ %@ 2p $@}@ @: $  @8 .@%H2+ U`4   $@1   }@1#Ȁ   5`6 $ "% $2  H  5`6  @0 $``<`8  8  > & >> > > > (> 0> 8> @> H> P> X> `k ``@' ") @@6` 2&`@ S"@- " @&`  > `>> > > > > (> 0> 8> @> H> P> X9 < @ ((&`, &`( N`@`.&`0N`A  ?`@c  2`  `2``,"&@`R`4 6`(  @  @    㿘  ( *@$  $ $   "@  `  @y  @`"`@"㿘 $ D@    @@% $2  I ?$ <  4 &$ 4 :$ 4 8$ $ 㿘@`  㿘  & @b & `? " @""2 " @"R46㿘   @8  /etc/fstabxxdpswrorqrw ufsswap,%s, %lu: Missing fields㻐 _"T+- _bP ^"P@^$ '  )"%" @^`8 n11"@=} % _J@ % _`$TJ@ # _"@=i "$J@ $"@=\ "TJ@ T`$  @{|`  _  `@{s$  @ H$ "@=8  J@  @^u"$@=&  J@  @^c $"@= % _J@ % _`p$TJ@ #m _"@< "$J@ $"@< "$J@ $"@< TJ@ T`d" " " "@<Ғ  J@  " @^"$@<  J@  " @]$ @w|#'%$@ː ""`   @zȐ "  2P@< L  @z` " _   X@h" _㿘 _"P`@A    1 _ "T㿘@1 " ! _@z} "T "T 㿘@  ! _ @zg  "T rCannot open `%s'㿘! _"P`""@A  #b0@j $"P @ "8 㿘! _"P @}$"P㿘 nb@.㿈'L'P'T'XL  +    ?L#`"@ P "` + "@@-㿈'L'P'T'XL  *  ?L#`#` P # *`# nb@.Q 㿘'L'P'T'X@ :LRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknown pLinux Ext2FILECOREHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunused/etc/disktab " ?J? , b0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdxX _#P`,@(̀   @w!  ̀ ' *`:  -  |"J : '  * `*J | :*̒bp@+ ̒bx@+ ̒b@+ Ȁ  @x˒b 2 X  Ȁ  @xb  X % X̒b@' :  X % X̒b@+?"% (̒b@+ה?% 0̒b@+Δ?% ,̒b@+Ŕ?% 4b̒@*Ȁ @`h 5 ̒@+?  5 ̒b@+Ā?2 ,@ 0% 8̒b@+Ā?2 8@ 4% <̒b@+?. 5 H̒b@+?  5 J̒b@+v?  5 L̒c@+l?  5 N̒c@+a? % P̒c@+W? % T̒c@+M?% ̒c @+C?% ( (/7#0 `#0/78 8/@7 `!@#H7/  #H/7Р ` a + /////@+?;$$̒@+?"$̔@*? Ā $̒@*?2 @\,̒@*?   .̒@)۔Ȁ @3a .`*`:  h  , cP : cP?5 7/ \ 0/@*Ā? Ē`*`$:  4   aW% @%㿘@  @g "&@`@ cDN ` > @Zj//dev/null㿘@9? @ @7? !?`@+"x` " @q ?" @ @ @  $ @ 㿘 1L  @J?`/ ? .?N /@8 / "N   x"'" "  @؀??  'h`" `'` @''''''؀` Ȁ @   &&&x''''' @؀ ؁x''''' @؀ ؁㿈'''''@j㿘 @ @? "㿘@&$$ $ $' $/ $ $+ $ <b@$ <b@$̈́ <b@$< <b@$9 <b@$ <b@$ <b@%& <b@$ <b@$ <b@$ <b@$Ä <b@$` <b@$R <b@$S <b@$P <b@$ <b@$ <b@$ <b@$] <b@$ <b@$8 <b@$ <b@$Є <b@$ <b@$ <b@$ <b@$ <b@% <b@$j <b@$  <b@% <b@% <b@$Q <b@$1 <b@$O <b@$ <b@$΄ <b@${ <b@$| <b@$# <b@$Z <b@$) <b@$= <b@$ <b@$ <b@$" <b@$ <b@yp_order: clnt_callp@E  `"P N@ "L @ @C @C܀ = '"`  "'''? ` #\cϔ  `"@  `@Kϒ`P   ?"`h&@`X@C&@D܁㿐@B# ``p      2  2 @  Dp$$ $ $ $ $  $ $$`p  " @|$  @u$ @ &$ @ $  @g $$  $ @$  @    @t#  @P @l $  "( @ $ 㿐! ` p  (  & #'@B p "  2 @s 2 @4 2 @$  2  yp_match: clnt_call`  ''@@D 2 `" N@ " @ @ @B̀  ' n8@s  `@^'@ C' @@@a*'ؒ"`  "'''??' ` #\%ϔ ؘ,耢 "   `@J`( ̐?"`h@B谒 !,`@'@ '& @@8@@sS*  ,@ؔ " ,@_ @C̀   @k'$NetBSD: pipe.S,v 1.2 1997/07/16 14:37:58 christos Exp $ * :"<b@"$NetBSD: fork.S,v 1.2 1997/07/16 14:37:56 christos Exp $  <b@"` $NetBSD: __vfork14.S,v 1.1 1998/01/04 20:58:13 thorpej Exp $! <b@"` h`''' ''''' '$'(''Ȁ` `` 0  0 ```@@? "㿘N@ `@N    2N@ 2N?libcUnknown signal: %u㿘!p@k9 `Ԁ. ! @l @o .`?x@k @ @l=㿘@rX㿐N@ ="`@F@ "q @;*6N@* ,`` c ! nb     `  b@f*` $bJ? "@֑*  b@t.$bb. " 'N  ! nJ@ ="@`J@  ="@@ 􀢠"*`"  L =  = *` ,  =,@ *`, @* ,``  㿐! n"* `" "@#  @ '''L'P'T'X@7'''''@4L㿐 U?@`0`  `@@"$`0@ $`0T` $` $`@` 3\@ `@0  ?@(`2  `C  $`4` $`$`$@2(" $`4` $@  $`  $`$`$`6#T m"c㿘 ( @w? 8"@L @2 P (    ? 2 "?   : @  0c `"  < :@ c"  "   "  :@ C 㿘<"e@& "4"E@&  $@  " @  " <@ < @ @ ;``( )  ??02 B ȁ7ąB#hh B#hh#hh ЉB Ѕ B ȅ7ąB#hh B#hh  #㻈 ?&b $@M$ n?""#d#\#`  @L  n ."b@Jx 6 n #"b ` `"d*` €6666|66 n   n  n  n "b?㿘-  `   @M< n""@a% n" $N ` J .Jd?`2J J .`? @ː yuad2  ? @l 4e   `  ?`> b9" `2" @G 4@@`=7 "   "  2     2 `"" `@  Ւ @   $ `? $?%s.%s㻐"` @L` n""4?`@ld"!N .2@l,@X@U@ $ n "b?ap@2HOSTALIASESr㻘" t@}" n@_ܒb j  ` /Z' D `2LOL  `" L I,@_P 2= LD  D L ` /L   D `2*L    `2 *DJ  `"*.$@kt$@r^0 #@Q O@rT rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`4"h*` €ACACA CACA$CA0CA<CAHATA`CAlCAxCCCCCCCCCCCACACCAACCCCCCCCCACCCACACCCCCCCAAACCCCCCCACBCCCCCCCBCCCCCCCB CCCCB,B8BDBPB\BhCCCBtCBCBCBCBCBCBCBCCCCCCCCCBCCBCCCCCCCBCCCCCCCCCCCCCCCCBCCCCCCCCC1 1 1 1 1 1~ 1{ 1x 1u 1r 1o 1l 1i!1f!1c!1`!1]! 1Z!(1W!01T!81Q!@1N 1K!H1H!P1E!X1B!`1?!h1<!x19!16!13!10!1-!1*!1'!1$!1!!1!1!1!1"1"1"1 "1 "(1 a!8@{ icmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp㿘`<#ȓ*` €D DD$DD0D<DHDTD`DDlDxDDDDD1*#@1'#H1$#P1!#X1#`1#h1#p1#x1#1#1 #1 #1 a!8@{L 㿘#b!` :  !\@ !"`  @͔ @L  @M* 2  & <`b!`  !@3 㿘@ϒc;; res options: %s㿘a@d  "# " @@Ta2 @3 ;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈%  2!`@H?B!` ( " 2  <"+` bp@ʐ @35!` ( ;@3+!` "Gb@2` db@dbb@bab@a`b@``@b@`@` b@` `b@y`b@r!` ! b@f !?#c @^ c@Y  c(@S!` +"  @2  i!`  "?c8@;? \"-+)`  @@+H@8}`   @ @J$ @ `g@b`  " `@LW* @22 @cP`@8O`   @LD* @'2 @#`` ` "? @2O?<`@/#p ?c#\   $@##\  @  @c #\   0 cc@㿘"㻐@J6$ O  @1 .@3㿘".㿘@J & @c J?`."  !,! *`㻐 ט$ @3[0  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing (  %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d)  ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) ?c' ` @F n"" =$ @2@J*  2 @J*  2 @J @Ja`*  2 `db@!`   !"@@@!"@y`eX!*` €SxTT_$_$TTUTTTTTT_$[`TTTZWXHZWWTWY_$]P\pWX_$Y,YX_$_$_$Z@_$Y|_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$_$[ [,[,``2? /   *`  *`  *` ?aT @ n" ܒ" 2Ր  ?aT @ a"   @J0* 2 b ` @Ր  @0>x   '@1Ԓ` ` "# "@eHb  \@0@0 ?  "@0" ` @1`#Ɛ "@e%b  \@/@/ ?  " 2i "@1b@w_  @/ _ @/ג V"@1q@I c@V@I!#@ @J@I!#0@ @>@I!#H@ @2@I!#`@ @& !#x@Ir* 2 @ Ô   !#x@I`* 2 @    @/n   "@1` `# "@dyb  \@/N@/J ?  " @/A  "@/:` ` "# "@dRb  \@/'@/# ?  "@/ @/ ڐ " @  "?   @ # .x"?` @ o"@Hِ * 4 @HԐ* 2  c@z!# @q @i @a  D M @H * 4`@H * 4 @H* 2  c@C & /  @.ߔ $ @.֔    @.@01  !#@Hm@  ?`/   *  ?*  !T*  ! # @ v" @   '  `@/ @/ @.G``, * )@.<  @.7@H* 2  c@ c@ c@?X@ ✒&@  z% ?2N@@N@@.  ?j@G*  a@2 @ c@@̰ @`@u@Gʐ@cȔ@k ! (@G@۰ @`@G@Ӱ @X! 0@G* 2 @O ?X@ ✒&@ y % ?2N@@4N@@-  ?c@)`c@#@  `8@ @-&`@@ _____ANYHESIODHSCHAOSINffffffffpfhfXfPf8f0f(f f fe ee ee ee eexepeXePe@e8e0e(eeddddddddddeddpdhd`dXd@d8ddccccccc cc`!cXc@"c8ccbbbbbbbdbb`ebXb@fb8b #bb_a"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘   @Th 2 2 &   2&㿘`  2  " &    a!b8@&2&㿘`   @2 2&  `  a!b8@&2&㿘# 㿘#t initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?㿘 ":1"/1&'1=1 a&'161 a+1@"#1+1 a$11"1 a"11 a1    1   1       !!@q (0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘   (1 a"bp@_̔ '0@ <@͒ <@ <@ƒ <@ @ 1 a""x"" (@q L`$@ L  , """@qw L`$@ L  ! ",  """@qU L`$@ L ` 2""2" 2" 2, ", `"""@q'" d'B@;%ld.%.2ld㿘6  @  @ * X@ 1 a!"@!@ d@ d@%+@  cD*`8   2(8Д *`8  `.2JcD@ 2ДJcD@ 2 " *  @ 㿘D.8    ) .8. (> Ј`.D8 .N.D8+.8.` (Ѕ8`D .N.D8Y* .8.` (Ѕ8` .(.ND?N(@( `(Nа@( (`@.D8 .N.D8 N(82\ (rststststststststrststststs0stststs0stststststststststststststrststststststststrststststs0stststs0)  (( (( (1 @()  (( (( (1 & (& (82@(t|tttttttttptttttptttt|tttttttttttttt|tttttttttptttttptttt| " ""NDN.D8N2#㿈''@'@} @      ```  2 2   K@ - +`?'K@ +%`'DK@ `  J 'K@,  * ?Р ` K@ ., `'K`D ` `'K`D* @ *`В` ', @*`@*`@@ǐ&%K@D @ `  D 'K@@ `  K@D  D 'K@@ `  @`5 K@D@ ` D 'K@@ `  K@D  D 'K@@ `  @35 uK@D@ ` D 'K@@ `  DK@@ ` D 'K@@ `  @5 H5 5 5 5`5`5`4 4 4 .`.`.`.`.`.`.`.`.`.` .` .` .` .` .`.@ ?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smX ax@"/0 `!  *``* `  `*  `*``+ @ +` @  @`*`*`  *  &%/  /&%""??ڐ!  N S @g#'@]#@` <'@V <@Y <'@O <` W  E@K#@A#@D <@: <@= <@3 <@5 d@+ d@l @V !!Xc!@V "!X\@V "!X#\#`#d;h#p#t#xa#|##@!!X@@!X@!X@㿘@   L ." `@ &L L * 2?J?`.2 %04d%02d%02d%02d%02d%02dX'Đ@{1 a؆l̄Ȱ"P#\#`ԒaXД?@!9~~~~~~~~x~p~h~`~P~H~8~(~ ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYphXH@8~~x~p0( ~NOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR?Ѐ 8?Ʌ(8㿘 `@ '@<."6+"3/"0`%0 D `h*  ` D "! Ґ   h*  D ` D "  ,  .@`` ` Ű   a 4  6%* . @ 0 07* @ ` 07*6*& @* %d.%d.%d.%d㿈'1 b!#\@l 㿘  0 @ @#@  /"㿈 b` @  @/@  "%x8   ????  4`@ :`*`$@*`  * * ``# ? '' ? ?,`` '' '"`?Ā@$'''' ``,` ?Ā@$''Ā ??'??#Ȣ  :'@  Đ@ `@ 22`,- ``,  ,`Ā  2 2 Ȓ$  ."  [ + @ ,` @n``Ā Đ 2, :, , $  @.@ "/etc/servicesr㿘!" !@M!a$"@# nb"b㿘!" " n@_$" n""# ,/㿘'⬀   b!@La  $ b⬐"@?l$ 2L@T #b @?# 1 c,%&"@?(  b,@`L@ "` "`b0@?  ֐@?;, cb"*  2" " "@>( "$@,  "$@`L    @$@`@>( ,  2L$@"/etc/protocolsr㿘!"쀢 #@Lc$"@#? mc"c㿘!"쀢 " m@_Y$" m"## 㿘%쀢   c#@Ldc  $ c#@>֒$ 2L@I #`@> 1 d,'&#@>  c, L "  " @>u ,@`@> dc#""` L    $@>V ,  2L$#㿘@% @㿘@%@/etc/networksr㿘! e "H@KbX$ @" nb"b㿘! e " n@^$  n""# 㿘# e`   e"H@K̒bX  $` e` @>>$ 2LK #b@= 1 f,'& @=蠒  e, L "  " @=ݒ褒 ,@$ f ` " "" `L    @$@`@=蠒 ,  2L$@ =㿈`B #p    `2`*3  *2  `? //////ꀢ`?/@{x??@{s@{o`? @{jU` .  .  .  .İ `@ //@ / * `@   2`*  2+ 2  //逢`?/@{7 ?@{2? @{-#p `.  .  = .  =. :?.?㿘N  ] `#D `2QN=R#p @V Z "`  `0; ,`06I"@* ,@1  @"@ @2 @ ,@* ,`! ` /"@ @2 @ ,@* ,`  "@ @ ,@` @zN =8 N    1 .,? #D `=N =2?N  #D `"?N ` @ ?0?%s: 㿘P 8a8@z`@{{@za@@Q㿘'H'L'P'T'X@'pH㿘@ Ɩ   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~h* R 㿘'L'P'T'X@ Lsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console @< `8ѐ ##  :@ `@#  @&`@g-(( ('&@@! h@LȖ@8:?&@- +`P  %` x@g:?&@ !@y @f:?&@`   :,@`?  ,@`?@ȑ*` $$':  % N` m `@P&@fǔx:?$(`,?`@*` : ,@Ȁ:?@ $@%&` '''' @[(  f!` `@,`@=    @n8 @T} > $@&   ''''@Z@Ԑ/var/run/log㿘 " !$ 3" 3`? f! *  `@@TX h    @Ak ?&` @e  ?5 f ! f!@  @:z? @`&`&㿘㿘!@ ? f$ "!㿘  กp`@8(pX@0pXPower fail/restartUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0!:rootroot uid should be 0invalid uid '%s'invalid gid '%s'warning, unknown root shellcorrupted entry㿐'D &%Dؐ@S &@@V{``?@H &`@B @     耢J`"&`   !L  D &D@ؠ @ J`" &` } !@Dw L    & !0&`&`&`$- Dؐ@&`@ R @&`L` D &D@Ԓؠ ? @&`$L` D &Dؒ@&`@&`@ !&` L @!0@U֐  @  @D!!8@D "    !X@D ELF(@ Ȁ @? "#\   @R# ? ?(`@cݔ @X?ELF(@ْ ?  Ȁ @ "#\   @Q  3a`@c   .0@ @(  `  *` * @ (( ( s `o @ j``d@ 2  ``J " **2@"` @ `   E` @ ";``J`4`_, @@T 2%` @ $  "     ,? ,? 2  "4 ? ,?4? -@ ̨  `@W?c)?#'H  @up 2??@ ?# @!2#?a.#?  ?# !#!#?#?  ?# ! ##? #? ?#  ̀O?#?cx @Đ ː#?    ?# ! #?  ?#  #TO##?   ?# ! 2 #8@! 3#?  ?c@  ̀@2 #$@@  ̀@#?  ?c@ ! @"  @@ ! @2# #? F ?   ?# !  #8 @! 2#?  ?c@  ̀@ #% @@  ̀@#?  ?c@ ! @"  ` @@ ! @2` @  # cx  8 D@c cx@ "{? <"@#\   @PH@` ``J@ **2"` @  ` @ ?`р`H7 @) "@@T9 3&@``@") 2$ H@`" ``J@ " @SL 2` ?$  ,?4 ,` @    ?Ӫ` `@@VU/bin/csh/bin/sh㿘! f"`2@@$"@ `$"㿘! f" " f@!d  f$"""㿘@ f"b/etc/shellsr㻐% f @!J @! $#@CcȢ ;'/   *`:  # / *: #D     N  `#* @J.@  $@5Ӕ 2@V6 shells-XXXXXshells-%dshells㿀 aa / // + f / //  / //b ` / / // @ Ւ @  %b@䀢?+ )'  b@  2@ !@`@g( 2@@`  @x! f" @  @ f1 f""` $"@"ǐ    #"''''a(@耢  * "@ Z"@F 0nisdnsfilesinitshells㿘! f" @ R @ $"cX(㠘!@AՐ  " "1@ = 1$""@  "./0! H@h  H .@ `.`@N_#.c@ / @`  P /2*`@8J@*`@& `@g < (@  @$ I.@@ @ ? X@N#@B$ 3N@ / N``?O @}b@}_ $ @ ?"`P@#@#@ @ @C @@@:@x "㿘  ` @m "  @# ##@ ` @X`"@Z,` "  㿘  1 f" " f@5 f&"A""@| f"b@  f"b@,? 2" f""N `)( N : N     ``: K  `:D@ `2 \" `:2N ( J:    ( `  J+ 8  `2J+ 8@:  :2J0 2J J@ 㿈#\?@ %s.dbtc㺀'X'H'D'T `  ?X# fb @T ! f"@$ \'@"b" $Ȥ @$ O'd      @D 6 @^̔   @Tr "@aT@B &-`@|@ސ@`  H D)  @f[ &x   J``#"L@;T 2G\@n 2>W :M@ ` G /  :   \"     2 , %d$@  '@ `"@ΰ?@*M@@$ 4@` @ ? 2,    M ?s ,? X  L : L  : #\$쀦 ? `@`@0w" ?2  :,??@ `: L  $$@L? : :,`$@%%@$d%%@@{  '@n `"@(9$ @@@N?\ = 2J@`@ $ H @H '@; "?@0@* ?@%?0D@ 㿈@z''?''  ? J ? ? &@J `?  JJ|:? ?J:|?  㿘@@㿘1 f" " f@R &" f f f""$"b"  r㷈! f"$ "$"$% f  "$@?#ax Z$# fb`  f  "P @  "@F >@Q"$$`$"$`  0@>ax $0* *?  f#b #D  `   *:  : #b    J?`\2#b  #b J?`\2#b  #b ?0Q @I  "@F @Q$,   *?  J@*:  : \`,J@   @`,O  J@ | @ :`*J@ *#\?Y  ` 1㿘  = ?@y d 2N@ "? d :*`:   ^ \ N`:` ~*2|* *`:  : А   4k*+ +`Б: @  +`:``/`7Z** : `2P !*` €¸                         ¸            Đ * * * *  *  * :*?*  "@\`d c dN :e*"@L "?&㿘D = 2?@ d 2N@@/ "'? d@ : "*@*@`? `"@  @" d  dN@ :@*@`"@ @ "?&㿘  # 2N@6? 0@`N@ x@ X `@     @>`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@L|.`.`PATH/usr/bin:/bin:/usr/pkg/bin:/usr/local/bin:.execvp: : path too long /bin/sh㻐N  @  "@H /  ='!@Z !@D0o'  "@x(@x%@ $ b@ @ b @ P@ /, @ , % n@|@> "  10H $0C) @    . @`2  @*  1!"0$``. $@@`@N@#``@`a@  2L@  @`@ "@?$ <b@$: <b@%( <b@$  <b@$; <b@$  <b@yp_first: clnt_call` " '&'@&@' 2} `"z N@ "v @wU @o @\̀ g 'ؒ"`  "'''??' ` #\#ϔ ؘa "   `@"oa ̐?"`h@ఒ !a`@& & @t* `@'@ ' @e@@* a@6ے@Ù  "@&& @'yp_next: clnt_callX\ ``" $@'$'@@ 2~ `"{ N@ "w @v @p @ȒĀ h 'В"`  "'''???' ` #\'ϔ И἟ "   `@!ڒc Đ?"`h@:ఒ !`@C'@ ' @@@* `@4$ $@ @@* @6F@Ā  "@@'@ @$@㿐@` '@  *&%m/%d/%y %H:%M%H:%M:%S 㿘.N`%2# N E O-  - : `y#D*` €,tttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttt4xttpҐttt<ttttӸ4`0ָ,ttttttXќ0Ptќt\ӀtӌtTԔtt֔?`!* `!*y ` {!*hp ` r!*8g ` d@'l  0@` !ࠔ7W "/O `   0@G `   @? `  0@~7 `@t~ "   0@q* `   0@h! `  @` `@t` "   @S `  0@K `   0@B "`!` 6  * "Ŗ倢 !ଔ܀ @  0@Ԁ @΀ "Ȓƀ "` `@"   0@ ` "   0@ @ ; ``'l` $? @s d 2 n@sے! 2mn`@sҒ d  !n@s̒! !m!n$@sŒ ?@s $@?& ђ  - :  V g   0@a  @s d  0@V   0@O ``` "  @   0@> `  0@}6 !औ - !ਔ$ ` d@sj'l  0@` ` 'l 0@W `  ` c @ " @p    *& N &X  (' ' ' ' ' ' ' ' $'''/@ 耤 @s  0,@  ? @,㿈/ 耤@r  0,@ ? 耤    ,?  @@ 2   (* @"@ J ( (*`   f0"   2"  @6LTP`(#@ @ @L ((L` * #@@& /etc/localtime/usr/share/zoneinfo/?` 2N" "%?N : *`:  /`?""`"?@s@s $@ab@m@j@C . 2 @  2?@]@ '? @Ԓ@ 2۰?T`Q`N`&@K` &`H`$&`E`(@`, 2&` ` 4?`` ar4?  24?  ?@ `?*` *@ * ` @@ +  @ $@@$@ x 6`` , $ `  ` 6`e @*` _`` & @` 6 ` gTgPgL$` @` I& @``D$` @4\?`  `   L@ @*`   `L@*@ 6`!L@ $`&@  ` ` 6 gX " "@L@` "@?`  `  g\`" "@L@` "@?` ` mn +  (:` Ѐ ,-:` " (8Ѐ  +  (Ї8   (8Ѐ (+  & "@ 㿐 ٖ $* "@*`@*`&@N :  Ȗ ; *" @* @&@N:   < 2@  &@㿘N -   +    @ &@㿘N J M &@`* !?Д &@ `   "0 N .  ` t  "$ N . `      &@` !m^ 2N  / u` &`㿘 ` @pZ d 2  @pT! 2  "  "" * @*`" *" * |;yT!v* @*`" *" * m ? ,@#|*`@  * @*`" *" *   @p  $  &@`@ d@o d,`** @  ``:`  : . " @o  &` ,` +`,?* *c|@ `6+`  +` * "*"@ *` posixrules`  @pg!'z&5?N 1ْĴ ,?! 2&@N ĸ^&?N  , ;  2N ?Đ1'N , ;g ’ഒ ?N ,ȴ ?N  Đ    &`&`&gL&gP&g`&gT&gd&gh`eئ '; ĐݔהȀ$ $@$@,`$@ ,,`$@ ,` c܀ @o d 2  @o! . .*@ *`" *" * Ȧ&` ? " `0gL gL&  @  e؄gP  * * ``@ &  @  e؄gP  * * `ݚ`@ &  @ 2 gPĪg\gLgX e* * @ `(@ 2 `  @& " * @` ``@چĖ   &gL&g`&gd&`&gP&gT &gh  &`&gL &`&gP&gT&` &` ` "?#L@@?ڔ@.@`@?є.@ 㿘#  㿘 f8 ! f"0?`"8@~̐"܀  $"0b0Ӑ "0㿘TZ㿘@QQ# # f՞c8  f"8@B ?@nݐ (  `$c8 f"8@?z # fb0 @~"܀ $$b0L 00#Lc"""L"T@?_!0 L :b0= b0(㿘㿐 f"0`'@]0G`` `  gP@ ! `  `@ 2*   `*@  * %ס* , 'L@@@f &  L c+ @ "@   @&(㿘T1 f#@ 㿘 㿘 f< ! f "<@}" f "b4! f"4@,` #"4`2##L@&(㿘! f#@ Ӕ㿘 ̔㿘! f#@Ô㿘    J!L!P *  8 28  4  * @ ` `!*  @2  @  ` ? @ę*'T@~ޒဤ@lဠ&@ Tဠ T! ?"  @~Ò.&@lĒ.@~ <&@l <& @l  & &'0)@~!m$@* @*`@*`@ `< @~ d$@~! < @~ d$@~!$$Ѣ#܀ @lx d 2  @lr! ,  , @ , * c| &&&*``*`& $ 6&$& & 㿘@h@ &  2` "㿘@`<`@~"@~: @zx$@&@`` ` ` `@ 0'@ ' ''''' '$'('' '̒ < 5?А < -?  &?ܐ ?'l ?Ԁ )!n'y?  ؤ܀ 4   ` @k d 2  @k! ,  , @ `'Ԁ!n(#؀ 4   ` @k d 2  @ky! ,  ,  Ԓ " 4'Ԁ Ԁ!n'"@ 'Ԁ  ''ؐ"  ?ؤ|* ܀  @kO d 2  @kI! ,  , * @Ԁ@ؠȐ8 ?ܐ'l'Ȑ?ŀ ?Ȑ ;'n''! 'A  f"4 f"0"q?? l,`* P@耢@2(? #, * L耢@ " '@֒Ȁ 2?耢@??좄ժ;?@Ȓ  -? `?'," ', '耢` @6 &  @  ''@ '@?㿘 ` 㿐  $  K G!@ f"4 f"0`<?`? 8-* gP @2-`? (,* @  gL`?"@  $$   "@  " `?$$ ޢ쬅Ш??㿘a 㿘?" 㿘& b 㿘& b f0 L*` &? 㿘'DDD&㿐'DڐDD@'ՐD&  '̐D& & @2?0?'D& 4?@2 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈 !Г*@ !@  *!@ !@  'l #h #\ D#`#d@LՐ㿘 gԒ`0 J "   J H 2* #2HJ$NetBSD: ffs.S,v 1.8 1998/07/01 02:16:27 tv Exp $Ԓ "2 J "2 J   "2 J  J 㿘+cD @ `` - +L@  L@` 0 L@ x XL` `? 0  ?@x+?@h   "& @|?"?@v  @`cD   ? ??۠4 `&@㿘 @#9 @"7'''''L'P'T'X@_L*@`"7''''@_ *?       @``-D@ ``% D @ ` ?& & 4@@ 2@2 @  ``x` d,` €H`` Lx```$l<L  4@@/ 2 @` ?& &B @h @e @b @`l2^ `@Z ,* @S?Р E  # B   !h ;  5!h !h" /  , @  @$   @   !h"    2@ 2"DА@ `  #   @@? r @` ? & &@? 2bD  2 `8@ ȓ,` €   T"     $@& & @:@@?y& $ ". @3ǖ "? ' K    ?&`&  4 @?J "`"0 L`2 `Z@ K`  ?&  ,&  4 @?  "բ0 L@`2 "Ӱ,#?  D?&`&  4@> 2D  "   D  ?&  ,&  4@>Ґ  $D @ `" $,!% Հ`MÐ d*` €                      `$ "$"" < :#`-`R  <#`-`R `` %! <  ! ?"񀤀!  =, ? &  &@>+ !2o! ( @Bܰ `x`X @6 Ő,    :  2"!l' Հ`:fÐ#*` €                                             > "! ?"! = %$ 9!, ? &  &@= !2!$8 @0 `e`E@ @ ,@h 2 ":"$h ? @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘 0 @2 4@tܐ$ $& 0& 4  @,< @& ,`@uN  @te& 4&& 0 ?㿘?, n!<`2` @q` `2`0```@q E?` &` ?6` &``6` `0  ``4@& @ "@-?&@*` %&`` ` ?߀6` @@ (` 2 `` &`&@``@@ `B &`&`<&`8&`0&`4&@.`B㿘 @= @㿘`? "`` *:  @ * "@@ B 㿘`? "`` *:  @ * "@@ ' ( n!<`@qK(@wU  F0IC0F@qU @2P   ?2  ?2 ;??  ;  0b ?< : `? "` "@: @ C ? @    ? @w6 " 2 @o h ڀd:"2 T & @s1 2  <   (4 ؐ$$L4 2T >`@s Ȓ>` B 2(0 @"P?   ?2? ;  0b ?< : `?0 8; @ C  @ `  ?20?0`@@"$0@s- $0 $ ?4 $ 㿀@b' ''''@^ƒ㿘 H* D  @s "?& H& D 㿘 4@: 2F&@ @b  $&@ @ "$4 4$  @b  $@Ò D@q$"$@`P $@D@q@:f ئ&@D&@  2   ` #dd 〉B#dd F`F@#㿘" ` @^?  !$ 㿘b` >@x"`㿈L@ @ 0 ` @ *:  x X*` @ *`!#D:` `@o? `D ` . ?? ` @*`:`*: . 􀤀 `$ #D `2$?$$ :     *.  `  HESIOD_CONFIG/etc/hesiod.confHES_DOMAIN㿘@q  ,&@D 8 Ȑ H@ "@D ` "/   @q@a@qf   $  .*@N`. @f? @t " " @q   @q ?@q?㿘@q  @q@qrhs-extension.㻐@@1 @  , @1 . $@Ȓ@k @t,  @aD@aA ` @a: J@ .   @a/N@`.   $ @\@ta ("3 'ȠА@@|`"N@J@  .@o@lN@ .@f@b@.@, @t. "㿘y 2  @ @t`  @@q㿘`@  @p  @prlhsrhsclassesINHS㻐  & & @%P` 2&!ɠ @,&@,`&   @s &  #   L "  " L" , L  `=, LD `2 =" DLL `"  ,@$ ɒ`@$ ɐ@$  @,6 F$@swZ @$z`Ѐ =L .   'ɀ`(`  ɀ, L  `, @$Y  $@@$R  $@``L  `  .```"@$@ hO@7~ `  ` @ @s "?㹈"`@?" "#d#\#`   @ @ Ԗ$ 6`@r  ="?`c @  (@ @  `@r۰ ~" @@oT*   @rͰ  o"@r P"@r (K"@H @ B@ ` >` ` ` *  @ `@ `*` `@@* 2'` "@r ("@o-` & @` @`@@@n@ @ ,  ` -  @oe - 0 -` &@rb "@oV 㿘@Fa㿘@? ! g !0 " g@o> g8 $!0@A!0㿘@$ ! g !4 " g@o# g8 $!4@&!4㿘 g8㿘    g"!8  "a?"! 㿘@q  (      =  "a/X/P/H/@/8/0/(/ ///...............x.p.`.X.P..H.@.8.(. ..------%I:%M:%S %p%H:%M:%S%m/%d/%y%a %b %d %H:%M:%S %YPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSun%s: : %s 㿘@qBP`8 ˒c`@R  @S˒ch@R!ˠ#p@)ݐ@R㿐@Ȓ  ?&stringlist㿘@m 2 ̒`8@" & & @m P &̒`8@! 㿘  @2 *@m&  &̒`8@!  * "  & 㿘 `  @ .` @mIJ` @ @m @m㿘  : , @1} 2  * 㿈''@$ <b@$! <b@?".  "*    0"?? 0?" ? 0? ? 0          /var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D  J E #@G6 ?< @ ?@p`#@nӐ- @nϐ@R+'☀?) n$ "$$ ` " @@l 2 `$$$☀`) n&@ $  D@0    D 2 h@l] l   @R  l?& \& h  h 2L hD(8$@? @FΒ ?"; h@T ,@o`#& '''Ԥ '̐@7 Ԗ "& H@n[& h . H& L. I& P& T6 J6 X@nL& Lm @nH`" @l{   f  ?ؐ ?''  ab?//ِؔ  @ 2 @#H`"| @lVx ""'' #\ϔ@ ̐ D耢 `2 " 2  D 8cX@P  `€?d& h @& H& L. H. I& P& T 6 J& L6 X & hD @, @ `%  H \ @?& \`''ab @] & `@#,& h \ @= ?`@#` $% $&`2&@ 㿘 ` @?& \& `㿘@Y 2  㿘@M % n$  @/  2 ` @`$@$$@k0 㿘! n&L 8   8 @!!  8  8& 㿐! nL 8       8& 8`?㿘 " N "  @[2 @@+ʒ /@  㿘'HH@9 @㿘'HH@1!㿘'HH@) @㿘@" @㿘@ @㿘@!㿘`@$㿘  ` `@  㿘͒ ϒ`@  㿘@; 㿘 `@/ @  㿘@㿘@㿘 " @  2  @`ђ`㿘 `@  㿐's  `D @`L@  㿘  o` j`@  x  ?$?'''''@܀  ܀ ֒ 2@  `  㿘 `@B!@  㿘'HH@6 A㿘  ϐ`D @p H@  㿘V  ϐ` @^ H@  㿘D @`@  㿘@ @`  @` @`@  㿘 `  @Ғ` ` @  㿘@Ò @`@   @( *` @ (* JJ2 @(*`㿐7D  `-+L  L0 L x XL >0  >??@VW ??@VF   ?, 8 %@` @` ??@lj? "" ?@<@ B ?  D   Ф ɤ   `?` &@㿈7'DD @ `` - +M@  M@` 0 M@ x XM` ` 0     ?#??>@) @MŖ  ?`B ?%   ? 9#?Q "] J $耢  `@ `@ 耥 !?@T= @ $b  4?2`@ `@ 耥?@k? "@1= @ B ?  @`D   ? ??` D&@㿘`` &`` 2 @@c "@@kd? %"``"  @e ? `@?&`*@`` &@`  @e ?: %s%s%s 㾘 2NѰ#N ##!#Ѡ 8@k#c@$d @Lߖxdr_reference: out of memory㿘@ @    @g &@@ 0 @M+ @`@g&@㿐@@ '@ߒ   Ŗ&@ LHOpO,OLPOxclnttcp_create: out of memory`' g@  $@@g5 @g0 d 2  @Ɛ!x! n $ @j $  2@ * `26 @g0} 6#$`  @  &@[  @#   ! n $ @jw $ ?W`@i/S`$`$@$` $` $` `L$` $` @$` @Lx@ `@  $@'''''Đ`0 @ @I 2 `P` #`@h``€`P$`H`ҟ@Ґ!`$@X$$ d@Uax `@g @g  h'D 'H  L\ 0'L  $ $    2  "&@ &@$ $%`  H `H D@ € L@   $  $ $@z o $@v   $ $f 2b    % n $ $W % n#(&@'`'`'''@  D@Ȁ 2 $ 0:@ $ $2%D@ €Ԁ   $ $ $ (   $ ؐ $ $؀  &@@ $ D@  @ 2i&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   "  P?" P@g P `@ L@f@f㿐`*`$ ,  ` , @f#耦 4 @ '7   @? 2@$`$"?@h`@h$`$?$`(@g?   6 $`$$`(?@h $`$$`(㿘 @gb?&@h?$ $$ ( @㿘! g!P g! "aT@e"$!P%s: ; errno = %s; low version = %u, high version = %u; why = %s(unknown authentication error - %d); s1 = %u, s2 = %u㿈 g aTu  Ԗ@7 @$@ @%@U$@ `P@ Ԑ#X*` €TTTSSTSSTT\TTTTTTTT!@ " @76,0@Ԑ@7xX$@  @ Ԑh@7m@7ep0@7T%s 㿘!#ՠ 8`z@IW0WVVVVVVhVHV(VUUUUUhUHU0RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code) #@* 㿘!#ՠ 8`@H - 㿘 g aTB Ԗ@6z$@% nԠ@ ݔ`/֐ H*` €XXXXXXXXXXXXXXXXXXՒc@  Ւc@ @@ 㿘!#ՠ 8`@HZYYYYYYhYHFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK  $* 㿘@ `@W @)` @$`  `c0` @ ǘ    㿘  `  `  @/# @*   & &@&& @`@` "   ` 㿘?#@6 6`@`w `@  & $ $&@`@``@`\2  ` *  , "@@ 4 "  "  , @@ 4    ,@@ 4  @@*  㿐   `  ` @O  `?  㿈 '  '  ` ''?``@2  `㻐 )@$ @?@* `4 @* 2  ` @j   ܤ 㻐  & $?  @$ @@U* `4 @P* 2  ` p+b 'H'Ԁ`'D@?"?b ` H"   @ 'Ю <    @ ޔb,` ' *g3b $   bDH`ؐ! *` €a bDa(ghl   )4а? b %b  b 2ހ @  @: $@d" @T䀢  "bJ@ϒH D''''@( H   @d *@ @eb7"@*`  7@c0ޠ ހ @dx@t6Ѐ @l't @* 2 ' 77ހ`*`2@c  ް"@*` 7ހ  @dH"b* &7ޑ* 2 ""@b蠒 ޒ"@*` 7 @ À  b bb  @  @ $!$" b `!" ` "   @䀢 # $"  D@ HH   /'7@ @c$" " D H@hHb *Ab*` @aƐ $  '7. %**@Y   @c`%0 @c" ' @6؀  '@׺ b $ ( Δ% (2 DH- %     b *@oba` Db `  " @` h  %b ` `b a@N "  DH`:ِ#*` €gbDgghl   )4+? & `@ (  & @ `@c? ="@c? < "@c ?0@c"?㿘!"  @a?$""" "H' `` d@  n""? ` ?,, , , , , , , , , , ,  @ `3 @4**  $  >*` a ?$ ''DZ?2X? ɺ@j  .$@ @đ2 .2 @  ;4  8@O  @  @ @  @ 4  ` @.2 , @ .2 @  @ /`2 @ ` @^4 &LOCALDOMAIN /etc/resolv.confrdomainlookupsearchnameserversortlistoptionsconfRES_OPTIONSenv㻀@ad<*@ 4`@    5 ,`,`4`$` $ad#8$`@17$a`   D ``@q ڒcH@ 2.L`` ``  $`D`H `\ *`:     . " "   N *` : :  " . N   *`."ڐ#P@9ch ' -@ `q-` ;n #lڒcp@8ܔ  *O  %ڀ ]N "  " N O M @  ڒcH@: 2.= ڒcx@8  2O 1 /ڐc@8  2WO  2Qڀ  N "  " N  #c @ @ 2.&?Lc ? c  ? *`:    . " "  N *` : :  " . N  *`."Ӳ c@8C ,O  'c#N "  " N  @g耢  -  5-5- c@8  O  c` "l N  " *`:   ~ ;}' !@ `2N *`: `"N@⨀ 2 NN`;`#DN.@䀢 Ch$@"@ 0. N#D``;`@  N   ;  `" *:`.@䀢 $h@@'$@@'& `` .c@7  2 O  ڒc@L@4$ O" d `* * @@$"dL`` `@!  ,a_@ .  ``@ `2b"b"@/6# @c` "` ndots:debuginet6㿘N H"c'%#ݑ*: N "  " `@7  @ǐ `!d*` < $!dh@6  `p@6  2   $    *`:     đ* 0 ???㿐@ M @A?c  㿘 @ @?  `L` .#`0 G?4B?@ @:=?(@`@. ,, \. \2 (@@:&?(@`(@`<' `?(   & ?`  (@' 㿘 @     2  @ ?@p  `@92 ,@`7*@ ?$$`@  @,@`   . \ $@ ?? " > *@@*,@2%?`$@      ? * " ? D (* P 㿘F`6 ` ") :?, `.-`\ Ѥ ͐  < ` "&`."  `?*  @ `Φ &*?J .* J." .`.`Ѐ    Ѐ -_2 `2J 㿘N * N  .   㿘N    ߀ ]`. `\ " N` `. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*`㿘  0 @ @@]? /"㿀)#D ` `k 0'    x X   #D ` @W?А '䀤` `D  䀊`* ??ɐ@'  . 􀤀9 $Ĥ #D `C $:  `0ߐ#*` €|<l?#@* @?# * *` 䀢 * *` * '䀦`  .` .@ .`.` 㿈 @?] N :   N :s I *`:   A ?#`@^ a@V  ",P %N:. EN`?4,@`,@`  7 `3  0,NŰ   `"4,@`,@`@$@    ? %@ ** @  @XΔ   㿐 ?㿘㿈  ?'  @[ ?? 㿈  ?'  @[z ?? $x <b@$ <b@$b <b@J H ? 2H  J  JJ2 @(` * @(*`*㿘 @۔ 㿘`6 "@"&&@X/+,(  @  2,  @H ܒ`"&&@X@ܤ,4 Hxdrrec_create: out of memory㿘@XK D @@ $ <@ @X=$ @ $ @ Ӑ!80   $  a$ $  $ 8& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4,`", "4@%   &@ 㿘    &  & & @8 2  & @ "㿘   4   8 2 @l 󀦠 8@D & 4"$ 4@㿘!    " 8 @Z˔ & $  @$ @  2  㿘   @Yі ?   "  ,0  "@ :`@  C  0"@ :`@ c ?? 㿘 ֐?$" " ,   "   $  4 "  0   ( "@ $ 4$ ,      @  4@  ,0 # , 4㿘 @W @W㿘  4@Ð "  8  & 4@ 2 4   4` 8 & 8 㿘  4@ "  8  & 4@ 2 4  4` 8  0 , `?㿘`        ` *  # @   #@ ? "  `# # 㿘 ` "@ @?* #   "     `$ $ 㿘 0 (  $ "@  ?" & ,& 0 㿘$  0 ,     8@Y ,&& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 8 & ,&@  c(/  ?xdr_array: out of memory㿘@@p & @ 29 @S @ "   % @V &@@! @;  : @  @ @ @VZ@&@㿘 :     @ 㿘 @Ԛ 㿘/D  ` - +L  L 0 L x XL ` 0  `' #@E@W` $ %   - "9`&` @X?"1 @SA& @Xڰc"?@S0  D   Ϡ? ??Ƞ``&@<p!! o`6 ?!'''#\ab7ڐ @]! /!!'`''''' #\"| ڀ   n "` ``  ڀ 2  n "` @6 ځ㿘@i @d`  @_` @Z`  4`pclntudp_create: out of memoryX) g!` \%!`@T @P#`j! n` ? h@T@ d@B#`\! n@ `d$``$`X@Ò  2 ` * `^`6 #H$$$`  $`  ?$` `8$`$`$`$`($` $`\$`$@:$`T!`   '''''%!``X@ @ +``<`€$`P`6$` '  @L   '! n $ @WĠ $ @  b~@Vr$`@$@ $`@T @T 㿈`''#\W  'L'H*`$ ,   , \@U#( `@''$'('''8$8 PX@3@ H   € L 2  $,Ȱ `€X @֘ @WA  $,$0  n ; n'̖"+" '''' '7 @”?) 2 b? '   '?/!  @ '@ '@& @& $,n @V`@V` `'` \@} `@V`#@Vذ $,J$0`X@  @ @ +@,,     $,$0  $@,$,  @  ?"$8 @x''$,, ,"@0"`4"`㿘  " 8 8@* ԇ(8$"$"($"(""" "  "" """   㿘   "  <?" <@T < `@ 8@S)@S'x ` '` "`@V ? .E" @8R  /.``  'ܐ  @ܰ - 'ؐ  @  #@`@U    @q  耦@ @䀢 @U"` hpx㿀! g!p 2  < @7X @ 2$!p+  < ' n""&  a(&  & & & & & ( @ @'@$  @& < `@㿘 g!p    (  <   $a <b@$i <b@$ <b@$ <b@$ф <b@$t <b@$v <b@$  <b@$h <b@dP4Pd`"" " " "   "  @" "   "@   "  㿐 ?  $  @T  &@  $  㿐 ?  $ @ '@Tz   $  㿘 "  $  @Tg  $  㿘 "  $  @TT  $    " @ ""      " " 㿘@  ``@!㿘@ 㿘 "@` "$ ` `# *` €8P``€@`  @` 㿘@c " @   @j`  @e`@L` 㿘@R @8` " ` 2  `  `@  㿘 &`&` 2 @/ @` @%`  @ ` @`  D* \ht "@ "@ "@  "@ "@"@ "`"@"`     "@ "@"`"@"`㿘    &@  3&@ @ ڒ@ &`@`$"*` € &`  &` &` &`㿀 ' 㿐`"  ` 0 @ €'  &@  㿐`"  ` 0 @ €'  &@  㿘    0    㿘    0    㿐`"  ` 0 @ €'  &@  㿐`"  ` 0 @ €'  &@  㿐`"  ` 0 V@ €'@€ "   6@ 㿐`"  ` 0 @ €'@€ "   6@ 㿐`"  ` 0 V@ €'@€ "   6@ 㿐`"  ` 0 @ €'@€ "   6@ 㿐N@'Œ   .@ 㿐@'֒   .@ 㿐 "    0@  @ '    @ &@  㿘Ē㿘% "       g a2      2    a`?xdr_bytes: out of memory㿘@_ "1  2*  "   0    @M&@ @"    @NZ&@㿘`Ö$㿘z "  @  2    €xdr_string: out of memory㿐  @  2  "5 @=ܐ' +􀢀8) ` ` 0  2@M&@ @# ,$@M&@  㿘?㿘'H'L'P'T'X@H%s: 㿘P 8a(@2 @3@2a0files㿘@@nsdispatch: memory allocation failure㿘 `2 ` @M*` & a@  * &  @P5 %s (%d source%s):s %s [ SUCCESS=continue UNAVAIL=return NOTFOUND=return TRYAGAIN=return ] 㿘 "P"h"p@   @ >3/-+)' ,`@bx   "' @  `%@  ``@b  `@"  `@@ `@& @x"/etc/nsswitch.confr - g L' 8@' ?X@Ba+bT 2' X   X"X. ` "@L"X   "XX@  "@@LX@ "bT@LbTբ` X "$X@L$X%bT&aa "`8@&? @`P! $# @PL@#bXT@  %"XT!@֖ 㿘'T @% "XȒ@ TX@  "@@LmX@ `@ T2*@ X@Lk*` $Xa@Z T* X* $T@N 㿘'X?     @   `,``2` , `  @  @1@  @   / @* @    X  ڤ " 㿘'L'P'T'X@L  @ (`(* PP` ( P "   @(`(+  PP ( P  ` 㿘6@I@  $66 㿘'H'L'P'T'X#@1NH㿐@ & @G  @%! :6  :::"Pbd6 6 & $& ,& (& &   @L                    !$&'()*+,-./0123456789:;<=>?@ABCDFGHIJKMNPRTVV  EFBFF216+-.::+&%/ /F!()*!!# F;;;;;<;=======;;<=======;================================;;  :9876543210/.-,+*)('&%$#"! ;;;;;;;;;;;;;;;;;;;;;;;;;<=<643210.-,+*)('&%$#"!  ;;;;;;;;;;;;;;;;;;;;;;;;;nsdispatch: memory allocation failurefatal flex scanner internal error--no action found㿘c  7㜀 "c & #"c !#"c# @1$$#@7'; k% m+ ga+ g㔔  a,@'a+ g'a%a :  a|+  k) @*  P@ @ *`U  +a ":V ;+ ( P  * S@  P@ ` * Uᴓ+  "P@  F"a+'ac + R+ kb%a k ?"?+ S@ #ἀᴐ * S@ ᴑ*P + m$@%c$ @+ g-a,@$+ mc @6ԘK@ ` "@ &K@  +* b8@€xƀƈƐƘƠƨư8Dph!!!!!!!@.Ԣ  bk '%D `(*@ `.  @8* m"#v!sJ#+ mԔ @4c&+ gh + g) a$@,@#? $` ! g#  #$!# $ !㔐 Ԓ@@$@a 㔘  $?@f " ! g  + ga"+ ga@$!  㜐?2  ԑ: $d ! + g@c+ gԒ@@$㔘#! @ @$@# + gfatal flex scanner internal error--end of buffer missedinput buffer overflow, can't enlarge buffer because scanner uses REJECTinput in flex scanner failed㿘%' g+ m# cԐc@{!cc "   ? @6 `, @ `$ 2` "`O$ᤐ"? 1@S!H 4` ( * )`*  @e#󀢠 `* 2$@c @$!$`1#@F   $@y# @!"`ᤀ   `c@ ᤰ " $@ $*  * %cԁ㿘 m3 g75 ka㔆&&a@@&31 |b: H@@( / R@(S@ :S ;/ /`Q(VR@`(!T #@ "!㿘. P@:(V  Q ;. .V(W2QP1!|(V ;`?`2   k  ᴀ` 㿘!% g# *#K4#c gᤐ # m(+cԒ #$#   # #@$c@M ? g!`!@c!cԐ$## *# $# ,c "c㿘!# @?$$#@h@㿘㐀   g ! g#*@#a" " @  g "a g m""c"#c  g(out of dynamic memory in yy_create_buffer()㿘@ِ ( 2`@ʐ h`@& & @ h & @㿘 c""c  @ @㿘@ & ` &@@D! 4  & & 㿘  & * *`   & & & $out of dynamic memory in yy_scan_buffer()㿘` @J  J  @j ( 2 @[! & & & & & & && & & $E㿘  `N 2`@out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()㿘`@,  @" @ @ , `@* @* , 2 @#( & %s 㿘cؐ 8@)@ 㿘@D㿘@E %s line %d: %s at '%s'/etc/nsswitch.conf㿘 mc 0`H%s: : %s 㿘@GP`8 `@)` @*`@)! @@)@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(* R 㿘 ka@ 㿘@4 @CÐ @Cb0 㿘 n"` m`?, @`, @?, @`2` m# @)3㿀'@An ''''@/耢 @Br&㿘@AW 2 , $@Bc' &  @@C @ &$@ @8@B"&&R  2  libcUnknown error: %u㿘!x@7 a. "` @ @ *?တ@ @@:NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @Ӓ / @@"8 2"@@"p  "x`r*`:  :m %a   ?* : `(R#`*` €܌H܌܌܌܌܌܌܌܌܌܌܌܌܌܌܌܌܌܌܌܌ܸ܌܌܌܌܌܌܌܌ܸ܌܌܌܌܌܌܌ܸJ@ * @ &`*J@  @ J@  @ `* @ :  *: * L *@?2 L    `?(@ ?,@A @D$?#\    @ @D?2???#@ @B7  && ̐@ ?㿘?2 @E@    ;  ?@ 0@ 2`@ :`* * @    @ `@  @ 2  : *@ *` Ԁ6@ @ 06@ ֒@ @Ec S"㿘? @EX?  "" @ > @BF pP@(x`H8 hP0 pH(x`@(xP(`H0pX0xP8 Value too large to be stored in data typeNo message of desired typeIdentifier removedNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0U㿈'XX#d#h#\  @B2#`  *`:`J    @ @(*`*㿘  `@ `; @<Β@@,$ %``@$&@6?""  ? **ٲ$@@ Ҁ@06`@<` @<`(q6`@<-    4  $@ @   4  %%    4      4  `@&$@`6?""  ? ** @;֒Q`@$@$6?""   ? ** @-$ 4X@2&@` @$$@`6?""  ? **@@Ԑ0- &,@2&$` $$`6?"" $ ? **$$@Ԑ@~`:@;H@@,$ %``@$&@6?""  ? **ٲ$@@ Ҁ@0^@;$@$  `$@ 2?""%  ? **%$"`% 2?""   ? **   @;֒%@;˒ٲ㿘@ unionnfs0@Z  @$#"@ߒ `c@@@      @=  @>Ж   cH@( `?     c @< @%  @> > @? @?` ƀ  $@ۀc``@>@Ԓ  @<@<e H&  /? @<3*  "@  $@@   , $ ┐@j , $    @ @I  "$  2``2$`@ 퀥 @#    > && $& @b& 㿘 @T? &@$ <b@    J@*8 ` "x'D'H 'P@?? G" 'D`?'H@9l@;  '4?D'H @-P` ?@'䀢'H@9O'` ?' ` ?'@ @ ` ?'@耥@P ? `2@@SPM2@ '4:8',@ P%@P@$@@(&%@@92 @8@P4@@%@@P@44"" $ $ / ,  , !`"  $ $  ,  , U" $  , `"  $    ,   ?@  ''' ? 'D쀠  H@8;@='@:ϰ 㿘.@` ?@8"@$`&@8@%@  ?@8 @$ 4   @@ 4  @@@ $@ "@ ? @.*@`& P@) $@ 4  @"@$@@ "@ ? @.*@`"@ *@@*ݠ$@ $@? @.*@`"@ * &  &@ "@ ?"`? 㿘$@  ,* @$@㿘@㿘@9w   k k `"ė*     8`# ` @ `?㿘` k*`"@  @   2  ,  @2    @2   @"   @;{  & >   $ @ "  @@9$@㿘  @ ` $ 25 &  `2  $ 2   @;L >  @%  &   @ 2   "   & @ `"   2  $ 2  % <b@㿐@t  @ N  ``  @@<> " @5  3 `:!3 ::::"Pbd3 # $# ,# (#  # $y <b@$I <b@㿘  @;   㿘 ? & @  & 㿘`? "`@  "@@j 㿘N r   w a  0 0       & "@;İ  "N + b @ N  +@   @ &@ 㿘T  @;? +"` @5z `" @  &? " 0@8  0` @@"$ 0@8 $ 0 D "$ @8x$ D$ 4 $ 㿘@  ? ?$  @`$㿘  @5:㿘 n!<`@5 `  $ `2 0``@;I "G?`@5 @? $  ?4 $ `4 ` @@" <@8%  <$ 0 $  8 &$  2 @3 @8֐"  $  $  ?Ȑ*@$  4 2 @ 4 4 $  㿘!ɔ@ 8 0@ @n6@ @n6 @ @=on6@:ܰ  "?(" " " " " " %$sniglet^&0`  @:°  "@K!ܠ Ő?$!$!  d @  @:` @:` @:" @?$!@: @  ` @ L0 "$! !$! !@9%!?!@:pom O!a@h  ? b! !X  @ " X O (@8P $!@ 2X   D* !8@ +   `2 *$!@v  `@@ $!0  ! @ ?$!4$!$@6 $  @:  @ܐ@:%" b"`b( & & & & & & & &  & @8!@6@9" 㿘 ?@ @6㿘 " ? !?@9ް? "0!#` ! @$ $ $ $ $ $ 4$! $ 8$  D @  Ē @ @` @ 8  @ $ $ + " @  *@@@ $ $  2$ 4 2$!  2 `ဦ "$ @9   "$ @  㿘 4@4  * @   *  D# *#  * ,& $& `@D " ?!.`2 ? & ,& < & 0@7M& (@ p  , 8& @ 㿘!4@    @99!؀ !!ؒ*`&! @6"!&!@6!@K 2!@9! 6!!8, @  @6! , !?@7@5 @8?"㿘` @8 "?"? !4  @ U  2 ?@  2?&!0 㿘!4 4aa $! $ !X $ @!  @0!?! ?  @8? O@8"$!,!8 đ. `"  . @ @Cm    .  㿘 @F @8 "&!,?㿘  "!@8  !  @8w "&!,?  @㿘 @8c !  @  @8V "&!,?㿐 @ @ ?P ` ` -` @G`   % 2  @ @0 G` `  @ "s `݀@@F[ +2 `'@F* 2 `@j "W `  T?` ` @A[ F?F ` `C `! ``+00 `6 ,`@  @F|  & "@ &@? 2 `@A&  `?@?{  ?0 @>?? ` ?-`㿘  " !$@7 "$!,?!$   $!($!$$!  ! 2"!$ (  @ "q?$!   ( $!( ($!$?$!$_ !(* `2 * @ $! $!(   !$$!  $!$"!  "! !*(3 *``   @F  )?0(! `  @ &@  " &`! 3  `*@ & 2`" &  !$ $!($!$$! $!( 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @n !ؓ,` "  ?!! `&!&! (@    D*` + "&  ,  & ,& 0@>㿘@37  @6S&@ @3$㿘! € , (  0㿘 @   $!  @.@   @6?A@6"  + +* !ؐ@" ! `$! @.: 't'\'` 'X'd'l'p'h ?"@  l  'dl  tp"`'l#X'pt`'tcX" 'p'l'd'\'X't'h ဢ@dT@2"$ X @J"$?$at $$a$al$ap$b@2$a F$`&& & & & & & & & a b  $b    "`ap8#haH& & & & & & & && `   "b 0 0 $b @ Ք $aaА` @Z?$ab  $b aВ @ ?`a@1 퀤`̀@rxa@4O  ဢ x!L!b@b ?F$b T $b xP'T L/x H/y D|/zT'P/{ `@/| `/} `/~P'L///L//'H///H'D/ / / /D'@/ / / @//x!b@| ?"@_|'hb  $b $a$bh X؀!'h"'hh@ 8'hX b  $b b $aԐ $b $bh$a\ h?*  '\h*` :aؔ'\aؐ@0l?d?@0g?* 2``4aܐ 4aaЖa@ -$@b    a(@@5?b  $b  b  $b  @b  $b @4 @4 O"` ` "a@1aЀ?@3n@1 㿐 @ / @4`2-?@4"@o "#?@i `2? $4 $ $ !ڒ 4 $ !ؐ@ @  @ 0?TMPDIR%s/bt.XXXXXX/tmp/x@~"؀ b"@$?'''' @k@?@= @_ @#d d 0 $ҁ#㿘  `"" @Ȕ & " !@4? "㿈  `@ $ @4? &"@ ?  @@ 0#\  @Ě!Ȱ" @ @@0@$ P" `2@0' ` ` `.' .. . .' . . . . '... . .7. ...7 ? 2 .P.* 2   ܰ؞ԆБ(2 @7 + + @  '``. +``+`+``@' +@ +` +`+`` @``@' +@ +` +`+``@'+@+`+`+`*`2   0mk* 2  g ΈȂIJ(2 7 `+ +   '  . +` +`+``@'`+@`+``+`+`` @4`@'`+@`+``+`+``@' +@ +` +`+``@' +@ +` +`+``@'+@+`+`+`*`2   P" `2@0 ? ``P2 * 2   (2   '``. +``+`+``@'`+@`+``+`+`` @``@' +@ +` +`+``@' +@ +` +`+`7 + 2`**@ † o`2l* 2  f ܤʂز԰О̅(0@  '  . +` +`+``@' +@ +` +`+`` @1`@'`+@`+``+`+``@'`+@`+``+`+``@' +@ +` +`+``@' +@ +` +`+`0@ 7 + ʒ@2*`*`  ' ` ` `.' .. . .' . . . . '... . .. 77.....t#tp * ` ** #p h*   t* (` l(` pd(`  #l  * (` (` l(`  #h * (` (` h(`  #d  * (` (` d(`  #` ` `* (` `(` `(`#㿘 ``@@( $`@/ ?"*?@'@?"%?` "a@.g$` $`a "a@._$a$aaȀ "a@.W$a$aa@.R@.P@0  ?㿘  ``@ $ `"" @1A? " `  `@? ?@ " ?$" 㿀 @8 L" !ؐ!b!Ԕ " ?''''@0 @  ?$  <b@$\ <b@" @ ` ?  2  㿐@㿘 - ' n 2 L0&$: &@!   J =J  = "@ 2 N =   @'P'T'X`"7''''@RP*?㿐@  ?0@L `  X`  L  L? X`% H?, %L? X?H ,?L XLH@  0,@+Œ ?L`XLHH z H` ,HJ a  z,H`** %<'L`/2?,@: N F,8L`*@0! &@;  a,@0`0 "@#! 6( 0@%  @0` `? aL  zD,  @ `А,@/ "   (  `? ``:0 t(56 6 55555* * * * * * * * ؖ 㿘     "   "     6@!ؑ* @ ,  ?!0    2@$   `?@9  ,$ ! " "!&& $! "㿘! ! ` "@@+  " @+ $`@,  ! s?q&!`"`@"` 2` `"e$` `@  `*  ? @9̘ 2d ``"``   3!ؑ* !0` `+ + `+  " + "` 2$ , 2($`  @ *  ? @9 2( $  , " "!`$ !$!"` " `2$` $`&,` ,`!Ē!$`$@&!`" @ 2@`! "!""!㿘! . !"*    `   @9; 2?`"  "@+` #  @+X"!@"``"` *` @`"!"`!"@! ` h `` @@ $`b @.8 "`(  `  " `@.& "?`aܐ  <  Ԑ@ '? ' '@- `@- `aܐ Ԑ@ ?Ғ ' '@- @- `aܐ ̠Ԁ2 a@ @ ` "?(`  @Ш 2 @ ܔШ ?  Ѐ @@_  Ѐ "`b "`@h?2 `@@I ?` @`    " -`4#\@ʐ a0k?* 2 4  , "*@-   6 "@6 , 2  ` &  $ , @@-``@-`(@  2 a`@2a`  4`a䀢 2@  2  4?2 ?@2@ $a 4a쀢 2 @2@ $a4a$a@@ ϔ  2b @ # b   $b 㿘 @ *!蠒 2!I&!& 6 `     ?"  *7!䀢 2   2/?*2 2`?@2' @ K &  6!6 6!쀢 2* 2 @ 4 46!쀠 `?&&!@ p  㿐  `"" @ d $ " @,H  0?@EA  7 "?  @   1'`?2  2  @1 2,? @I 2``    @  ? @ `? @,o "? "  $" 㿐 @@  @ n " @@"``c@@    , @ V "հ ` ?2 ? @=@ ٔ !?&! 2"- 2 `@   !"!2! @ &!@ "  @  @  2@ @! "!2`! &!@2`@u@  @ "u @ "e``a@ x   , @  "_   A@ h !?&! 2""- 2 `@   @ N@  `!"!2`2!  &!@ 5 @  2@ ?@ !"!2`! &!@2`@   @ &@`?㿐 @y 2} {? 2  @ q`?  @  2&` @ 2P" `?2  2 @V ??0O@ Ԕ K ? 2 @ ئ ` ? 2 " ?#@4 @ p  @ʔ?"  " `4 `?2  @   @   ?@  ?@ ?㿘s , @  ` - @  @  ?"u`?2  2@@   4`!ڔ 4`I$` @ 2q?@ + "E!i?`` @$ @*H`?*?4`2`#@   2*`2  `?2 "?* `+ 2  *2*` `?4`@  @!?&! 2@  @   @  ?@3  @ Ē  㿘 (@  . @ 2 @@o 2j?.@``@ j` ?"]?`  @` @ _@ ?2@P?`  &@ @)*?62`#@@   2*`2  ?2 "?* `+`2  *2*` @?6 ( @ @ 2    2  ?6  㿈  ` ,`" `  `  #\'7 @ 2 7'@ 2 ` W,`?2 ?7'@  ` C,`2`"@  %' 27@Ȕ 2 `" @  ?2 ?2('`"$'@ h /?'7@ 2 ` ,`@   $@4`@ ܔ '7 `#\  @  `  ,`㿘``"`@ , `" @  ``" @  2`?" @   % <b@$ <b@$ <b@% <b@2 J@ ""  J@J`   x\@7ހ     @ @ 2 ? ޒ"@6 * 2 b    & ,  & $ , @((@(#@ T`,b  @  ?@  Q@@1?[`,=a @@s "R@    ``7`"  0>`:`< 08   6 ?   a ( ?  *   2`*2  (" `  @`@ @  '' '' @:     @    "   @g @ ߨ  * ޓ2   * "@ *@'  6    "  "  0 > a0 "ޑ*2 *`6 3 @'ex$  "ޑ*2 *`6 2   & &  $   , @'D W  @ɐ? 0Oހ ?*       @` @Ő$@$  ޒ"@**`6 4 @6 &*$  ?*       @` `?2 $@$  ޔ"6 *6  *?22 &  $ @ "@@ 2@b @ϒ?@?@@Ԕ @@Д a?$a @ @ @ @0@@ @@ @ @?@ @-`㿐@ ]  4`$@4``$`@$`` $` ```?2 @  &`4`7&&?@#Wؠ 2@@u 4  $@` $ ڒ ``4 `$ 4 $  @Δ 2@@# & @T @Ɩؐ@&E"@#&&㿐@ @   $@$@$`$ $ $`4 4`!ڐ4 4``  $ $` @&&㿘!ڐ?6`6`*  2 `@?2 @$$ `6`6`*` 2` @ ?2 @$ $ ` 6` `&` @  㿘!ڐ?* 6`6`2`&@ @ &.`  ' 6  ` " 6`6` * 2 &@@&.  @% "`  @7?2`  ? ` " *2 @ 6`6`@%&@`   `&` 6`@  xa'T`*`?2 2`* 2`''X7*     w 5'' ,22` X3  `  3 0'  3 0!@ @ `  3 @ @ ` `  ? `3  @   @  `@  @%25  .2  :-3 0@$ ( *"@6 7@  @% 'ܖ* ܒ@*`   ,3  , 2` 6 ` ` `@@ 5@ `2*` :#`#`"2 T "0䀣G ` -2  `  "*`  *`0  *`0@ @ `  @ @ `   ?*`  @ @ @ ` @ ,"@7 25  @$*  ,2 @7  7 㿘@    " @k  ?` (0 `*`0`@*`0  㿈  `"@F $ ` "4*` €b|bb|bbb|bXbbX ( @@&@$z? " @s#\!@B!"   @0$ 㿐`g#H*` €cldcddd@cdd@  @$= "L?@F    @@< "7? ?2  "  " &@)6` @ %   *     @@ "? ?2 `" &@ ?2 ?6` 㿐  `    @VR @  C "" `C6` `  ` *?2`2 @4  @g @ϔ ! %6`  ,`&@` 6`` ? @J 2 @ 2??2 ?6`&@ 㿐@ 2 "c" " &x ' ',@ @  @{ 2$@2^? @ X??2 4 4 @ @   @ ' ' 7 ` @@͔ &&!  ?2 @2& @ `2 @! ?4 $&  &㿘  " (@& &  (&   . (. (6 㿘`,%a @@ 2%`i   2`*`  ` ,45` @*  "=aN& * 4  *b #`- 2    @X / 4 ?2 @2&   @" &5` ,` 2a,`3 "a 2`a %a@   @ @@㿐 @` ' 7@Ĕ  @ 0 @  & & & 㿐 @a` '  27@  @ް 0 @ٔ  & & & 㿘@`* @\7    @ 2n?$`2" @@ @  @ "T?&& @!&& && "B  `   @` 4?0@`2 " @"$  `@(@ @D  @ 2'@?  '` @` @!T  ' @'  ' 㿐   1    *@ 2   *2 @ "  ' '  !@D!̀ "!?'!€`     @ @"`" `  @   @ @   ` @ 㿐@ ϔ `@ ˔ & :! @  @ &$?'!?@' @ 8@ @ "' 㿐` !ت @?@@j $?$$ $ $ 4 @4  @ r $@m &ܤ@b  㿐@ W `@ S  @ 2` ? "!@G   ? @ "'`@ '8 㿘&`!Ԓ&`"  @&!@"&" 㿘!Ԁ`@   !&@" `$" $!@A0@r ' <   @ P " @ؒ$(  &&   ""@` Ȗ @ &$ &$&$&$"$$"$"$ mpool_new: page allocation overflow. 㿘$?c@ 8@@ 2$%  "&@ &$* `*``  ""@ 2 "" "" " @2 &" & 㿘$@ @` "0&@/ ;`? *  @@ `""``@ @"@$`$@@ 2"" "`@` & "` ` @`"`$` $` @2 &" &  ` `G,`@ 2$@ @ $`@ $  . @ O" *    ,`$` $@$`@ 2 "" "$` $` @2 &" & $"`$$``` `  *` 㿘@ & "`  @ &"`@7  @1 㿘  "  @\?" ? 2 @$  ?㿘$$ @*9$"5$  2-  @9?"4  ? *  @  ""` @ "@ @ $ "`  @ "`$"2 $@^   & $ $$ 㿘$ "$$$``$`@ $`@)$ ?` .`("    2  $_ <b@㿐#\#`  @   㿐#\#`  @   㿘@˒@ @ 㿈?'?'?' @} |   m#  "|@j@|  @5  @e @_@q @W 㿘'L'P'T'X@L㿘   `  `  @  ` h? n#''''''@ " ?2* @  *@ @  '@Ȁ ?ȁ$ $ %% <b@%# <b@$% <b@  #*0 ` + +    "*2"*㿘` @A&`&`&` @   ? ,$ 7''7'''''@1 @7 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.@F'D'P '@'H'L  2  @Ɛ " @1? J"   V =''''X %3@l@j  l@ $$@ '耢 'd X'X `  'T?/_N@``X)  *` €ֲXttttttttt|tt$,,,,,,,,,ttttttttttttttt`ttXttttt<tttttttttttthttpt\tt@ttO_ 2N@ /_'T 'T +/_N@* ` &~?}N@Ѐ   , * ?РN@Ѐ` ` &m?lg , * ?РN@Ѐ` `\'TXV@N@ l2R`O @{/@ ? @* : :  6  -/_` ?g  G2 " ??H@IH  H  -/_b< @%H "4 `#`H#\k@dgGed$ gg E e ed 'd@A`'D f`  Ok   Ok  " Ok  -/_ X:`:2 @Xv2Xq" ? @ Z # '@  O x` #  @# "$/_@ ? @ ! # # '@? @  2/_ 6 `N ",  3, ? , 4` `4 0 ,`402 0/,  @`0  @, ` `0,, 4`@ ` 4   ,#8@ '?Ϊ@/@ /__  2 2'<T  - #b $$` '耢 ' ? 4$b$$@ '耢 ' O_  _ $$` 0/8/9 8$$` '耢 'Ò r<3'@T  - #bШ $$` '耢 ' T? 4$b$$@ '耢 ' >'@ - #bШ $$` '耢 'v %? 4$b$$@ '耢 '`  e$$@:H BTd#X $$` '耢 ': `@P$$` '耢 '" Ѧ`? } #bФ $$` '耢 ' ? 4$b$$Q@``#X $$` '耢 ' P$$` '耢 'Ӓ d  - #bФ $$` '耢 ' h? 4$b$$@ '耢 ' R`$$@ N$$@  '耢 ' 7`"@ - #bФ $$` '耢 'n ? 4$b$$@ '耢 'X #` $$`$@  '耢 '< #` $$d @ '耢 '& զd$`"$q@ ` 4 @Q  @ ./8/9 8$$`` '耢 ' H B `$$ /@ `? 4 #bФ $$` '耢 'Ғ ? 4$b$$@$$` '耢 ' dD$$@ '耢 ' Q0T  - #b $$` '耢 ' 5? 4$b$$@ '耢 'q 2! T@&X 'X` 2 'ۦ耢 T 2 ' @?'XX㿀?&\ f'   e E  聩 9/ -/?#\@ ?耤 g G f# fJ 02 @聩 B  '@@聩 B3'@   0`*@@ '`" "@ ``, -,   +,  ` @ 0.@r ` `0􀦀 . .   & 0. `0. &㿘` ` `2 @@ِ "@@D? "`   2` `$$`, ۤ`" $&`װ w " `   * : !"`"`@ " `. `*.  @` ``&@` $`$`$@$`"`*@@ `@"$`$@.@`@ @@@$@ 2` `` `,` $r` ` @ݔ`@"$`$@`" $&`_   `  `2` @[ "@  ``` @@   @@@=$@ )0   `,` 0  @`@"$`$@2`@   `" $&` ` ? @4` 㿐@㿘@  H 'T@  :8?T  `2;@  0+4`444`4`4`ؗ445`5`'75`5`@ ڮ27```@e`@M`*  @[@C`*  @Q@9`*  @GT` @,T ;@-`-2 ,`- ֓2`@ Ū`` "` '`` ';`   đ. ?3@ "@ `*`# @ 'Ā@ .`@`` @@`@`` '`' `'- @@ @, @@Β * 2 5@?c  @. 2, @ ? ?#9@. @ , @'@?""6`4@'  @"6``4@  *. @?@ @ @ 4@ 6`@4@Ĩ 3@`'`' T`%`@ .  "@?:@* @2 . 4@*  *`T@ ;@̑* Τ Г*`@  +     @( 82 `+ ( 2;```0  ?2 `2 #;`` (` `?#@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $NetBSD: strlen.S,v 1.3 1997/07/16 14:37:52 christos Exp $ J " "  `  ?2  㿘 k#X.  ` @ " ,, @ "`"`"`"`   k`X("@ 㿘 ? # @ ] @4`@ W4  *  $2  &-    * @ Ȑ - %@ & 㿘@ϒ   *`   " " `   N  &N     &N?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘'  " " 㿈 `@6 ' ` @ ` ' .@ '쀧@% *%`, @ ,`' @L@?   @ r 4  @ @ j4`5`44 4  $@2 "? @ N 4` 44@ F5` @   4 $`@  쀦@   2" }㿘` +`*  6``#! k#``]"q$# $@ 2[$@"`" 6`R6``2@㿘6` @ *@  X   "* ` " * " 2@ ` "`" & B`(` " ?8 㿘     V     ` ? * `@ +? # @ @"  23`0"  `  2 33 @  ?#? @ 2 2`   2  33   ? 2 ?   ?0   0 4?8      ( ;``"##㿐  * ? "@ &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐E ?. . 6  `''`'ؐ   " *@ $ 2 '$   $   $  $ $   ` 5͐@& "@ Ε. &. "@&㿐v?o ?`" *"   * * #??āh@ 'HcD @   @       ' ` @ `2`*:  - +` @ '*` @*:  ր 0*`M@ `M@ 0 @OH*: '   / 9  -*   ?4`* *  ?Ъ`M@/ ,`: L'` M@0Ϫ`M@0`π =e ' Ѐ` 4e`)`     -*  4 * *     -*    * *   `M@В` Ҁ`e EK 2 `2"Ъ`M@+ -Т `M@Ѐ 00Ϫ`M@0"`π #Ъ`M@/%@ 9 +  *  `M@/?А%@ "" `2     쀣`H%'쀥  'B? '? *`? HBD? 8 @ p 24%SH!  ? - ! B"   %?`+ % @ D-@$?% B ? *` ?$%E  + ?  B?4 2@ ""{x  2+`?@ B?`?, ?+`( B?  $(#a?_]   + ?  ?M23 a 2+`? B?`?a+`@ D? F*?()B"?# D$?% F@ "  "`H,?@?w   ` '\  0b7 !#   P #   ? # A?? ?葠 ?! B0+ ! + &6'?$10B'1 B&''??@?؀ ȉB1 %?, ??? @'cȉD?   #D?  BB?Y?? @D?   F'  €?   0( ``*@  {      􀢠  $@  ?<3 6" @   4 `% & $@  k `  ^` &` ?   # nljhfH2 ?(耠)㿐 `  -'`@ @   @ɒ` 9?#  5?@@ @4` @  "@ @4 `2`23  @"  2 55 @ߨ  ('` "'`ɐ 7?#`  -?@ @  "@ @44``2`23  @"  2 55 @    ('` "'`InfinityNaN0h% kP'L'P'T?Ȩ ''܀ '' kT *@ " "$PȀ6'@ '@ ( '  T# ̀ 1?11!!\N    \ 0ȁB# T  \1аa  Ȫ0' ' k?+| &'$2`   @Ȓ"@̐$( 0@ ̐"(' 8B?? {'ؘ'?@HXLP0DHFF'B#  '`-@ȁ)'"?    '& 'L 8'LL 'L L ('2 ( €ȼȼ?'? 'P'PP 'PP' 'P '`  ` $TT,   @"TT$P ` Ș$  `* 5@ Ƞ ! ?Ȁ  ! 4 /`@B `ȡ ?철``* ȡ6`@ B?! 4 /`@ȡ B?Ȁ `쀠`ȁ9'  hB?'p?0 ȅND''x ?ȁ   +01 P|?耠H?* `@ȑN'0/ȝ?ȕʁ  [ `01΁  @6S?hȕDD?ȑP'0.ȝ?ȁ  9 01΁ `@2?Ȑ?`* @Bh Ⱥ`D?Ȁ@P'0.ȝ? Dȁ f.ʣ/ 9 ?Ȱ?N 0"? ?Ȭ  ZY -P !     xBȁ 1//9 0hB0?ȁDͺ`Ȁ@ ƑB'0 F.ȝ? ȝ01N?ȁ -?01F?̐ 0?N 9`. 'Ԁ! L ?؀$3 6" &$' &  ` @4%&&@耠` iߒ Yǐ 䀠PL̀2'?2 ' ''䀠 *`M  "  ` "```@HB쀠y       L    W  1Pˬ8 1/ Ƭ耠`܀'eԤ* @    t Ԁ  l  'Ԓ e 'Ԑ ` ` 0$ ` =` L ̀ `9+ 4`f.& ``L`̀` ڒ 4`2N.`"K.``:  9E. `9` 9.- ;..@    ` 0.@ k  4 ??`N  1?N 9` ./ N 0"? Đ Ԁ2. 0/  .T \2  "  J` ? `   ?J@"J@@  " *   J@J@"`   `  `(*`  㿘 n!<`2 @% 2 +? 0`  @@" @N  & 0  & 6 & 6   2 @   &  &   &  㿐  C & & (&@&@  6  C  & 6 & &cT m"#& &  &@hV  2  6 0T  &&@  &< ؒ`?&$&@(&@ $ L( (:"@"$p. * "* @T  2 ?  ? +  k#P#? PH? ? ?   ( 0 8 @ H??:::::::@::::`XXX㿘 n!<`@N    R X 2 &  ?2 2 """""""0"4"D"H㿘@ ` " `   ` "@`4`x $㿘6@#6T m n "#"a<㿘 2 6@#0  @0 "?@㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`,  $0 m       $((()(*(+ (,!(-"(.#(/" $  m("$" "` "`xpp.ݨݨݨݨݨݨݨ$NetBSD: umul.S,v 1.3 1997/07/16 14:37:44 christos Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@+dd70(#x? `'7#P*` €<Hx $0<$0T`\lH _  @6耢 ?}{ d W  O   J  G  I  A  >  @  = % 5  2  /  ,  )  &  '='                        &''  #? ܖؘ @ǚ ? ܀ ?@ " ? ܖؘ @ ??܁h@Ȑ: @ @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $„ <b@% <b@㿘 `@Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*㿘% mH #H@R$H@V ?   H H@I?-H  *` ` m"#LH  ? m#L@ ' m@ @`' mС,` 2 @ 2 "@ ..  㿘  *  m#H@ @ m"Г. ? " "?       mЅ(" 㿘  vK`2 D   @=    m@6 &  m#H * ??  #H *  @@ 8 @  8@M mА *       $* ?㿘T @8  P>  B< P ?Đ*@4 㿘 !" V   @7  ?Ĕ*@ 6 V @㿘T   @$?  2  ?Đ*@4   4 < P㿘@V 㿘  ? T` "??`X2㿈1 m#P #P   ?'  @ ?#P?#P@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  $ <b@$ <b@$6 <b@$ <b@㿐#\  @  $NetBSD: sbrk.S,v 1.5 1999/03/31 18:14:27 kleink Exp $   : <b@"/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin㿘 @oj `@a \   X W X"<`@@x XM    E "@  ?`6<!*` €  (L0<<<<<<<<DL#?###    (",&  &@ "?$ʄ <b@$Ƅ <b@$NetBSD: cerror.S,v 1.7 1999/03/31 18:14:27 kleink Exp $㿠@b"??Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @* n"compat%s line %d: 'compat' used with other sources/etc/nsswitch.conf%s line %d: duplicate source '%s'㿘 m#J% m`` 㨀 `B?=`֒ ` `== `ݔ0!== `ȔՖ0`` 6 m `,    `&` m"cl`cl㿘+ nb耦    Ȑ#4,? #. 4' n! m#Х.  " : ,` ) m$#$#~.  #Г,` ? n n%b" "0%# ?syntax erroryacc stack overflow㿘5 m3 n+ m7 m?%c`&&aH h= m#% n' n$ $2@ F. Rc   %%"R.c +* x*R@ # n 0  x /=#&R$2  maH?㔒"$ `%㠐&aH"Rc aH x*R @ aH#&LR aH  =Ԑ"aH`&㜀 9c "&aH`x#& n! n- m R@* S@ б*S!0@  T@`$2` $ m"Ѐ@ ?$$ ?_%b*R@  "* @# m`T$c>"p*` €(lx m#`:  m# mc`"c`"1" m  "cp*  m %"cp {!  @  ml "l * "   $cؐ  $cؐ $cؐ $c$c , "@ % , R!" R $ $ 2 cؔ c" '  %%c 7ؐF#, R  n  x*R @#&R "R  0  V  =`$2` cؒ"$ =א#  0 "W? Q?  ߜȦ I, 6 E?" ƀ -   ?8   $@ `4`  ,`  J,` .  & ?  kȦ , Б. "? ˀ7  &@㿘@ =`r`?z ԰  ?' ''''''' !ؘ  !    "  "& `& . ``& i& &`FC'"   ?$`!``2``l  & ?b f&  @"& A!A"& 0P  & p K@? !& CB@AM@C aȔ<"b\& & & & & & &   ( ` 2  `"    a$   )€??0 " `X "㿘  `"" 1 & " ("? "㿘  `" $ `7@"*` €@p$H@$)" ( $  $!   ( " "  $?2"H " )2"!€??=?"7 "5?" " )2 "!€ $" ؀8 @>   ( , ($ $@В" @  ܪ@0@$ 㿘  `ܜ $ @`2"? )"@ " )" !€ @  ? @ " @  j@0@$ 㿐̀ Ȁ 4   $5?$'&'Ȱ ?2.2.  Ĕ@  ـ*   !$ 㿐bC ba'a̐@  1?<?2.a̤!!a$aaȀ & ֐ X `$aȑ. 2 @. Fa?߀aȀ?&''`͐?*aȀ b  !$b 㿐bà aȀ    $a3? !/$b b$aab'b'b"b :b baȀ*   b& @  Ԡ  〦$b 㿐bb  b"b*'b  !$b  *& '@ ߖ  ?  $b 㿘  `N $ " (0!@`"@ @% " 2 $ @   $?$ $~?  " "  @$" 㿘@ 2@?`@    㿘`.@   " ٓ ?2G?`` @& @ `" :6`?*c2  3*`2   `? ? @" : ?* `.2   *3*`  ` 6`?$㿘` `ڙ $ @% ? ?" $  "" 2?" ( @+! " 2?H?"?p  `` i $ ` 2" m z  r 2 "!€??"i?"  k @2a? $ ''" b ؔ  23$ $"3䀢 G ؔ  ""!$ $ " ?ؔ ''"S  ( ؔ  "$ $?"?"    ?  A"  ?" *@$"  ?㿘'L!Ā !  5 `; &!&!!Lǔ  &!& "@ @`* @  !ߘ!̀ 2.?&!" @"#!̲ @ !Ȁ z`2&!? &!!Ȓ' !'''  㿘 ,&!   J` $@& 6 o ` ?2 `* *2 *@  @ @(!"!2`! &! В*2 ? @   *2 ? @  #@ 5 0 '! ؒ@ ``*` @ ?`*` @  #@   !?&! `2[ "㿘,` ``$ , 2 `@,`26 $ , 2 `,`2`,``2 6**`@6$ 2`2`㿘`.`  @I" " )+ 2`@`*  2 " @4. ??@`2@23@` ,`*  @4   3?48 $8` .`㿀  @   8 2 q?- .3 3`@j `-  -'  -@@ @ `` ߑ, @ '2 $  '2%* "@ , 2 $ @(@  "66@`  @ '" '`@@Ȥ@ "*2``**`4@@% 2`@* 2   -  ?-p*`2     ?* 2   #\@% 2?܀؀+,`2 `2% `" + 2**4' 2*`* 2 2`w [  @[ ^ ,`2 `W  ' %@ ' ' # ';2   * @  `@  @ l  . * @  `@  @ 2?M .`*`2   ,`2  *T @ 㿘` .  * 2 `8) " * @  ?* `  S ?Җ "Q?` Ӑ   *     @= 7 `  *  @  `@  ۔ `@Z 2?`  .` 8` & 8 (` 4 $  @ ?㿘 4@@ `2  & 4 & 4``@.`,`2``c  &` ` *`*2*  2224`㿐!  6@  ?6` 6`  < ?*  D@ 3  *  <?@  '?*  D @ @> ? Y?  `? OP"6@`2  @ 2  6@ ?6` @6` ဢ@;`  2 65 ```@ '  +@ `.@`(( @ 7.@.`@ 4 `` 7 *.@` 㿐!? @ʐ 2r?  ဢ@5!   2 @.````' @ +  ((+@ @``7 @**  < ?*  D@ 4  *  <?@  '?*  D @ @> 8?  O"?㿘=  !4 ` , &!  " ?* $ ĕ.2 !8.`" $      (HASH: Out of overflow pages. Increase page size 㿘 D,@ `$* 2 ?2  1 8, @] 2 * ?  $* ? @  :  ? ?e` *` Ց, @%$@ &@* $@ g$  Hb` Ȕ 1| % * ,% % * ?@2%`  H, I  2` @` gU&@H% * ,%  , ?% E ``:** %@  * @$ 6, F  :**&   * $  $*` $ ?%$  ,    ,  ?* @$@ g4 , . 6  㿘`2 ` '*  D@  $&& $ !8 3 *  *`` @  :**$@  *@* #@ _hashXXXXXXhI bАb // ? / / / /  / / / ///'''' h³?&!:! >  X ! ?㿘,``$4, 2 `@`$ 6, 2 64`4`` *`$ @2`* 2 㿘!@6 ~ .`!8 $ .` @      2ܰ  *@  2@* *@ 㿘`* c* 2 * *`$ , 4`2 W **42*`4$ 2** 2 4 `q%'*@ @- $@,`4 2 4 $ 4%@*"@2* 2  4` `.`*@`?* `H* 2 @ @"* *`$@ ,`4 2 **42*`4$@ 2@*  2 * 4 ! 2`?* 4 `` .` *  㿘`  * 2  ( `2 *   `2*`@ `.`*`2`c K`   2+  ?  22`$$?$?2` + *`2 "  2 ``*`@ 2`  ,`8 ?$`8㿘`. "@ *`2 &*`.    *`*` 2` #  $@``   " *2 ߒ *`2 ?.  ??㿘 @+  ? א "    +  @  `+ &@  㿘`.  `.*  "u?`   .  `2*  ^`  ?*  ``2 "~ -, E?  & " !&  * !$  &!(&!$&!  ?a )&!  &!(`@2# !$&!  &!$ , 2 @?&  !q@ ! & "?㿘`   "@(`! 3 A&!, &!(* 0&!  `,!$&!  &!$* Ĕ $?,` 2 @ ! `@ 0q "?㿘@  ?&! &?㿘```? * 2 "@ ` ! ?ǐ 0$!  ,&?@* ΐ ,` 2 @ !``ｒ@ 0 "?㿈\'P 2d?\@ P* 2`` 4 Pc $ L?$  `"`` *``/` @`* `2 *62*6 2`6@2`?* 2 P$$  `` *` *  * 2`6@ 2`*P2  ?6P"$ $ 㿈  `"" > $ " ""+" "&Y!̀ !Ȁ    M$!"$!!!" "Ѩ" !'"''' 1M#. €7t7<777T7t77777t ( ! $@2"  @"@"  0S2 "N?"5" )2 "!€???" %" "" '" '"'G " "'@( #?"`" "@  "$ $" @$"   xa 䀢?/ ? '' b@    "b@Y?2 @M J?     ?`"@ @ . 2#\ϔ 2b .$b* 2 2  .  "*    4 "@4 .  2    $  *  bb  @$b$b  $NetBSD: crunched_main.c,v 1.2 1997/08/02 21:30:10 perry Exp $%%%%%,%,%,%@%%%!H%!H%$H%.0%x.0%p8%h}0%`0%X %P%H%8 P%( ]8% pH% pH% ֈ% $ $ $ $ $ $ $ X$ $ x$ $ $x $p h$h Ϡ$` h$X s$P $H x$@ `$8 Ĉ$0 Ĉ$ h$ h$ h$ x# `# _x# e@# gH#P####P#P#P#ߠ###x#p#h#`X#P\`#H^#@^#8v#0x#(# #@#@# !7 776666666""CCCCC$C$C$C$C8C8C8C8 e j   ky JKYdu f   bvz!w" (F2R r u'g<<p%[)]*())*{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVqQ:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular file (use -f to see it) SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. h H Display this help. q :q Q :Q ZZ Exit. e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-( RightArrow * Left 8 character positions (or _N positions). ESC-) LeftArrow * Right 8 character positions (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------- /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. --------------------------------------------------- Search patterns may be modified by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------- g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. --------------------------------------------------- m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------- :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. = ^G :f Print current file name. V Print version number of "less". -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. __<_f_l_a_g_> Display the setting of a command line option. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. --------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - command. -? Display help (from command line). -a Forward search skips current screen. -b [_N] Number of buffers. -B Don't automatically allocate buffers for pipes. -c -C Repaint by scrolling/clearing. -d Dumb terminal. -e -E Quit at end of file. -f Force open non-regular files. -g Highlight only last match for searches. -G Don't highlight any matches for searches. -h [_N] Backward scroll limit. -i Ignore case in searches. -I Ignore case in searches and in search patterns. -j [_N] Screen position of target lines. -k [_f_i_l_e] Use a lesskey file. -m -M Set prompt style. -n -N Use line numbers. -o [_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] Define new prompt. -q -Q Quiet the terminal bell. -r Output "raw" control characters. -s Squeeze multiple blank lines. -S Chop long lines. -t [_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U Change handling of backspaces. -V Display the version number of "less". -w Display ~ for lines after end-of-file. -x [_N] Set tab stops. -X Don't use termcap init/deinit strings. -y [_N] Forward scroll limit. -z [_N] Set size of window. --------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. CNTL-RightArrow ESC-RightArrow ESC-w Move cursor right one word. CNTL-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. CNTL-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. CNTL-DELETE ESC-DELETE ESC-X Delete word under cursor. CNTL-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. CNTL-L Complete filename, list all. dda)b .tB)`c.0d)߰e. ߐxXf.@ g)ޘh. xPi)0j)ݸkHlH<m.lݨݘ݈n".hpX8o(OpH̜Pq.ܰܘr!)pHs!)0S!)t8Tu".pۨۈpV@w!)@x$.HXA.@ڠy.<ڈ`z*H("δ?ϔ0 (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when donejj'332/x/0.....8---x.-0,,0xa0hc0`c0Pd0@d08f00h0(l0 L0n0N0q0q/r/S/t/T/v/V/1/9/Z/bj4H4(3333X3222`2 1111p1H0 46KKKKKK 46KKL\ \\\....\      .8n7=o=o           #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $NetBSD: chroot.c,v 1.7 1998/10/06 03:47:51 mrg Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: chflags.c,v 1.6 1998/10/10 07:38:23 mrg Exp $$NetBSD: stat_flags.c,v 1.7 1999/01/03 01:30:10 lukem Exp $$NetBSD: cchar.c,v 1.13 1998/07/28 11:51:47 mycroft Exp $$NetBSD: gfmt.c,v 1.13 1999/03/02 17:27:03 christos Exp $$NetBSD: key.c,v 1.17 1999/03/02 17:30:05 christos Exp $$NetBSD: modes.c,v 1.14 1998/07/28 11:40:59 mycroft Exp $$NetBSD: print.c,v 1.19 1999/03/02 17:27:03 christos Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: stty.c,v 1.17 1999/03/02 17:30:05 christos Exp $!h!y!y!y!y!C!C!F!f!v!V!u!xu!psCopyright (C) 1989, 1991, 1992, Free Software Foundation. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. Q0pR!hp A$0hHߌ AT0XM" Q0PI` Q0HJ@ AD0@K08 Q00L0( Q0N A\0<" Ad0O08ml Q/P0(m A</Q!hpp AH/< Q/< Q|/</ Q/< A`/<  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~??A 00123456789abcdef0123456789ABCDEFAAAAA͠ʰ͐ ʰ̀ ʰp ʰ`DP D@ D0  x ?H@80( A $NetBSD: skeleton.c,v 1.14 1997/10/20 03:41:16 lukem Exp $! &  )''  +, #$"%%(*  >i? j] a"5:; )% ek/09#!Uw'&`d834xr(LJc6vzX2MNK7*1+,=.-Cl !uvmno0"p(,).qr:+ q, , ,n , X c; X X X X ,g u\c , , , , , ,S{Wd ,) X F*nq ,nn k )X L  F>>%a$ FXn Xch-)c F FX F X X >>>>>c> .n F > F F F7aan ;> nanaaa67 \9 p&KP/ KGppJ c:; ;`p } p ? z *tFcHILObvFb g`[A[P^<5^'g6gA&PbbggwAg$A$OAbbAADA\]_[\_\^A%&g3[$$@b$'$$4$[\]g'$WXY_U\b@Vx@z@@@@AA@QFEQ@GW\]USTV'X$@$@#@@@'@ ff@RYZRDH#OIX#Qff@O@f@#Q=#[{|^5Sg6Pf gbSSORb@}~DAAAgfAA_\AAAAAAAAAAAAAAAAAAAAA$$$$$[S$$$$$$$$$$$$$$$$$$$$$@@@Q@@QFEG@@@@@@@@@@@@@@@@@@@@@@@@R@@Rf@@f@@@t@@@@tt-ffttttttSZSS /12888>8t 88BR888888y&V58@6$V8V*8LM8t88888888/   8ut/8V8ttuuuu Ns8s8tt!888sss|s||o|%o79;8Ouoo8888888888ss;8s8Oo88|sV**oVVsO EF*O)s,-0OG2OOOOOOOOuOuu;**s*usOsOOO|sOs#||oWssossO*WW**OOOOO*W* .51*364*{W{{{{WW{  {{{{{{{{{{yyyyyyyyyyyyyyy@@@@@@@TTT@@'T'@@k@@@@@k@@@@@@@@@@@@@@@@@@@T@@@@TT@@<<<<<<^< _`abcdefghij  _`abcdefghij <<@@@@@@@@@@@@@@@@@@@@@@'BBBBBBBBBBB<<<<<<<<<<<<<<<<<B<<<<<@@@@@@BB@CCCC@C56CCCCC _`abcdefghijC BBBBBBBBCCBBBBBBB@@@@@@@@@@@@@@@@@@@@@ppppppppppCCCCCCCCCqq qqqpCCCCCCCqqqqqppq56qqLMBBBBBBBBBBNpppppppp}}}B}ppppppp}}}}qqqqqqqq~~~~qqqqqqq~~~~}5 E6'LMJ~BBBBBBBBBBBBBBBBN56KLMJ}}}}}}}}}}}}}}}}~~~~~~~~~5N6~~~~~~~LMJ EF56GHILMJ5N656'LMJLMJ ENF"GHI(+N/P N5 6  EF56GHILM EF56GHI EFN EFGHIGHI  h hhhh h EF5h6GH 6@@@@@@'? hh6hl lhhhllhhl5 6l  lm mmmm m @@@@@m @@@@@  llllnnlllll nnnnmmmmnmmmmmnnnnnnnnn),)$)!,;$,) (,+[-D;D),:;&,!? $;>(:;+-;/!")]),,];]m([]q( q!{)$,](;+]-(/,<,,,!"{;;p%^|]*]{!/($ ,(;;+-/({}([;;;>;;%!"(*+{-!/;$34)((/+^-/{!}$((+-/{{){{,;))>);)^|:;{)}?{(, !$,( ]+-{ ;> | {#$  {!"   !"#$ |   !"#$     !"#$   j !"#$ ,!"#$%&  :;>?346 EFHIJKLM !"ij|5ef@lSTUVWX+,!$l(p+;-t>#<>cks,| :;>?|#, :;>,#D:;)>,|:;    mqr5|@]!&|STUVWX { lp t"'(+/!"#$m efl   ,), 02;>    !$%()*+,-!/&!$:;<(>?+-/!|$%)*+,-/]^:;<>?)!,$0(2+-{|!$%]^()*+,-/?:;<>?{|!$%()*+,-/]:;<,>?:;>? {|!$%]()*+,-/:;<>?{|   |] !"#$   {|!"#$ !"#$     !"#$ !"#$   !$%()*+,-/   !"#$:;<>? #$   !$%]()*+,-/ !"#$:;<>?{|!$%()*+,-/]:;<>?!$%()*+,-/{|]:;<,>?:;>?{|!$%]()*+,-/:;<>?{|   |!$]^()+,- !"#$:;<>?{|   ] !"#$   {| !"#$   !$%()*+,-/  !"#$:;<>? #$   !$]^(+-/ #$;{|,   !;$>()+,- !"#$:;<>?{}!$(+-/];|!$(+-/{|;  !{$}(+-/ #$;{}!"#$ {}   !$(+-/ !"#$;!"#${}!"#$!"#$!$(+-/;!$()+,-:;>?{]!"#$!$(+-/{|;!$%(*+,-/:;>?!$(){,!$^(+-:;<>?|]!"#$  {| !"#$!()+,-:;<>?]!"#$  !$(){|, #$:;<>?  !$(),] !"#$:;<>?!"#${|!$%(]*+-!/$(+-;<>?{|<>  !^$(+,- !"#$:;>?|!(|+,-:;<>?  !$(|, !"#$:;>?  !$|(, !"#$:;>?|  !$(+- !"#$;<>?!"|   !"#$|  !$(+,- !"#$<>?A  !$(+-/ !"#$  !v$|()+- !"#$<>?{  !$(+- !"#$:<>?!|$(+!-$(+-;<>?<>?!| $(+-/ !"#$!$|*| ! $(+-!"#$ {!$(+- !"#$<> !$(+- !"#$:? |  !"#$ !"#$!$ (+-/),!"#$:;?! $(+-/]!"#$! $(!{+$-/(+-!"#$! $(+-/ !"#$!$(!+$-/(+-!/$;(+-/!$(+-/ ),!"#$ :;#$?!$(+-/]!"#${ ),!"#$!"#$:;?]!"#${!"#$!"#$!"#$  !"#$), #$:;?!"#$]  { #$   #$ ?#,?#-?# 421?#r0*665?#  x(ph?#s,`?#vX?$vP?#wH?#@08.0/(?# 3?#T?# ?#l?#?#X?#?# 8?# d?#D?#?#?#)(END OF FILE)<dd`d@d dccccccchc@cbbHp8ˤ(8l̠͸<ͨp?@(#) Copyright (c) 1998 The NetBSD Foundation, Inc. All rights reserved. $NetBSD: mknod.c,v 1.18 1998/11/24 22:56:26 christos Exp $*&t*&t*()%)')&t)&t)$)%P)&)&t)'l)&t)&t)'l)&t@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $NetBSD: init.c,v 1.34 1998/11/14 07:17:58 tls Exp $6l@(#)cl_bsd.c 8.25 (Berkeley) 4/30/960123456789;123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz@(#)cl_funcs.c 10.40 (Berkeley) 5/16/96@(#)cl_main.c 10.27 (Berkeley) 4/28/96@(#)cl_read.c 10.13 (Berkeley) 5/3/96@(#)cl_screen.c 10.44 (Berkeley) 5/16/96@(#)cl_term.c 10.20 (Berkeley) 5/3/96@(#)cut.c 10.9 (Berkeley) 3/30/96@(#)delete.c 10.10 (Berkeley) 3/6/96@(#)ex.c 10.46 (Berkeley) 5/15/96@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96@(#)ex_append.c 10.27 (Berkeley) 4/27/96@(#)ex_args.c 10.14 (Berkeley) 4/27/96@(#)ex_argv.c 10.19 (Berkeley) 3/30/96@(#)ex_at.c 10.10 (Berkeley) 4/27/96@(#)ex_bang.c 10.32 (Berkeley) 5/18/96@(#)ex_cd.c 10.9 (Berkeley) 3/30/96@(#)ex_cmd.c 10.17 (Berkeley) 4/10/96@(#)ex_cscope.c 10.6 (Berkeley) 5/16/96@(#)ex_delete.c 10.8 (Berkeley) 3/6/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96@(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96@(#)ex_file.c 10.11 (Berkeley) 5/2/96@(#)ex_filter.c 10.33 (Berkeley) 4/27/96@(#)ex_global.c 10.20 (Berkeley) 5/3/96@(#)ex_init.c 10.22 (Berkeley) 5/15/96@(#)ex_join.c 10.9 (Berkeley) 3/6/96@(#)ex_map.c 10.9 (Berkeley) 3/6/96@(#)ex_mark.c 10.8 (Berkeley) 3/6/96@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96@(#)ex_move.c 10.9 (Berkeley) 3/6/96@(#)ex_open.c 10.7 (Berkeley) 3/6/96@(#)ex_perl.c 8.6 (Berkeley) 3/18/96@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96@(#)ex_print.c 10.18 (Berkeley) 5/12/96@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.31 (Berkeley) 5/8/96@(#)ex_screen.c 10.10 (Berkeley) 3/6/96@(#)ex_script.c 10.29 (Berkeley) 5/12/96/dev/ptyXX@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.33 (Berkeley) 4/27/96@(#)ex_shift.c 10.10 (Berkeley) 3/6/96@(#)ex_source.c 10.10 (Berkeley) 4/22/96@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.30 (Berkeley) 5/16/96@(#)ex_tag.c 10.32 (Berkeley) 5/16/96@(#)ex_tcl.c 8.9 (Berkeley) 4/28/96@(#)ex_txt.c 10.13 (Berkeley) 3/6/96@(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96@(#)ex_util.c 10.21 (Berkeley) 5/8/96@(#)ex_version.c 10.25 (Berkeley) 4/12/96@(#)ex_visual.c 10.12 (Berkeley) 4/27/96@(#)ex_write.c 10.25 (Berkeley) 5/8/96@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96@(#)exf.c 10.35 (Berkeley) 5/16/96@(#)getc.c 10.10 (Berkeley) 3/6/96@(#)key.c 10.30 (Berkeley) 4/3/96\^:   }) 00123456789abcdef01234567@(#)line.c 10.20 (Berkeley) 4/27/96@(#)log.c 10.8 (Berkeley) 3/6/96@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.43 (Berkeley) 5/15/96@(#)mark.c 10.12 (Berkeley) 3/30/96@(#)msg.c 10.36 (Berkeley) 5/15/96@(#)options.c 10.43 (Berkeley) 5/16/96@(#)options_f.c 10.23 (Berkeley) 5/4/96@(#)put.c 10.9 (Berkeley) 3/6/96@(#)recover.c 10.18 (Berkeley) 5/15/96@(#)screen.c 10.13 (Berkeley) 5/10/96@(#)search.c 10.24 (Berkeley) 5/26/96@(#)seq.c 10.10 (Berkeley) 3/30/96@(#)util.c 10.10 (Berkeley) 3/6/96@(#)v_at.c 10.8 (Berkeley) 4/27/96@(#)v_ch.c 10.8 (Berkeley) 3/6/96@(#)v_cmd.c 10.9 (Berkeley) 3/28/96@(#)v_delete.c 10.8 (Berkeley) 5/19/96@(#)v_ex.c 10.38 (Berkeley) 4/28/96@(#)v_increment.c 10.12 (Berkeley) 3/19/96@(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.13 (Berkeley) 4/27/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.7 (Berkeley) 3/6/96@(#)v_match.c 10.8 (Berkeley) 3/6/96@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96@(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.16 (Berkeley) 4/27/96@(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.16 (Berkeley) 5/8/96uX@(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/96@(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.66 (Berkeley) 5/18/96@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96@(#)v_undo.c 10.5 (Berkeley) 3/6/96@(#)v_util.c 10.10 (Berkeley) 3/6/96@(#)v_word.c 10.5 (Berkeley) 3/6/96@(#)v_xchar.c 10.8 (Berkeley) 3/6/96@(#)v_yank.c 10.9 (Berkeley) 5/19/96@(#)v_z.c 10.10 (Berkeley) 5/16/96@(#)v_zexit.c 10.6 (Berkeley) 4/27/96@(#)vi.c 10.47 (Berkeley) 5/18/96@(#)vs_line.c 10.18 (Berkeley) 5/13/96@(#)vs_msg.c 10.65 (Berkeley) 5/15/96|/-\@(#)vs_refresh.c 10.35 (Berkeley) 5/7/96@(#)vs_relative.c 10.11 (Berkeley) 5/13/96@(#)vs_smap.c 10.23 (Berkeley) 5/7/96@(#)vs_split.c 10.24 (Berkeley) 5/4/96$NetBSD: ping.c,v 1.47.2.1 1999/06/24 16:23:03 perry Exp $8Ad?A~8?6C-@$?ə?333333@@A.A.A.@Y?@@?6C-@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: rm.c,v 1.24 1998/07/28 11:41:51 mycroft Exp $$NetBSD: cmp.c,v 1.14 1998/10/09 02:00:39 enami Exp $$NetBSD: stat_flags.c,v 1.7 1999/01/03 01:30:10 lukem Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: ls.c,v 1.36 1999/02/17 15:28:09 kleink Exp $P.$NetBSD: print.c,v 1.26 1999/02/17 15:28:09 kleink Exp $$NetBSD: util.c,v 1.17 1999/02/17 15:28:09 kleink Exp $$NetBSD: map.c,v 1.9 1998/07/26 23:09:50 mycroft Exp $$NetBSD: misc.c,v 1.5 1997/10/20 01:07:52 lukem Exp $$NetBSD: set.c,v 1.7 1997/10/14 02:07:59 lukem Exp $$NetBSD: term.c,v 1.11 1998/08/25 20:59:42 ross Exp $@(#) Copyright (c) 1980, 1991, 1993 The Regents of the University of California. All rights reserved. $NetBSD: tset.c,v 1.8 1998/12/19 23:19:45 christos Exp $$NetBSD: wrterm.c,v 1.6 1997/10/20 01:07:55 lukem Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $NetBSD: disklabel.c,v 1.63.2.5 1999/06/22 14:37:43 perry Exp $/tmp/EdDk.aXXXXXX!pX$NetBSD: dkcksum.c,v 1.8 1997/09/14 08:50:18 lukem Exp $$NetBSD: interact.c,v 1.8 1998/11/12 16:19:48 christos Exp $ S S S S Tt S S T@ S` SX SP SH U S( S W RAA@@(#) Copyright (c) 1988, 1990, 1993 The Regents of the University of California. All rights reserved. $NetBSD: shutdown.c,v 1.34 1998/11/22 19:13:45 bad Exp $FPFP*0 XXX,,x<<$NetBSD: dkcksum.c,v 1.8 1997/09/14 08:50:18 lukem Exp $$NetBSD: getmntopts.c,v 1.5 1997/09/16 12:22:42 lukem Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: newfs.c,v 1.37 1999/01/19 19:34:50 tron Exp $ r r r r r rp rh r` rX rP rH r@ r8@ r0 r( @%s: can't read disk label; disk type must be specified$NetBSD: mkfs.c,v 1.35 1999/03/16 21:52:34 wrstuden Exp $>......@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: cp.c,v 1.27 1999/03/01 18:57:29 mjl Exp $ ֨$NetBSD: utils.c,v 1.17 1999/03/01 18:57:29 mjl Exp $$NetBSD: acu.c,v 1.7 1998/07/12 09:59:29 mrg Exp $$NetBSD: acutab.c,v 1.4 1997/11/22 07:28:40 lukem Exp $  P l ` b0 bx P R RX hP j@ j x z {D x z {D$NetBSD: cmds.c,v 1.13 1998/12/19 22:59:21 christos Exp $<< $NetBSD: cmdtab.c,v 1.4 1997/11/22 07:28:42 lukem Exp $!  L<  L>  tt p p X | @ $  C  c  |.  l  l  (  (s  ,? h 3# X $NetBSD: cu.c,v 1.6 1997/11/22 07:28:42 lukem Exp $$NetBSD: hunt.c,v 1.9 1998/07/12 09:59:30 mrg Exp $$NetBSD: log.c,v 1.8 1998/08/25 20:59:41 ross Exp $$NetBSD: partab.c,v 1.5 1997/11/22 07:28:44 lukem Exp $ !"$'(+-.03569:( p u 09  ( (9P  4 9   9 f 9  X 78  k : < <` ¸ 4 :(  :H p :p  < : : : zp : ¸ ; ;8  k ;P ¸ <` ¸ 4 ; x oX p; x oX h; ¸ `; p X;  P<(  H8 v` @<` ¸ 4 8<  ( (<  =   =8  l =p $ ?P m =  P =  =  >  t >( p u >8 p ud > > J >  P >h  > ¸ ? ¸ p ?(  ?P m p<  h?x  p `? ¸ X@  P@    H@8  lp @@X  8@  8 0@  kp (@  P @  h@ @  A  ( A(  9 fU$NetBSD: complete.c,v 1.21.2.1 1999/06/25 01:14:57 cgd Exp $$NetBSD: domacro.c,v 1.12 1998/06/04 08:28:35 lukem Exp $$NetBSD: fetch.c,v 1.52.2.3 1999/07/02 17:20:58 perry Exp $ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/$NetBSD: ftp.c,v 1.41.2.1 1999/06/22 21:02:42 perry Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.40.2.2 1999/06/25 01:15:32 cgd Exp $$NetBSD: ruserpass.c,v 1.21 1998/08/08 03:17:40 lukem Exp $iiihhh h$NetBSD: util.c,v 1.46.2.2 1999/06/25 01:15:42 cgd Exp $ KMGTP@YA.A.@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $NetBSD: route.c,v 1.30 1998/10/23 05:36:42 lukem Exp $0123456789abcdef0ϐpH0ΨΈhH ͠ pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD$NetBSD: show.c,v 1.8 1998/10/23 05:36:43 lukem Exp $PH80(      xph`XP@80 (!"#$%&'()*+,-$NetBSD: dir.c,v 1.25 1998/03/18 17:01:23 bouyer Exp $ ... ...$NetBSD: inode.c,v 1.30 1998/10/23 01:13:33 thorpej Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.33 1998/07/26 20:32:43 mycroft Exp $$NetBSD: pass1.c,v 1.21 1998/03/18 17:01:24 bouyer Exp $$NetBSD: pass1b.c,v 1.13 1998/03/18 17:01:24 bouyer Exp $$NetBSD: pass2.c,v 1.25 1998/10/23 01:13:33 thorpej Exp $$NetBSD: pass3.c,v 1.10 1997/09/16 16:45:19 lukem Exp $$NetBSD: pass4.c,v 1.14 1997/09/20 06:16:32 lukem Exp $$NetBSD: pass5.c,v 1.20 1998/08/25 19:18:15 ross Exp $$NetBSD: fsutil.c,v 1.7 1998/07/30 17:41:03 thorpej Exp $$NetBSD: setup.c,v 1.35 1998/11/12 16:19:48 christos Exp $$NetBSD: utilities.c,v 1.25 1998/05/06 02:45:09 mycroft Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@SSST@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $NetBSD: sync.c,v 1.9 1997/11/05 21:19:04 cgd Exp $$NetBSD: ar_io.c,v 1.13 1999/03/03 18:06:52 christos Exp $$NetBSD: ar_subs.c,v 1.11 1999/03/03 18:06:52 christos Exp $$NetBSD: buf_subs.c,v 1.9 1998/02/03 07:48:36 mycroft Exp $~ $NetBSD: cpio.c,v 1.8 1998/02/28 15:53:00 mrg Exp $$NetBSD: file_subs.c,v 1.10 1998/02/28 15:52:04 mrg Exp $$NetBSD: ftree.c,v 1.8 1998/07/28 17:44:24 mycroft Exp $$NetBSD: gen_subs.c,v 1.14 1998/11/04 19:37:56 christos Exp $$NetBSD: getoldopt.c,v 1.7 1997/11/01 06:58:44 lukem Exp $$NetBSD: options.c,v 1.19 1999/03/07 01:03:32 mycroft Exp $f fh5p 5:8':#! $,~<f`L% %''(#! $,~<fXn, ,/'0#! $,~<fPn,P,,//0#! $,~<fH( „h”$,8f@(΀d(„lh”$,~<$NetBSD: pat_rep.c,v 1.9 1999/03/24 17:00:23 pk Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $NetBSD: pax.c,v 1.9 1999/03/03 18:06:52 christos Exp $$NetBSD: sel_subs.c,v 1.11 1998/11/04 19:38:12 christos Exp $$NetBSD: tables.c,v 1.8.2.1 1999/07/07 00:01:45 perry Exp $$NetBSD: tar.c,v 1.14 1999/01/21 08:46:06 mycroft Exp $$NetBSD: tty_subs.c,v 1.7 1997/07/20 20:32:49 christos Exp $@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: ln.c,v 1.15 1998/07/28 05:31:25 mycroft Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: chown.c,v 1.19 1999/03/14 19:36:05 kleink Exp $@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount.c,v 1.45 1998/12/01 23:20:43 kenh Exp $@pX@80 @ @  ffs$NetBSD: vfslist.c,v 1.2 1997/09/16 12:22:47 lukem Exp $$NetBSD: alias.c,v 1.10 1998/05/20 00:27:56 christos Exp $$NetBSD: cd.c,v 1.26 1998/07/28 11:41:52 mycroft Exp $$NetBSD: error.c,v 1.20.2.1 1999/04/19 04:08:30 mycroft Exp $$NetBSD: eval.c,v 1.45.2.1 1999/07/01 15:20:58 perry Exp $PATH=$NetBSD: exec.c,v 1.26 1998/07/28 11:41:54 mycroft Exp $$NetBSD: expand.c,v 1.45.2.1 1999/04/07 17:24:02 he Exp $$NetBSD: histedit.c,v 1.20 1998/07/28 11:41:55 mycroft Exp $$NetBSD: input.c,v 1.31 1998/05/20 01:36:14 christos Exp $) $NetBSD: jobs.c,v 1.29.2.1 1999/04/19 04:07:53 mycroft Exp $$NetBSD: mail.c,v 1.12 1998/01/31 12:36:17 christos Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.33 1999/03/27 13:46:19 christos Exp $ $NetBSD: memalloc.c,v 1.21 1998/01/31 12:36:17 christos Exp $))$NetBSD: miscbltin.c,v 1.27 1998/09/26 19:28:12 christos Exp $$NetBSD: mystring.c,v 1.13 1997/07/04 21:02:15 christos Exp $$NetBSD: options.c,v 1.28 1998/07/28 11:41:57 mycroft Exp $ȨeȠfȐIȀixmpnhs`xXvPVHE8C(a buq$NetBSD: parser.c,v 1.42 1999/02/04 16:17:39 christos Exp $@=}-+?=$NetBSD: redir.c,v 1.20 1999/02/04 16:17:39 christos Exp $$NetBSD: show.c,v 1.17 1999/02/04 16:17:39 christos Exp $$NetBSD: trap.c,v 1.21 1999/03/27 13:46:19 christos Exp $$NetBSD: output.c,v 1.21 1998/01/31 12:37:55 christos Exp $def0123456789ABCDEF$NetBSD: var.c,v 1.22 1999/01/28 18:11:51 kleink Exp $$NetBSD: skeleton.c,v 1.14 1997/10/20 03:41:16 lukem Exp $$NetBSD: arith.y,v 1.12 1999/02/05 07:52:52 christos Exp $!!!!}mu=IUa!/   !"#$%&'()*+,-./012                                                                                     $NetBSD: arith_lex.l,v 1.10 1999/02/05 07:52:52 christos Exp $            @(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $NetBSD: mkdir.c,v 1.21 1998/10/13 20:11:42 scw Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $NetBSD: hostname.c,v 1.13 1998/07/28 05:31:24 mycroft Exp $$NetBSD: args.c,v 1.13 1998/07/28 03:47:15 mycroft Exp $$NetBSD: conv.c,v 1.8 1998/07/28 05:15:46 mycroft Exp $unblock and -DNO_CONV?@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: dd.c,v 1.12 1998/08/19 01:32:44 thorpej Exp $$NetBSD: misc.c,v 1.8 1998/07/28 05:31:23 mycroft Exp $$NetBSD: position.c,v 1.6 1997/07/25 06:46:24 phil Exp $@(#) Copyright (c) 1987, 1990, 1993 The Regents of the University of California. All rights reserved. $NetBSD: update.c,v 1.6 1997/10/17 13:59:42 lukem Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $NetBSD: umount.c,v 1.24 1998/04/17 01:19:42 fair Exp $$NetBSD: vfslist.c,v 1.2 1997/09/16 12:22:47 lukem Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $NetBSD: reboot.c,v 1.24 1998/10/09 18:50:35 is Exp $$NetBSD: test.c,v 1.20 1998/11/04 20:12:12 christos Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: pwd.c,v 1.11 1998/11/03 21:38:19 wsanchez Exp $$NetBSD: history.c,v 1.13 1999/03/06 00:17:25 mycroft Exp $_HiStOrY_V2_ /.editrc͘ά`̔Ɉh,@,p<$8$ʠ8@0HP`X@ܘߤ8ހtHݠ@~,~h~,4}T}|d|||x~,\0<4 FGIXHJ(DE8XH9(@OxP`HST:?ph6@07<>UXPX8(;Y=xhB ARQpM8 NCHhXV(WKxL0'&5`P, -%)P@04#xh.(1(3x/P82$*x+P@(xh P@   x XHpX8("xhP@(!  P@hX0 XH0 1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RYK"""Q"7I: UH""@""NG"PTW""D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""db80^H_v? fwdbck:CCCCCCCCCxC`CXCHC@C(C CCBBBBBBBBBBBhB`BHB@B0B(BBAAAAAAAAAAAhA`APAHA8A0AAA@@@@@@@@@@x@p@X@P@8@0@@?DDhD`DPDHD0D(DDCCDOAOBOCODaaiXiP@iHi@ʀi8iX@iP@iHi@ i8aiX@iPiHi@i8 =,A"'B" """"kkkxkpkhk` kX@kPkHk@k8k0k( k kkk kj@jjjjjj j@jjjjjjjxjpjhj`jXjPjH@j@@j8 j0j(j jjiiiiiiii i@iiii i@iiixipihi`$NetBSD: tokenizer.c,v 1.4 1998/12/12 20:08:23 christos Exp $$NetBSD: opendisk.c,v 1.4 1997/09/30 17:13:50 phil Exp $$NetBSD: logwtmp.c,v 1.8 1998/12/09 14:35:03 christos Exp $$NetBSD: logout.c,v 1.9 1998/08/10 02:47:35 perry Exp $$NetBSD: login_tty.c,v 1.7 1999/01/11 23:10:26 kleink Exp $$NetBSD: getrawpartition.c,v 1.3 1997/07/31 00:01:23 jtc Exp $$NetBSD: getmaxpartitions.c,v 1.3 1997/07/31 00:01:18 jtc Exp $$NetBSD: fparseln.c,v 1.6 1998/12/09 14:35:03 christos Exp $\\#$NetBSD: standout.c,v 1.7 1997/07/22 07:37:05 mikel Exp $$NetBSD: insertln.c,v 1.9 1998/02/03 19:12:27 perry Exp $$NetBSD: initscr.c,v 1.9 1998/02/03 19:12:26 perry Exp $$NetBSD: idlok.c,v 1.7 1997/07/22 07:36:45 mikel Exp $$NetBSD: delwin.c,v 1.8 1998/02/03 19:12:22 perry Exp $$NetBSD: clrtobot.c,v 1.9 1998/02/03 19:12:18 perry Exp $$NetBSD: addnstr.c,v 1.4 1997/07/22 07:36:23 mikel Exp $$NetBSD: addch.c,v 1.8 1997/07/22 07:36:22 mikel Exp $$NetBSD: addbytes.c,v 1.12 1998/02/03 19:12:16 perry Exp $ $NetBSD: setterm.c,v 1.10 1998/02/03 19:12:35 perry Exp $))))$)))) )))))X)@)))l))0))<)D)))))))()4))H)l)p)\)h)|))t)x)P)X))))@))))) ),)L)))))'()))))x)T)p)\))|)h)P)L)d)D)t)T)`)))`))))8),$NetBSD: scroll.c,v 1.9 1998/02/03 19:12:34 perry Exp $$NetBSD: longname.c,v 1.8 1998/02/03 19:12:28 perry Exp $$NetBSD: deleteln.c,v 1.9 1998/02/03 19:12:21 perry Exp $$NetBSD: clrtoeol.c,v 1.9 1998/02/03 19:12:18 perry Exp $$NetBSD: termcap.c,v 1.16 1999/03/22 03:26:43 abs Exp $$NetBSD: id_subwins.c,v 1.8 1998/02/03 19:12:25 perry Exp $$NetBSD: tty.c,v 1.10 1998/01/30 04:33:37 perry Exp $$NetBSD: tstp.c,v 1.12 1998/01/30 04:33:35 perry Exp $$NetBSD: refresh.c,v 1.10 1998/02/03 19:12:32 perry Exp $ $NetBSD: newwin.c,v 1.9 1998/02/03 19:12:30 perry Exp $$NetBSD: erase.c,v 1.10 1998/02/03 19:12:22 perry Exp $$NetBSD: curses.c,v 1.9 1997/07/22 07:36:34 mikel Exp $ՠ$NetBSD: cur_hash.c,v 1.6 1998/02/03 19:12:20 perry Exp $$NetBSD: cr_put.c,v 1.11 1998/08/19 00:20:59 thorpej Exp $$NetBSD: tputs.c,v 1.9 1999/02/02 12:34:56 christos Exp $5MS7) $NetBSD: tgoto.c,v 1.11 1998/10/14 13:51:37 agc Exp $$NetBSD: tscroll.c,v 1.4 1997/07/22 07:37:08 mikel Exp $$NetBSD: touchwin.c,v 1.8 1998/02/03 19:12:36 perry Exp $$NetBSD: putchar.c,v 1.7 1997/07/22 07:36:57 mikel Exp $$NetBSD: move.c,v 1.8 1998/02/03 19:12:28 perry Exp $$NetBSD: w_pow.c,v 1.5 1997/10/09 11:35:48 lukem Exp $$NetBSD: w_log.c,v 1.7 1997/10/09 11:35:36 lukem Exp $$NetBSD: w_fmod.c,v 1.7 1997/10/09 11:34:42 lukem Exp $$NetBSD: w_exp.c,v 1.7 1997/10/09 11:34:37 lukem Exp $@.B9I-0Q@.B9I-0Q$NetBSD: w_atan2.c,v 1.7 1997/10/09 11:34:07 lukem Exp $$NetBSD: s_ceil.c,v 1.9 1997/10/09 11:31:16 lukem Exp $~7<u~7<u$NetBSD: e_pow.c,v 1.10 1997/10/09 11:29:39 lukem Exp $???@>LC?@C@~7<unY?33333?mo?UUQ&M?t`A?͆Je?~(JEN?UUUUU>fl?Vj%,Ak>f7ir?.B9?.C \a l9<Ge+? :? >/[?Ge+?G`>T ]D???UUUUUU??G`>T ]D?Ge+C@?~(JEN?͆Je?t`A?UUQ&M?mo?33333@? >/[? :~7<u<Ge+nY?.C?.B9 \a l9>f7irоAk?Vj%,fl?UUUUU>@$NetBSD: e_atan2.c,v 1.10 1997/11/11 22:34:01 veego Exp $nY?!TD-?!TD-@ !TD-<&3\@ !TD- !TD-!TD-?!TD-?!TD-!TD-@|3!|3!<&3\$NetBSD: w_sqrt.c,v 1.7 1997/10/09 11:36:12 lukem Exp $$NetBSD: s_sin.c,v 1.8 1997/10/09 11:33:29 lukem Exp $$NetBSD: s_finite.c,v 1.9 1997/10/09 11:31:53 lukem Exp $$NetBSD: s_cos.c,v 1.8 1997/10/09 11:31:28 lukem Exp $$NetBSD: s_atan.c,v 1.9 1997/10/09 11:30:56 lukem Exp $?ݬgaO?!TD-?s ҁ?!TD-W}Z+=:Z|=:Z|Z+>W}*a?UUUUUI?$NetBSD: k_cos.c,v 1.9 1997/10/09 11:30:12 lukem Exp $??UUUUULVlQw>~OR>!Ľ龈8?龈8>!ľ~OR>VlQw?UUUUUL??$NetBSD: e_rem_pio2.c,v 1.9 1997/10/09 11:29:44 lukem Exp $?Ap?_0mȃ?!T@=дabc1=дa`;.ps;.9{% I?!T@=дabc1=дa`;.ps?_0mȃ?;.9{% IAp$NetBSD: e_log.c,v 1.10 1998/08/19 00:45:36 thorpej Exp $?.B=95yRDCP??.B=95yRD?Fd?I$"Y?UUUUU$NetBSD: e_fmod.c,v 1.9 1997/10/09 11:29:00 lukem Exp $?$NetBSD: e_exp.c,v 1.9 1997/10/09 11:28:53 lukem Exp $??~7<up@.B9I-0Q?.B.B=95yfl?Vj%,Ak>f7ir@.B9I-0Q?Ge+~7<u?>f7irоAk?Vj%,fl?UUUUU>@p$NetBSD: s_rint.c,v 1.9 1997/10/09 11:33:10 lukem Exp $C00$NetBSD: s_matherr.c,v 1.7 1997/10/09 11:32:53 lukem Exp $$NetBSD: s_lib_version.c,v 1.7 1997/10/09 11:32:40 lukem Exp $$NetBSD: k_rem_pio2.c,v 1.8 1997/10/09 11:30:18 lukem Exp $?!@>tD-p>pAp?@ ?$NetBSD: e_sqrt.c,v 1.9 1997/10/09 11:30:06 lukem Exp $?nY$NetBSD: s_scalbn.c,v 1.10 1998/08/19 00:45:37 thorpej Exp $CP<~7<unYCPnY<$NetBSD: s_floor.c,v 1.9 1997/10/09 11:32:01 lukem Exp $~7<u~7<u$NetBSD: s_copysign.c,v 1.9 1997/10/09 11:31:22 lukem Exp $$NetBSD: kvm_file.c,v 1.12 1999/04/01 09:57:00 veego Exp $$NetBSD: kvm_proc.c,v 1.30 1999/03/24 05:50:50 mrg Exp $$NetBSD: kvm.c,v 1.63 1999/04/01 09:53:09 mycroft Exp $$NetBSD: kvm_sparc.c,v 1.20 1999/02/01 09:15:35 mrg Exp $)$NetBSD: strptime.c,v 1.17.2.1 1999/04/29 14:39:43 perry Exp $$NetBSD: tcsetpgrp.c,v 1.4 1997/07/21 14:09:19 jtc Exp $$NetBSD: tcgetpgrp.c,v 1.4 1997/07/21 14:09:17 jtc Exp $$NetBSD: tcflush.c,v 1.5 1999/02/12 15:04:01 kleink Exp $$NetBSD: tcdrain.c,v 1.4 1997/07/21 14:09:14 jtc Exp $$NetBSD: cfsetspeed.c,v 1.3 1997/07/21 14:09:13 jtc Exp $$NetBSD: cfsetospeed.c,v 1.3 1997/07/21 14:09:13 jtc Exp $$NetBSD: cfsetispeed.c,v 1.3 1997/07/21 14:09:12 jtc Exp $$NetBSD: cfmakeraw.c,v 1.5 1998/08/18 07:51:45 msaitoh Exp $$NetBSD: cfgetospeed.c,v 1.3 1997/07/21 14:09:10 jtc Exp $$NetBSD: cfgetispeed.c,v 1.3 1997/07/21 14:09:10 jtc Exp $$NetBSD: swab.c,v 1.7 1998/02/03 18:49:26 perry Exp $$NetBSD: strspn.c,v 1.7 1998/02/03 18:49:24 perry Exp $$NetBSD: strcspn.c,v 1.7 1998/02/03 18:49:19 perry Exp $$NetBSD: bcopy.c,v 1.10 1998/03/26 23:53:36 cgd Exp $$NetBSD: strtok.c,v 1.8 1998/11/15 17:21:49 christos Exp $$NetBSD: strsignal.c,v 1.10 1998/11/15 17:21:49 christos Exp $$NetBSD: strmode.c,v 1.8 1998/02/03 18:49:20 perry Exp $$NetBSD: system.c,v 1.16 1998/11/15 17:13:52 christos Exp $$NetBSD: random.c,v 1.16 1998/11/15 17:13:51 christos Exp $192$f1]B; oH@tIk۰\YeT.h=y-Ckg.*ʈis]O5oQank6A?"˜*{" 'Gthh$NetBSD: getopt.c,v 1.13 1999/01/09 20:31:07 kleink Exp $$NetBSD: atof.c,v 1.9 1998/01/30 23:37:46 perry Exp $$NetBSD: atexit.c,v 1.10 1998/10/18 14:36:30 kleink Exp $$NetBSD: vprintf.c,v 1.7 1997/07/13 20:15:36 christos Exp $$NetBSD: setbuffer.c,v 1.7 1998/11/15 17:19:53 christos Exp $$NetBSD: setbuf.c,v 1.5 1997/07/13 20:15:25 christos Exp $$NetBSD: puts.c,v 1.8 1998/11/15 17:19:53 christos Exp $$NetBSD: mkdtemp.c,v 1.1 1998/07/27 16:13:01 mycroft Exp $$NetBSD: fscanf.c,v 1.6 1997/07/13 20:15:04 christos Exp $$NetBSD: fputc.c,v 1.8 1998/02/03 18:41:12 perry Exp $$NetBSD: fgetc.c,v 1.7 1998/01/19 07:38:43 jtc Exp $$NetBSD: auth_unix.c,v 1.14 1999/01/20 11:37:34 lukem Exp $$NetBSD: regexec.c,v 1.12 1998/12/08 13:41:43 drochner Exp $$NetBSD: regerror.c,v 1.12 1998/12/08 13:48:06 drochner Exp $$NetBSD: regcomp.c,v 1.13 1998/12/13 12:21:46 drochner Exp $$NetBSD: lshrdi3.c,v 1.5 1998/01/29 03:23:42 mouse Exp $$NetBSD: ashrdi3.c,v 1.5 1998/01/29 03:23:41 mouse Exp $$NetBSD: fixdfdi.c,v 1.3 1997/07/13 20:01:44 christos Exp $C$NetBSD: rcmd.c,v 1.30 1999/03/16 18:15:13 christos Exp $$NetBSD: ns_ntoa.c,v 1.8 1998/11/13 15:46:55 christos Exp $$NetBSD: ns_addr.c,v 1.8 1998/11/13 15:46:55 christos Exp $$NetBSD: linkaddr.c,v 1.9 1998/11/13 15:46:55 christos Exp $0123456789abcdef$NetBSD: iso_addr.c,v 1.8 1998/11/13 15:46:55 christos Exp $0123456789abcdef$NetBSD: inet_netof.c,v 1.6 1997/07/21 14:08:05 jtc Exp $$NetBSD: inet_makeaddr.c,v 1.7 1998/11/13 15:46:53 christos Exp $$NetBSD: inet_lnaof.c,v 1.6 1997/07/21 14:08:02 jtc Exp $$NetBSD: herror.c,v 1.14 1998/11/30 20:15:41 thorpej Exp $$NetBSD: getservbyport.c,v 1.6 1997/07/21 14:08:00 jtc Exp $$NetBSD: getservbyname.c,v 1.6 1997/07/21 14:08:00 jtc Exp $$NetBSD: getnetnamadr.c,v 1.13 1999/01/20 13:09:57 christos Exp $$NetBSD: gethnamaddr.c,v 1.14 1999/01/20 23:31:02 lukem Exp $gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef$NetBSD: setlocale.c,v 1.16 1998/11/13 15:49:04 christos Exp $CCCCCCC$NetBSD: bswap64.c,v 1.2 1999/01/18 20:36:32 christos Exp $$NetBSD: bswap32.c,v 1.1 1999/01/15 13:31:22 bouyer Exp $$NetBSD: bswap16.c,v 1.1 1999/01/15 13:31:22 bouyer Exp $$NetBSD: wait3.c,v 1.6 1997/07/21 14:07:49 jtc Exp $$NetBSD: wait.c,v 1.6 1997/07/21 14:07:48 jtc Exp $$NetBSD: vis.c,v 1.11 1998/11/13 15:49:29 christos Exp $$NetBSD: utime.c,v 1.8 1998/03/30 14:51:42 kleink Exp $$NetBSD: usleep.c,v 1.16 1997/11/24 19:56:32 kleink Exp $$NetBSD: unvis.c,v 1.14 1998/12/02 19:33:28 thorpej Exp $$NetBSD: uname.c,v 1.5 1998/08/18 23:52:31 thorpej Exp $$NetBSD: ttyname.c,v 1.15 1998/08/26 00:38:40 perry Exp $/dev/$NetBSD: __signame14.c,v 1.1 1998/11/30 20:45:40 thorpej Exp $$NetBSD: siginterrupt.c,v 1.9 1997/07/21 14:07:32 jtc Exp $$NetBSD: setmode.c,v 1.21 1999/03/16 18:13:46 christos Exp $$NetBSD: setjmperr.c,v 1.6 1997/07/13 19:46:14 christos Exp $$NetBSD: sethostname.c,v 1.8 1998/11/13 12:31:52 christos Exp $$NetBSD: raise.c,v 1.6 1997/07/13 19:46:10 christos Exp $$NetBSD: pwcache.c,v 1.12 1999/01/19 08:32:34 mycroft Exp $$NetBSD: popen.c,v 1.22 1998/07/18 05:04:35 lukem Exp $$NetBSD: nlist.c,v 1.13 1998/07/26 14:18:18 mycroft Exp $$NetBSD: isctype.c,v 1.14 1997/07/13 19:46:04 christos Exp $$NetBSD: initgroups.c,v 1.16 1999/03/31 12:19:32 lukem Exp $$NetBSD: __glob13.c,v 1.10 1999/02/07 12:19:37 lukem Exp $$NetBSD: getttyent.c,v 1.14 1999/01/15 18:47:49 tsarna Exp $$NetBSD: getpwent.c,v 1.40.2.2 1999/04/27 22:09:45 perry Exp $__YP!$NetBSD: getpass.c,v 1.12 1998/02/03 18:23:45 perry Exp $$NetBSD: getnetgrent.c,v 1.22 1999/01/22 03:25:31 lukem Exp $*netgroup: %m$NetBSD: getmntinfo.c,v 1.8 1998/02/26 03:08:13 perry Exp $$NetBSD: getlogin.c,v 1.9 1997/07/21 14:07:08 jtc Exp $$NetBSD: getloadavg.c,v 1.7 1997/07/21 14:07:08 jtc Exp $A$NetBSD: getgrouplist.c,v 1.9.2.1 1999/04/27 14:11:26 perry Exp $$NetBSD: getgrent.c,v 1.34.2.1 1999/04/27 14:10:58 perry Exp $$NetBSD: getbsize.c,v 1.10 1997/07/21 14:07:02 jtc Exp $$NetBSD: __fts13.c,v 1.15 1999/03/16 18:13:44 christos Exp $$NetBSD: fstab.c,v 1.19 1999/02/23 17:00:53 mrg Exp $: 0( $NetBSD: execv.c,v 1.4 1998/09/11 21:03:18 kleink Exp $$NetBSD: execlp.c,v 1.5 1997/11/23 01:16:47 enami Exp $$NetBSD: execl.c,v 1.6 1998/09/11 21:03:18 kleink Exp $$NetBSD: errx.c,v 1.3 1997/07/17 21:33:22 thorpej Exp $$NetBSD: disklabel.c,v 1.23 1999/01/19 06:24:08 abs Exp $($NetBSD: daemon.c,v 1.7 1997/07/21 14:06:51 jtc Exp $$NetBSD: basename.c,v 1.1 1997/11/02 16:48:28 kleink Exp $.$NetBSD: alarm.c,v 1.8 1998/11/12 15:36:16 christos Exp $$NetBSD: sigcompat.c,v 1.10 1998/09/27 13:21:28 christos Exp $$NetBSD: killpg.c,v 1.6 1998/02/02 06:26:38 perry Exp $$NetBSD: creat.c,v 1.6 1998/02/02 06:26:35 perry Exp $$NetBSD: yp_order.c,v 1.9 1999/01/31 20:46:12 christos Exp $$NetBSD: yp_match.c,v 1.12 1999/01/31 20:46:12 christos Exp $$NetBSD: tcsetattr.c,v 1.4 1997/07/21 14:09:18 jtc Exp $$NetBSD: strstr.c,v 1.8 1998/11/15 17:21:49 christos Exp $$NetBSD: __strsignal.c,v 1.17 1998/11/30 20:43:53 thorpej Exp $$NetBSD: strcoll.c,v 1.6 1998/01/30 23:38:29 perry Exp $$NetBSD: setenv.c,v 1.15 1998/11/15 17:13:51 christos Exp $$NetBSD: sscanf.c,v 1.9 1998/11/15 17:19:53 christos Exp $$NetBSD: setvbuf.c,v 1.12 1998/02/03 18:41:21 perry Exp $$NetBSD: ftell.c,v 1.11 1998/11/15 17:19:53 christos Exp $$NetBSD: regfree.c,v 1.9 1998/12/08 13:49:46 drochner Exp $$NetBSD: fixunsdfdi.c,v 1.5 1999/03/26 21:04:24 kristerw Exp $C=AA$NetBSD: res_query.c,v 1.22 1998/11/24 22:19:01 christos Exp $$NetBSD: res_debug.c,v 1.23 1998/11/15 17:40:36 christos Exp $yp$NetBSD: res_data.c,v 1.7 1998/07/26 11:32:24 mycroft Exp $$NetBSD: nsap_addr.c,v 1.7 1998/11/13 15:46:55 christos Exp $$NetBSD: inet_ntoa.c,v 1.7 1998/11/13 15:46:54 christos Exp $$NetBSD: inet_ntop.c,v 1.6 1998/01/06 05:01:22 perry Exp $%u.%u.%u.%u$NetBSD: getservent.c,v 1.6 1997/07/21 14:08:01 jtc Exp $$NetBSD: getprotoent.c,v 1.6 1997/07/21 14:07:58 jtc Exp $$NetBSD: getnetent.c,v 1.12 1998/01/06 05:01:18 perry Exp $$NetBSD: base64.c,v 1.4 1998/11/13 15:46:52 christos Exp $ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/$NetBSD: verrx.c,v 1.3 1997/07/17 21:33:24 thorpej Exp $$NetBSD: warn.c,v 1.3 1997/07/17 21:33:28 thorpej Exp $$NetBSD: waitpid.c,v 1.6 1997/07/21 14:07:50 jtc Exp $$NetBSD: syslog.c,v 1.22 1999/03/16 14:00:58 is Exp $$NetBSD: __siglist14.c,v 1.1 1998/11/30 20:45:40 thorpej Exp $$NetBSD: pw_scan.c,v 1.8 1998/11/13 12:31:50 christos Exp $$NetBSD: nlist_elf64.c,v 1.3 1997/07/13 19:46:08 christos Exp $$NetBSD: nlist_aout.c,v 1.8 1998/11/13 10:26:19 christos Exp $$NetBSD: getusershell.c,v 1.17 1999/01/25 01:09:34 lukem Exp $$NetBSD: getcwd.c,v 1.17 1999/03/26 22:23:57 sommerfe Exp $$NetBSD: getcap.c,v 1.29 1999/03/29 09:27:29 abs Exp $$NetBSD: execvp.c,v 1.11 1999/02/04 18:17:16 kleink Exp $$NetBSD: yp_first.c,v 1.10 1999/01/31 20:46:12 christos Exp $$NetBSD: strftime.c,v 1.8 1999/02/07 17:33:30 augustss Exp $$NetBSD: localtime.c,v 1.21 1998/11/15 17:11:06 christos Exp $WILDABBRGMTˀˀ$NetBSD: asctime.c,v 1.9 1998/10/08 12:18:18 kleink Exp $$NetBSD: rindex.c,v 1.9 1998/03/26 23:53:37 cgd Exp $$NetBSD: strsep.c,v 1.8 1998/10/13 20:32:09 kleink Exp $$NetBSD: strtoul.c,v 1.13 1998/11/15 17:13:52 christos Exp $$NetBSD: atol.c,v 1.7 1998/01/30 23:37:49 perry Exp $$NetBSD: sprintf.c,v 1.6 1997/07/13 20:15:29 christos Exp $$NetBSD: vsnprintf.c,v 1.9 1998/10/13 14:19:21 kleink Exp $$NetBSD: vfscanf.c,v 1.22 1998/11/15 17:19:53 christos Exp $$NetBSD: ungetc.c,v 1.9 1998/11/15 17:19:53 christos Exp $$NetBSD: rewind.c,v 1.8 1998/11/18 21:13:46 kleink Exp $$NetBSD: putc.c,v 1.7 1998/01/19 07:38:51 jtc Exp $$NetBSD: fseek.c,v 1.16 1998/11/15 17:19:53 christos Exp $$NetBSD: fputs.c,v 1.8 1998/11/15 17:19:53 christos Exp $$NetBSD: fgetln.c,v 1.7 1998/11/15 17:19:53 christos Exp $$NetBSD: clrerr.c,v 1.6 1998/01/19 07:38:41 jtc Exp $$NetBSD: floatdidf.c,v 1.4 1997/07/13 20:01:46 christos Exp $A$NetBSD: sethostent.c,v 1.10 1998/10/14 19:41:03 kleink Exp $$NetBSD: inet_network.c,v 1.7 1997/07/21 14:08:06 jtc Exp $#Id: hesiod.c,v 1.18.2.1 1997/01/03 20:48:20 ghudson Exp ##Id: hesiod_p.h,v 1.1 1996/12/08 21:39:37 ghudson Exp ##Id: hescompat.c,v 1.1.2.1 1996/12/16 08:37:45 ghudson Exp #$NetBSD: hesiod.c,v 1.9 1999/02/11 06:16:38 simonb Exp $,$NetBSD: vwarn.c,v 1.3 1997/07/17 21:33:25 thorpej Exp $$NetBSD: time.c,v 1.8 1998/09/07 15:26:18 kleink Exp $$NetBSD: stringlist.c,v 1.5 1997/09/29 06:52:40 enami Exp $$NetBSD: sleep.c,v 1.20 1998/11/13 12:31:52 christos Exp $$NetBSD: ypprot_err.c,v 1.3 1997/07/21 14:09:33 jtc Exp $$NetBSD: yplib.c,v 1.33 1999/01/31 20:46:12 christos Exp $  $NetBSD: xdryp.c,v 1.22 1999/01/31 20:46:12 christos Exp $$NetBSD: strcpy.c,v 1.10 1998/03/26 23:53:37 cgd Exp $$NetBSD: strcat.c,v 1.10 1998/03/26 23:53:37 cgd Exp $$NetBSD: strtouq.c,v 1.10 1998/11/15 17:13:52 christos Exp $$NetBSD: strtoq.c,v 1.11 1998/11/15 17:13:52 christos Exp $$NetBSD: wbuf.c,v 1.8 1998/02/03 18:41:24 perry Exp $$NetBSD: perror.c,v 1.20 1999/03/09 13:14:36 kleink Exp $$NetBSD: xdr_reference.c,v 1.12 1998/11/15 17:32:47 christos Exp $$NetBSD: clnt_tcp.c,v 1.18 1999/03/25 01:16:10 lukem Exp $$NetBSD: clnt_perror.c,v 1.16 1999/01/20 11:37:35 lukem Exp $$NetBSD: authunix_prot.c,v 1.9 1999/01/31 20:45:31 christos Exp $$NetBSD: muldi3.c,v 1.4 1998/02/03 18:31:39 perry Exp $$NetBSD: moddi3.c,v 1.5 1997/12/30 07:58:36 mikel Exp $$NetBSD: res_send.c,v 1.16 1998/11/15 17:40:38 christos Exp $$NetBSD: res_mkquery.c,v 1.14 1998/11/13 15:46:57 christos Exp $$NetBSD: res_init.c,v 1.23 1999/01/16 07:48:24 lukem Exp $/&$NetBSD: res_comp.c,v 1.13 1998/11/13 15:46:56 christos Exp $$NetBSD: inet_pton.c,v 1.9 1998/11/13 15:46:54 christos Exp $0123456789abcdef0123456789ABCDEF$NetBSD: gethostname.c,v 1.6 1998/05/06 19:48:39 kleink Exp $$NetBSD: getdomainname.c,v 1.7 1998/10/13 20:40:29 kleink Exp $$NetBSD: strpbrk.c,v 1.8 1998/11/15 17:21:49 christos Exp $$NetBSD: strncat.c,v 1.7 1998/02/03 18:49:21 perry Exp $$NetBSD: atoi.c,v 1.8 1998/01/30 23:37:48 perry Exp $$NetBSD: fgets.c,v 1.10 1998/11/15 17:15:18 christos Exp $$NetBSD: xdr_rec.c,v 1.16 1999/03/04 05:26:48 lukem Exp $$NetBSD: xdr_array.c,v 1.11 1999/01/20 11:37:40 lukem Exp $$NetBSD: send.c,v 1.7 1997/07/13 19:58:06 christos Exp $$NetBSD: strtol.c,v 1.13 1998/11/15 17:13:52 christos Exp $$NetBSD: pmap_getport.c,v 1.12 1999/03/25 01:16:11 lukem Exp $$NetBSD: pmap_prot.c,v 1.7 1998/02/13 05:52:27 lukem Exp $$NetBSD: clnt_udp.c,v 1.17 1999/03/25 01:16:11 lukem Exp $$NetBSD: bindresvport.c,v 1.14 1999/01/20 11:37:35 lukem Exp $$NetBSD: auth_none.c,v 1.11 1999/01/20 11:37:34 lukem Exp $$NetBSD: xdr_mem.c,v 1.14 1998/11/15 17:32:47 christos Exp $$NetBSD: rpc_prot.c,v 1.12 1999/01/31 20:45:31 christos Exp $$NetBSD: xdr.c,v 1.18 1998/11/15 17:32:46 christos Exp $$NetBSD: warnx.c,v 1.3 1997/07/17 21:33:30 thorpej Exp $$NetBSD: vwarnx.c,v 1.3 1997/07/17 21:33:27 thorpej Exp $$NetBSD: nsdispatch.c,v 1.9 1999/01/25 00:16:17 lukem Exp $$NetBSD: err.c,v 1.15 1997/07/17 21:33:21 thorpej Exp $$NetBSD: strcasecmp.c,v 1.9 1998/02/03 18:49:17 perry Exp $$NetBSD: bsearch.c,v 1.9 1998/11/15 17:13:51 christos Exp $$NetBSD: printf.c,v 1.6 1997/07/13 20:15:18 christos Exp $$NetBSD: fopen.c,v 1.6 1998/02/03 18:41:11 perry Exp $$NetBSD: nslexer.l,v 1.3 1999/01/25 00:16:17 lukem Exp $$NetBSD: verr.c,v 1.3 1997/07/17 21:33:23 thorpej Exp $($NetBSD: strerror.c,v 1.11 1998/11/15 17:21:49 christos Exp $$NetBSD: strdup.c,v 1.9 1998/10/13 20:27:55 kleink Exp $$NetBSD: exit.c,v 1.8 1998/10/18 14:36:30 kleink Exp $$NetBSD: fwrite.c,v 1.8 1998/11/15 17:19:53 christos Exp $$NetBSD: fread.c,v 1.9 1998/02/03 18:41:12 perry Exp $$NetBSD: fileno.c,v 1.7 1998/11/20 14:44:14 kleink Exp $$NetBSD: ferror.c,v 1.7 1998/11/20 14:44:14 kleink Exp $$NetBSD: __strerror.c,v 1.14 1998/11/15 17:21:49 christos Exp $$NetBSD: __errlist14.c,v 1.2 1999/03/22 19:03:39 kleink Exp $`$NetBSD: mmap.c,v 1.10 1998/11/15 17:23:00 christos Exp $$NetBSD: index.c,v 1.9 1998/03/26 23:53:36 cgd Exp $$NetBSD: strncpy.c,v 1.9 1998/03/26 23:53:37 cgd Exp $$NetBSD: qsort.c,v 1.10 1998/11/15 17:13:51 christos Exp $$NetBSD: opendir.c,v 1.17 1998/11/13 12:31:50 christos Exp $$NetBSD: closedir.c,v 1.7 1998/02/03 18:23:40 perry Exp $$NetBSD: strcmp.c,v 1.10 1998/03/26 23:53:37 cgd Exp $$NetBSD: merge.c,v 1.7 1998/11/15 17:13:51 christos Exp $$NetBSD: seekdir.c,v 1.6 1997/07/21 14:07:28 jtc Exp $$NetBSD: telldir.c,v 1.9 1998/02/28 12:57:28 enami Exp $$NetBSD: readdir.c,v 1.12 1998/11/13 12:31:51 christos Exp $$NetBSD: fdopen.c,v 1.8 1998/10/13 14:07:04 kleink Exp $$NetBSD: ftruncate.c,v 1.9 1998/11/15 17:23:00 christos Exp $$NetBSD: getc.c,v 1.7 1998/01/19 07:38:50 jtc Exp $$NetBSD: flags.c,v 1.9 1999/03/19 12:55:52 christos Exp $$NetBSD: fclose.c,v 1.10 1998/10/18 23:48:18 dbj Exp $$NetBSD: rget.c,v 1.7 1998/02/03 18:41:20 perry Exp $$NetBSD: refill.c,v 1.9 1998/02/03 18:41:19 perry Exp $$NetBSD: db.c,v 1.11 1998/12/09 12:42:48 christos Exp $$NetBSD: hash.c,v 1.15 1998/12/09 12:42:48 christos Exp $$NetBSD: bt_open.c,v 1.13 1998/12/09 12:42:46 christos Exp $$NetBSD: bt_get.c,v 1.9 1997/07/21 14:06:32 jtc Exp $$NetBSD: bt_conv.c,v 1.8 1998/12/09 12:42:46 christos Exp $$NetBSD: bt_close.c,v 1.9 1997/07/21 14:06:30 jtc Exp $$NetBSD: memcmp.c,v 1.9 1998/03/26 23:53:36 cgd Exp $$NetBSD: getenv.c,v 1.12 1998/11/15 17:13:51 christos Exp $$NetBSD: snprintf.c,v 1.8 1998/10/13 14:19:21 kleink Exp $$NetBSD: mkstemp.c,v 1.2 1998/07/27 16:05:07 mycroft Exp $$NetBSD: gettemp.c,v 1.3 1999/03/19 12:56:16 christos Exp $aa$NetBSD: hash_log2.c,v 1.7 1997/07/13 18:52:05 christos Exp $$NetBSD: hash_func.c,v 1.8 1998/12/09 12:42:50 christos Exp $58$NetBSD: hash_buf.c,v 1.8 1998/12/09 12:42:49 christos Exp $$NetBSD: bt_put.c,v 1.12 1998/12/09 12:42:47 christos Exp $$NetBSD: bt_delete.c,v 1.11 1999/03/16 18:17:56 christos Exp $$NetBSD: strncmp.c,v 1.10 1998/03/26 23:53:37 cgd Exp $$NetBSD: bt_split.c,v 1.10 1998/12/09 12:42:47 christos Exp $$NetBSD: bt_seq.c,v 1.11 1998/12/09 12:42:47 christos Exp $$NetBSD: bt_search.c,v 1.11 1998/12/09 12:42:47 christos Exp $$NetBSD: bt_utils.c,v 1.8 1997/07/13 18:52:00 christos Exp $$NetBSD: bt_overflow.c,v 1.9 1998/12/09 12:42:46 christos Exp $$NetBSD: bt_page.c,v 1.9 1997/10/10 21:08:53 is Exp $$NetBSD: mpool.c,v 1.10 1998/12/09 12:42:51 christos Exp $$NetBSD: pwrite.c,v 1.4 1998/11/15 17:23:00 christos Exp $$NetBSD: pread.c,v 1.4 1998/11/15 17:23:00 christos Exp $$NetBSD: calloc.c,v 1.9 1998/02/03 18:44:14 perry Exp $$NetBSD: abort.c,v 1.11 1998/10/12 15:56:16 kleink Exp $$NetBSD: fprintf.c,v 1.6 1997/07/13 20:15:00 christos Exp $$NetBSD: divdi3.c,v 1.4 1997/07/13 20:01:43 christos Exp $$NetBSD: signal.c,v 1.10 1998/10/16 12:47:45 kleink Exp $$NetBSD: memset.c,v 1.12 1998/08/09 22:48:11 wrstuden Exp $$NetBSD: vfprintf.c,v 1.30 1998/11/15 17:19:05 christos Exp $ 0000000000000000$NetBSD: fvwrite.c,v 1.11 1998/11/15 17:19:53 christos Exp $$NetBSD: umoddi3.c,v 1.3 1997/07/13 20:01:58 christos Exp $$NetBSD: udivdi3.c,v 1.3 1997/07/13 20:01:56 christos Exp $$NetBSD: qdivrem.c,v 1.6 1998/02/03 18:31:40 perry Exp $$NetBSD: isnan.c,v 1.4 1998/10/13 14:43:38 kleink Exp $$NetBSD: isinf.c,v 1.5 1998/11/14 19:31:02 christos Exp $$NetBSD: memchr.c,v 1.9 1998/03/26 23:53:36 cgd Exp $$NetBSD: strtod.c,v 1.32 1999/02/06 16:01:22 kleink Exp $?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?$NetBSD: multibyte.c,v 1.6 1997/07/13 20:16:48 christos Exp $$NetBSD: wsetup.c,v 1.7 1998/02/03 18:41:25 perry Exp $$NetBSD: makebuf.c,v 1.10 1998/11/15 17:16:27 christos Exp $$NetBSD: findfp.c,v 1.12 1998/11/15 17:19:53 christos Exp $)dPdP 8dP|$NetBSD: fflush.c,v 1.11 1998/02/03 18:41:07 perry Exp $$NetBSD: localeconv.c,v 1.9 1998/11/13 15:49:03 christos Exp $`݀$NetBSD: infinity.c,v 1.4 1998/11/14 19:31:02 christos Exp $$NetBSD: sysconf.c,v 1.9 1998/08/03 14:41:21 kleink Exp $$NetBSD: isatty.c,v 1.7 1998/10/13 15:05:02 kleink Exp $$NetBSD: ctype_.c,v 1.14 1997/07/13 19:45:45 christos Exp $ ((((( AAAAAABBBBBB @$NetBSD: tcgetattr.c,v 1.4 1997/07/21 14:09:16 jtc Exp $$NetBSD: bcopy.c,v 1.10 1998/03/26 23:53:36 cgd Exp $$NetBSD: malloc.c,v 1.16 1999/01/29 08:11:36 kleink Exp $$NetBSD: stdio.c,v 1.9 1998/11/15 17:19:53 christos Exp $$NetBSD: fwalk.c,v 1.7 1998/02/03 18:41:16 perry Exp $$NetBSD: getpagesize.c,v 1.7 1997/07/21 14:07:11 jtc Exp $$NetBSD: lseek.c,v 1.6 1998/10/14 11:25:19 kleink Exp $)$NetBSD: sysctl.c,v 1.8 1998/11/18 20:51:51 kleink Exp $$NetBSD: bcopy.c,v 1.10 1998/03/26 23:53:36 cgd Exp $$NetBSD: skeleton.c,v 1.14 1997/10/20 03:41:16 lukem Exp $$NetBSD: nsparser.y,v 1.3 1999/01/25 00:16:18 lukem Exp $            ]:[= $NetBSD: scandir.c,v 1.14 1998/11/13 12:31:51 christos Exp $$NetBSD: rec_open.c,v 1.11 1998/05/07 19:24:21 kleink Exp $$NetBSD: rec_seq.c,v 1.9 1997/07/21 14:06:47 jtc Exp $$NetBSD: rec_get.c,v 1.10 1997/07/21 14:06:44 jtc Exp $$NetBSD: rec_delete.c,v 1.11 1998/12/09 12:42:51 christos Exp $$NetBSD: rec_close.c,v 1.10 1998/08/18 23:50:09 thorpej Exp $$NetBSD: rec_utils.c,v 1.8 1997/07/13 18:52:15 christos Exp $$NetBSD: rec_search.c,v 1.9 1997/07/21 14:06:46 jtc Exp $$NetBSD: hash_page.c,v 1.13 1998/12/09 12:42:50 christos Exp $$NetBSD: ashldi3.c,v 1.5 1998/01/29 03:23:40 mouse Exp $$NetBSD: hash_bigkey.c,v 1.9 1998/12/09 12:42:49 christos Exp $$NetBSD: rec_put.c,v 1.11 1998/12/09 12:42:51 christos Exp $# $NetBSD: protocols,v 1.8 1998/09/14 21:09:51 hwr Exp $ # # Internet (IP) protocols # # originally from: @(#)protocols 8.1 (Berkeley) 6/9/93 # see http://www.isi.edu/in-notes/iana/assignments/protocol-numbers # likely to move to http://www.iana.org/ one of these days # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # internet group management protocol ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol egp 8 EGP # exterior gateway protocol pup 12 PUP # PARC universal packet protocol udp 17 UDP # user datagram protocol hmp 20 HMP # host monitoring protocol xns-idp 22 XNS-IDP # Xerox NS IDP rdp 27 RDP # reliable data protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol Class 4 xtp 36 XTP # Xpress Tranfer Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport ipv6 41 IPv6 # Internet Protocol, version 6 rsvp 46 RSVP # Resource ReSerVation Protocol gre 47 GRE # General Routing Encapsulation esp 50 ESP # Encapsulating Security Payload ah 51 AH # Authentication Header mobile 55 MOBILE # IP Mobility (IP tunneling) ipv6-icmp 58 IPv6-ICMP # ICMP version 6 iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport ospf 89 OSPFIGP # Open Shortest Path First IGP ipip 94 IPIP # Yet Another IP encapsulation encap 98 ENCAP # RFC1241 encapsulation pim 103 PIM # Protocol Independent Multicast ippcp 108 IPPCP # IP Payload Compression Protocol echo "" echo "The host table is as follows:" echo "" cat /tmp/hosts echo "" echo "You may want to edit the host table in the event that" echo "you need to mount an NFS server." echo -n "Would you like to edit the host table? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/hosts ;; *) ;; esac cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. If you do change the default route, and wish for that change to carry over to the installed system, execute the following command at the shell prompt: echo > /tmp/mygate where is the IP address of the default router. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 elif [ "$_mp" = "swap" ]; then echo /dev/$_dev none swap sw 0 0 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. You may also wish to take this opportunity to place NFS mounts in the fstab. This would be especially useful if you plan to keep '/usr' on an NFS server. __fstab_config_1 echo -n "Edit the fstab? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done install_sets # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab ifconfig.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done # Enable rc.conf if [ -e /mnt/etc/rc.conf ]; then cp /mnt/etc/rc.conf /tmp sed 's/^rc_configured=NO/rc_configured=YES/' /tmp/rc.conf \ > /mnt/etc/rc.conf fi # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link..." else echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." fi if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." else echo -n "Making devices..." pid=`twiddle` cd /mnt/dev sh MAKEDEV all kill $pid echo "done." fi md_copy_kernel md_installboot ${ROOTDISK} ) unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 4h= 4D4K4S4]4g4v4484<444444444!434C4LP4d4x4 p4 p4 p4 H44p4444h4p4_dvma_mapin_block_count_opf_romp.urem_bcopy_devopen_obp_close.udiv_pgofset_netif_debug_freelist_printf_putchar_oldmon_iclosestart_io_vsnprintf_obp_v0_strategy_obp_v2_strategy_sparc_noop_oldmon_strategy_closeall_vprintf_block_size_promops__rtt_dvma_init_dvma_free_prom_si_prom_bootdevice_cputyp_pgshift_panic_progname_etext_prom_init_oldmon_iopen_obp_v2_devsw_block_table_dvma_mapout_oldmon_close_loadboot_prom_halt_romp_errno_nbpg_oldmon_devsw_main_free_debug_close_alloc_edata_obp_v0_devsw_end_dvma_alloc___main_filessrt0.ois_sun4is_sun4cmpromdev.ogcc2_compiled.___gnu_compiled_c_saveecho_promdev_inuse_oldmon_mapin_oldmon_mapinfo_oldmon_mapinfo_cnt_prom_devmapdvma.ogcc2_compiled.___gnu_compiled_cpromlib.ogcc2_compiled.___gnu_compiled_c_obp_v2_putchar_obp_v2_seek_obp_v0_getbootpath_obp_v2_getbootpathbootxx.ogcc2_compiled.___gnu_compiled_calloc.opanic.ocloseall.oprintf.oclose.osubr_prf.o__main.ourem.oudiv.o# $NetBSD: services,v 1.31 1999/02/14 00:43:38 lukem Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 8.2 (Berkeley) 3/26/95 # tcpmux 1/tcp # TCP port multiplexer (RFC1078) echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp # File Transfer Protocol ssh 22/tcp # Secure Shell ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp # name-domain server domain 53/udp mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp # Trivial File Transfer Protocol gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink kerberos 88/tcp krb5 # Kerberos v5 kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp # Remote Procedure Call sunrpc 111/udp auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap2 143/tcp # Interim Mail Access Proto v2 imap2 143/udp snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp mailq 174/tcp # zmailer MTA xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp nip 376/tcp # Amiga Envoy Net Inquiry Prot. nip 376/udp # Amiga Envoy Net Inquiry Prot. ldap 389/tcp # Lightweight Directory Access Protocol ldap 389/udp # Lightweight Directory Access Protocol # # UNIX specific services # exec 512/tcp # Remote execution biff 512/udp comsat # Biff the dog login 513/tcp # Remote login who 513/udp whod # Remote who shell 514/tcp cmd # Remote command shell syslog 514/udp # System logger printer 515/tcp spooler # line printer spooler talk 517/udp # Talk protocols ntalk 518/udp route 520/udp router routed # RIP timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon rdist 541/tcp rdistd # rdist daemon afpovertcp 548/tcp # AppleshareIP protocol afpovertcp 548/udp # AppleshareIP protocol remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # ldaps 636/tcp # ldap protocol over TLS/SSL (was sldap) ldaps 636/udp # ldap protocol over TLS/SSL (was sldap) # webster 765/tcp # Network dictionary webster 765/udp # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp cvspserver 2401/tcp cvspserver 2401/udp rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. # klogin 543/tcp # Kerberos `rlogin' kshell 544/tcp krcmd # Kerberos `rsh' kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos4 750/udp kdc # Kerberos (server) udp kerberos4 750/tcp kdc # Kerberos (server) tcp kerberos-master 751/udp # Kerberos admin server udp kerberos-master 751/tcp # Kerberos admin server tcp krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' eklogin 2105/tcp # Kerberos encrypted `rlogin' # # Unofficial but necessary (for NetBSD) services # supfilesrv 871/tcp # SUP server supfiledbg 1127/tcp # SUP debugging # # other common ports # nfs 2049/udp nfsd # Sun NFS nfs 2049/tcp nfsd # Sun NFS X11 6000/tcp # X Window System ircd 6667/tcp # Often used IRC port (also see 194) hunt 26740/udp # multi-player/multi-host maze-wars # # Netatalk (in-kernel Appletalk) services # Note: The running kernel must be configured with "options NETATALK" # and software not included in NetBSD, such as Netatalk version 1.4b2 # or later, must be used to take advantage of these services. # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol , ...#!/bin/sh # $NetBSD: install.sub,v 1.25.2.4 1999/07/02 16:40:06 perry Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation/upgrade script - common subroutines. ROOTDISK="" # filled in below VERSION=141 export VERSION ALLSETS="base comp etc games man misc text" # default install sets UPGRSETS="base comp games man misc text" # default upgrade sets THESETS= # one of the above local_sets_dir="" # Path searched for sets by install_sets # on the local filesystems # decide upon an editor if [ X$EDITOR = X ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi fi getresp() { read resp if [ "X$resp" = "X" ]; then resp=$1 fi } isin() { # test the first argument against the remaining ones, return succes on a match _a=$1; shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } rmel() { # remove first argument from list formed by the remaining arguments local _a _a=$1; shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1"; fi shift done } cutword () { # read a line of data, return Nth element. local _a local _n local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi eval echo \$$_n } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { # return first character of argument local _a _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir local _file _dir=$1; shift for _file in $* do if [ -f $_dir/${_file}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}.tgz ]; then return 0 fi # Try for split files if [ -f $_dir/${_file}${VERSION}.aa ]; then return 0 fi done return 1 } twiddle() { # spin the propeller so we don't get bored while : ; do sleep 1; echo -n "/"; sleep 1; echo -n "-"; sleep 1; echo -n "\\"; sleep 1; echo -n "|"; done > /dev/tty & echo $! } get_localdir() { # $1 is relative mountpoint local _mp local _dir _mp=$1 _dir= while : ; do echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __get_reldir_1 The directory \"$local_sets_dir\" does not exist, or does not hold any of the upgrade sets. __get_reldir_1 echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir="" break ;; esac fi done } getrootdisk() { cat << \__getrootdisk_1 The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the standalone installation program. Available disks are: __getrootdisk_1 _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo "" echo -n "Which disk is the root disk? " getresp "" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo "" echo "The disk $resp does not exist." ROOTDISK="" fi } labelmoredisks() { cat << \__labelmoredisks_1 You may label the following disks: __labelmoredisks_1 echo "$_DKDEVS" echo "" echo -n "Label which disk? [done] " getresp "done" case "$resp" in done) ;; *) if isin $resp $_DKDEVS ; then md_labeldisk $resp else echo "" echo "The disk $resp does not exist." fi ;; esac } addhostent() { # $1 - IP address # $2 - symbolic name # Create an entry in the hosts table. If no host table # exists, create one. If the IP address already exists, # replace it's entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/^$1 /d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2 $2.$FQDN" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface link-layer medium # $6 - (optional) interface link-layer directives local _m _m="" if [ "$5" != "" ]; then _m="media $5" fi # Create a ifconfig.* file for the interface. echo "inet $2 netmask $4 $_m $6" > /tmp/ifconfig.$1 addhostent $3 $2 } configurenetwork() { local _ifsdone local _ifs # _IFS=`md_get_ifdevs` _IFS=`ifconfig -l | sed ' s/lo0// s/ppp[0-9]//g s/sl[0-9]//g s/tun[0-9]//g'` _ifsdone="" resp="" # force at least one iteration while [ "X${resp}" != X"done" ]; do cat << \__configurenetwork_1 You may configure the following network interfaces (the interfaces marked with [X] have been succesfully configured): __configurenetwork_1 for _ifs in $_IFS; do if isin $_ifs $_ifsdone ; then echo -n "[X] " else echo -n " " fi echo $_ifs done echo "" echo -n "Configure which interface? [done] " getresp "done" case "$resp" in "done") ;; *) _ifs=$resp if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" fi else echo "Invalid response: \"$resp\" is not in list" fi ;; esac done } configure_ifs() { local _up local _interface_name local _interface_ip local _interface_mask local _interface_symname local _interface_extra local _interface_mediumtype local _interface_supported_media local _m local _t _interface_name=$1 _up=DOWN if isin $_interface_name `ifconfig -l -u` ; then _up=UP fi _interface_supported_media=`ifconfig -m $_interface_name | sed -n ' /^[ ]*media autoselect/d 4,$s/[ ]*media //p'` # get current "media" "ip" and "netmask" ("broadcast") _t=`ifconfig $_interface_name | sed -n ' s/^[ ]*media: [^ ]* \([^ ][^ ]*\).*/\1/p'` if [ "$_t" != "manual" -a "$_t" != "media:" -a "$_t" != "autoselect" ]; then _interface_mediumtype=$1 fi set -- `ifconfig $_interface_name | sed -n ' /^[ ]*inet/{ s/inet// s/--> [0-9.][0-9.]*// s/netmask// s/broadcast// p;}'` _interface_ip=$1 _interface_mask=$2 # Get IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "IP address? [$_interface_ip] " getresp "$_interface_ip" _interface_ip=$resp done # Get symbolic name resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Symbolic (host) name? " getresp "" _interface_symname=$resp done # Get netmask resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Netmask? [$_interface_mask] " getresp "$_interface_mask" _interface_mask=$resp done echo "Your network interface might require explicit selection" echo "of the type of network medium attached. Supported media:" echo "$_interface_supported_media" echo -n "Additional media type arguments (none)? [$_interface_mediumtype] " getresp "$_interface_mediumtype" _m="" if [ "X${resp}" != X"" -a "X${resp}" != Xnone ]; then _interface_mediumtype=$resp _m="media ${resp}" fi echo "Your network interface might require additional link-layer" echo "directives (like \`link0'). If this is the case you can enter" echo "these at the next prompt." echo "" echo -n "Additional link-layer arguments (none)? [$_interface_extra] " getresp "$_interface_extra" if [ "X${resp}" != X"" -a "X${resp}" != Xnone ]; then _interface_extra=$resp fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ $_up != "UP" ]; then ifconfig ${_interface_name} down if ifconfig ${_interface_name} inet \ ${_interface_ip} \ netmask ${_interface_mask} \ ${_interface_extra} ${_m} up ; then addifconfig \ "${_interface_name}" \ "${_interface_symname}" \ "${_interface_ip}" \ "${_interface_mask}" \ "${_interface_mediumtype}" \ "${_interface_extra}" return 0 fi else echo "Interface ${_interface_name} is already active." echo "Just saving configuration on new root filesystem." addifconfig \ "${_interface_name}" \ "${_interface_symname}" \ "${_interface_ip}" \ "${_interface_mask}" \ "${_interface_mediumtype}" \ "${_interface_extra}" fi return 1 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Set up the hostname. if [ ! -f /mnt/etc/myname ]; then echo "ERROR: no /etc/myname!" return 1 fi hostname=`cat /mnt/etc/myname` hostname $hostname # configure all the interfaces which we know about. if [ -f /mnt/etc/rc.conf ]; then ( # assume network interface configuration style 1.2D and up . /mnt/etc/rc.conf if [ "$net_interfaces" != NO ]; then if [ "$auto_ifconfig" = YES ]; then tmp="`ifconfig -l`" else tmp="$net_interfaces" fi echo -n "configuring network interfaces:" for i in $tmp; do eval `echo 'args=$ifconfig_'$i` if [ ! -z "$args" ]; then echo -n " $i" ifconfig $i $args elif [ -f /mnt/etc/ifconfig.$i ]; then echo -n " $i" (while read args; do ifconfig $i $args done) < /mnt/etc/ifconfig.$i elif [ "$auto_ifconfig" != YES ]; then echo echo -n "/mnt/etc/ifconfig.$i missing" echo -n "& ifconfig_$i not set" echo "; interface $i can't be configured" fi done echo "." fi ) else ( tmp="$IFS" IFS="$IFS." set -- `echo /mnt/etc/hostname*` IFS=$tmp unset tmp while [ $# -ge 2 ] ; do shift # get rid of "hostname" ( read af name mask bcaddr extras read dt dtaddr if [ ! -n "$name" ]; then echo "/etc/hostname.$1: invalid network configuration file" exit fi cmd="ifconfig $1 $af $name " if [ "${dt}" = "dest" ]; then cmd="$cmd $dtaddr"; fi if [ -n "$mask" ]; then cmd="$cmd netmask $mask"; fi if [ -n "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr"; fi cmd="$cmd $extras" $cmd ) < /mnt/etc/hostname.$1 shift done ) fi # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route add $hostname localhost # /etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route add default `cat /mnt/etc/mygate` fi # enable the resolver, if appropriate. if [ -f /mnt/etc/resolv.conf ]; then _resolver_enabled="TRUE" cp /mnt/etc/resolv.conf /tmp/resolv.conf.shadow fi # Display results... echo "Network interface configuration:" ifconfig -a echo "" if [ "X${_resolver_enabled}" = X"TRUE" ]; then netstat -r echo "" echo "Resolver enabled." else netstat -rn echo "" echo "Resolver not enabled." fi return 0 } install_ftp() { local _f local _sets local _next # Build a script to extract valid files from a list # of filenames on stdin. # XXX : Can we use this on more places? Leo. echo "#!/bin/sh" > /tmp/fname_filter.sh echo "while read line; do" >> /tmp/fname_filter.sh echo " case \$line in" >> /tmp/fname_filter.sh for _f in $THESETS; do echo " $_f.tar.gz|$_f.tgz|$_f.${VERSION}.aa)" \ >> /tmp/fname_filter.sh echo ' echo -n "$line ";;' \ >> /tmp/fname_filter.sh done echo " *) ;;" >> /tmp/fname_filter.sh echo " esac" >> /tmp/fname_filter.sh echo "done" >> /tmp/fname_filter.sh # Get several parameters from the user, and create # a shell script that directs the appropriate # commands into ftp. cat << \__install_ftp_1 This is an automated ftp-based installation process. You will be asked several questions. The correct set of commands will be placed in a script that will be fed to ftp(1). __install_ftp_1 # Get server IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP? [${_ftp_server_ip}] " getresp "${_ftp_server_ip}" _ftp_server_ip=$resp done # Get login name resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Password? " stty -echo getresp "" echo "" stty echo _ftp_server_password=$resp done cat << \__install_ftp_2 You will be asked to enter the name of the directory that contains the installation sets. When you enter a '?' you will see a listing of the current directory on the server. __install_ftp_2 _sets="" while [ -z "$_sets" ] do resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server directory? [${_ftp_server_dir}] " getresp "${_ftp_server_dir}" if [ "X$resp" = 'X?' -a -z "$_ftp_server_dir" ]; then resp="" fi done if [ $resp != '?' ]; then _ftp_server_dir=$resp fi # Build the basics of an ftp-script... echo "#!/bin/sh" > /tmp/ftp-script.sh echo "cd /mnt" >> /tmp/ftp-script.sh echo "ftp -e -i -n $_ftp_server_ip << \__end_commands" >> \ /tmp/ftp-script.sh echo "user $_ftp_server_login $_ftp_server_password" >> \ /tmp/ftp-script.sh echo "bin" >> /tmp/ftp-script.sh echo "cd $_ftp_server_dir" >> /tmp/ftp-script.sh # Make a copy of this script that lists the directory # contents, and use that to determine the files to get. cat /tmp/ftp-script.sh > /tmp/ftp-dir.sh echo "ls" >> /tmp/ftp-dir.sh echo "quit" >> /tmp/ftp-dir.sh echo "__end_commands" >> /tmp/ftp-dir.sh if [ $resp = '?' ]; then sh /tmp/ftp-dir.sh else _sets=`sh /tmp/ftp-dir.sh | sh /tmp/fname_filter.sh` fi done rm -f /tmp/ftp-dir.sh /tmp/fname_filter.sh while : ; do echo "The following sets are available for extraction:" echo "(marked sets have already been extracted)" echo "" _next="" for _f in $_sets ; do if isin $_f $_setsdone; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f; fi fi echo $_f done echo "" # Get name of the file and add extraction command # to the ftp-script. if [ "X$_next" = "X" ]; then resp=n; else resp=y; fi echo -n "Continue to add filenames [$resp]? " getresp "$resp" if [ "$resp" = "n" ]; then break fi echo -n "File name [$_next]? " getresp "$_next" if isin $resp $_sets; then echo "get $resp |\"pax -zrvpe\"" >> \ /tmp/ftp-script.sh _setsdone="$resp $_setsdone" else echo "You entered an invalid filename." echo "" fi done echo "quit" >> /tmp/ftp-script.sh echo "__end_commands" >> /tmp/ftp-script.sh sh /tmp/ftp-script.sh rm -f /tmp/ftp-script.sh echo "Extraction complete." } install_from_mounted_fs() { # $1 - directory containing installation sets local _filename local _sets local _next local _all local _f local _dirname _dirname=$1 _sets="" echo "" echo "The directory at the mount point, \"${_dirname}\", contains: " echo "" ls -F ${_dirname} echo "" echo "Enter the subdirectory relative to the mountpoint, that" echo -n "contains the savesets: [try this directory] " getresp "" if [ "X${resp}" != "X" ]; then _dirname=${_dirname}/$resp fi while ! dir_has_sets ${_dirname} $THESETS; do echo "" echo -n "There are no NetBSD install sets available in " echo "\"${_dirname}\"." echo "\"${_dirname}\" contains: " echo "" ls -F ${_dirname} echo "" echo -n "Enter subdirectory: [try other install media] " getresp "" if [ "X${resp}" = "X" ]; then return fi if [ ! -d ${_dirname}/${resp} ]; then echo "\"${resp}\" is no directory; try again." else _dirname=${_dirname}/$resp fi done for _f in $THESETS ; do if [ -f ${_dirname}/${_f}.tar.gz ]; then _sets="$_sets ${_f}.tar.gz" elif [ -f ${_dirname}/${_f}.tgz ]; then _sets="$_sets ${_f}.tgz" elif [ -f ${_dirname}/${_f}${VERSION}.aa ]; then _sets="$_sets ${_f}${VERSION}" fi done while : ; do echo "The following sets are available for extraction:" echo "(marked sets have already been extracted)" echo "" _next="" _all="" for _f in $_sets ; do if isin $_f $_setsdone; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f; fi _all="$_all $_f" fi echo $_f done echo "" # Get the name of the file. if [ "X$_next" = "X" ]; then resp=n; else resp=y; fi echo -n "Continue extraction [$resp]?" getresp "$resp" if [ "$resp" = "n" ]; then break fi echo -n "File name(s) (or "all") [$_next]? " getresp "$_next" if [ "x$resp" = xall ]; then resp="$_all" fi for _f in $resp; do _filename="/${_dirname}/$_f" # Ensure file exists if [ ! -f $_filename ]; then if [ -f ${_filename}.aa ]; then _filename=${_filename}.\?\? else echo "File $_filename does not exist. Check to make" echo "sure you entered the information properly." continue 2 fi fi # Extract file echo "Extracting the $_f set:" cat $_filename | (cd /mnt; pax -zrvpe) echo "Extraction complete." _setsdone="$_f $_setsdone" done done } install_cdrom() { local _drive local _partition_range local _partition local _fstype local _directory # Get the cdrom device info cat << \__install_cdrom_1 The following CD-ROM devices are installed on your system; please select the CD-ROM device containing the partition with the installation sets: __install_cdrom_1 _CDDEVS=`md_get_cddevs` echo "$_CDDEVS" echo "" echo -n "Which is the CD-ROM with the installation media? [abort] " getresp "abort" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo "" echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # Get partition _partition_range=`md_get_partition_range` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [a] " getresp "a" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__install_cdrom_2 There are two CD-ROM filesystem types currently supported by this program: 1) ISO-9660 (cd9660) 2) Berkeley Fast Filesystem (ffs) __install_cdrom_2 resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the CD-ROM if ! mount -t ${_fstype} -o ro \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi install_from_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive local _partition_range local _partition local _fstype local _fsopts local _directory local _md_fstype local _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo "" echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition _partition_range=`md_get_partition_range` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [d] " getresp "d" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__mount_a_disk_2 The following filesystem types are supported: 1) ffs __mount_a_disk_2 _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ ! -z "$_md_fstype" ]; then echo " 2) $_md_fstype" else _md_fstype="_undefined_" fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [ffs] " getresp "ffs" case "$resp" in ffs) _fstype=$resp _fsopts="ro" ;; $_md_fstype) _fstype=$resp _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the disk if ! mount -t ${_fstype} -o $_fsopts \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << \__install_disk_1 Ok, lets install from a disk. The file-system the install sets on may already mounted, or we might have to mount the filesystem to get to it. __install_disk_1 echo -n "Is the file-system with the install sets already mounted? [n] " getresp "n" case $resp in y*|Y*) echo "What mount point are the sets located in? [] " getresp "" if [ -d "$resp" ]; then install_from_mounted_fs $resp else echo "$resp: Not a directory, aborting..." fi return ;; *) ;; esac cat << \__install_disk_2 The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __install_disk_2 _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo "" echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi install_from_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP address? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport (only works with capable NFS server)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-T" ;; *) _nfs_tcp="" ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi install_from_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << \__install_tape_1 The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __install_tape_1 _tape=`basename $TAPE` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=`basename $resp` TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=`expr $resp - 1` ;; *) echo "Invalid file number ${resp}." resp="" # fore loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << \__install_tape_2 There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __install_tape_2 resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="pax -zrvpe" ;; 2) _xcmd="tar -rvpe" ;; *) echo "Invalid response: $resp." resp="" # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a local _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediatly. # if [ ! -e /usr/share/zoneinfo -a ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath="" fi cat << \__get_timezone_1 Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "MET" or "GMT-6". Other zones are grouped by continent, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __get_timezone_1 if [ X$TZ = X ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#/usr/share/zoneinfo/} fi while :; do echo -n "What timezone are you in [\`?' for list] [$TZ]? " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone [\`?' for list]: " getresp "" case "$resp" in "?") ls ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then TZ="$_a" echo "You have selected timezone \"$_a\"". break 2 fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } install_sets() { local _yup _yup="FALSE" # Ask the user which media to load the distribution from. cat << \__install_sets_1 It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. __install_sets_1 if [ "X$local_sets_dir" != "X" ]; then install_from_mounted_fs ${local_sets_dir} if [ X"$_setsdone" != X ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp="" # force at least one iteration while [ X"${resp}" = X ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (t)ape, (C)D-ROM, (N)FS" echo -n " or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk ;; f*|F*) install_ftp ;; t*|T*) install_tape ;; c*|C*) install_cdrom ;; n*|N*) install_nfs ;; *) echo "Invalid response: $resp" resp="" ;; esac else _yup="FALSE" # So we'll ask next time fi # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo "" echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp="" ;; *) ;; esac done } munge_fstab() { local _fstab local _fstab_shadow local _dev local _mp local _fstype local _rest # Now that the 'real' fstab is configured, we munge it into a 'shadow' # fstab which we'll use for mounting and unmounting all of the target # filesystems relative to /mnt. Mount all filesystems. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _rest; do # Skip comment lines case "$_dev" in \#*) continue;; *) ;; esac # and some filesystem types (like there are swap,kernfs,...) case "$_fstype" in ffs|ufs|nfs) ;; *) continue;; esac if [ "$_mp" = "/" ]; then echo $_dev /mnt $_fstype $_rest else echo $_dev /mnt$_mp $_fstype $_rest fi done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab _fstab=$1 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype -o async -o $_opt $_dev $_mp ; then # error message displated by mount exit 1 fi done ) < $_fstab if [ "X${?}" != X"0" ]; then cat << \__mount_filesystems_1 FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __mount_filesystems_1 exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-fast] local _fast local _fstab local _pid if [ "$1" = "-fast" ]; then _fast=1 _fstab=$2 else _fast=0 _fstab=$1 fi if [ ! \( -f $_fstab -a -s $_fstab \) ]; then echo "fstab empty" > /dev/tty return fi if [ $_fast = 0 ]; then echo -n "Syncing disks..." _pid=`twiddle` sync; sleep 4; sync; sleep 2; sync; sleep 2 kill $_pid echo "done." fi ( _devs="" _mps="" # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo -n "Umounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "Done." if [ $_fast = 0 ]; then exit fi echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab _fstab=$1 ( _devs="" _mps="" while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Do#!/bin/sh # $NetBSD: install.sh,v 1.19.2.1 1999/04/13 17:20:42 is Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used thoughout FQDN="" # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_ifdevs() - return available network interfaces # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with installation? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. cp /etc/disktab.shadow /tmp/disktab.shadow while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${ROOTDISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. Loop and # get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << \__get_filesystems_1 You will now have the opportunity to enter filesystem information. You will be prompted for device name and mount point (full path, including the prepending '/' character). Note that these do not have to be in any particular order. You will be given the opportunity to edit the resulting 'fstab' file before any of the filesystems are mounted. At that time you will be able to resolve any filesystem order dependencies. __get_filesystems_1 echo "The following will be used for the root filesystem:" echo " ${ROOTDISK}a /" echo "${ROOTDISK}a /" > ${FILESYSTEMS} resp="X" # force at least one iteration while [ "X$resp" != X"done" ]; do echo "" echo -n "Device name? [RETURN if you already entered all devices] " getresp "done" case "$resp" in done) ;; *) _device_name=`basename $resp` # force at least one iteration _first_char="X" while [ "X${_first_char}" != X"/" ]; do echo -n "Mount point? " getresp "" _mount_point=$resp if [ "X${_mount_point}" = X"/" ]; then # Invalid response; no multiple roots _first_char="X" else _first_char=`firstchar ${_mount_point}` fi done echo "${_device_name} ${_mount_point}" >> ${FILESYSTEMS} resp="X" # force loop to repeat ;; esac done # configure swap resp="" # force at least one iteration while [ "X${resp}" = X"" ]; do echo -n "Ok to configure ${ROOTDISK}b as a swap device? [] " getresp "" case "$resp" in y*|Y*) echo "${ROOTDISK}b swap" >> ${FILESYSTEMS} ;; n*|N*) ;; *) ;; esac done echo "" echo "You have configured the following devices and mount points:" echo "" cat ${FILESYSTEMS} echo "" echo "Filesystems will now be created on these devices. If you made any" echo -n "mistakes, you may edit this now. Edit? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} ${FILESYSTEMS} ;; *) ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _mp; do if [ "$_mp" != "swap" ]; then newfs /dev/r${_device_name} echo "" fi done ) < ${FILESYSTEMS} # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. Note, enter all symbolic host names WITHOUT the domain name appended. I.e. use 'hostname' NOT 'hostname.domain.name'. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) resp="" # force at least one iteration if [ -f /etc/myname ]; then resp=`cat /etc/myname` fi echo -n "Enter system hostname: [$resp] " while [ "X${resp}" = X"" ]; do getresp "$resp" done hostname $resp echo $resp > /tmp/myname echo -n "Enter DNS domain name: " resp="" # force at least one iteration while [ "X${resp}" = X"" ]; do getresp "" done FQDN=$resp configurenetwork echo -n "Enter IP address of default route: [none] " getresp "none" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi echo -n "Enter IP address of primary nameserver: [none] " getresp "none" if [ "X${resp}" != X"none" ]; then echo "domain $FQDN" > /tmp/resolv.conf echo "nameserver $resp" >> /tmp/resolv.conf echo "search $FQDN" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi #!/bin/sh # $NetBSD: upgrade.sh,v 1.16.2.2 1999/04/13 19:38:18 pk Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK="" # filled in below trap "unmount_fs -fast /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_ifdevs() - return available network interfaces # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS $MDSETS" # Files that moved between 1.2 and 1.3 RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/dumpfs /usr/sbin/dumpfs" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/dumplfs /usr/sbin/dumplfs" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/nfsd /usr/sbin/nfsd" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/nfsiod /usr/sbin/nfsiod" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/mountd /usr/sbin/mountd" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/quotacheck /usr/sbin/quotacheck" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/rtquery /usr/sbin/rtquery" # Files that moved between 1.3 and 1.4 RELOCATED_FILES_14="${RELOCATED_FILES_14} /sbin/newlfs /sbin/newfs_lfs" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/games/chess /usr/games/chess" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/games/hide/chess /usr/games/hide/chess" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/share/games/gnuchess.book /usr/share/games/gnuchess.book" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/share/games/atc/ATC_scores /usr/share/games/atc/ATC_scores" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/share/games/atc/ATC_scores /usr/share/games/atc/ATC_scores" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libamu.a /usr/lib/libamu.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libamu_p.a /usr/lib/libamu_p.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libamu_pic.a /usr/lib/libamu_pic.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libbfd.a /usr/lib/libbfd.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libbfd_pic.a /usr/lib/libbfd_pic.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libg++.a /usr/lib/libg++.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libg++_p.a /usr/lib/libg++_p.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libg++_pic.a /usr/lib/libg++_pic.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/gettable /usr/sbin/gettable" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/dig /usr/bin/dig" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/dnsquery /usr/bin/dnsquery" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/htable /usr/bin/htable" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/htable /usr/sbin/htable" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/nslookup /usr/sbin/nslookup" rm_relocated_files() { # ($n, $(n+1)): pairs of (old,new) locations of relocated files while [ $# -ge 2 ]; do if [ -f "$2" ]; then echo Removing "$1"; rm -f "$1" fi shift 2 done } # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp="" # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp="" # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. We remove all but ufs/ffs. ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" -o \ "X${_fstype}" = X"ffs" ]; then if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab fi done ) < /mnt/etc/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. Note that this fstab is only for installation purposes, and will not be copied into the root filesystem. __fstab_config_1 echo -n "Edit the fstab? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check all of the filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets # Remove files that have just been installed in a new location # from the old location rm_relocated_files `eval echo \\$RELOCATED_FILES_${VERSION}` # Get timezone info get_timezone # Fix up the fstab. echo -n "Converting ufs to ffs in /etc/fstab..." ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab done ) < /mnt/etc/fstab echo "done." echo -n "Would you like to edit the resulting fstab? [y] " getresp "y" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." echo -n "Making devices..." _pid=`twiddle` cd /mnt/dev sh MAKEDEV all kill $_pid echo "done." md_copy_kernel md_installboot ${ROOTDISK} ) unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 #!/bin/sh # $NetBSD: binstall.sh,v 1.3 1999/03/01 01:05:51 kim Exp $ # vecho () { # echo if VERBOSE on if [ "$VERBOSE" = "1" ]; then echo "$@" 1>&2 fi return 0 } Usage () { echo "Usage: $0 [-hvt] [-m] net|ffs directory" exit 1 } Help () { echo "This script copies the boot programs to one of several" echo "commonly used places. It takes care of stripping the" echo "a.out(5) header off the installed boot program on sun4 machines." echo "When installing an \"ffs\" boot program, this script also runs" echo "installboot(8) which installs the default proto bootblocks into" echo "the appropriate filesystem partition." echo "Options:" echo " -h - display this message" echo " -m - Look for boot programs in (default: /usr/mdec)" echo " -v - verbose mode" echo " -t - test mode (implies -v)" exit 0 } Secure () { echo "This script has to be run when the kernel is in 'insecure' mode." echo "The best way is to run this script in single-user mode." exit 1 } PATH=/bin:/usr/bin:/sbin:/usr/sbin MDEC=${MDEC:-/usr/mdec} if [ "`sysctl -n kern.securelevel`" -gt 0 ]; then Secure fi set -- `getopt "hm:tv" "$@"` if [ $? -gt 0 ]; then Usage fi for a in $* do case $1 in -h) Help; shift ;; -m) MDEC=$2; shift 2 ;; -t) TEST=1; VERBOSE=1; shift ;; -v) VERBOSE=1; shift ;; --) shift; break ;; esac done DOIT=${TEST:+echo "=>"} if [ $# != 2 ]; then Usage fi WHAT=$1 DEST=$2 if [ ! -d $DEST ]; then echo "$DEST: not a directory" Usage fi SKIP=0 case $WHAT in "ffs") DEV=`mount | while read line; do set -- $line vecho "Inspecting \"$line\"" if [ "$2" = "on" -a "$3" = "$DEST" ]; then if [ ! -b $1 ]; then continue fi RAW=\`echo -n "$1" | sed -e 's;/dev/;/dev/r;'\` if [ ! -c \$RAW ]; then continue fi echo -n $RAW break; fi done` if [ "$DEV" = "" ]; then echo "Cannot find \"$DEST\" in mount table" exit 1 fi TARGET=$DEST/boot vecho Boot device: $DEV vecho Target: $TARGET $DOIT dd if=${MDEC}/boot of=$TARGET bs=32 skip=$SKIP sync; sync; sync vecho ${MDEC}/installboot ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV $DOIT ${MDEC}/installboot ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV ;; "net") TARGET=$DEST/boot.sparc.netbsd vecho Target: $TARGET cp -f ${MDEC}/boot.net $TARGET ;; *) echo "$WHAT: not recognised" exit 1 ;; esac exit $?  . ..AlgiersLuanda Porto-Novo(Gaborone( Ouagadougou Bujumbura(DoualaBanguiNdjamena(Kinshasa( Lubumbashi( BrazzavilleAbidjanDjibouti(CairoMalaboAsmera Addis_Ababa Libreville(BanjulAccraConakryBissauNairobiMaseruMonrovia(TripoliBlantyre(BamakoTimbuktu( Nouakchott( Casablanca(El_Aaiun(MaputoWindhoek(NiameyLagosKigaliSao_Tome(DakarFreetown( Mogadishu( JohannesburgKhartoum(Mbabane Dar_es_SalaamLomeTunisKampalaLusakaHarareHCeutaH . ..I 0J 1K 2L 3M 4N 5O 6P 7Q 8R 9S 10T 11U 12V 13W 14X 15Y 16Z 17[ 18\ 19] 20^ 21_ 22` 23a 24b 25c 26d 27e 28f 29g 30h 31i 32j 33k 34l 35m 36n 37o 38p39q 40r 41s 42t 43u 44v 45w 46x 47y 48z 49{ 50| 51} 52~ 53 54 55 56 57 58 59 60 61 6263` 0 `@# ` 9#" $@` `T@ 6# 9c@2`"` H*/+ 9    9"a( 8"b0  "! 9"!  * 9"!!` 8""@oldmonobp v0obp v2㿘  1c€  1c€㿘@yCan't open device `%s' Can't open NFS network connection on `%s' 㿘@ % 1% ``  @  D 1$` $`b`% ?$ 6 ",+* ) ! 9! "# `0@ 2$@ `    ! 1$` $`bt    ! 1$` $`b%  ! 9 !@!h0!!@m $`&` 2 2 2 8 8b@- @   !@ː!0 8 b@  promstrategy: non-block device not supported 㿘    @#x ` 9a(,a(06 * '@㿘   .  1 #:`  ` 1c``8c``<'@ 㿘  @*& `& $& (   €@- " '@ 㿘 ` @@  1c€ 㿘   2 @ @ $ ? 6`$ *㿘 9!( 4㿘 1#㿘 9!( 8㿘 1#? xmit: not a network device 㿘  ,` @"(?@@ @`?㿘 ,@`€@㿘 1c㿘! 1#` $ \@,ے#%lx mac-address drop swap 6 cmoveX 1#`#`` `6 9` 60&`0" c  c   Њ@*@` 6#@ 0a(0  cP@A`Tielefdxyxdstsddevice_typeblocknetworkbyte㿘 1#``>``:  9 1"`2"N@J@2J`N` "( 2! a(€ @` @-`   `@-    @-`   㿘 1#``€  1 6`## #.prom_iopen: "%s" error=%d 㿘) 6#䀢 ?K  @ @ 9 $`" $` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` () V`" * @H$`0 "@$`4 " @I$` @ 2#&  %#  @"  㿘# 6c䀢  @ 4 "$c@ & 4$coldmon_mapin: length=%d oldmon_mapin: invalid maptype %d 㿘 9!*`@  #@h 1#T   1"ܐ  `   #@R`` 9@! 13 cX Ԣ&@  ` 8"cX @? Đ`IJ`  dvma_mapin㿘? #@(1? @!8dvma_mapout㿘 #@(1 @ !㿘@ " ڒ㿘 @Operation not implemented on ROM version %d X 1#` b @ 9a  9?`\€ 0!( `  `€0   㿘% 1` € $ @+ "  2 @G  ` @-``'@*ǒ& 㿘 7@ 㿐'L' L 2'L*@L㿈 '' 쀢 X L?@vN`E 1#` x@ N/ N /*`:   : * : ``/`@:    * *   *:  / *  : @K "?N 2 x WARNING: opennode not valid on PROM version %d 㿘 1#`#`` @ !   0@   D@no PROM root device㿘1 7 2 &  1cܟ€ 2&  @֐"8namex  1#`! "A @+S  `|@  㿘 1c€: @ PROM exit failed㿘! 1#` X€  H@PROM boot failed㿘! 1#` X€  L@㿘 7 'L'H'P'T'X!@"H  1#`O` (@ (@ &O㿘 9a(@* |€obp_v0_read: unimplemented read from %d 㿘 1#h   X?obp_v0_write: unimplemented write on %d 㿘 1#l    9a(`?㿐 1#` 8   2 8O  / . > 㿐 1`8  O ?  / . > 㿘 9!(`    1p 1p 1pJ-2    J?   J  1p@㿘 1#p`v2_bootargs too long 㿘N 7 ' "%*@` *:  @  -b 2 *@ "*@N?  " *@*@ N`  **@㿘 1#p`㿘 1` < 9(x"@ 1/chosenno CHOSEN node㿘1 7"( 2 &"( @T  2&"( @` bootpath㿐 `p''  1  bootargs㿐 `'' y 1 J 㿐 `'' d 1 ^ opf_nextprop not implemented yet 㿘 @1! stdinstdout㿘 9!`4 9?L 1"c`Jc`( "`  , "` ,  "`  "  \`"`"`"`"`"`("` "`$"`,"`L"`P"`H"`\"``"`X "`d(A @2 ` 1` (  t`( t  ` 1 `@(``   `t  H`d# L`l Pa X d \`p `` x |   ``9 ``"`H0"*a0 J  `L J" `,    `T  (`P  `X  $`` ,`$ 0`(, T 4 8 < ha la pa t(` @ "  @b#⨒" " " " " |    b x#" T" (" " $" , " 0a" 4 " 8`\" <" @" _" D 1 ! c` c` b$ < c$ D        # % ' ) + - / 1 3 5 7 9 ;  `ܒ`H!Ԛa0 0ئ∨#`@ะ"a x!a#Xa$ $ H$ L$ P$ T$ X$ \$ $ $ x$ |$ $ $ $ $ ($ $ $$ 0$ 4$ 8$ @b$  aȔ @b  aД @\ 㿐 1 `/ < vmunixonetbsd.gzonetbsdnetbsd.old.gznetbsd.oldnetbsd.gznetbsd  J- + J& # ""  9 (8 d" `@sa#!/bin/sh - # # $NetBSD: MAKEDEV.local,v 1.5 1997/07/31 04:08:15 perry Exp $ # # Copyright (c) 1991 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV.local 8.1 (Berkeley) 6/9/93 # # Local device MAKEDEV script. PATH=/sbin:/bin:/usr/sbin:/usr/bin umask 77 for i do case $i in all) #sh $0 list_of_all_devices ;; *) echo "$0: unknown device type: $*" ;; esac done TZif tLMTGMTWATTZif Ύn~Qp *0CATCASTTZifLMTGMTTZif CATTZifh LMTWAT ....MAKEDEV/ MAKEDEV.local0console1 tty2kmem}(3 mem4null}(5zero}(6eeprom(7openprom8drum}(9klog}(:stdin}(;stdout(<stderr(= fb>mouse}(? kbd@ttya}(Adtya}(Bttyb}(Cdtyb}(Dttyc}(Edtyc}(Fttyd}(Gdtyd}(H fdsd0c}(sd0a}(sd0b}(sd0d}(sd0e}(sd0f}(sd0g}(sd0h}(rsd0a}(rsd0b}(rsd0c}(rsd0d}(rsd0e}(rsd0f}(rsd0g}(rsd0h}(sd1c}(sd1a}(sd1b}(sd1d}(sd1e}(sd1f}(sd1g}(sd1h}(rsd1a}(rsd1b}(rsd1c}(rsd1d}(rsd1e}(rsd1f}(rsd1g}(rsd1h}(sd2c}(sd2a}(sd2b}(sd2d}(sd2e}(sd2f}(sd2g}(sd2h}(rsd2a}(rsd2b}(rsd2c}(rsd2d}(rsd2e}(rsd2f}(rsd2g}(rsd2h}(sd3c}(sd3a}(sd3b}(sd3d}(sd3e}(sd3f}(sd3g}(sd3h}(rsd3a}(rsd3b}(rsd3c}(rsd3d}(rsd3e}(rsd3f}(rsd3g}(rsd3h}(sd4c}(sd4a}(sd4b}(sd4d}(sd4e}(sd4f}(sd4g}(sd4h}(rsd4a}(rsd4b}(rsd4c}(rsd4d}(rsd4e}(rsd4f}(rsd4g}(rsd4h}(xd0c}(xd0a}(xd0b}(xd0d}(xd0e}(xd0f}(xd0g}(xd0h}(rxd0a}(rxd0b}(rxd0c}(rxd0d}(rxd0e}(rxd0f}(rxd0g}(rxd0h}(xd1c}(xd1a}(xd1b}(xd1d}(xd1e}(xd1f}(xd1g}(xd1h}(rxd1a}(rxd1b}(rxd1c}(rxd1d}(rxd1e}(rxd1f}(rxd1g}(rxd1h}(xd2c}(xd2a}(xd2b}(xd2d}(xd2e}(xd2f}(xd2g}(xd2h}(rxd2a}(rxd2b}(rxd2c}(rxd2d}(rxd2e}(rxd2f}(rxd2g}(rxd2h}( xd3c}( xd3a}( xd3b}( xd3d}( xd3e}(xd3f}(xd3g}(xd3h}(rxd3a}(rxd3b}(rxd3c}(rxd3d}(rxd3e}(rxd3f}(rxd3g}(rxd3h}(xy0c}(xy0a}(xy0b}(xy0d}(xy0e}(xy0f}(xy0g}( xy0h}(!rxy0a}("rxy0b}(#rxy0c}($rxy0d}(%rxy0e}(&rxy0f}('rxy0g}((rxy0h}()xy1c}(*xy1a}(+xy1b}(,xy1d}(-xy1e}(.xy1f}(/xy1g}(0xy1h}(1rxy1a}(2rxy1b}(3rxy1c}(4rxy1d}(5rxy1e}(6rxy1f}(7rxy1g}(8rxy1h}(9xy2c}(:xy2a}(;xy2b}(<xy2d}(=xy2e}(>xy2f}(?xy2g}(@xy2h}(Arxy2a}(Brxy2b}(Crxy2c}(Drxy2d}(Erxy2e}(Frxy2f}(Grxy2g}(Hrxy2h}(Ixy3c}(Jxy3a}(Kxy3b}(Lxy3d}(Mxy3e}(Nxy3f}(Oxy3g}(Pxy3h}(Qrxy3a}(Rrxy3b}(Srxy3c}(Trxy3d}(Urxy3e}(Vrxy3f}(Wrxy3g}(Xrxy3h}(Ycd0c}(Zcd0a}([cd0b}(\cd0d}(]cd0e}(^cd0f}(_cd0g}(`cd0h}(arcd0a}(brcd0b}(crcd0c}(drcd0d}(ercd0e}(frcd0f}(grcd0g}(hrcd0h}(i st0jnst0}(kest0}(lenst0}(mrst0}(nnrst0}(oerst0}(penrst0(q st1rnst1}(sest1}(tenst1}(urst1}(vnrst1}(werst1}(xenrst1(yfd0c}(zfd0a}({fd0b}(|fd0d}(}fd0e}(~fd0f}(fd0g}(fd0h}(rfd0a}(rfd0b}(rfd0c}(rfd0d}(rfd0e}(rfd0f}(rfd0g}(rfd0h}(sound0(audio0(mixer0( audioctl0sound1(audio1(mixer1( audioctl1sound2(audio2(mixer2( audioctl2sound3(audio3(mixer3( audioctl3ttyp0}(ptyp0}(ttyp1}(ptyp1}(ttyp2}(ptyp2}(ttyp3}(ptyp3}(ttyp4}(ptyp4}(ttyp5}(ptyp5}(ttyp6}(ptyp6}(ttyp7}(ptyp7}(ttyp8}(ptyp8}(ttyp9}(ptyp9}(ttypa}(ptypa}(ttypb}(ptypb}(ttypc}(ptypc}(ttypd}(ptypd}(ttype}(ptype}(ttypf}(ptypf}(vnd0c}(vnd0a}(vnd0b}(vnd0d}(vnd0e}(vnd0f}(vnd0g}(vnd0h}(rvnd0a(rvnd0b(rvnd0c(rvnd0d(rvnd0e(rvnd0f(rvnd0g(rvnd0h(vnd1c}(vnd1a}(vnd1b}(vnd1d}(vnd1e}(vnd1f}(vnd1g}(vnd1h}(rvnd1a(rvnd1b(rvnd1c(rvnd1d(rvnd1e(rvnd1f(rvnd1g(rvnd1h(vnd2c}(vnd2a}(vnd2b}(vnd2d}(vnd2e}(vnd2f}(vnd2g}(vnd2h}(rvnd2a(rvnd2b(rvnd2c(rvnd2d(rvnd2e(rvnd2f(rvnd2g(rvnd2h(vnd3c}(vnd3a}(vnd3b}(vnd3d}(vnd3e}(vnd3f}(vnd3g}(vnd3h}(rvnd3a(rvnd3b(rvnd3c(rvnd3d(rvnd3e(rvnd3f(rvnd3g(rvnd3h(sound}(audio}(mixer}(audioctltun0}(tun1}(tun2}(tun3}(ccd0c}(ccd0a}(ccd0b}(ccd0d}(ccd0e}(ccd0f}(ccd0g}(ccd0h}( rccd0a( rccd0b( lkm rccd0c( rccd0d( rccd0e(rccd0f(rccd0g(rccd0h(ccd1c}(ccd1a}(ccd1b}(ccd1d}(ccd1e}(ccd1f}(ccd1g}(ccd1h}(rccd1a(rccd1b(rccd1c(rccd1d(rccd1e(rccd1f(rccd1g( rccd1h(!ccd2c}("ccd2a}(#ccd2b}($ccd2d}(%ccd2e}(&ccd2f}('ccd2g}((ccd2h}()rccd2a(*rccd2b(+rccd2c(,rccd2d(-rccd2e(.rccd2f(/rccd2g(0rccd2h(1ccd3c}(2ccd3a}(3ccd3b}(4ccd3d}(5ccd3e}(6ccd3f}(7ccd3g}(8ccd3h}(9rccd3a(:rccd3b(;rccd3c(<rccd3d(=rccd3e(>rccd3f(?rccd3g(@rccd3h(Araid0c(Braid0a(Craid0b(Draid0d(Eraid0e(Fraid0f(Graid0g(Hraid0h(Irraid0aJrraid0bKrraid0cLrraid0dMrraid0eNrraid0fOrraid0gPrraid0hQraid1c(Rraid1a(Sraid1b(Traid1d(Uraid1e(Vraid1f(Wraid1g(Xraid1h(Yrraid1aZrraid1b[rraid1c\rraid1d]rraid1e^rraid1f_rraid1g`rraid1haraid2c(braid2a(craid2b(draid2d(eraid2e(fraid2f(graid2g(hraid2h(irraid2ajrraid2b" ` "` "ᨐ J  2( >> %s, Revision %s >> (%s, %s) device[%s] ("halt" to halt): haltboot (press RETURN to try default list): open: %s: %s: trying %s... Booting %s @ %p 㿘@'! 16#`  2 2 8`X@Wx  2 2 P`@P + 9 €%a @`L@ %? 1#! a,! @ H @2  1c,@ "    @   @  $  `) 9@"@ ؐ `@'t  # 9M" 2%a@`a@ ŐLa` 1#  @ & 9  @@Bad format %ld+%ld+[%ld+%d]=%p boot: short read x@ <%?@  ?# @!2?2 a/ ? ?# @!2?$ a! ? ?# @! 2? a  ? ?# @ 2  `"  "@#?@ ?# @!  a ܤ` ܐ@ܔ  ? @@ ?# @! a ? ?# @! #a  @" .@`@2.@ #@F@` 2d @@: :.@  `耢 "< @  `@##@=耢 2A # 8@cD@2  7 @g cD   ?`@!2& @ #@`?    9"a # @@ 1c`  9 9!(ab1  Ā 0#(@㿘! 7"  @  2 "` 9 !,@0 " $"㿘 7b ? "b  2@z`boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' 2@ ?7 9"! #'@B@@ ) 9  8#@{b 2` 1 8`#@  9#!  '@#@e#'@)  9  9!, 2  9!0㿘 9!0 ` 9@  7$ " }   "a,?  9 , ? 90 㿘  ; < 㿘 = 9"    ?peer㿀 " 9 'a('''? child㿀 " 9 'a('''? parent㿀 #  9 'a('''? instance-to-package㿘  7#p 9"⠔ a($ $ $ ?? getproplen㿀 # 9  'a(''''??getpropx 9! 4?  8 9  'a(''''''؀??setpropx 9! 4?   9  'a(''''''؀??nextpropx !( 9  'a('''''؀??finddevice㿀 ! 9 'a('''??instance-to-pathx 9! 4? ! 9  'a('''''؀ ?package-to-pathx 9! 4? "` 9  'a('''''؀ ?call-method@'T  'X+  "ؔ '?'' ? T`?& 9a(€ ?, ? `+ ?   `? "@ 8'P'T''X  ."ؘ''''' P" 9a(€ ? @ ?* @?open㿀@#א 9a 6?   9 'a('''??close㿈 ! 9 'a('''test㿀 !@ 9 'a('''??test-method㿀 ! 9  'a(''''readx !  ?'''耦 % 9# 9a('@؀?? 2  &writeOF_write() > 1024 x "  '?''耦  ."! 93 9!  'a(@؀??&seekx 9(  P  ''''''@؀??OF_bootbootOF_boot failed㿈@# 9a &  @ v## 9 'a(''' @ i#enter㿈  @ 9'a(''€exitOF_exit failed㿈  x 9'a(''€ @ H SUNW,power-offOF_poweroff failed㿈   9'a(''€ @ 1 set-callback㿀 !  9 'a('''? set-symbol-lookup㿀 !x 9 'a(''''interpret㿀 ! 9 'a('''milliseconds㿈 " 9 'a(''㿐`@|`0@X``@#`` @#``@#,@ ` @"j@#`x`` * `d, `0 2`0`0@"`x @"P* @ ?  " ??%`0@f㿘 `  .` 8@ X&   ,`@@ ```&@`,`F C& h`>  ,` @!  @0$@     d ,  0 2 0 2 %@` ,@"@!,`& 㿐   e<`P @ K 4`0*:  8  2 `0 @8eD`0eD `L  Ȁ(u 2: @`0$  " @w  `d  *   0@^$ $  $&@&    b 8   @   " & 㿐`@!P  <@`@.@ 0 "  2  @!8  2  &*@ B<@@` 8Ԑ2 ``@͐ 㻀@$ Ш@ &`@@% `   `  @2 \F!T@ 0@@eg`0 @-   @"2t,   $@  ' f ` @  7%0<`@%0 @C  >%0 H L;`;   ;`; >%@>%8pؐ@^ @n 8 'pt@_ ,  $ #`a#\b` @ ?  9 H "a,؀` 9@@  "!,?㽠Px@(  @0 @4 8 t@& $`   h #`a#\b`$ @ ?  9!, x  |@ 0@ D 㺈ؐ @  `$#\#`ab  @X ?  9!, `  dh@ ݒd .@  ?nfsread: short packet, %d < %ld 0Ȣ @ Ɣ $$ $$L#`a$ $b$ (#\  @ ,? L 9 H"a,`"`H 9"!,?@ T@ 0@ >  9 H",?㿘@  2 9 "a,  8" РX6 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈/ 8HH   @ "8   l N /" c  0 _ @ ` x  $<N   /   L  N  / . @.0 /H 2:H@@ d*  '`@ @@ O/ H@ E x@ A x  @ : x   `H&`  @ ( x@ # x㿘  "& @  x&  㿘 ! 9@    ? !,   ;  B& > @ 2&       D"; 0 0   @ ;  `; ??0   2 0ఐ *  4  "` 8"`  <"` @"` D :`8bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p l 9ba"'Д  $ $ $ ''X@ؒ X? 2В??4` $@!"И#`ab#@ #\ @  ! 8 @̐"0<?# 9"@b"+ '4b2@  ` @"X#? 8'ܢ  8b"@ ? 9" 8b@w  ? 8@b ? ? 7 P 8" 8b''@H 2C?@ؐ@? 2:? 2  8?6 b"&# К#`a#@b#\ @     9 H"a,''@( 2?@J 2?#'@ ? ?㿘 &# @ &@  㿘`&@   ? & @ q.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@#rarp: bad socket. %d No response for RARP request   @Ґ"E?@  .     , , , , , /Ƣ, , @  @   4#\  `T  .@˚~ ! 9 @"?"@  " @ 0 2 ? @  2??"a" $㿘 2 X@ 5㿐@ 9 ."a,  5@2)?@`* @`2"?``* @h2?` 2?` 2?``* @`2 ? `@  ??callrpc: error = %d 㿐\@?B6 '?'??@ } ` 8@@ '?ܖ ?'?'? #@   #\ @  bЖ$ " @/?  9 H"a,`@ 9 H "a,`` #@@!p 9 H",?recvrpc: reject, astat=%d, errno=%d 㿘! 9$!,@i  8#@@ 2?`2 ?` ` $!,"@ʒ ??"@?2 9 8ȇ(    ?      ? 9a  #a  8ȇ+   #a  getport: %s㾐a"@3 o'?(' "p #\#` ""   ,   p'0 # 9! a,@j H@U H$a,?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentNot a directoryUnknown error: code %d㿘`Y "*` €0X0X0Y0Y0X0X0Y0X0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0X0Y0X0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0X0Y0Y0Y0Y0Y0Y0Y0Y0X0Y0Y0Y0Y0Y0XT0X`0Xl0Xx0X0X1 3!@1 0!X1 -!p1 *!1 '!1 $!1 !!1 !1 !1 "1 "(1 "P1 "h1  "1  "1 7" b @㿘'L'P'T'X @L  @ *`㿘W  ,  ". /.".+."&  "!"..鿐 0麐 鸐 ?鵐 0鲐 @͠L鬠 *L0馐 0飰 0sendudp: bad write (%d != %d)x@4 <* @ *@@ &  ,`,` 4` $`  @ $`4`  6 4 4  `''`` '`'@ ' 4` @4 &쀣?$` $`$` $`  2!     8`b'@ܖ@(@? "@^readudp: huge packet, udp len %d x@ް `}ހ((  * @`t?@o?2m?<@ 2f? 2b?6` <`\@ 2X? &T?``  2L?` &@  "4  ` 2=?` 5` % @ x0? ' ' ' ''@] `4 @F  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   ) 9 <+  $%!,3?@@b@, 4 2 "ޠ 2 !,   "$ Ȧ` l *` Є  *  :(Е*`*`8. 53 # .?#8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘# 7c,@  . @  0,@@O "@  0,@@D  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*? ` `. Ȓ?N*c  .   J    `&     ,` ` `   ( `߀` ܗ(2 ?# : :* arpwhohas: overflowed arp_list! arp: no response for %s # 2a8 @ 2 ؀@  'h@B`@  8   $a8@d @Ɛ@ .    , , , , /, , , @ @ h@ h 4&#\  a" .Z~?2  h!  h'll@  @ a8$a8㿘 2X@(㿐@ 9 :"a,(27?@`* @`20?``* @h2)?` 2%?` 2!?``* @``@?? 2!8 2*` ؑ*  `@  ??㿘@`*` ;``* @h4` 0` ,``* @`%` @u   ``.`.`@ `@  @ @  .@(㿘 @ @ޔ 6` [ `??㿘Y ` @.    2!X@'  "` ?` ?7 8 2@  : 0 *@ `  *@`*@` 8* 2J  "  JJ@ `  㿘 8a'H'L'P'T 'X @ "a@H @!㿘 9" , @  @ , 㿘'H'L'P'T'X@hH㿘@@h㿘@ 㿘@=㿘 < " ?21 9 @&!, D@$ 4  D!, `$ <?$ 8 $$ $  @`$㿘אԐ* А* ̐?. ?$`8㿘 2! , @ " ? X?& L  & & K`?  & L ` ?:& 8  ``* ?`??``x ?``p ?`"  < g   <  ?& 81.1.3㿘@ƒ?-`+@ P 8aБ. `"@@p P ?@ 8 `@ &`D&@o&`@0 @ѐ`@ P@$?㿘  9 "a,? 9". @  8. a@ @ D@@ P@㿘 8!Г.   8?? 2 $  ??~$ 8{$  L 2+    8     "@"$$ $  $ c&  @@ \? " $ V&  < # 9 D$a,@ 4 Da, `$ < D$ $@ے $$ 8  H@ " $ H  H ?  ?$ 8ʐ 8`2  8@  @  $ H 8 2   < 2   2 L  H@ |"  $ H&㾘  9  9"- @ 8@!9!Г-  `L@?2*$`(&$`" `  9e b 9a  @ F `%@"  @ ?K @`D@B P ?@͖ 8$@$`D$`@H `4@ 2` @ f )`' a !: @ 9  [d 4 `0 ["a,??㿐 9. " @@   9 ."a," @ * 2`   :     9 "a,  B < ' 9 "a,&?㿐 9"   `    9 H"a,$  $ $ < '" 9 9`  0 "`J + 2`*$@'$ `P @  8" @€ `2`P`    ` 9@ 9"!,$?㿘 9. "@ @   9 "   9  [ :@B: [?? "a,    㿘 9. " @  @   9 $"a,2  " @      @ $ 9"!,` 9 "!,?|/-\㿘 8!  cȖJ@ N#!L  8 8@`*@"㿘 !(@㿘 8! 8"a $! @!*!"8N@`N@`%` N@`oq``s`c"N`d``b"0T`l" 0z"B`u`ph0r]`x"h0m@wL`Р L !  ?,@ < ,L L    L  *`:    >0 `L` L` N@` - @0 N@@( N@@  {N@ 0 x@ oN@ % g lc0123456789abcdef㿈 #8@D @@,  ?L?` *    @ ?  *@0    *@ ` 2 ?@ @: ?  2a "a"     2? " 㿘 ?`2"`0"`"`   "` @{ 㿘 "? `"? $2` ? @0  $€ (&  㿘"M?N 12I?8 D?2 @? &  "& & ( $ 2  "& $   (  )& "  `"   "`  ( ?"  `   '  *@A  " ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "O?  "K? F` ??` >  4*` €0l0000(0|00000$0x00 ( `$ $  #   $  " cX 2    " cx " `  $ $    $`* @ː  &@ c`   &@ &@  `$ $    * "` $" `Β  $ $    *` " $"@ `  $ $    *` " $"@    $ $  @  ` #  $ $ 0" # c $ "  @?   " "9 " u @ `  "@'  "@ b `$ $    * "` $" `O  $ $   *` " $"@ `:  $ $   *` " $"@ `%   $ $   " $@  " c $  "  " ??㿘    "#?  ?@Ԕ 0  ? & 06 * ?$@ @N  " 㿘 ??`2@09  "@"``2.? 2!`  8  @`   #  $$$ " $$ "@?㿘 " ?   ?  @     㿘" <& ``$`(€ `2 ( @  (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$ `  `(  $ ($ ,$ 8$  `$ `(€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` - "!*` €00\0000$0l0 00Ȩ?  *`` 4  `&  `-`0  `4 $@&Υ4@@耢 & & & @&``$  &`&@& 4?  &4 "& &`4& & @&``$  &`&@& 4Ҕ?}?  *`` <?#2` @ @ " & &`& & @&``$  &`&@& 4?`&  l o  `& & @&``$  &`&@& 42C  , ` 0 ( @ "?"`21 & 4@  0 4  " ,? ,"@  ` ( "?"@`2 & & @&``$  &`&@& 4Q 8 "%%@&     &?  *``  ?, & 4   !  "&!&`& & @&``$  &`&@& 4 ? `  `( & & & @&``$  &`&@& 4? &4&   2  @ ! #?  *``   *@ *`"  & 2  4     !#* *`"  &  &   $ @  `$`(€ 2&  && & @&``$  &`&@& 4&&  0 `a   6 "#8a8 @,  Z?  *`@ ,   *` `  (" $@& T4` `   @  ??  *`@ 4$@* 4   !  $@ 4 `2! ` `$`( &&`& & @&``$  &`&@& 4%?  ( ? *"@?&  0  !@ *   $4  `#\#` &   !`''#d@*ܠ`$`(€ ?"&& & @&``$  &`&@& 4ޔ@؀ 2& & & @&``$  &`&@& 4ǔ?&& & @&``$  &`&@& 4@  @ 0 4@`  "? ,"   ^&&& 4@ 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘2 `$ `( (`$`(€ $`(`$€㿘 ( (& 0& 4`?w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z- %# `Y G: % 2(@   (@ 2 @(@ 2 (@ 2 (@ 2 (@ 2 (@ 2 (@2   % 2(@ :㿘?c6  ` [ V1?!:& ``@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ ̲` @`@@#@#񀦠,` #+3;CScspp !1Aa  0@` 㾸'H'P\' H'L'T'X''''''''''''''''(@&@H2X$"-   .@. *   .@.8 " ( .@  ,  . ??$  '4 8 0  .@(h&@$H*- h'H'0? 'p @¸  +`??',H'$h,'(*@ @R,*   ''%    #@,@? : d. d &d,@`(p$&$// @ "@68 '.@&@&X$@ @4(#@/  /L   `/'LT (P/ P('6 ,. . &@@ @ @ , 62 $," ? '@ ?.@??2U@ `@$C  2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀 ' (   #?#d#`#\#h   | ?? )! '  )@ 2 ( )!' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d`' !  (  W? ' '@"#\#`#d#h! ? ,?? )"$  )"$ ? (1 $ ' '\#`#d8##\#h  ? 2 (?? )" $ ? )# )#($ ? ( $ ( $ €㿘 20; 2&b4 2&@8 6&8& 㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@`  *!*` €0 000p0l00(0P00)` '& & @&``$@&@&`& 4 ` ``@` 0 4@ `  "@? ,": $@ ` `$` $`$@`  6`  *   6c8+`@ ` *   $ 4   $`$@   $` $`$@ @_   $@ *$@!`&`& & @&``$  &`&@& 4?`  6`[  *   6#8+`  ` ` `$`$ $` $`$@4 `  6`J  *   6c8+`@ ` *   $  4 $`  $` 7$@ @ $`  * .$` *$@!&`& & @&``$  &`&@& 4H?`  6`  *   6#8+`  `  $` $ $@4  ( `   ," "@` "$@26  ,  0 ( @ "?"2$ & 4@ 0 4  " ,? ,"@   ( "?"@"&  ( ,   (`? $`$@2C `  ,  0 ( @ "?"21 ` & 4@В 0 4  " ,? ,"@   ( "?"@2 ` & & @&``$  &`&@& 4 (c$@ & 4?`@ 0 4@& & @&``$  &`&@& 4r $@& & @&``$  &`&@& 4b & & @&``$  &`&@& 4T?& & @&``$  &`&@& 4F& & @&``$  &`&@& 48& & @&``$  &`&@& 4*& & @&``$  &`&@& 4& @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`@  ,  68. ( ǀ`0?(``( ( ` ,4c8`@` (` . ( `2&   &@/@7`6`` 8.&@" "@#`#"@"`"`"4 ` 1"` `&@˹7`(`&@ ` 7 ?(`` ( , %c8`@2 `(` (.  6` "`8.&@" "@#`#"@"`"`"4U? `&@ڹ7`@ (` ?(`@ (`&@ ('@7 &'@/@ `/@ `,  &/@ `(/@ `; `6` 8.&@" "@#`#"@"`"`"4 㿘 4 0@`  ,"` 8 " `"@&`&` 8 <& <&`0腔 ,@@ & 4  (& 4`" 8 " `"@&`&` 8 <& <&`0^@&` & 0㿘  `  `  @/# @*   & &@&& @.@* "   ` 㿘?#@6 6`@  `@  & $ $&@`@@2  ` *  , "@@ 4 "  "  , @@ 4    ,@@ 4  @@*  : : *2@ : @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &   J "     J@*8 ` "@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@000040000000 00000x0p0h0`0X0P0H 0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0`0P0@000(000;0?H0?0@0@0A 0FX0H0H0IT0I\0INetBSD/sparc Secondary Boot1.8Mon Jul 19 04:22:51 PDT 1999mrg@sun4690@` 0123456789abcdef/0 inflate 1.1.3 Copyright 1995-1998 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??TZif!`POGx,ppHp*` .zL5ppX ϒ4ЊrN$pKp\xC DxZhYvCpfB_|O_1   PMTWESTWETCESTCET0 `@# ` 9#" $@` `T@ 6# 9c@2`"` H*/+ 9    9"a( 8"b0  "! 9"!  * 9"!!` 8""@oldmonobp v0obp v2㿘  1c€  1c€㿘@yCan't open device `%s' Can't open NFS network connection on `%s' 㿘@ % 1% ``  @  D 1$` $`b`% ?$ 6 ",+* ) ! 9! "# `0@ 2$@ `    ! 1$` $`bt    ! 1$` $`b%  ! 9 !@!h0!!@m $`&` 2 2 2 8 8b@- @   !@ː!0 8 b@  promstrategy: non-block device not supported 㿘    @#x ` 9a(,a(06 * '@㿘   .  1 #:`  ` 1c``8c``<'@ 㿘  @*& `& $& (   €@- " '@ 㿘 ` @@  1c€ 㿘   2 @ @ $ ? 6`$ *㿘 9!( 4㿘 1#㿘 9!( 8㿘 1#? xmit: not a network device 㿘  ,` @"(?@@ @`?㿘 ,@`€@㿘 1c㿘! 1#` $ \@,ے#%lx mac-address drop swap 6 cmoveX 1#`#`` `6 9` 60&`0" c  c   Њ@*@` 6#@ 0a(0  cP@A`Tielefdxyxdstsddevice_typeblocknetworkbyte㿘 1#``>``:  9 1"`2"N@J@2J`N` "( 2! a(€ @` @-`   `@-    @-`   㿘 1#``€  1 6`## #.prom_iopen: "%s" error=%d 㿘) 6#䀢 ?K  @ @ 9 $`" $` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` () V`" * @H$`0 "@$`4 " @I$` @ 2#&  %#  @"  㿘# 6c䀢  @ 4 "$c@ & 4$coldmon_mapin: length=%d oldmon_mapin: invalid maptype %d 㿘 9!*`@  #@h 1#T   1"ܐ  `   #@R`` 9@! 13 cX Ԣ&@  ` 8"cX @? Đ`IJ`  dvma_mapin㿘? #@(1? @!8dvma_mapout㿘 #@(1 @ !㿘@ " ڒ㿘 @Operation not implemented on ROM version %d X 1#` b @ 9a  9?`\€ 0!( `  `€0   㿘% 1` € $ @+ "  2 @G  ` @-``'@*ǒ& 㿘 7@ 㿐'L' L 2'L*@L㿈 '' 쀢 X L?@vN`E 1#` x@ N/ N /*`:   : * : ``/`@:    * *   *:  / *  : @K "?N 2 x WARNING: opennode not valid on PROM version %d 㿘 1#`#`` @ !   0@   D@no PROM root device㿘1 7 2 &  1cܟ€ 2&  @֐"8namex  1#`! "A @+S  `|@  㿘 1c€: @ PROM exit failed㿘! 1#` X€  H@PROM boot failed㿘! 1#` X€  L@㿘 7 'L'H'P'T'X!@"H  1#`O` (@ (@ &O㿘 9a(@* |€obp_v0_read: unimplemented read from %d 㿘 1#h   X?obp_v0_write: unimplemented write on %d 㿘 1#l    9a(`?㿐 1#` 8   2 8O  / . > 㿐 1`8  O ?  / . > 㿘 9!(`    1p 1p 1pJ-2    J?   J  1p@㿘 1#p`v2_bootargs too long 㿘N 7 ' "%*@` *:  @  -b 2 *@ "*@N?  " *@*@ N`  **@㿘 1#p`㿘 1` < 9(x"@ 1/chosenno CHOSEN node㿘1 7"( 2 &"( @T  2&"( @` bootpath㿐 `p''  1  bootargs㿐 `'' y 1 J 㿐 `'' d 1 ^ opf_nextprop not implemented yet 㿘 @1! stdinstdout㿘 9!`4 9?L 1"c`Jc`( "`  , "` ,  "`  "  \`"`"`"`"`"`("` "`$"`,"`L"`P"`H"`\"``"`X "`d(A @2 ` 1` (  t`( t  ` 1 `@(``   `t  H`d# L`l Pa X d \`p `` x |   ``9 ``"`H0"*a0 J  `L J" `,    `T  (`P  `X  $`` ,`$ 0`(, T 4 8 < ha la pa t(` @ "  @b#⨒" " " " " |    b x#" T" (" " $" , " 0a" 4 " 8`\" <" @" _" D 1 ! c` c` b$ < c$ D        # % ' ) + - / 1 3 5 7 9 ;  `ܒ`H!Ԛa0 0ئ∨#`@ะ"a x!a#Xa$ $ H$ L$ P$ T$ X$ \$ $ $ x$ |$ $ $ $ $ ($ $ $$ 0$ 4$ 8$ @b$  aȔ @b  aД @\ 㿐 1 `/ < vmunixonetbsd.gzonetbsdnetbsd.old.gznetbsd.oldnetbsd.gznetbsd  J- + J& # ""  9 (8 d" `@sa" ` "` "ᨐ J  2( >> %s, Revision %s >> (%s, %s) device[%s] ("halt" to halt): haltboot (press RETURN to try default list): open: %s: %s: trying %s... Booting %s @ %p 㿘@'! 16#`  2 2 8`X@Wx  2 2 P`@P + 9 €%a @`L@ %? 1#! a,! @ H @2  1c,@ "    @   @  $  `) 9@"@ ؐ `@'t  # 9M" 2%a@`a@ ŐLa` 1#  @ & 9  @@Bad format %ld+%ld+[%ld+%d]=%p boot: short read x@ <%?@  ?# @!2?2 a/ ? ?# @!2?$ a! ? ?# @! 2? a  ? ?# @ 2  `"  "@#?@ ?# @!  a ܤ` ܐ@ܔ  ? @@ ?# @! a ? ?# @! #a  @" .@`@2.@ #@F@` 2d @@: :.@  `耢 "< @  `@##@=耢 2A # 8@cD@2  7 @g cD   ?`@!2& @ #@`?    9"a # @@ 1c`  9 9!(ab1  Ā 0#(@㿘! 7"  @  2 "` 9 !,@0 " $"㿘 7b ? "b  2@z`boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' 2@ ?7 9"! #'@B@@ ) 9  8#@{b 2` 1 8`#@  9#!  '@#@e#'@)  9  9!, 2  9!0㿘 9!0 ` 9@  7$ " }   "a,?  9 , ? 90 㿘  ; < 㿘 = 9"    ?peer㿀 " 9 'a('''? child㿀 " 9 'a('''? parent㿀 #  9 'a('''? instance-to-package㿘  7#p 9"⠔ a($ $ $ ?? getproplen㿀 # 9  'a(''''??getpropx 9! 4?  8 9  'a(''''''؀??setpropx 9! 4?   9  'a(''''''؀??nextpropx !( 9  'a('''''؀??finddevice㿀 ! 9 'a('''??instance-to-pathx 9! 4? ! 9  'a('''''؀ ?package-to-pathx 9! 4? "` 9  'a('''''؀ ?call-method@'T  'X+  "ؔ '?'' ? T`?& 9a(€ ?, ? `+ ?   `? "@ 8'P'T''X  ."ؘ''''' P" 9a(€ ? @ ?* @?open㿀@#א 9a 6?   9 'a('''??close㿈 ! 9 'a('''test㿀 !@ 9 'a('''??test-method㿀 ! 9  'a(''''readx !  ?'''耦 % 9# 9a('@؀?? 2  &writeOF_write() > 1024 x "  '?''耦  ."! 93 9!  'a(@؀??&seekx 9(  P  ''''''@؀??OF_bootbootOF_boot failed㿈@# 9a &  @ v## 9 'a(''' @ i#enter㿈  @ 9'a(''€exitOF_exit failed㿈  x 9'a(''€ @ H SUNW,power-offOF_poweroff failed㿈   9'a(''€ @ 1 set-callback㿀 !  9 'a('''? set-symbol-lookup㿀 !x 9 'a(''''interpret㿀 ! 9 'a('''milliseconds㿈 " 9 'a(''㿐`@|`0@X``@#`` @#``@#,@ ` @"j@#`x`` * `d, `0 2`0`0@"`x @"P* @ ?  " ??%`0@f㿘 `  .` 8@ X&   ,`@@ ```&@`,`F C& h`>  ,` @!  @0$@     d ,  0 2 0 2 %@` ,@"@!,`& 㿐   e<`P @ K 4`0*:  8  2 `0 @8eD`0eD `L  Ȁ(u 2: @`0$  " @w  `d  *   0@^$ $  $&@&    b 8   @   " & 㿐`@!P  <@`@.@ 0 "  2  @!8  2  &*@ B<@@` 8Ԑ2 ``@͐ 㻀@$ Ш@ &`@@% `   `  @2 \F!T@ 0@@eg`0 @-   @"2t,   $@  ' f ` @  7%0<`@%0 @C  >%0 H L;`;   ;`; >%@>%8pؐ@^ @n 8 'pt@_ ,  $ #`a#\b` @ ?  9 H "a,؀` 9@@  "!,?㽠Px@(  @0 @4 8 t@& $`   h #`a#\b`$ @ ?  9!, x  |@ 0@ D 㺈ؐ @  `$#\#`ab  @X ?  9!, `  dh@ ݒd .@  ?nfsread: short packet, %d < %ld 0Ȣ @ Ɣ $$ $$L#`a$ $b$ (#\  @ ,? L 9 H"a,`"`H 9"!,?@ T@ 0@ >  9 H",?㿘@  2 9 "a,  8" РX6 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈/ 8HH   @ "8   l N /" c  0 _ @ ` x  $<N   /   L  N  / . @.0 /H 2:H@@ d*  '`@ @@ O/ H@ E x@ A x  @ : x   `H&`  @ ( x@ # x㿘  "& @  x&  㿘 ! 9@    ? !,   ;  B& > @ 2&       D"; 0 0   @ ;  `; ??0   2 0ఐ *  4  "` 8"`  <"` @"` D :`8bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p l 9ba"'Д  $ $ $ ''X@ؒ X? 2В??4` $@!"И#`ab#@ #\ @  ! 8 @̐"0<?# 9"@b"+ '4b2@  ` @"X#? 8'ܢ  8b"@ ? 9" 8b@w  ? 8@b ? ? 7 P 8" 8b''@H 2C?@ؐ@? 2:? 2  8?6 b"&# К#`a#@b#\ @     9 H"a,''@( 2?@J 2?#'@ ? ?㿘 &# @ &@  㿘`&@   ? & @ q.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@#rarp: bad socket. %d No response for RARP request   @Ґ"E?@  .     , , , , , /Ƣ, , @  @   4#\  `T  .@˚~ ! 9 @"?"@  " @ 0 2 ? @  2??"a" $㿘 2 X@ 5㿐@ 9 ."a,  5@2)?@`* @`2"?``* @h2?` 2?` 2?``* @`2 ? `@  ??callrpc: error = %d 㿐\@?B6 '?'??@ } ` 8@@ '?ܖ ?'?'? #@   #\ @  bЖ$ " @/?  9 H"a,`@ 9 H "a,`` #@@!p 9 H",?recvrpc: reject, astat=%d, errno=%d 㿘! 9$!,@i  8#@@ 2?`2 ?` ` $!,"@ʒ ??"@?2 9 8ȇ(    ?      ? 9a  #a  8ȇ+   #a  getport: %s㾐a"@3 o'?(' "p #\#` ""   ,   p'0 # 9! a,@j H@U H$a,?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentNot a directoryUnknown error: code %d㿘`Y "*` €0X0X0Y0Y0X0X0Y0X0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0X0Y0X0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0X0Y0Y0Y0Y0Y0Y0Y0Y0X0Y0Y0Y0Y0Y0XT0X`0Xl0Xx0X0X1 3!@1 0!X1 -!p1 *!1 '!1 $!1 !!1 !1 !1 "1 "(1 "P1 "h1  "1  "1 7" b @㿘'L'P'T'X @L  @ *`㿘W  ,  ". /.".+."&  "!"..鿐 0麐 鸐 ?鵐 0鲐 @͠L鬠 *L0馐 0飰 0sendudp: bad write (%d != %d)x@4 <* @ *@@ &  ,`,` 4` $`  @ $`4`  6 4 4  `''`` '`'@ ' 4` @4 &쀣?$` $`$` $`  2!     8`b'@ܖ@(@? "@^readudp: huge packet, udp len %d x@ް `}ހ((  * @`t?@o?2m?<@ 2f? 2b?6` <`\@ 2X? &T?``  2L?` &@  "4  ` 2=?` 5` % @ x0? ' ' ' ''@] `4 @F  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   ) 9 <+  $%!,3?@@b@, 4 2 "ޠ 2 !,   "$ Ȧ` l *` Є  *  :(Е*`*`8. 53 # .?#8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘# 7c,@  . @  0,@@O "@  0,@@D  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*? ` `. Ȓ?N*c  .   J    `&     ,` ` `   ( `߀` ܗ(2 ?# : :* arpwhohas: overflowed arp_list! arp: no response for %s # 2a8 @ 2 ؀@  'h@B`@  8   $a8@d @Ɛ@ .    , , , , /, , , @ @ h@ h 4&#\  a" .Z~?2  h!  h'll@  @ a8$a8㿘 2X@(㿐@ 9 :"a,(27?@`* @`20?``* @h2)?` 2%?` 2!?``* @``@?? 2!8 2*` ؑ*  `@  ??㿘@`*` ;``* @h4` 0` ,``* @`%` @u   ``.`.`@ `@  @ @  .@(㿘 @ @ޔ 6` [ `??㿘Y ` @.    2!X@'  "` ?` ?7 8 2@  : 0 *@ `  *@`*@` 8* 2J  "  JJ@ `  㿘 8a'H'L'P'T 'X @ "a@H @!㿘 9" , @  @ , 㿘'H'L'P'T'X@hH㿘@@h㿘@ 㿘@=㿘 < " ?21 9 @&!, D@$ 4  D!, `$ <?$ 8 $$ $  @`$㿘אԐ* А* ̐?. ?$`8㿘 2! , @ " ? X?& L  & & K`?  & L ` ?:& 8  ``* ?`??``x ?``p ?`"  < g   <  ?& 81.1.3㿘@ƒ?-`+@ P 8aБ. `"@@p P ?@ 8 `@ &`D&@o&`@0 @ѐ`@ P@$?㿘  9 "a,? 9". @  8. a@ @ D@@ P@㿘 8!Г.   8?? 2 $  ??~$ 8{$  L 2+    8     "@"$$ $  $ c&  @@ \? " $ V&  < # 9 D$a,@ 4 Da, `$ < D$ $@ے $$ 8  H@ " $ H  H ?  ?$ 8ʐ 8`2  8@  @  $ H 8 2   < 2   2 L  H@ |"  $ H&㾘  9  9"- @ 8@!9!Г-  `L@?2*$`(&$`" `  9e b 9a  @ F `%@"  @ ?K @`D@B P ?@͖ 8$@$`D$`@H `4@ 2` @ f )`' a !: @ 9  [d 4 `0 ["a,??㿐 9. " @@   9 ."a," @ * 2`   :     9 "a,  B < ' 9 "a,&?㿐 9"   `    9 H"a,$  $ $ < '" 9 9`  0 "`J + 2`*$@'$ `P @  8" @€ `2`P`    ` 9@ 9"!,$?㿘 9. "@ @   9 "   9  [ :@B: [?? "a,    㿘 9. " @  @   9 $"a,2  " @      @ $ 9"!,` 9 "!,?|/-\㿘 8!  cȖJ@ N#!L  8 8@`*@"㿘 !(@㿘 8! 8"a $! @!*!"8N@`N@`%` N@`oq``s`c"N`d``b"0T`l" 0z"B`u`ph0r]`x"h0m@wL`Р L !  ?,@ < ,L L    L  *`:    >0 `L` L` N@` - @0 N@@( N@@  {N@ 0 x@ oN@ % g lc0123456789abcdef㿈 #8@D @@,  ?L?` *    @ ?  *@0    *@ ` 2 ?@ @: ?  2a "a"     2? " 㿘 ?`2"`0"`"`   "` @{ 㿘 "? `"? $2` ? @0  $€ (&  㿘"M?N 12I?8 D?2 @? &  "& & ( $ 2  "& $   (  )& "  `"   "`  ( ?"  `   '  *@A  " ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "O?  "K? F` ??` >  4*` €0l0000(0|00000$0x00 ( `$ $  #   $  " cX 2    " cx " `  $ $    $`* @ː  &@ c`   &@ &@  `$ $    * "` $" `Β  $ $    *` " $"@ `  $ $    *` " $"@    $ $  @  ` #  $ $ 0" # c $ "  @?   " "9 " u @ `  "@'  "@ b `$ $    * "` $" `O  $ $   *` " $"@ `:  $ $   *` " $"@ `%   $ $   " $@  " c $  "  " ??㿘    "#?  ?@Ԕ 0  ? & 06 * ?$@ @N  " 㿘 ??`2@09  "@"``2.? 2!`  8  @`   #  $$$ " $$ "@?㿘 " ?   ?  @     㿘" <& ``$`(€ `2 ( @  (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$ `  `(  $ ($ ,$ 8$  `$ `(€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` - "!*` €00\0000$0l0 00Ȩ?  *`` 4  `&  `-`0  `4 $@&Υ4@@耢 & & & @&``$  &`&@& 4?  &4 "& &`4& & @&``$  &`&@& 4Ҕ?}?  *`` <?#2` @ @ " & &`& & @&``$  &`&@& 4?`&  l o  `& & @&``$  &`&@& 42C  , ` 0 ( @ "?"`21 & 4@  0 4  " ,? ,"@  ` ( "?"@`2 & & @&``$  &`&@& 4Q 8 "%%@&     &?  *``  ?, & 4   !  "&!&`& & @&``$  &`&@& 4 ? `  `( & & & @&``$  &`&@& 4? &4&   2  @ ! #?  *``   *@ *`"  & 2  4     !#* *`"  &  &   $ @  `$`(€ 2&  && & @&``$  &`&@& 4&&  0 `a   6 "#8a8 @,  Z?  *`@ ,   *` `  (" $@& T4` `   @  ??  *`@ 4$@* 4   !  $@ 4 `2! ` `$`( &&`& & @&``$  &`&@& 4%?  ( ? *"@?&  0  !@ *   $4  `#\#` &   !`''#d@*ܠ`$`(€ ?"&& & @&``$  &`&@& 4ޔ@؀ 2& & & @&``$  &`&@& 4ǔ?&& & @&``$  &`&@& 4@  @ 0 4@`  "? ,"   ^&&& 4@ 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘2 `$ `( (`$`(€ $`(`$€㿘 ( (& 0& 4`?w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z- %# `Y G: % 2(@   (@ 2 @(@ 2 (@ 2 (@ 2 (@ 2 (@ 2 (@2   % 2(@ :㿘?c6  ` [ V1?!:& ``@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ ̲` @`@@#@#񀦠,` #+3;CScspp !1Aa  0@` 㾸'H'P\' H'L'T'X''''''''''''''''(@&@H2X$"-   .@. *   .@.8 " ( .@  ,  . ??$  '4 8 0  .@(h&@$H*- h'H'0? 'p @¸  +`??',H'$h,'(*@ @R,*   ''%    #@,@? : d. d &d,@`(p$&$// @ "@68 '.@&@&X$@ @4(#@/  /L   `/'LT (P/ P('6 ,. . &@@ @ @ , 62 $," ? '@ ?.@??2U@ `@$C  2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀 ' (   #?#d#`#\#h   | ?? )! '  )@ 2 ( )!' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d`' !  (  W? ' '@"#\#`#d#h! ? ,?? )"$  )"$ ? (1 $ ' '\#`#d8##\#h  ? 2 (?? )" $ ? )# )#($ ? ( $ ( $ €㿘 20; 2&b4 2&@8 6&8& 㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@`  *!*` €0 000p0l00(0P00)` '& & @&``$@&@&`& 4 ` ``@` 0 4@ `  "@? ,": $@ ` `$` $`$@`  6`  *   6c8+`@ ` *   $ 4   $`$@   $` $`$@ @_   $@ *$@!`&`& & @&``$  &`&@& 4?`  6`[  *   6#8+`  ` ` `$`$ $` $`$@4 `  6`J  *   6c8+`@ ` *   $  4 $`  $` 7$@ @ $`  * .$` *$@!&`& & @&``$  &`&@& 4H?`  6`  *   6#8+`  `  $` $ $@4  ( `   ," "@` "$@26  ,  0 ( @ "?"2$ & 4@ 0 4  " ,? ,"@   ( "?"@"&  ( ,   (`? $`$@2C `  ,  0 ( @ "?"21 ` & 4@В 0 4  " ,? ,"@   ( "?"@2 ` & & @&``$  &`&@& 4 (c$@ & 4?`@ 0 4@& & @&``$  &`&@& 4r $@& & @&``$  &`&@& 4b & & @&``$  &`&@& 4T?& & @&``$  &`&@& 4F& & @&``$  &`&@& 48& & @&``$  &`&@& 4*& & @&``$  &`&@& 4& @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`@  ,  68. ( ǀ`0?(``( ( ` ,4c8`@` (` . ( `2&   &@/@7`6`` 8.&@" "@#`#"@"`"`"4 ` 1"` `&@˹7`(`&@ ` 7 ?(`` ( , %c8`@2 `(` (.  6` "`8.&@" "@#`#"@"`"`"4U? `&@ڹ7`@ (` ?(`@ (`&@ ('@7 &'@/@ `/@ `,  &/@ `(/@ `; `6` 8.&@" "@#`#"@"`"`"4 㿘 4 0@`  ,"` 8 " `"@&`&` 8 <& <&`0腔 ,@@ & 4  (& 4`" 8 " `"@&`&` 8 <& <&`0^@&` & 0㿘  `  `  @/# @*   & &@&& @.@* "   ` 㿘?#@6 6`@  `@  & $ $&@`@@2  ` *  , "@@ 4 "  "  , @@ 4    ,@@ 4  @@*  : : *2@ : @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &   J "     J@*8 ` "@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@000040000000 00000x0p0h0`0X0P0H 0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0`0P0@000(000;0?H0?0@0@0A 0FX0H0H0IT0I\0INetBSD/sparc Secondary Boot1.8Mon Jul 19 04:22:51 PDT 1999mrg@sun4690@` 0123456789abcdef/0 inflate 1.1.3 Copyright 1995-1998 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??TZifxL 4LMTWAT`P4 `@# ` #" $@` `T@ !8 c@2`"` H*/+     "bt "ah0  ""l ""p * ""|!` "!l@holdmonobp v0obp v2㿘  a€  a€㿘@Can't open device `%s' 㿘@ ! $!!  @ ``$?$  "8!+   "h " `0@ 2$@ !   t    $   $`  h@ !h㿘` bt, bt06 * '@ 㿘.  !> @  `2 < 8'@ 㿘  @& `& $& (   €@ " '@ 㿘  !̰ €@㿘  @e $ ? `$ ;*prom_iopen: "%s" error=%d 㿘) !< ?K  @ @ "0$`""0$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` () V`" * @H$`0 "@$`4 " @ $` @ 2!<&  %!<  @W  㿘# a<  @ 4 "$a<@ & 4$a<oldmon_mapin: length=%d oldmon_mapin: invalid maptype %d 㿘 "|*`@  !@ !      `   !@`` @"| 3 a Ԣ&@  ` !la @? Đ`IJ`  dvma_mapin㿘? #@(1? @# dvma_mapout㿘 #@(1 @#h㿘@f " ڒ㿘 @㿘 !@㿐  / < 㿘 "t`     @㿘 "l` ?L "!J@!, "   " " ( " H@ " "tS" "tA @L`" ` "t t`"t  t  " "@"t #` t #`H L J#`  T#`( $#`0 (#`4 @#`#`   @ #` #`(  #`0  #`4 L#`8  #`#`<#`@#`%s: can't open device `%s'unknown㿐@3' % `#  x"x$h   h  "pa  "@Đ @(  @ᘀ "t@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐) !(@a +   #`@a a, @E ?!0c' 5 / - ,`2 x@z    a( "!(@ ;@&!( @` `a,@?@2 @a aa a,@ a,`@Ʋ@    *@ ` 00 ?@ @: ?  a4 "a4"     0? 0"  㿘 aH'H'L'P'T 'X @ "aH@fH @"㿘 " , @  @ , 㿘'H'L'P'T'X@FH㿘 . " @  @    $"bx2  " @      @ $ ""x`  ""x?  X\@`*@"X㿘 !(@㿘 ! "a\ $!X#@!X*!X"8N@`N@`%` N@`oq``s`c"N`d``b"0T`l" 0z"B`u`ph0r]`x"h0m@wL`Р L !  ?,@ < ,L L    L  *`:    >0 `L` L` N@` - @0 N@@( N@@  {N@ 0 x@ oN@ % g lc0123456789abcdef㿈 "@ @@,  ?L?@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" 44<444444444 4444 bootxx44,4, 4h'4p-4 44=4H4N 4lW 4pd40n4v4(4p4 4x4 4444<4p44( 4 4\44& 40/ 4h@ 4lH 4pQ4X4 b4`i4t4$4404t44 4 4t 4x 4|4`4 4 444 H484t$ 4)45 4  @D, @'G$`'8$+#@  /8@e / "% % @<@”@ `Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h#<b $   Ɩ ? $               ? ?#! ? ?@ ?#        bؖ??"@ @#\ #`?#! ?04@! 0? ?#@`̀  ?0$@@`̀ ? ?#@a  0 @@a  #d#h0   #d#h0  #d#h  Ŕ  - ?b $b8  &  #  ?#`#\ܘ ?#! ? ?# ?FB?? ?#!  ?1@! +? @?#`̀  ? @`̀ ? @?#a "  @a # #?8  ?#!  ?. @! (? @?#`̀  ? @`̀ ? @?#a    @a 2   #d#h   Ř  ? 8  y  v 䀠!b` b#\   `#`#d#h  \ ? G8  V  S G"8b`b  %<$ $$ $ $  ` ?P  8 `  ?  x  ,  )  $@@6㿘<"@`@€ 㿘<"@``@?㿘<"@``€ 㿘<"ܔ@`` ?Service unavailable㿐<"@`  `  ?1 !@  @ m㿘<"@`` €*`:` J " _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-a ] 㿘; b`@^!x@ . a:vnhsysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@#G'G-G%G! "  n aG0 v  0 "0 $b $  %$@"Ȁ?• h!8 Ȑ& *` ȑ*`@`)G`+Gb3G%ap&b '%",G   d!'''  @* ? b@X    b@   1  ""$b 1  ap@K" b@G# ,@C# b@?# b@ "耢  b@ ڒb b @ Ԓc8   $ c@@ b@蠒 ,@[  @ @ ap ",c`@  @Ē @I @* `2"@", cp@  @   ",c`@  "@) 2 b c@ܐ @@)Ȑ耢  c@ϐ @)א nlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 0'8H@6  #@   H  "    #`@) 0@ x  #`@] @&  #x@S0QȚaB + cB + 3`  ; 2`* @ *`  @    #@06@)ȕ:  ̀ #@'0#@))G"    ` @@ a,c?   ~?# ! ? ?#  ?JF?? ?# !  ?6@! 0? ?c@  ̀@ ?%@@  ̀@? ?#@    @@ # @?B #@?;  ?# !  ?1 @! +? ?c@  ̀@ ?  @@  ̀@? ?#@   ` ?@@ ` @ @? ?# !??? ?#   ?&# @ ?" #  ?#    @ ##@? #? ?#    #@ "#H G    @ GG#""" "a #` #ؒ     @@&*@'2 G!G!`$"(   (@"   @  X  ` @Ւ  p@ђH "( @&@" @a &&  `  %s: devread: lseek%s: devread: read㿘. >@' 2 @ c@ @' c@ statfs: %sffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: Too many blocks%s: block numbers: %d  %s: block numbers (indirect): indirect block0@ o  c`@9 @ ݒ `P@/ ``@ `   `h@ Y  `p@ @ h `@ @$p  cx@  @'<c  Y@$ 0 `@  @#  @"  @",@   @@# x `*  d 0,  ؐ/@v xG 0* " 0 :``@ 8@ϐB G ( G`@ " 'G"@က  @`(`(  3G/,` db*က`"  @` `  쀤က @!?က ! @`X 0!@ϒ t@   -G+,` d*က`"  @fa t`@  뀤က @U!`@8  㿘8x`   x $ x?@ x  x㿘G! !`     `@  G!, @@?, @!`㿘Dc  "c%s: illegal option -- %c %s: option requires an argument -- %c 㿘G|  8!8 J`(#G8"| !8+ @$ J`-"J"` $ J - J`    "`"$ i? #GJ $ ̀`:$at@7 2J at- V?J`88`Ȑ "`8 Ā`I ?N :E8`;!x0bh :  G"b0J6at8`Ȑ 0"` J@ 8G"""0Ȑ ""`$ N`:8 : Ā` 8`;at!xb@  ?* @G"b0"``$ "at㿘!G"2D#$""*@# " ?""$" *"@" FCC㿘 @Z ?@@%.㿘! , @ €?  , ?㿘'L'P'T'X@ L$$ %s: 㿘;8!xbh@h`@@^bp@.㿘'H'L'P'T'X@HELF(@"6 Ȁ @&? "#\   @3 ? ?(b@ @x?ELF(@"  ?  Ȁ @% "#\   @  3c@V   .0@ % @(  `  *` * @ (( ( s `o @ j``d@ 2  ``J " **2@"` @ `   E` @ ";``J`4`_, @@ΐ 2%` @ $  "     ,? ,? 2  "4 ? ,?4? -@ ̨  `@?c)?#'H  @0 2??@ ?# @!2#?a.#?  ?# !#!#?#?  ?# ! ##? #? ?#  ̀O?#?cx @  ː#?    ?# ! #?  ?#  #TO##?   ?# ! 2 #8@! 3#?  ?c@  ̀@2 #$@@  ̀@#?  ?c@ ! @"  @@ ! @2# #? F ?   ?# !  #8 @! 2#?  ?c@  ̀@ #% @@  ̀@#?  ?c@ ! @"  ` @@ ! @2` @  # cx  8 D@c cx@$ "{? <"@#\   @-H@` ``J@ **2"` @  ` @" ?`р`H7 @) "@@"9 3&@``@") 2$ H@`" ``J@ " @ 2` ?$  ,?4 ,` @    ?Ӫ` `@@%s: : %s 㿘@#;8ax a8@  @8a@@!!H@k@㿘'H'L'P'T'X@H%s: 㿘;8!xb@ @ @xb㿘'L'P'T'X@L㿘;'H'L'P'T'X! @H%s: : %s 㿘@#,;8ax b@M` @֐b@C!"@ @;@ 㿘E``@+ 㿘G"`G`?, @`, @?, @`2`G!x @libcUnknown error: %u㿘#@7 `. 9  @ @ *?@ @@:NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @Ӓ / @@& 2 @   `r*`:  :m %a   ?* : `(R!*` €RS RS S S S S S S S S S S S S S S S S S S S S8S S S S S S S S S8S S S S S S S S8J@ * @ &`*J@  @ J@  @ `* @ :  *: * L *@?2 L    `?(@ߒ ?,@  @ $?#\    @ @ ?2???#@ @Y  && ̐@E?㿘?2 @!@    ;  ?@ 0@ 2`@ :`* * @    @ `@  @ 2  : *@ *` Ԁ6@ @ 06@ ֒@ @! S"㿘? @!z?  "" @ @h `______x_`_H_0_^^^^^^^^h^@^0^ ^]]]]]]x]h]P]@]0]\\\\\h\H\0\[[[[[[X[@[ [ZZZZZhZHZ0ZYYYYYpY`YHY0YYXXXXXXhXPX0XWWWWWWhW8Value too large to be stored in data typeNo message of desired typeIdentifier removedNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0U㿈'XX#d#h#\  @T#`  *`:`J    @ @(*`*$ 6a@    J@*8 ` "$I 6a@" @ ` ?  2  㿐@㿘 - 'G 2 L0&$: &@!   J =J  = "@2 2 N =   @'P'T'X`"7''''@ޔP*?$ 6a@2 J@ ""  J@J`   $_ 6a@㿐#\#`  @p   㿘@=@b @ 㿘'L'P'T'X@L$  #*0 ` + +    "*2"*㿘` @A&`&`&` @   ? ,$ 7''7'''''@1 @7 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.@F'D'P '@'H'L  2  @Ɛ " @1? J"   V =''''X %3@l@j  l@ $$@ '耢 'd X'X `  'T?/_N@``X)#*` €ֲi`p|p|i|p|p|p|p|p|p|iip|iip|j,j4j4j4j4j4j4j4j4j4p|p|p|p|p|p|p|p|p|p|jk$p|k$p|p|p|p|jhp|p|m`p|p|p|p|p|nDp|p|np|p|p|p|p|p|p|p|p|p|jjk$k$k$jpjp|p|jxp|mmdmjp|mp|nHp|p|nO_ 2N@ /_'T 'T +/_N@* ` &~?}N@Ѐ   , * ?РN@Ѐ` ` &m?lg , * ?РN@Ѐ` `\'TXV@N@ l2R`O @{/@ ? @* : :  6  -/_` ?g  G2 " ??H@IH  : H  -/_a< @%H "4 `#`H#\k@dgGed$ gg E e ed 'd@A`'D f`  Ok   Ok  " Ok  -/_ X:`:2 @Xv2Xq" ? @ Z " '@  O x` "   @# "$/_@ ? @ ! "(" '@? @  2/_ 6 `N ",  3, ? , 4` `4 0 ,`402 0/,  @`0  @, ` `0,, 4`@ ` 4   ,"@@ '?Ϊ@/@ /__  2 2'<T  - #:` $$` '耢 ' ? 4$`$$@ '耢 ' O_  _ $$` 0/8/9 8$$` '耢 'Ò r<3'@T  - #:` $$` '耢 ' T? 4$`$$@ '耢 ' >'@ - #:` $$` '耢 'v %? 4$`$$@ '耢 '`  e$$@:: H BTd"` $$` '耢 ': `@P$$` '耢 '" Ѧ`? } #:` $$` '耢 ' ? 4$`$$Q@``"` $$` '耢 ' P$$` '耢 'Ӓ d  - #:` $$` '耢 ' h? 4$`$$@ '耢 ' R`$$@ N$$@  '耢 ' 7`"@ - #:` $$` '耢 'n ? 4$`$$@ '耢 'X "h $$`$@  '耢 '< "h $$d @ '耢 '& զd$`"$q@ ` 4 @Q  @ ./8/9 8$$`` '耢 ' : H B `$$ /@ `? 4 #:` $$` '耢 'Ғ ? 4$`$$@$$` '耢 ' dD$$@ '耢 ' Q0T  - #:` $$` '耢 ' 5? 4$`$$@ '耢 'q 2! T@&X 'X` 2 'ۦ耢 T 2 ' @?'XX㿀?&\ f'   e E  :( 9/ -/?#\@ ?耤 g G f# fJ 02 @:( B  '@@:( B3'@   0`*@@ '`" "@ ``, -,   +,  ` @ 0.@r ` `0􀦀 . .   & 0. `0. &㿘` ` `2 @@ِ "@@D? "`   2` `$$`, ۤ`" $&`װ w " `   * : !"`"`@ " `. `*.  @` ``&@` $`$`$@$`"`*@@ `@"$`$@.@`@ @@@$@ 2` `` `,` $r` ` @ݔ`@"$`$@`" $&`_   `  `2` @[ "@  ``` @@   @@@=$@ )0   `,` 0  @`@"$`$@2`@   `" $&` ` ? @4` 㿐@㿘@  H 'T:,@  :8?T  `2;@  0+4`444`4`4`ؗ445`5`'75`5`@ ڮ27```@e`@M`*  @[@C`*  @Q@9`*  @GT` @,T ;@-`-2 ,`- ֓2`@ Ū`` "` '`` ';`   đ. ?3@ "@ `*`# @ 'Ā@ .`@`` @@`@`` '`' `'- @@ @, @@Β * 2 5@?c  @. 2, @ ? ?#9@. @ , @'@?""6`4@'  @"6``4@  *. @?@ @ @ 4@ 6`@4@Ĩ 3@`'`' T`%`@ .  "@?:@* @2 . 4@*  *`T@ ;@̑* Τ Г*`@  +     @( 82 `+ ( 2;```0  ?2 `2 #;`` (` `?#@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $NetBSD: strlen.S,v 1.3 1997/07/16 14:37:52 christos Exp $ J " "  `  ?2  㿘E!h.  ` @ " ,, @ "`"`"`"`  E`h("@ 㿘 ? # @ ] @4`@ W4  *  $2  &-    * @ Ȑ - %@ & 㿘@ϒ   *`   " " `   N  &N     &N?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘'  " " 㿈 `@6 ' ` @ ` ' .@ '쀧@% *%`, @ ,`' @L@?   @ r 4  @ @ j4`5`44 4  $@2 "? @ N 4` 44@ F5` @   4 $`@  쀦@   2" }㿘` %h*  6``#!E!``]"q$! $@ 2[$@"`" 6`R6``2@㿘6` @ *@  X   "* ` " * " 2@ ` "`" & B`(` " ?8 㿘     V     ` ? * `@ +? # @ @"  23`0"  `  2 33 @  ?#? @ 2 2`   2  33   ? 2 ?   ?0   0 4?8      ( ;``"##㿐  * ? "@ &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐E ?. . 6  `''`'ؐ   " *@ $ 2 '$   $   $  $ $   ` 5͐@& "@ Ε. &. "@&㿐v?o ?`" *"   * * #??āh@ 'H<` @   @       ' ` @ `2`*:  - +` @ '*` @*:  ր 0*`M@ `M@ 0 @OH*: '   / 9  -*   ?4`* *  ?Ъ`M@/ ,`: L'` M@0Ϫ`M@0`π =e ' Ѐ` 4e`)`     -*  4 * *     -*    * *   `M@В` Ҁ`e EK 2 `2"Ъ`M@+ -Т `M@Ѐ 00Ϫ`M@0"`π #Ъ`M@/%@ 9 +  *  `M@/?А%@ "" `2     쀣`H%'쀥  ':0B? :'?" *`? H:0BD? 8 @ p 24%SH!  :?" - ! B"   %:?b + % @ D-@$?% B :?" *` ?$%E :" + ?  B?4 2@ "";{ :؀ 2+`?@ B?`?, ?+`( B?  $(#a?_]  :" + ?  ?M23 :c 2+`? B?`?c+`@: D(? F*?()B"?# D$?% F@ "  "`H,?@?w   ` '\  0b7 !#   P #   ? # A?? ?:( ?! B0+ :8! +: :@&6'?::@H$1:@::P0PB'1P B&''??@?؀ ȉB1 %?, ??? @'cȉD?   #D?:@ :P BB?Y?? @D?   F'  €:?::X :` 0h ``*@  {      􀢠  $@  ?<3 6" @   4 `% & $@  k `  ^` &` ?   # nljhfH2 ?(耠)㿐 `  -'`@ @   @ɒ` 9?#  5?@@ @4` @  "@ @4 `2`23  @"  2 55 @ߨ  ('` "'`ɐ 7?#`  -?@ @  "@ @44``2`23  @"  2 55 @    ('` "'`InfinityNaN0h%E`'L'P'T?Ȩ ''܀ ''Ed *@ " "$`Ȁ6'@ '@ ( ' : T# ̀ +?++  \N    \ pȁB# T  \+а`   Ȫ0' 'E?+| &'$2`   @Ȓ"@̐$( 0@ ̐"(' :xB?? {'ؘ':?::㘅L::pDHFF'B#  ':b -@ȁ)'"?    '& 'L 8'LL 'L L ('+#( € ?'? 'P'PP 'PP' 'P '`  ` $dd,   @"dd$` ` Ș$ : b * 5@ :Ƞ " ?Ȁ  :"؀ 4 /`@B `ȡ ?철`:b * ȡ6`@ B?:"؀ 4 /`@ȡ B?Ȁ `쀠:ȁ9'  :㨨B?':?0 ȅND'':㸤 ?ȁ   +01 P|?耠H:?:* b @ȑN'0/ȝ?ȕʁ  [ :01΁  @6S?:ȕDD?ȑP'0.ȝ?ȁ  9 01΁ `@2?Ȑ?b * @:B Ⱥ`D?Ȁ@P'0.ȝ? :Dȁ f.ʣ/ 9 ?Ȱ?N 0"? ?Ȭ  ZY:" -P !     :㸅Bȁ 1//9 0::Bp?ȁDͺ`Ȁ@ ƑB'0 F.ȝ? ȝ01N?ȁ -?01F?̐ 0?N 9`. 'Ԁ! L ?؀$3 6" &$' &  ` @4%&&@耠` iߒ Yǐ 䀠PL̀2'?2 ' ''䀠 *`M  "  ` "```@HB쀠y       L    W  1Pˬ8 1/ Ƭ耠`܀'eԤ* @    t Ԁ  l  'Ԓ e 'Ԑ ` ` 0$ ` =` L ̀ `9+ 4`f.& ``L`̀` ڒ 4`2N.`"K.``:  9E. `9` 9.- ;..@    ` 0.@ k  4 ??`N  1?N 9` ./ N 0"? Đ Ԁ2. 0/  .T \2  "  J` ? `   ?J@"J@@  " *   J@J@"`   `  `(*`  㿘G!`2 @% 2 +? 0`  @@" @N  & 0  & 6 & 6   2 @   &  &   &  㿐  C & & (&@&@  0  C  & 6 & &b\G"!x& &  &@hV  2  6 0T  &&@  &< ؒ`?&$&@(&@ $ L( (4!@"$p. * "* @T  2 ?  ? + E!P!? PH? ? ?   ( 0 8 @ H??:::::::@::::`XXX㿘G!`;@N;!   R X 2 &  ?2 2 """""""0"4"D"H㿘@ ;a " `   ` "@`4`x $㿘0@"0\GG "!x"a㿘 2 0@"0  @0 "?@㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, ;`$;pG       $((()(*(+ (,!(-"(.#(/"`;d G;h"d" "` "`Āxx.İİİİİİİ$NetBSD: umul.S,v 1.3 1997/07/16 14:37:44 christos Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@+dd10(#x? `'1"X*` €$ DPǀnjǘǤǰǼ ,8D,8\hdtP _  @6耢 ?}{ d W  O   J  G  I  A  >  @  = % 5  2  /  ,  )  &  '='                        &''  #? ܖؘ @ǚ ? ܀ ?@ " ? ܖؘ @ ??܁h@Ȑ: @ @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $„ 6a@% 6a@㿘 `@Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*㿘%GX #X@R$X@V ?   X X@I?-X  *` `G"!\X  ?G!\@ 'G@ @`'G,` 2 @ 2 "@ ..  㿘  * G!X@ @G . ? " "?      G(" 㿘  vK`2 D   @=   G<<@6 & G!X * ??  !X *  @@ 8 @  8@MG *       $* ?㿘T @8  P>  B< P ?Đ*@4 㿘 !" V   @7  ?Ĕ*@ 6 V @㿘T   @$?  2  ?Đ*@4   4 < P㿘@V 㿘;!Ц ? T` "??`X2㿈1G!` !`   ?'  @ ?!`?!`@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  $ 6a@$ 6a@$6 6a@$ 6a@㿐#\  @  $NetBSD: sbrk.S,v 1.5 1999/03/31 18:14:27 kleink Exp $<0   : 6a@"0/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin㿘 @oj `@a \   X W X"5cH@x XM    E "@  ?`66 *` € (0T8DDDDDDDDLT#?###    (",&  &@ "?$ʄ 6a@$Ƅ 6a@$NetBSD: cerror.S,v 1.7 1999/03/31 18:14:27 kleink Exp $㿠@b"??Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*G"$$NetBSD: crt0.c,v 1.27 1999/01/22 11:29:17 mycroft Exp $*P*@*0$NetBSD: getopt.c,v 1.13 1999/01/09 20:31:07 kleink Exp $>`$NetBSD: atexit.c,v 1.10 1998/10/18 14:36:30 kleink Exp $$NetBSD: nlist.c,v 1.13 1998/07/26 14:18:18 mycroft Exp $$NetBSD: errx.c,v 1.3 1997/07/17 21:33:22 thorpej Exp $$NetBSD: verrx.c,v 1.3 1997/07/17 21:33:24 thorpej Exp $$NetBSD: warn.c,v 1.3 1997/07/17 21:33:28 thorpej Exp $$NetBSD: nlist_elf64.c,v 1.3 1997/07/13 19:46:08 christos Exp $$NetBSD: nlist_aout.c,v 1.8 1998/11/13 10:26:19 christos Exp $$NetBSD: vwarn.c,v 1.3 1997/07/17 21:33:25 thorpej Exp $$NetBSD: warnx.c,v 1.3 1997/07/17 21:33:30 thorpej Exp $$NetBSD: vwarnx.c,v 1.3 1997/07/17 21:33:27 thorpej Exp $$NetBSD: err.c,v 1.15 1997/07/17 21:33:21 thorpej Exp $$NetBSD: printf.c,v 1.6 1997/07/13 20:15:18 christos Exp $$NetBSD: verr.c,v 1.3 1997/07/17 21:33:23 thorpej Exp $$NetBSD: strerror.c,v 1.11 1998/11/15 17:21:49 christos Exp $$NetBSD: exit.c,v 1.8 1998/10/18 14:36:30 kleink Exp $$NetBSD: __strerror.c,v 1.14 1998/11/15 17:21:49 christos Exp $$NetBSD: __errlist14.c,v 1.2 1999/03/22 19:03:39 kleink Exp $U$NetBSD: mmap.c,v 1.10 1998/11/15 17:23:00 christos Exp $$NetBSD: index.c,v 1.9 1998/03/26 23:53:36 cgd Exp $$NetBSD: strncpy.c,v 1.9 1998/03/26 23:53:37 cgd Exp $$NetBSD: strcmp.c,v 1.10 1998/03/26 23:53:37 cgd Exp $$NetBSD: memcmp.c,v 1.9 1998/03/26 23:53:36 cgd Exp $$NetBSD: getenv.c,v 1.12 1998/11/15 17:13:51 christos Exp $$NetBSD: snprintf.c,v 1.8 1998/10/13 14:19:21 kleink Exp $$NetBSD: strncmp.c,v 1.10 1998/03/26 23:53:37 cgd Exp $$NetBSD: pread.c,v 1.4 1998/11/15 17:23:00 christos Exp $$NetBSD: calloc.c,v 1.9 1998/02/03 18:44:14 perry Exp $$NetBSD: fprintf.c,v 1.6 1997/07/13 20:15:00 christos Exp $$NetBSD: memset.c,v 1.12 1998/08/09 22:48:11 wrstuden Exp $$NetBSD: vfprintf.c,v 1.30 1998/11/15 17:19:05 christos Exp $ 0000000000000000$NetBSD: fvwrite.c,v 1.11 1998/11/15 17:19:53 christos Exp $$NetBSD: umoddi3.c,v 1.3 1997/07/13 20:01:58 christos Exp $$NetBSD: udivdi3.c,v 1.3 1997/07/13 20:01:56 christos Exp $$NetBSD: qdivrem.c,v 1.6 1998/02/03 18:31:40 perry Exp $$NetBSD: isnan.c,v 1.4 1998/10/13 14:43:38 kleink Exp $$NetBSD: isinf.c,v 1.5 1998/11/14 19:31:02 christos Exp $$NetBSD: memchr.c,v 1.9 1998/03/26 23:53:36 cgd Exp $$NetBSD: strtod.c,v 1.32 1999/02/06 16:01:22 kleink Exp $?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?$NetBSD: multibyte.c,v 1.6 1997/07/13 20:16:48 christos Exp $$NetBSD: wsetup.c,v 1.7 1998/02/03 18:41:25 perry Exp $$NetBSD: makebuf.c,v 1.10 1998/11/15 17:16:27 christos Exp $$NetBSD: findfp.c,v 1.12 1998/11/15 17:19:53 christos Exp $lXѬ lXѬ xlXѬ$NetBSD: fflush.c,v 1.11 1998/02/03 18:41:07 perry Exp $$NetBSD: localeconv.c,v 1.9 1998/11/13 15:49:03 christos Exp $hĈ$NetBSD: infinity.c,v 1.4 1998/11/14 19:31:02 christos Exp $$NetBSD: sysconf.c,v 1.9 1998/08/03 14:41:21 kleink Exp $$NetBSD: isatty.c,v 1.7 1998/10/13 15:05:02 kleink Exp $$NetBSD: ctype_.c,v 1.14 1997/07/13 19:45:45 christos Exp $ ((((( AAAAAABBBBBB $NetBSD: tcgetattr.c,v 1.4 1997/07/21 14:09:16 jtc Exp $$NetBSD: bcopy.c,v 1.10 1998/03/26 23:53:36 cgd Exp $$NetBSD: malloc.c,v 1.16 1999/01/29 08:11:36 kleink Exp $$NetBSD: stdio.c,v 1.9 1998/11/15 17:19:53 christos Exp $$NetBSD: fwalk.c,v 1.7 1998/02/03 18:41:16 perry Exp $$NetBSD: getpagesize.c,v 1.7 1997/07/21 14:07:11 jtc Exp $$NetBSD: lseek.c,v 1.6 1998/10/14 11:25:19 kleink Exp $4$NetBSD: sysctl.c,v 1.8 1998/11/18 20:51:51 kleink Exp $$NetBSD: bcopy.c,v 1.10 1998/03/26 23:53:36 cgd Exp $TZif}lLMTWATTZif dfqp&` LMTWATWASTTZifWATTZif CATTZif,TLMTWATTZifH8LMTGMTTZif (t*0LMTEATTZif ȓ{ˮ`)ͬϏfЩyф`ҊP6c`-P ``mﰳpy%ZYsp;Up6Ep9۾p%gYpIap+C Հ$Ep x < 1pdt(pU\np7OPHp{<pp4g p!a"z\p#D $b'p%%S&^`?sWP@@`A\sBh"`CE7F1 FHHIJKLPMNPO`PdPQy`RDPSY`T$PU9k`VdPWM`WYiYbZK[D\-]&^_m`aV%Pbac6PdJ`ePf*`fPh `hխPi`jPkx`lmn~ovp^oqsXr>QsS:t3u3vPPww2Px`yPz`{P|`}P~`fP*0 *0 EESTEETTZif D<LMTGMTWATTZif $h*0ADMTEATTZif $h*0ADMTEATTZif慤LMTWATTZif*'6dd LMTBMTWATGMTTZif 0fLzP.-ͭ`ŮPǐrʴLSP̕5 LMTGHSTGMTTZif \0$LMTGMTWATTZif ē gadLMTWATGMTTZifšǑG/"*0#(& LMTEATBEATBEAUTTZif FʸΎn~Qp *0LMTSASTTZif _laMMTLRTGMTTZif $ݻ#`xe/?pNB`p+*_`̯`z p` pJp!a~"Rp#D$4%%7`&@'j'1\2O3D6p45j \     LMTCESTCETEETTZifFð  LMTCATTZif LMTGMTWATTZifT,LMTGMTTZif tȐ LMTGMTWATTZifQXpҡ25'%r@pkm aG ?pQ'po  LMTWESTWETCETTZif H ѰLMTWATWETTZifF LMTCATTZif\Fḫ͞op&-.i/}0H1g2(3F45&ɀ5ސ778捀9:o;<=qf>n?Z@oPA:eBO2CGD/D)FF GH'IJ KրLMNb͐OwPBQ`R"S@T U {UW]WrX?YTZ![6\=]k^_T4`ia4bHcd(ŀdڐffӼghiѦjkl|mjn\oqLpA?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    WETWESTCETCEST . .. Cape_Verde( St_Helena(Faeroe Reykjavik( Jan_Mayen(AzoresMadeiraCanaryBermudaStanley8 South_GeorgiaTZif Q̕ t| @LMTCVTCVSTTZifBXJMTGMTTZifs mX#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yLMTWETWESTTZif@`шrQMf&C& %ˬB ͌$μ lМ K҅+ʠe9 Eq %S p w ܹY 4 ޢu߮ W b9m BM !6ؠ   ~ ` Bj _ S_A 3?# d F (E l  RMTISSTISTGMTTZifEGTTZif tK㠜 ɟ_pAn#)O @k"p>rP 2h䐸ՐƐ{ xhzXk?!8M:XȐK<˵òh͕ܿQgrېu3ϬRХUьf2҅YI9@)@@ @@@ܹu@ݲޢߒsrdbURFB72("E@ 6@'@@ @@@@@@z@j@cSC3#qb )Et6d'T&D 4#̠۠˰Ӯß    | l !\q "Lb #A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y     HMTAZOSTAZOTAZOMTWETTZif pK{Րɑ_bA瀣n}#Oɶ2]zp0rP2Zրǀ︀mx{hlX]?8?:X=.q˵àYܱ͕CYpr̀u%ϬuRХUьW2t҅YI90)00 000ܹg0ݲޢߒterVbGR8B)2" 70 (00 0000000z0j0cSC3#rcT  7t(dTC3#ܐ͐㽠ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   FMTMADSTMADTMADMTWESTWETTZifv\A M63#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   LMTCANTWETWESTTZif  ` P ` xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`HLMTASTADTTZif{ D_ 0?c@0ACBa0C#DA0EF*ϰFoH Ȟ@IꓰJn@KuLP@MWNl2@Ot0PL@QsV0R+@SS80TU30UW0WX0YZ[\ܰ]t|^_]@`{a={@b[c]@d;dd?@f$0f!@hc0h=iE0jk'0lm 0neo%pEqmr%sLt@u,˰u@w wΈ@x쏰yj@zլ0{L@|0}wh~p0WJ  SMTFKSTFKTTZifGST . ..Comoro( Antananarivo Mauritius(MayotteReunionMahe( Kerguelen(Chagos(Maldives( Christmas(0Cocos(TZif(*0LMTEATTZif 3⫹@,*08@*0LMTEATEASTTZif58@LMTMUTTZif*h*0LMTEATTZif948@LMTRETTZifd38@LMTSCTTZifabFP___TFTTZifFPIOTTZif/ØDFPMMTMVTTZifbpCXTTZif[hCCT . ..Casey@Davis@MawsonDumontDUrvilleSyowa@PalmerMcMurdop South_PoleTZif̀p___WSTTZif @GGbp___DAVTTZif 2T`___MAWTTZif Լv4``<___PMTDDUTTZif X*0___SYOTTZif柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď q0]V?8\@>@p @ Z0!o@"90#N@$0%8%0''١0()½*צ+,-.j/bc0@1BE2`i@3"'4@K@5 D06 @7հ8@809+:0; <0=>j0?@SʰAhB3CHDE1@EpG@GRHv@Io0JX@KQ0L:@M|30N@O\0Pz8Q;0RZS0T9UVVװWXĹY@Z[¿@\}]@^m0_@`M|0abe@b-^0cBG@d @0e+ce"0g Eg0h'i j klmun@oUưps@q5rS@st3@t0v@vމ0wr@xk0y܎zM0{p|~/0}R~gK|4 ___ARTARSTCLSTCLTTZif  ` ~^>xgXIf8+`!H`e`*`G` `)``g `` F`!`"0 #i$%.`&B' `'$(`)*ͧ`+#`,`-`.k`/j`0mM`1J`2Vi3*`46K5 `6-678Ӌ9:m;`s1?~`@\N`A^`B<0`C>`D`Ex`E`GG`HvI`JXKL:MNOdPp9`QDzRP`S$\T/`U>V`V[`W`X=`Yϣ`Z`[\`]^l`_x`UaXeb5c8Gde)egF`gՇh(`iij `k`l`m~h`n`o^J`piq>,`rIs`t)u*v v wrxyTz{q`|}S`~fr5` ___NZDTNZSTTZifa8 *`*0LMTASTTZif@8@?HAFTTZif u H P'0@50̅te|V lG!\8"L)#<$, %& '`' `(@( p)xp)0*ĥ +`,`-`.`/t`0d`03=4Rk5r62M6T8j`869L`:;.`<5`=`>`?`@e`ABE`CcD%`ECF`G#GIIΝJxKL̕`MaNw`OnCPY`QW``Rl;`S7B`TL`U$`V+`V`XX`YZ`[\]^_`_a}`b?c]`dne=`f`gf`gm`hH`iO`j*`k1`lFm`n(og`p qQres0tEuv.`vx`xЙy`z{{Α`|`}s`~yz`U` )*0FP 8@8@FP 8@ 8@*0FP8@FP8@LMTYERTYERSTAMSTAMTTZifrD P'0@50̅te|V lG!\8"L)#<$, %& '`' `(R@( p)@*ij0*p01]2r2p3=4RO5d6216F8N@8(90@: ;@<'P=@> P?@@ePABEPCcD%PECFPG#GIzIΏJ\KqLy@MSN[@On5P=@QWRPRl@S74PTL@UPV+@VPXXPYZP[\]^_`_a}@b?~c]@d`e=h@f}PgJ@g_Ph,@iAPj@k#Pl*mPn ogPpqQres0tEuv.@vx@xЋy@zm{u@|P}W@~ylP9@                                          .*0FP 8@8@FP 8@ *08@*08@FP8@FP8@LMTBAKTBAKSTAZTAZSTTZif /l8@*0LMTGSTASTTZifۆq̕2ݨҘO R[hMX T` T`HMTBURTISTDACTBDTTZif t!aMT MXT`LMTISTBTTTZifDgGkixpLMTBNTTZifs\њgZ$[h~ [h RMTBURTJSTMMTTZif oD$_ГAb\cbppLMTSMTICTTZifxǐm6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#vwp ~~ LMTHARTCSTCDTTZif \'pZ6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#q~pLMTCDTCSTTZifm6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#cbp~ p LMTCHUTCDTCSTTZifdm 6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#RT`~ p LMTURUTCDTCSTTZifDǑm06ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#G<MXFP~ p LMTKASTCDTCSTTZifFiZj8ԓJB8֚>A.$9ܸʨޢ8߭8(Oi8v(/K8_Ǩ-8?I+m Ol(wѸN(W0(@8h( 8G(%~8a(`8C(B8_^A@#"~n]MG(78&(8 ( 8 ( ֩8 ƌ( 8n(98ol{8ON3k~p p LMTHKSTHKTCSTTZif(їazpyBZ:#p<fp&pYݪrsߵdp|ᖗ]wp>0 p!qp p ?/ypVp ݉ ν6~pCDTCSTTZif*$wѸN(W0(7dh( 8G(c'`8C(B8_^A@#"~n]M=p-& ( 8 ( ֩8 ƌ( 8n(<vo;p_:Op8]j|~p p LMTMOSTMOTCSTTZif w ݒ d P 9``uOc`SPM3P#`P`P`hPg`fe|H lG!\*"L)#< $, %& ' P' `(P)`*P+`,P-`.P/t`0duP1]2M3=4-s5r62x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yH*0  *0LMTEESTEETTZif u  P'0@50̅te|V lG!\8"L)#<$, %& '`' `(( p)`P)P*@+P,@-P.@/tv@0dY01]3=f4RA5V62#688@089"0:;0<@=0>@?0@e@ABE@CcưD%@ECF@G#GIlI΁JNKcLk0MENM0On'P/0QWD@Rl0S7&@TK0U@V+0V@XX@YӰZ@[Ե\]^_y`_a}0b?pc]x0dRe=Z0fo@g<0gQ@h0i3@j0k@lm@nog@pqPre°s0tEuv.0vx0x}y0z_{g0||@}I0~y^@+0    **0FP 8@8@FP 8@ *08@*0FP8@TBMTTBITTBISTGETGESTTZif ۆq̕2tR[hMX [h HMTBURTISTTZif x`˿<&d g ix~ pbpJMTJAVTJSTTZif]Րˈoop~ LMTMMTBORTJSTTZif  h~ LMTJAYTCSTTZifhl}Ht-@@0:@UgEJ7-( v()KH*t8+~,-H.8/m0c1OH2DB831H4&8566H7.8889a:;z$?oM@[XHAP8B=HC38DE9FDHFm8GwH֠IJ%K0HLY8McN{OgHP\8QJHR?E8S+OT xU HV8VW߸X;YdZoH[8\]˸^sH_h8`V[HaK8b7c,dHe 8efg)HhR8iHj8kl mHnu>8oaHpVqqCr8s%Ht*8u4u]vhHwܑ8xHy8z {I|TH}}8~mb080818FP 8@?H ?H 18LMTTMTIRTIRSTTZifq 0<0hPPC@̓@Pte|V lG!\8"L)#<$, %& '`'x(纀)*?+0,s-d./|0m1_2P_3@P415!6778<9~:o;<=>ր?z@k[A\BLC=рD-€EFG8G{H⽀IҮJKL$MNXOwPhQXRJS:T+DU5V wVWXY0Z![c\T]^ـ_u`e aVObF@c7d'tef f;g,hoi`jklmn[oqLpbqRrCs3t$u8vzvkwx؟yzҀ{|W}~}ǹ)*08@*08@*0BMTASTADTTZif0EYPͬϏfЩyф`ҊpekZ`/pF۴4ܹ ޴΀ߤvV}J`64tҀ'O| ` 3``P `!I"]M`# $Z0`%?P& &'(P)`*+e,-G._P/{)0H1H2?W@lA7BLCD5DiFFpGoHhpIQJJpK3L,pMN`pO~2PI*Q^R) S=TUUVWȲXրYZƸ[p\]qp^|_Qup`f^a1WpbF@c9pd/]dpf?f7g!hijklymnYowpBpqWŀr"ps7tpuupvkwdpxyFpzj{b|L}kD~.K& *0 8@ JMTIDTISTIDDTTZif΅p~~CJTJSTTZifw ry P$7` j P u #``r` `P r`!bP"R`#K$d`%+&7o`' ( s(JP)`*f+e,H-G.x/d`0X1dF`2A`3D(`4!`5$ `6`7`7h`89J`:;f<=H>?j*@lAJ BLrC)D5`E Fq`F`GS`H`I5`J`K`L`M`Nru`O~P[Q]R;sS=TUUU7VWX`YZƜ`[`\~`]`^``_c``fB`aC`bF$`c#`d/@e`f"fgh̀ijbklDm`nl&ow`pUC`qW`r5%`s7`t`um`u`vO`w`xky`zM{|/}}~]!*0  LMTEESTEETTZifu{0'} ivgXI|: l+!\"L #;$+%& '@'@(P)xP)Դ *ė+ ,y-x .[/tZ 0d=1]v2rC3=X4R%5:6268$89:;< => ?@e AȐBE CcD% ECFg G#nGIPIeJ2KGLOM)N1On PQW( RkS7 TKU V+V XՐXְ YZ [ԙ\]{^_]`_ra}zb?Tc]\d6e=>fS g g5 hi jk lm nog pĐqP٠res0tEuv.vxxayizC{K|` }-~yB H$FPbp T`T`bp T` FPLMTALMTALMSTTZif u h@' 0' wufW|H l9!\*"L#< $+%& ' P'P(`)x`)0*ĥ +0, -0.i /th00dK 1]2rQ3=f4R35H626*82 8 9 :; < 0= >0? @e0A֠BE0CcD%0ECFu0G#|GI^IsJ@KUL] M7N? OnP! QW60Rl S70TK U0V+ V0XX־0YŠZ0[ԧ\]^_k`_a} b?bc]j dDe=L fa0g. gC0h i%0j k0lm0nog0pҠqPres0ɰtEuv. vx xoyw zQ{Y |n0}; ~yP0                                                58@T`FPFPT`FP 8@T`FPFPLMTAKTAKSTAKTSTAQTTAQTSTTZif u @' 0' wufW|H l9!\*"L#< $+%& ' P'P(`)x`)0*ĥ +0, -0.i /th00dK 1]2r_3=t4RA5V62#688@089"0:;0<@=0>@?0@e@ABE@CcưD%@ECF@G#GIlI΁JNKcLk0MENM0On'P/0QWD@Rl0S7&@TK0U@V+0V@XX@YӰZ@[Ե\]^_y`_a}0b?pc]x0dRe=Z0fo@g<0gQ@h0i3@j0k@lm@nog@pqPre°s0tEuv.0vx0x}y0z_{g0||@}I0~y^@+0     / 8@T` FPFPT` FP8@T`FPFP8@FPLMTSHETSHESTAQTSTAQTTTZif t ~0'} ivgXI|: l+!\"L #;$+%& '@'@()70*ĥ +0, -0.i /00dK 1f02Mg3=4RV5k6286M8UH8/97H:;H<.X=H>X?H@eXABEXCcD%XECFXG#GIIΖJcKxL̀HMZNbHOn`?uP@e`AUPBE`C5PD%`EPF`FGHޞIΝJKLbMaN~DOnCPgaPQW``RGCPS7B`T'%PU$`VPV`WPX`YPZ`[\]^_o`_aOb?c/odneQf`fnPgm`hPPiO`j2Pk1`lPm`nwPog`paqQr@s0t uvvwxЙy|z{{P|`}{P~yz`i]P*0 EESTEETTZifgNː;>``0)a\bpg ~ ixp SMTMALTJSTMYTTZifgG{'P]ՠP>ö ŘPGy:[0"gpixu0 p~pLMTBORTBORTSTJSTMYTTZiftL ܐ'apȀMK<-| l!\"K#;$+Ӡ%Ġ& ' '()Ԙ*z+z,\-\.>/t>0d 1]Z2op3=<4-p56 p67p89p:Ā;<=>?u@eAUBEC5iD%iEKFKFhpGgHJpIIJ,pK+LpM N}pOmPg QW RFS6T&UVVWX֔YvZv[p\]up^t_oWp`_VaO9pb?8c/pdepf7fghijklmnwogp`pqPr@ps0t puvdpvcwFpxEy(pz'{D|D}&~y&id4bp~ pLMTULATULASTTZif }0OMXPLMTISTNPTTZif68@LMTGSTTZif~̕2tݨO0>MX[hFPFP LMTISTKARTPKTTZifYPͬϏfЩyф`Ҋpek6c`-P ``mﰳpy%ZYsp;Up6Ep9'BP| ` 3``P `!I"]M`# $Z0`%?P& &'(P)`*+e,-G._P/{)0H01dF`2A`3D(`4!`5$ `6`7`7h`89J`:;f<=H>?j*@lAJ BLrC)D5`E Fq`F`GS`H`I5`J`K`L`M`Nru`O~P[Q]R;sS=TUUU7VWX`YZƜ`[`\~`]`^``_c``fB`aC`bF$`c#`d/@e`f"fgh̀ijbklDm`nl&ow`pUC`qW`r5%`s7`t`um`u`vO`w`xky`zM{|/}}~]*0 *0*0   EETEESTIDTISTTZif 0pЩ%pl9բuFfz~p~ PHSTPHTJSTTZif 00P8@*0LMTGSTASTTZifa6+*0LMTASTTZifgNː;>``M0)a\bpg ~ ixix p SMTMALTJSTSGTTZifZ(̕+u81(2q JMXT`[h[h T` MMTISTIHSTLKTTZif x/^pa>p@ap Հ}R[ps(;~pUT66Hptp4gpgIa+C  p$S  .p p ?kYsLpmpJpU#p Gz!"`?y@k?`A\sBLrC=PD-`EFGPG^HPIҒ`JKLPM`N-Ow~`PhQXRIPS9`T+UV MPVWPX`YZ[9P\8`]l^`_t`daV%PbF$`c7Xd'WePf fPg`hDiCjxPkw`lm`n0oq/pbdPqRc`rCs3t$PuvPPvO`wx؂yɷPz`{|;`}o~}nnP"*0 LMTEESTEETTZif  0'} ivgXI|: l+!\"L #;$+%& '@'@(e (P)`0 @FPbp T`T`bp T` FPT`FPLMTDUSTDUSSTTJTTJSTTZifjg^<bpBMTICTTZif  D@'  ' wufW|H l9!\*"L#< $+%& ' P') 0)Դ *ė68@FPT` T`FPT` T`FPLMTASHTASHSTTMSTTMTTZif38@LMTGSTTZif  #`@'  ivgXI|: l+!\"L #;$+%& '@'@(0)Դ *ė >8@FPT` bpT`T`bpFPFPT`LMTSAMTSAMSTTASSTTASTUZTUZSTTZif  0'} ivgXI|: l+!\"L #;$+%& '@'@(0)Դ *ė@FPbp T`T`bp FPFPT`LMTTASTTASSTUZTUZSTTZif oB_ГAdcbppLMTSMTICT . ..KabulQYerevanBakuQBahrainDaccaQThimbuBruneiRangoon Phnom_PenhHarbinShanghai( Chungking(UrumqiKashgar Hong_Kong(TaipeiMacaoQNicosiaTbilisiCalcutta( Jakarta  Ujung_Pandang Jayapura( Tehran Baghdad Jerusalem(TokyoQAmmanQAlmatyAqtobeAqtauQBishkekSeoulQ Pyongyang(Kuwait Vientiane(Beirut Kuala_LumpurKuching Ulan_Bator(Katmandu(MuscatKarachi GazaQ!Manila"QatarQ#Riyadh$ Singapore(%Colombo&Damascus('Dushanbe((Bangkok) Ashkhabad(*DubaiQ+ Samarkand(,Tashkent(-Saigon.AdenQ/ Yekaterinburg0OmskQ1 Novosibirsk2 Krasnoyarsk3Irkutsk4Yakutsk5 Vladivostok6Magadan7 Kamchatka(8Anadyr9Riyadh87(:Riyadh88(;Riyadh89(<Istanbul(Tel_AvivTZif u &@' 0' wufW|H l9!\*"L#< $+%& ' P'P(`)x`)Դ *ė+P,P-P.P/tP0duP1]2r{3=4R]5d62?6F8\P8(9>P: ; P<'P=P> P?P@ePABEPCcD%PECFPG#GIIΏJjKqL̇PMSNiPOn5PKPQWRPRl-PS74PTLPUPV+PVPX XPYZP[\]^_`_a}Pb?~c]Pd`e=vPf}PgXPg_Ph:PiAPjPk#Pl8mPnogPpqQres0tEuv.PvxPxЋyPzm{΃P|P}eP~ylPGP  88@T` FPFPT` FP 8@T`FPT`FPLMTSVETSVESTYEKSTYEKTTZifu00'} ivgXI|: l+!\"L #;$+%& '@'@(P)xP)Ԧ*ĉ+@,@-@.@/tv@0dg@1]2rm3=t4RO5V621688N@890@:;@<@=@>@?@@e@ABE@CcD%@ECF@G#GIzI΁J\KcLy@MEN[@On'P=@QWD@Rl@S7&@TL@U@V+@V@XX@YZ@[\]^_`_a}@b?pc]@dRe=h@fo@gJ@gQ@h,@i3@j@k@l*m@n og@pqPres0tEuv.@vx@x}y@z_{u@||@}W@~y^@9@DFPbp T`T`bp T` FPLMTOMSTOMSSTTZifuvD 'o׀֐ [hYJ;|, l!\"K#;$+%Ұ& ð'0'0(@)x@)Ԙ*z+0,0-0.@/tv@0dg@1]2rm3=t4RO5V621688N@890@:;@<@=@>@?@@e@ABE@CcD%@ECF@G#GIzI΁J\KcLy@MEN[@On'P=@QWD@Rl@S7&@TL@U@V+@V@XX@YZ@[\]^_`_a}@b?pc]@dRe=h@fo@gJ@gQ@h,@i3@j@k@l*m@n og@pqPres0tEuv.@vx@x}y@z_{u@||@}W@~y^@9@MT`p bpbpp bp T`LMTNOVTNOVSTTZiful 'o׀֐ [hYJ;|, l!\"K#;$+%Ұ& ð'0'0(@)x@)Ԙ*z+0,0-0.w0/th00dY01]2r_3=f4RA5H62#6*8@08 9"0:;0< 0=0>0?0@e0ABE0CcưD%0ECFu0G#GIlIsJNKULk0M7NM0OnP/0QW60Rl0S70TK0U0V+0V0XX־0YӰZ0[Ե\]^_y`_a}0b?bc]x0dDe=Z0fa0g<0gC0h0i%0j0k0lm0nog0pqPre°s0ɰtEuv.0vx0xoy0zQ{g0|n0}I0~yP0+0WT`p bpbpp bp T`LMTKRATKRASTTZifub0'apȀMZK<-| l!\"K#;$+Ӡ%Ġ& ' ' (0)xy0)ԉ*l+ , -x .i /tZ 0dK 1]v2rQ3=X4R35:62682 89 :; < = > ? @e A֠BE CcD% ECFg G#|GI^IeJ@KGL] M)N? On P! QW( Rl S7 TK U V+ V XXְ YŠZ [ԧ\]^_k`_ra} b?Tc]j d6e=L fS g. g5 h i j k lm nog pҠqP٠res0tEuv. vx xayw zC{Y |` }; ~yB  abp~ pp~ p bpIMTIRKTIRKSTTZifuJp'Sp`p?pL=.| l!["K#;Ԑ$+Ő%& ''( )xk ){*^+,y-j.[/tL0d=1]h2rC3=J4R%5,6268$89:Ґ;<=>?@eAȐBECcD%wECFYG#nGuIPIWJ2K9LOMN1OmPQWRkS6TKUV+VXՐX֢YZ[ԙ\]{^_]`_da}zb?Fc]\d(e=>fEg g'hi jklmnogpĐqPːres0tEuv.vqxxSyiz5{K|R}-~y4yp ~~ ~ pLMTYAKTYAKSTTZifuHPٷ'E`yxP`1`>/ | k!["KՀ#;ƀ$+%& ''()x])m*P+z,k-\.M/t>0d/1]Z2r53=<4R5616889:Ā;<=>?@eABECcD%iEC~FKG#`GgIBIIJ$K+LAM N#OmPQW RkS6TKUV+VXǀX֔YZv[ԋ\]m^t_O`_Va}lb?8c]Nde=0f7gghijklmnԀogpqPres0tEzuv.vcxyxEy[z'{=|D}~y&{~   ~VMTVLATVLASTTZifu6٩'7Pkj@P#P0p!ppp{p kp![p"Kp#;p$+p%p& p''()xO)_*B+k,\-M.>/t/0d 1]Lp2r'p3=.p4R p5p61p6p88p9:p;<=>?@eApBExCcpD%ZECppF`2r`3= `4Q`5`61`6`88`9:`;ڽ<=>?@eA`BEjCc`D%LECb`F.G#D`GK`I&`I-`J`K`L$M`NOm`PQVRkS6TKUV+VX`XwY`ZY[o`\v`]Q`^X`_3``_:`a}Ob?`c]1d`e=fgghijܹkl`mn`ogp`qP`re|`s0`tE^`ue`v.zvG`x\x)`y>z `{ |'}~y    LMTPETTPETSTTZifuٍ'0ON 0ڶ0PPPP{P kP![P"KP#;P$+P%~P& oP''()x2)C*&+O,@-1."/t0d1]0P2r P3=P4QP5P61P6P88ܸP9:P;گ<=>?s@ezAPBE\CcrPD%>ECTPF G#6PG=PIPIPJPKPLMPNOmPPQVRkS6TKUV+VXPXiYPZK[aP\hP]CP^JP_%P`_,Pa}Ab?Pc]#dPe=f gghijܫklPmnPogvpPqPPrenPs0uPtEPPuWPv.lv9PxNxPy0zP{|}~xd   LMTANATANASTTZif  `վТec{PN`?Ц%''Ъ((`Ы1P`J`΀Pˮ`Pqk PӢ9`CPL ){+ ]`?`\P`ݳ`dh`8kKi`4Pnp9u  :  ` $P 9`P`sPgM6Gz#݀'\>PܔP|s ld!\U"LF#<7$,(%& '5''4(%)*+,-ڐ.ː/t0d1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yh*0 8@ *0*0 *0 IMTEESTEETTRSTTRT= . ..>Darwin?Perth@Brisbane(ALindeman(BAdelaide(CHobartD Melbourne(ESydneyF Broken_HillG Lord_Howe(E ACTECanberraG LHIE NSW>North(@ QueenslandBSouth(CTasmaniaDVictoria?West(F YancowinnaTZifN'T^x̷]ͧ@xΠzχ"xCSTTZifP/0g$u <  jn   _9  f S ' H O  =w   2)  G & x`  y m ! # $a %& ' (V0 ) *: -? 5: 8(5 9y :+ < =n! > @ Ab B Dt EV F` G IKL J K3 M? N O Q3 Rm S U(O Vy W, Y Zn [z ] ^bW _ a4 bV c d fJ gZ h j?7 k l n3 o p] r' sy: tʦ v wm x ze {a |B ~ V  Jr Y > ; 3" ' x k  mW C a 4  V* J    b %  W/ > K M @\ ‘ p 4 Ɔ  ) {" ̱ ; o T  dm ӵ  Y ת . M ۟G B` ߓ y 7 ㈒ ! + }: N q g  f{  [ ( O < DF U 8!_!-d!~!sn! i!!_!P!U!!EK!!;!?Ч!A"!Bs!C!ER!Fg!G*!I !J\!Ki!L!NPA!O!P!RD!S!TS!V8!W+!Xۗ!Z-![~o!\!^!B!_r!`!b!cf!dc!f !g[;!h!i!kO!l!mf!oC!pH!q!s8*!t!u!w,!x}!yi!{ !|rU!}!A!f!2! ![#!!!!D!!-!~!#!!!s-!ķ!?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoponmlkjihgfeqrstuvw^]\[Zxyz{|}T~KIHEBBCDEHJK|Wy[`bqgjnܽpjsv]y}SQ++******k*R*9* *)))))))q)])I):)&))(((((((((((((((((((((()) ))+)5)D)S)b)))))))* **/*>*f*u*******+++)+=+L+[+o+~++++++++,,,,(,7,A,K,U,_,i,s,},,,,,,,,,,,n,d,Z,P,F,<,2+++++++++y+j+`+Q+G+8+.++********z*p*a*\*W***+$+3+B+t++++,,-,,,,--,-@-T-m-------..&.:.I.].q........///%///>/H/W/a/k/u////////////z/p/f/M/ //....v.b.0.-----|-c-E-'-,,,x,+??TZifQ!b!ܴD!!W!!!LP!!!A!蒴!M!5!z!!*!|6!!^!p!!!e!3!!ZQ!!j"N"~""C"""8+" " 5" ,"Ͽ""["0""P&"""!D"""#"%8"&o"'")-V"*~"+B"-!".s)"/Ě"1 "2g|"3"5 ^"6["7@"8":P"";"<">Dp"?"@M"B8"C*"Dۖ"F-"G~s"H"J!P"Kr"L("N"Og"Pq"R "S[N"T"U+"WO"X"Yy"[C"\V"]"_83"`"a"c,"d}"eh"g "hrJ"i"k1"lf"m"o "pZ"qu"r"tOa"u"vR"xC"y>"z"|8/"}"~%","~"ϖ"!" "P""D" ""9*""4"-"C"""R"s"f""hu"" "]"","Q"E""F^""w";"""/"8""$Q"u"j""j"ļ" "_+"Ȱ"D"S"̥X""Hq"Й""="Ԏ""1"؃2"Է"&A"w"K""lU""_"`"i"">i"d"2""'U"x"F""m7"#(#a###U#q## JX# # ?# >#!##3#t##'Q#x#.##m #w##aO##!,#"U###$p#&I#'C#(#*>#+#,#.2Z#/#02#2x#4q#6#7lD#8#:#;`#<#>[#?T#@3#A#CI #Dw#E#G=T#H#I1#K1#L#Mz#O%#Pw\#Q#S>#Tk#U #W#X`#Yx#[#\Td#]#^P#`H#a<#b#d=-#e#f##h1#i#jԔ#mw#r#u`#x#yU(#z#{2#}I#~F##>Z##s#2###'#y>##a#m###b#E##Wr# ##L8##o#A##?#5#v##*#|K###q #¾#\#e## 6#Z#r##O#L##D#!#>  !"#$%&'&%$#("! )*+,-./0123456789 :;< =>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghgfedcbai`j^]klZYXWVmnopqrPOstuvwxyz{G|}E~CBA@>>@BCD}|zyxOqSnV\jaeʽ϶ӯ֪٤d_kVt{|++******p*W*>*%* )))))))v)b)N)?)+)) (((((((((((((((((((((())&)5)D)S)q)))))*****M*a*****++$+8+G+[+j+y++++++++,,,,(,2,A,K,U,_,i,n,x,,,,,,,,,,,,},d,Z,,,+++++++++~+o+`+V+=+.+ *******z*u*k*f*\*R****+++L++++,<,P,,,,--'-;-O-c-|------. .!.5.I.X.l......../// ///9/H/R/\/k/p/z//////////f/M/C/4/%/.....{.g.N.-----h-J-1-,,,F, +++t??TZifQ##9]##ܔ#.-##_#"#t#/##i\#ͺ# #^#ѯ#E#R#դm##G#ٙ##$$$&$'`$($*d$+T$,<$-$/I$0$1$3=b$4$5?$71$8$9ԍ$;%$Z%@*%A|F%Bͼ%D2%Ep%F(%H%Ie%J%MY%QN %R%V%W%Y7%Z%[(%]+%^}7%_%a K%bq%c_%e%ffx%g%i %j[%%k%lH%nO%op%p%rD%s,%t%v9T%w%x܆%z.%{%|L%~"%t%%%iS%% %^(%%d%R%%9%G%u%%<%O%%1%)%%&`%w%ɜ%r\  !"#$%&'&%$#"( )*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklkjihgmedcbanopqrstZuXWVvwxyRQPz{|}L~JIFECBAABE~M{zSwvZsqobehlϼҴ֬idnqtVTRPNI++*****z*a*C***))))))){)g)S)?)0)!) ((((((((((((((((|(((((((()))N)])l)))))))***%*9*M*\*p*****++$+3+G+V+j+y++++++++,, ,,#,2,<,F,P,Z,d,n,x,},,,,,,,,,,,i,_,U,K,A,7,-,++++++~+t+e+L+=++ ********u*k*f*W*R****+)+8+[+++,,,,- --6-J-^-r------...0.?.S.g.{......./// /*/9/H/R/\/f/p/z/////////////u/k/a//.....l.:.!. ------m-O-,,,+`+B??TZifN¼=T s̷rͧUΠ χ7  b)%\) p~~pWSTTZifN TWp̷Vͧ9pΠsχpp9 %I%')') )ESTTZifN TWp̷Vͧ9pΠsχpp9 %I%')') )*s+ʀ,ҏ-xESTTZifN'T^x̷]ͧ@xΠzχ"xp@ #P"?0!   Ȉ   ^>xXm8O禈!kLjMj/Ly Y!Ո"B#i$"%I&f')') )d*z+ш,Җ-(.x/tE0Z1]a2r<3=C4R5%626889:ˈ;<=>?@eABECcD%pECFRG#gGnIIIPJ+K2LHMN*OmP QWRkS6TKUV+VXΈX֛YZ}[Ԓ\]t^{_V`_]a}sb??c]Ud!e=7f>gg hijklmnۈogpqPĈres0tEuv.vjxxLybz.{D|K}&~y-CSTTZifN TWp̷Vͧ9pΠsχp~Yv;V?p9 P8/ ߀  ~^>xXf8HO!d1Fc(E g' Y~!΀"B#i$"}%I&_')'()Ԙ*À+z,-\./t>0mi1]Z2V3=<46h56J67,89:Ā;*<= >?~@eA^ЀBEC>D%iEFKGGgHIIJuK+LWM N9OmPpUQW RP7S6T0UVVW݀X֔YϿZv[\]^t_x`_VaXb?8c8ddeFf7gbghDij&klmnogpjqPrIs0t)uv vcwxEyqz'{|D}o~y&rQESTTZifN TWp̷Vͧ9pΠsχpp9 P8/ ߀  ~^>xXf8H矀!dǁFc(E y Y~!΀"B#i$"}%I&_')') )*s+ʀ,ҏ-x.q/t>0S1]Z2r53=<4R5616889:Ā;<=>?@eABECcD%iEC~FKG#`GgIBIIJ$K+LAM N#OmPQW RkS6TKUV+VXǀX֔YZv[ԋ\]m^t_O`_Va}lb?8c]Nde=0f7gghijklmnԀogpqPres0tEzuv.vcxyxEy[z'{=|D}~y&ESTTZifN TWp̷Vͧ9pΠsχpp9 P8/ ߀  ~^>xXf8H !dǁFc(E y Y~!΀"B#i$"}%I%')') )*s+ʀ,ҏ-x.q/X0S1]Z2r53=<4R5616889:Ā;<=>?@eABECcD%iEC~FKG#`GgIBIIJ$K+LAM N#OmPQW RkS6TKUV+VXǀX֔YZv[ԋ\]m^t_O`_Va}lb?8c]Nde=0f7gghijklmnԀogpqPres0tEzuv.vcxyxEy[z'{=|D}~y&ESTTZifN'T^x̷]ͧ@xΠzχ"xp@ #P"?0!   Ȉ   ^>xXm8O !kLjMj/Ly Y!Ո"B#i$"%I%')') )*z+ш,Җ-x.x/X0Z1]a2r<3=C4R5%626889:ˈ;<=>?@eABECcD%pECFRG#gGnIIIPJ+K2LHMN*OmP QWRkS6TKUV+VXΈX֛YZ}[Ԓ\]t^{_V`_]a}sb??c]Ud!e=7f>gg hijklmnۈogpqPĈres0tEuv.vjxxLybz.{D|K}&~y-CSTTZifr f8@x!]xzx?x\x!x>xxyx Ywx!x"B#i$"u%I%')') )*k+x,҈x-xx.jx/Xx0Lx1]Sx2r.x3=5x4Rx5x61x6x88x9:x;<=>?@eAxBECcxD%aECwxFCG#YxG`xI;xIBxJxK$xL9MxNOmxPQWRkS6TKUV+VXxX֌YxZn[Ԅx\x]fx^mx_Hx`_Oxa}db?1xc]Fdxe=(f/g ghijklxmnxogpxqPxrexs0xtEsxuzxv.v\xxqx>xySz x{5|<}~yESTLHSTH . ..I Rarotonga(JFiji`KGambierL Marquesas(MTahiti`NGuam`OTarawa`P Enderbury(Q Kiritimati(RSaipan`SMajuro`T Kwajalein(U YapVTruk`WPonape`XKosrae`YNauru`ZNoumea`[Auckland(\Chatham]Niue`^Norfolk_Palau`` Port_MoresbyaPitcairn(b Pago_Pago(cApia`d GuadalcanaleFakaofof Tongatapu(gFunafuti(hJohnston(iMidway`jWake`kEfate`lWallis`mHonolulu(nEaster`o Galapagos(b<SamoaeTZif (?y Yc y9E 蕘"awCY%;h G!ˠ"1#j $%J %'* 'lXs`zhCKTCKHSTTZifP <6;6`8$4`8`:`:`;`W`?`@@AB ClDbELEDG,~G&I `IJBK%`L_`Mi`NA`OH`P#`Q(`Ru`S`TT`T`V4`VѫXXYZo[ݩ\qQ]^Q3_m`:P`a`b2`cfl`c`eFN`e`g&0`g`i`i`j`klmbnoBpq"|rns^tNt{`v7`v]`x`x?`yy`z!`{[`|k`}=`~J``D LMTFJSTFJTTZif PH|pLMTGAMTTZif PLH}8zhLMTMARTTZif PUss`LMTTAHTTZifGSTTZifGILTTZifV/0W@ePPHOTTZifU/} js`LINTTZif7p~MPTTZifPMHTTZif P,tW@MHTKWATTZif7p~YAPTTZifTRUTTZifPONTTZif PPONTKOSTTZif +˴HBPp|~LMTNRTJSTTZif tPVƜP7@2K3Dp   LMTNCSTNCTTZifQ`1p`o0#`8h`hmḩOh཮࿎nƒNcp.~L``,o`}h  ` ~^>xgXIf8+`!H`e`*`G` `)``g `` F`!`"0 #i$%.`&B' `'$(`)*ͧ`+#`,`-`.k`/j`0mM`1J`2Vi3*`46K5 `6-678Ӌ9:m;`s1?~`@\N`A^`B<0`C>`D`Ex`E`GG`HvI`JXKL:MNOdPp9`QDzRP`S$\T/`U>V`V[`W`X=`Yϣ`Z`[\`]^l`_x`UaXeb5c8Gde)egF`gՇh(`iij `k`l`m~h`n`o^J`piq>,`rIs`t)u*v v wrxyTz{q`|}S`~fr5` NZHDTNZSTNZDTTZif_ ' `'$(`)*ͧ`+#`,`-`.k`/j`0mM`1J`2Vi3*`46K5 `6-678Ӌ9:m;`s1?~`@\N`A^`B<0`C>`D`Ex`E`GG`HvI`JXKL:MNOdPp9`QDzRP`S$\T/`U>V`V[`W`X=`Yϣ`Z`[\`]^l`_x`UaXeb5c8Gde)egF`gՇh(`iij `k`l`m~h`n`o^J`piq>,`rIs`t)u*v v wrxyTz{q`|}S`~fr5`\LCHADTCHASTTZifC5`t8`^HePNUTTZifANMTNFTTZif~PWTTZifPGTTZifxPNTTZifb8U+00_^HeP eP ePLMTSAMTNSTBSTSSTTZif b8_^HeP LMTSAMTWSTTZifO3LMTSBTTZifs`TKTTZifpTOTTZifTVTTZifs`HSTTZif U+00ePePePNSTBSTSSTTZifWAKTTZif ´fP{P k@![P"K@#;P$+@%~P& a@&`P'C@(|)Q@*H+a3@ LMTVUSTVUTTZifWFTTZif CH ˉ=aI8ՍsHlXzhzhs`HSTHDTHWTTZif@`uz@sU\ U>yp7[p=p p ` p `ph`H`f(`F&yr[Tx`6Z`q<` Z5P!o`":P#O`$P%8%P''ٽP()*+,-./b0`1Ba2``3"C4@g`5 `P6 `78+`8$P9G:P;)jP?@SAhB3CHDE1`EG`GnH`IPJt`KmPLV`M|OPN8`O\1PPzTQ<PRZ6SPT:UVVWXY`Z[`\]`^mP_``MPab`b-zPcBc`d \Pe+e>Pg ag PhCiA?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y BSTGMTBDSTTZif & 0à ve {ȠN? %` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ &ʗYw;ͱ`Xϐn^r2i c)I !BN . p  ޴߮ ̠rHkt R*T2 = ) T q S  g} aI_ Jf _A ! ?#  Ѡ {ǻpp )X P  : 0  l N  0  qޠ.Qy1X#8Ɛ͐㯐Ñk lr!M"LT#a/$,6%JK& '*-'4) )*+,Ӑ-ڐ./t00$1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   DMTISTBSTGMTBDSTTZif & 0à ve {ȠN? ?%` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ I!N,( . p  ޴߮ ̠rHkt R*T2 = ) T q S  g} aI_ Jf _A ! ?#  Ѡ {ǻpp )X P  : 0  l N  0  qޠ.Qy1X#8Ɛ͐㯐Ñk lr!M"LT#a/$,6%JK& '*-'4) )*+,Ӑ-ڐ./t00$1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                             DMTISTBSTGMTTZif 4hmpKͩ͸(9>` x q Op H` k*`pt `pS`pp;`Hp`1p_`̯| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  LMTCETCESTTZifk A| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y WETCETCESTTZif `ٮ MpD[ qKͩ΢Cϒ4Ђ%rҡOcI9), #ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif z 8`^pKͩ΢Cϒ4 `'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq  *0   8@*08@*0 MMTEETMSKCETCESTMSDEESTTZif DI %pٮ0`~p.zL5^#p%5'*}4p_PAɧ#OpkpLrP.IZ 02v㠹Ԡ֋  x h Xy ?/8[ : X֠ J Kͩ΢Cϒ4[`n^rN@ӑ@K# *p cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                                 WETCETCESTWESTTZif}Kͩ΢Cϒ4Ђ%r$ cPU?M 5!,p 㡀ӒÃ|s ld!\U"LF#<7$,(%& '5'' `(P)`*P+`,P-`.P/t`0duP1]2r{3=4R]5r62?6T8\P869>P:; P<5`=P>`?P@e`ABE`CcD%`ECF`G#GIIΝJjKL̇PMaNiPOnCPKPQW``Rl-PS7B`TLPU$`V+PV`X X`YZ`[\]^_`_a}Pb?c]Pdne=vPf`gXPgm`h:PiO`jPk1`l8m`nog`pqQres0tEuv.PvxPxЙyPz{{΃P|`}eP~yz`GP  *0  *0 EETCETCESTEESTTZif `ٮ qKͩ΢Cϒ4n^yҡOӀIL8), pxdpd'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif `վCWpKͩ΢Cϒ4Ђ%r$y^Gɐ׿ΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZifY-̞+psoLȰƗPKͩ΢Cϒ4t'@PC@̓s|d lU!\F"L7#<($,%& '5'&()*+,ۀ-̀./t0d1]2r3=4R56P62x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y      4    *0 8@*08@*0  *0*0TMTCESTCETEETMSKMSDEESTTZifu soQ`̿#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yh*0 *0 HMTEESTEETTZif `ٮ qKͩ΢Cϒ4Ђ%rѿސWmҡOcK#9gըs), xΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  *0 *0  CESTCETCEMTTZif `POGx,ppHp*` .zL5^#p%5'X&p}4p_PAɧ#Opkp"prpPpI//p2Lpppp`ȷ𽸨_pxlh]XN?p80:Xp l'Kͩ΢Cϒ4OЉrN@ 9  cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  1         PMTWESTWETCETCESTWEMTTZif& 0à ve {ȠN? %` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ &ʗYw;ͱ`Xϐn^r2i c)I !BN . p  ޴߮ ̠rHkt R*T2 = ) T͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    BSTGMTBDSTCETCESTTZif !|ƯcPKͪL΢ϓip`߷ P ^` ` ͮ U]7jd{RF`3P#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y<*0   *0 *0 AMTEESTEETCETCESTTZif `ٮ0Xp) dyp( ZA?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif 7𝵼pp`~p\7pL(pl5Kͩ΢Cϒ4_`nBprL>1Ip)뀐 3pp`Ųb`ZpBwpv+np gE:I .Wp 9 9p  ptppSpΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif"F˃ȯd`bePKͩ΢Cϒ4Ђ%Аp'@PC@̓s|d lU!\F"L7#<($,%& '5'&()*+,ۀ-̀./t0d1]2M23=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y      $ *0   8@*0 8@*0 *0 RMTLSTEETMSKCETCESTMSDEESTTZifr #ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y CETCESTTZif~"OPJ0fx`ȬpY*Kͩ΢Cϒ40='@PC@̓s|d lU!\F"L7#<($,% & ''p'p()*+,ۀ-̀./t0d1]2r3=4R4`562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                         h *0  8@*08@*0  WMTKMTCETEETMSKCESTMSDEESTTZif`pp`~堢.zi5^?%5'*4pnآpPɧ2Opkp0rpP.IZ 02v㠹Ԡ֋  x h Xy ?/8[ : X֠ B0 Kͩ΢Cϒ4orN@ӑ@K# *p cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y              LMTCESTCETWESTWETTZif 7𝵼pp`~p\7pL(pl5Kͩ΢Cϒ4Ђ%rL>1Ip)뀐 3pp`Ųb`ZpBwpv+3p $pp4p  ؐрavAE[*#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif t `'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()`*P+`,P-`.P/t`0duP1]2r{3=4R]5r62?6T8\P869>P:; P<5`=P>`?P@e`ABE`CcD%`ECF`G#GIIΝJjKL̇PMaNiPOnCPKPQW``Rl-PS7B`TLPU$`V+PV`X X`YZ`[\]^_`_a}Pb?c]Pdne=vPf`gXPgm`h:PiO`jPk1`l8m`nog`pqQres0tEuv.PvxPxЙyPz{{΃P|`}eP~yz`GP 8@*0 *0 8@*0*0 LMTEETMSDMSKEESTTZif `POGx,ppHp*` .zL5^#p%5'X&p}4p_PAɧ#Opkp"prpPpI//p2Lpppp`ȷ𽸨_pxlh]XN?p80:Xp [T˭iKͩ΢Cϒ4ЉrN@ 9  cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                             1     PMTWESTWETWEMTCESTCETTZif  KRٸ%Avp#VP6%['^㐩Z煐'gfIΙ+pHRP*s0 T@xq쐼ΐؐ]x§ː]`Xtpp8Vp`!rDKͩ΢Cϒ4Ђ%rѱ^ *p cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                                   NSTAMTNETNESTCETCESTTZif '{`ȷM`Kͩ΢Cϒ4Ђ%rb L=.xhXG7'/ҐΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif*Л `ٮe}|`vKͩ΢Cϒ4Ѐ`ѕpҊ`bp#l`^)+ kT᥀і캳Zzw<ZY:;}: U 7t(dT M63#݀΀㡀ӒÃ|s ld!\U"LF#<7$,(%& '5'&()*+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq    *0   WMTCESTCETEESTEETTZif KmpǀpɃprp_TppApnop# Opɧ#Opkp"prpPp2Lppppȷ𽸨_pxlh]XN?p80:Xpp/p pb˵R̀Kܢ͕4K`rſpuϬgRХpTьI2f҅pYI9 )  ܹY ݲޢuߒfWrHb9R*B2 !)    z j cSC3#sdUF *  7t(dTC3#ܐ͐㽠ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y p      LMTWESTWETWEMTCETCESTTZif >``ߍ`~`ȩླྀྨ࿘|mx^hOX@H18"(`SPM 3`#݀΀㡀ӒÃ|s ld!\U"LF#<7$,(%& '5'' `(`)`*`+`,`-$-`.P/t`0duP1]2r{3=4R]5r62?6T8\P869>P:; P<5`=P>`?P@e`ABE`CcD%`ECF`G#GIIΝJjKL̇PMaNiPOnCPKPQW``Rl-PS7B`TLPU$`V+PV`X X`YZ`[\]^_`_a}Pb?c]Pdne=vPf`gXPgm`h:PiO`jPk1`l8m`nog`pqQres0tEuv.PvxPxЙyPz{{΃P|`}eP~yz`GPx*0 *0 BMTEESTEETTZif  `ٮ qKͩ΢Cϒ4Ђ%pѕ`ҊP&'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()x)@*ij0+p,p-$-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq           *0 8@ *0 *0 8@ *0  CESTCETMSDMSKEESTEETTZif >*49m$D<@m=2h=EP`'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()x)@*ij0+p,p-p.p/tp0dp1]2r3=4Ry562[6b8xp8D9Zp:&;%p?p@fpABEpCcD%pECFpG#GIIΫJKḶpMoNpOnQPgpQWnpRlIpS7PpTL+pU2pV, pVpX)XpY Zp[\]^_`_a}pb?c]pd|e=pfpgtpg{phVpi]pj8pk?plTm!pn6ohppqQres1tEuv.pvxpxЧypz{Οp|p}p~ypcp 1L#<?\*0 8@FP *0 8@*0 MSTMMTMDSTMSKMSDEETEESTTZif u  P'0@50̅te|V lG!\8"L)#<$, %& '`' `( p)xp)0*ĥ +`,`-`.`/t`0d`1]2r3=4Rk5r62M6T8j`869L`:;.`<5`=`>`?`@e`ABE`CcD%`ECF`G#GIIΝJxKL̕`MaNw`OnCPY`QW``Rl;`S7B`TL`U$`V+`V`XX`YZ`[\]^_`_a}`b?c]`dne=`f`gf`gm`hH`iO`j*`k1`lFm`n(og`p qQres0tEuv.`vx`xЙy`z{{Α`|`}s`~yz`U`  /*0FP 8@8@FP 8@ *0FP8@FP8@LMTKUYTKUYSTSAMTSAMSTTZifpp*p^pp_ɧ#Opkp"prpPp¨pXN9p80:!Mp`̖`K`΢ϣ-`Ѝ`у``pb`AF p ` tp   9`ltpd'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    WESTWETWEMTCESTCETTZifw `ΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  CETCESTTZifx $r`&``#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  CESTCETTZif >T*Ԟ@DDsġ<Ԥ{T>ĥvD=Td`'@PC@̓s|d lU!\F"L7#<($,% & &' P' `(P)`*P+`,P-`.P/t`0duP1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y *8 8@*0*08@*0*0 USTKMTUDSTEETMSDMSKEESTTZif>*p>r``t=`'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()*+,ۀ-M`-P.@/tP0dg@1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    ,:  8@*0*08@*0 8@*0*0 CSTNMTCDSTEETMSDMSKEESTTZifw 5Kͩ΢Cϒ4Ђ%ѡN@E_p㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CETCESTTZifz cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yWESTWETTZif `ٮ qKͩ΢Cϒ4Ђ% cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  CESTCETTZif `ٮ qKͩ΢Cϒ4Ђ% cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  MESTMETTZifz cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y*0 EESTEETTZif4LpLMTASTTZifuL\Mn@4$#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y$ LMTCGTCGSTEGTEGSTTZifu hM|P3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yπLMTWGTWGSTTZif[ w+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`LMTADTASTTZif p`p`epjp5`S`3އpiRK௳4~-౜QpgJ`|3pG,`\p'`;p`p`ƴ`Ĺ𿏲o„}Ovd_/XM|p:-^pW` @p9`ˈp`u@U 5peމpݩ`޾kp߉d`MpiF`~/pI(`^pW.G-7'ֶƵ`p`p`op_y`Oxp?[`/Zp(wp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEWTESTEDTTZif,pptEҀcSp3ޕwaYC~;_gXp|AG:p\#'p<p瀹ppZހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A CWTCSTCDTESTTZif :逢eEˉ a/v(XvuXW:9wqaP@0ހ5   ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OMWTMSTMDTTZif H*ˉa&t ؀Ѡ޳ݩ޾߉wip~YIR^;)4GX Q': 3   qޠo_O?/(f fe HG *)  x q(a'Q A 0C ΐ ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]PWTPSTPDTTZifˉa&G *)  x q(a'Q A 0C ΐ ௠    ysir YUIT 97)6 "S  5B%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k p PSTPWTPDTAKSTAKDTTZifˉ(a4 U08 70 x0q6a5QA0Q ܠ 0 ཰  0 0y i0Yc Ib09E )D0"a &0CB%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k pp YSTYWTYDTAKSTAKDTTZifˉ6aB0Gc@F0E@(0x'@qDaCQ&A%1_  @ ̰ 0 0@0@y0i@Yq0Ip@9S0)R@"o 4@QB%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k s`ps` ppCATCAWTAHSTAHDTAKDTAKSTTZifˉDaP@UqPT@SP6@x5PqRaQQ4A31m  P @ @P@Py@iPY@I~P9a@)`P"} BP_B%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k ePs`ePs` pNSTNWTBSTBDTAKDTAKSTTZifˉDaP@UqPT@SP6@x5PqRaQQ4A31m  P @ @P@Py@iPY@I~P9a@)`P"} BP_P32 vG@!ٰ"V)@#j0$6 @%J0&@'*0' ) 0)*~0+,Ӛ-.|/~0^1g@2s@3G@4S"5'r@637T@8!086@90:@;0<4=0>?0@oAŰBOCdD/EDFG$kG@IMI؝@J/K@LL0Ma@N.0OxC@P0Qa_Rl0SAATL0U!#V,0WXҰXYZ[Ֆ\@]x^@_Z`i@a~w0bI@c^Y0d)n@e>;0fg0glh0iNj0k0lmn߰oqpq[@rfs:@tFu@v/0v@x0xڙ@yf0z{@{H0|}*0~y 0ePs`ePs` ps`NSTNWTBSTBDTHADTHASTTZif  :ˉ |,ЁuXMWTMSTMDTTZifH*FL ˉ auXW:9wqaP@0ހ   ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O PWTPSTMWTMSTMDTTZif!,ppW"Gpˈa u@U 5sޗݩp޾y߉rp[iTp~=I6p^ CWTCSTCDTESTEDT . ..MarengoKnoxVevay Indianapolise(TZif%,ppˈa ޗݩp~=I6p^)pG<4'wp``pP`@p0`p p ` CWTCSTCDTESTEDTTZifX,ppˈa U 5sޗݩp޾y߉rp[iTp~=I6p^Wp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p CWTCSTCDTESTEDTTZif"[<ˈp`53p;@p0`p ` p ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p% LMTCSTESTEWTEDTTZif,ppˈa u@Jg+@p0p' p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A CWTCSTCDTESTTZif b ~|ܡ8L\Lt\dL^ܧDL=ܩ$LܫLܬfLݟܮ̯͂ܰḏ\F̳\m(̵fb\M ̷FD\,̹&&\ LBܻL$ܽLMl߸x(–X(v8b(_8D(?8`8Bˣ85(|8Z(@j!HӈDJHh&)HH H'HXtXݩmH޾VX߉OH8Xi1H~XIH]X(HG&챷ƠHﯽXHXHoX_dHOcX?FH/EX(b'XDC&%wpH`XPH@X0H X H X qH pX ٍ RXonQPy3i2YI8("HHXHXHXH u!~H"U#j$5%J|&'*^'X) @)ސX*"+rX,?H-TX.!H/~6X0H1gR2rH3G44RH5'62H7889:Ƽ;ۉX?M@oXAjHBOXCdLHD/aXED.HFCXG$HG_IHIAJHK#LMNOwPQaXRlS@XTLxU XV,ZWXXwHXXYYHZnX[;H\]H^l_H`iNa~bI0c]d)e=f/XggXhiXj݅kXlƢHmXnHoqXpfHqZrfHHs:tF*Huyv/Fv[x(x=y z{|`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`LMTADTASTTZifb ~|Ml߸x(–X(v8b(_8D(?8`8Bˣ85(|8Z(@j!HӈDJHh&)HH H'HXtXݩmH޾VX߉OH8Xi1H~XIH]X(HG&챷ƠHﯽXHXHoX_dHOcX?FH/EX(bkX.`KJ-,wpP``PP@`0P ` P ` xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`ܤΔ NSTNDTADTASTADDTTZif 񫠚0`#P@00zV@0SR<@4@:0@0@0E@U0@Kp~@$0n`@NB@0]@1@0^G0@P0mp@00r<@b06n~P`ˈ``u@U 5|u`W{`ݩtP޾]`߉VP?`i8P~!`IP^`(PG'챾`Po`_kPOj`?MP/L`(i.`KJ-,wpP``PP@`0P ` P ` xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%``LMTADTASTTZifdp1`X袔 _s>S-ގpp܍pR诼SP~5Pg.@|PG@[P&@;P@$й@лнĝпox„aOZdC/p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTESTTZifp1`ˈp`wp``pP` p ` p ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTESTTZifp1`ˈp` p ` p ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTESTTZif6MeO0HE1*% 0pp `raQ8`1!p `p`ˉ acSoU 5Ðޥݩ޾߉iib~KID^-)&GJC',% LMTMDTMSTCSTTZif?pˈa  π p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~ACDTCSTTZifúP?p ;Oˈa ӈhS`U 5\ޗݩp޾y߉rp[iTp~=I6p^)pG<4'o1bJggII++ wq pa Pp@0p π p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~ACDTCSTTZifMˉ avSoU 5',qa LMTMDTMSTCSTTZif M҅萣jʐ5ÀS3ˉ aU uX9aP@0ހ ݐ  ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OLMTMDTMSTTZif[ˉa&v S}U 5  Ѡ޳ݩ޾߉wip~YIR^;)4GX Q': 3   qޠo_O?/(f fe HG *)  x q(a'Q A 0 ΐ ͠ ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]PDTPSTTZif8 [ˉa&U 5  Ѡ޳ݩ޾߉wip~YIR^;)4GX Q': 3   qޠo_O?/(f fe HG *)  x q(a'PDTPSTMSTTZif| `P`0ˈ``/0@([i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`ADTASTADDTTZif| p`p@ˈp`/>P(iiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTESTEDDTTZif| p‡Pˈa /L`(wiVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~ACDTCSTCDDTTZif| 𐡢`ˉ a/Zp(idYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OMDTMSTMDDTTZif}pˉa&/h( idYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O PDTPSTPDDTMDTMSTTZif}˰# Ҁˉ(a4 /v(iir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]p YDTYSTYDDTPDTPSTTZif}˰# Ҁˉ(a4 /v(0ir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]p YDTYSTYDDTPDTPSTTZifVb1gv2sp3GX4Rp5'+5`62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A LMTCSTCDTEDTESTTZifbpnfV`C` 6`'`ް`Ɨ4PUPϷVPڙv1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A  LMTMSTCSTCDTTZifZtnfV`C` 6`'`1gv2sp3GX4Rp5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O LMTMSTCSTCDTMDTTZif]pnfV`C` 6`'`ؑp1g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O< LMTMSTCSTPSTMDTTZif|g;ؑѠ޳ݩ޾߉wip~YIR^;)4GX Q': 3   qޠo_O?/(f fe HG *)  x q(a'Q A 0C ΐ ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]L LMTPSTMSTPDTTZifY|g;ؑ1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~] LMTPSTMSTPDTTZif75 LMTASTTZif 73BPLMTESTASTTZif 7BOxp?[`/Zp(wp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p|LMTEDTESTTZif y$丅ctnvTP_`0>P LMTBMTADTASTTZif7^ٰ;EQء.nX^PX>2X'`X`X`جǤ`vخ`Vذh`6زpشPf|ض0HߙX*฿{X ຟ]X)`?X `_!X`?Xx`(X`8`!ɧsːXUpXb`Paq`7PP  LMTCHDTCSTCDTTZifKMTESTTZif  @6I`nP+`PP'`(n)w`)@ SJMTCDTCSTTZif b˜ӔPt]@[fQ@;Hʼm$eP̜O P;ӣP`}@=DS;@ũh@wp@`P5@PH@ P{ P j@ iP ن KPhP}@Qf1F[&{;d]F?(\@ >@zSP @ Z5P!o@"CQ#N@$#3%.@&''P()މP*״+kP,-MP.x/~/P0wZ1gK2W<3G-4@YP5P62P6P88ݙP9:{P;ې<=r>y?T@f[AqPBF=CdSPD&ED5PFG$PGPIPIPJPKPLMPNOnPPQWRlS7TLUV,aVhX~PXJY`PZ,[BP\IP]$P^+P_P`` Pa~"b?Pc^dPe=fgghiȱj݌klƩPmunPohWpmPqQtPrfOPs1VPtF1Pu8Pv/MvPx/xPyzP{|}~yHMTCDTCST . .. GMT UTC UCTGMT-14 GMT-13 GMT-12 GMT-11 GMT-10 GMT-98 GMT-88 GMT-78 GMT-68 GMT-58 GMT-48 GMT-38 GMT-28 GMT-18 GMT+18 GMT+28 GMT+38 GMT+48  GMT+58 !GMT+68 "GMT+78 #GMT+88 $GMT+98 %GMT+10 &GMT+11 'GMT+12   Universal Zulu  Greenwich GMT-0 GMT+0 GMT0TZifGMTTZifB`K@C{HpPHPPH0P P`  SDMTEDTESTEHDTASTTZif զ !\P"z#<}P`LMTCDTCSTTZif4dLMTASTTZifPLMTASTTZif U`͖,x`P'(\$LMTCDTCSTTZif nqF@P@P@P@ P!w@"U#j$5%J&'*s'`) U)ޗ`*7+y`,T`-[`.6`/~=`0`1gY2r`3G;4R`D  PPMTEDTESTTZif LKD !\P"z#<}P<LMTCDTCSTTZif p ` ` p ٢ gpfeyHiGY*I)9 ) ")` `KMTESTEDTTZif 0Mn@4 FFMTASTADTTZif5ŬLMTASTTZif -HCt` >PQoP1QP)a *KP+D 6cw$ MMTCSTESTCDTTZifbPMTESTTZif2`ASTAWTTZif744LMTASTTZifǰCMTASTTZifu8ncYI 8(" @@P@P@P@ u!w@"U#j$5%Ju&'*W'P) 9)މP*+kP,8@-MP.@/~/P0@1gK2r@3G-4R@5'62@7889:Ƶ;ۂP?F@oPAc@BOxPCdE@D/ZPED'@FP?F@oPAc@BOxPCdE@D/ZPED'@F ,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v'!0'XCMTARTARSTTZif< ,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%vCMTARTARSTTZifA,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v'!0'X(@)½*@ CMTARTARSTWARTWARSTTZif> ,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v)0):CMTARTARSTTZifA,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v'!0'X(g)H*@ CMTARTARSTWARTWARSTTZif /8HHLMTANTASTTZif, LPMTBOSTBOTTZif! ed;и2& f8 ӠܹK ޛ݌ T%PV Q Ƿ Ġ oɀ xɐ' 3![ " #X#b%7%ԹLMTFDTFSTTZif ttI@40t 800ܹY 0ޛ ݚ0T3 ^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" ȠҌLMTEDTESTTZif! kI@40t 800ܹY 0ޛ ݚ0T3 ^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" Ƞ#X#p %7% LMTEDTESTTZifv t0I@40t 800ܹY 0ޛ ݚ0T3 ^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" Ƞ#X#p %7% 0y01M2W 3j 48T04 6 06h808J90:,;N?ð@.ҠAhB CHC E(iE׳ G0G Hh0Iw JJ0KL,0M`uN0O@WPz*Q 9RZ ST9TVаV WX YٔZ [±0\h ]0^H _u0`1abW0bcB90ce"0edg 7gFhi(jkzE lݰmZ' no: ps0q rS0r t30tٯ v0vˠwd0xyF0z{b|bq}D~BS|&LMTEDTESTTZif# h|I@40t 800ܹY 0ޛ ݚ0T3 ^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" Ƞ#X#p %7% 0y01MބLMTEDTESTTZif rI@40t 800ܹY 0ޛ ݚ0T3 Z 0R0^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" Ƞ#X#p %7% '!0')0) * +k2,0-f .0/F 0y01M2W 3j 48T04 6 06h808J90:,;N?ð@.ҠAhB CHC E(iE׳ G0G Hh0Iw JJ0KL,0M`uN0O@WPz*Q 9RZ ST9TVаV WX YٔZ [±0\h ]0^H _u0`1abW0bcB90ce"0edg 7gFhi(jkzE lݰmZ' no: ps0q rS0r t30tٯ v0vˠwd0xyF0z{b|bq}D~BS|&LLMTEDTESTTZif! {WNB@ނ08@@ܹg0#@ޛ0ݨ@TA0 l0r@,Q:@0 @ɜ@xC 3ݰ!w@" ְ#X#~0%8%0lLMTWDTWSTTZif WNB@ނ08@@ܹg0#@ޛ0ݨ@TA0 l0r@,Q:@0 @ɜ@xC 3ݰ!w@" ְLMTWDTWSTTZif DWNB@ނ08@@ܹg0#@ޛ0ݨ@TA0 l0r@,Q:@0 @ɜ@xC 3ݰ!w@" ְ,@-f0ǼLMTWDTWSTTZif f\PPސ@8PPܹu@1Pޛ@ݶPTO@z@P:QHP@ "PɪPxQ 3!P" pLMTADTASTTZif $iq P@^{бw=@AгXp"4P9@gзP\ Pn`guP@IU2 +>O@ 1@@ Ѱ @ 0 @ 0@h0H0f(v0F&{t]V?8\@>@p @ Z0!o@"90#N@$0%8%0''١0()½*צ+,-.j/bc0@1BE2`i@3"'4@K@5 D06 @7հ8@809+:0; <0=>j0?@SʰAhB3CHDE1@EpG@GRHv@Io0JX@KQ0L:@M|30N@O\0Pz8Q;0RZS0T9UVVװWXĹY@Z[¿@\}]@^m0_@`M|0abe@b-^0cBG@d @0e+ce"0g Eg0h'i j klmun@oUưps@q5rS@st3@t0v@vމ0wr@xk0y܎zM0{p|~/0}R~gK|4  SMTCLSTCLTTZif XUt*!+Bp@ BMTCOSTCOTTZif . H`LMTANTASTTZifBhQMTECTTZif+5LMTGFTTZif y9> }<'0xDD LMTGBGTGYTTZif~ +@ t ʰ x0-@Z1t`FȰ8@'0L /@c0۳08l@O0 p!a@"S#DX@$4;0%A;@&n'@'0(@)H*Ͻ+ 0,@-p ./O0n@16h02W.3474066ر07809ֶ:u0;@X90?@@AUA_y@B!7C?[@DE=@EGYGݰH;IJK0LMi0NOI0Pp@Q)0RP@S d0T0@TF0V@VbW@XDYh@Z&[\r]f^Q_yH`;0aY*b0c9 c0eeڭ0g @g0h@iq0j@kl@mcon@oCQpjq#3rJst*st20v Uv0w7x0yz0{6@|k0}@~K0r@AMTPYTPYSTTZif  t@JPE@/J-, p%&|+C+h LMTPESTPETTZif*Kb, X1H<L LMTPMTNEGTSRTTZif73TLMTASTTZif?%Y8C0Ìvԗyy8_[}x8?=]Z8=<8<080UT0͕_ . EJ r T s 6ꦠ>0bqؖ(0ɨX0Ǡ ZG( ݠ0 U0nG!T0";>#$ %Jg%v'!0'X) +):*0+T MMTUYHSTUYTUYSTTZif,@H@CMTVET . .. ScoresbysundGodthabThulevxNew_York(ChicagoDenverx Los_AngelesJuneauxYakutat Anchorage(NomevxAdakvxPhoenixBoisevx IndianapolisIndiana Louisville(Detroit Menominee(St_Johns( Goose_Bay(Halifax Glace_Bay(Montreal( Thunder_BayNipigonReginax Rainy_RiverWinnipeg( Swift_CurrentEdmonton( Vancouver( Dawson_Creek PangnirtungIqaluit Rankin_Inlet YellowknifeInuvikx Whitehorse(DawsonxCancunx Mexico_City Chihuahua(Mazatlan(TijuanaEnsenada(Anguilla(AntiguaNassauxBarbados(BelizexCaymanx Costa_Rica(HavanaxDominica( Santo_Domingo El_SalvadorGrenada Guadeloupe( Guatemala(Port-au-Prince TegucigalpaJamaica Martinique( Montserrat(ManaguaPanamax Puerto_RicoSt_Kitts(St_Lucia(Miquelon( St_Vincent( Grand_Turk(Tortola St_Thomas( Buenos_AiresRosarioCordobaJujuyvx  Catamarca(MendozaArubavxLa_PazxNoronhaBelemvx Fortaleza( Araguaina(Maceiox Sao_Paulo(Cuiabax Porto_VelhoManausx Porto_Acre(Santiago(BogotaxCuracao Guayaquil(CayenneGuyanaxAsuncion(Limavx Paramaribo( Port_of_Spain Montevideo( CaracasShiprockAtka Fort_WayneKnox_INVirginTZifUTCTZifUCTTZifGMT-14TZifGMT-13TZifGMT-12TZifGMT-11TZifGMT-10TZif~GMT-9TZifpGMT-8TZifbpGMT-7TZifT`GMT-6TZifFPGMT-5TZif8@GMT-4TZif*0GMT-3TZif GMT-2TZifGMT-1TZifGMT+1TZifGMT+2TZifGMT+3TZifGMT+4TZifGMT+5TZifGMT+6TZifGMT+7TZifGMT+8TZifpGMT+9TZifs`GMT+10TZifePGMT+11TZifW@GMT+12TZif1Local time zone must be set--see zic manual page) . ..*AST4ADT+EST5EDT,CST6CDT-MST7MDT.PST8PDT/YST9YDT0AST4p1EST5p2CST6p3MST7p4PST8p5YST9p6(HST10pTZif* Ђ Єpj PZ `IP9`)P` P`Pٓ`ҰЏu`БtГsrVЕbUR8ЗB72Й"7P 6`P`P`P`P`Фj`cЦSCШ3#ЪcЫbEЭDbP&బDPC`&P|%`lP\`KP;`+P`лмԬоī࿴p„o}PdQ]oPMn`=QP-P`3P 2`P`P`϶Хѕ҅ueUE5.P|P`|P{`^P޾]`߮@P?`"P~!`w>^`W G7'֨ƧP`P`Po`_kPOj`?MP/L`(i.`KJ-,wpP``PP@`0P ` 5P xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P `!P"q`#j$Z%J&:'*e(d) G)F*)+(,FP- .(P/'`0 P1 `2rP3b`4RP5B`62P7"`89 9:;ې<ˏ=r>q?T@SAqPBk5CdSPDTR`ED5PF44`G$PH`IPI`JPK`LM`NOPQ|RlS\TLU<~V,aW`X~PY}`Y`PZ_`[BP\A`]$P^#`_P``a~"bd`c^dNe=f-gh hij݌k͋lƩPm`nPo`pmPqvl`rfOPsVN`tF1Pu60`v/Mw`x/x.yz{|}~ADTASTTZif8pj`ZpI`9p)`p `p`١pҾp𒒂rdbcRFBE2("'E` Dp'`&p `p`p`pjpcSC3#qpSRp`4R`Qp4`|3pl`\pK`;p+`pԺĹ𿴜~„}}`d_]}`M|p=_`-^pA` @p#`"p`p!϶ Ці҅ueUE5.``p`މpl`޾kp߮N`Mp0`~/pwL^pW.G-7'ֶƵ`p`p`op_y`Oxp?[`/Zp(w?b@aA`BkCCda`DT`pEDC`F4BpG$%`H$pI`IpJ`KpLMpNOPQ|RlS\TLUpv/[w px=xp~=wZ^W?p@pApBkRCdopDTnEDQpF4PG$3pH2IpIJpKLM؀NOPQ|RlS\TLU<V,}W}XpYY|pZ{[^p\]]@p^?_"p`!a~>bec^ dN e>f.gh hijݨkͨlpmĀnpoppqvrfkpsVjtFMpu6Lv/iw.xKxKy-z-{|}~CDTCSTTZifASTTZifU87qj6Z5J:) ܀ې龀ٽrbRcBb2E"Da `CB%$逢萣jʐcSC3#pǒQnmP|Ol2\1L<+„}d|]M={-z] \?>! >϶=Ц і҆veUE5.ĀÐޥΈ޾߮jiL~Kwi^-WKGJ7-',рАo_O?w/v(XvuXW:9wqaP@0ހ5 5  ࡐ ٿ yeidYGIF9))("E '& ̀ ̐!"q#j$Z%J&:'*() r)q*T+S,p-5.R/Q04132s3c4R5B62ڀ7"ِ89 9:;ۻ<˺=>?@~ABk`Cd}DT|ED_F4^G$AH@I#I"JKL"MNOPQ|RlS\TLU<V,WXYYZ剐[l\k]N^M_0`/a~Mbec^/dN.e>f.gh hijݷkͶlӀmҐnopqvrfysVxtF[u6Zv/xw ?@ ABkn CdDTEDmF4lG$OHNI1I0JKL0MNO PQ| RlS\ TLU< V,W XYYZ嗠[z\y]\^[_>`=a~[bec^=dN< e>f. gh hi jk lmnÐo pqvrfsVtFiu6hv/wJxhxg yJzI {,|+ }~ PDTPSTTZifq0T S06 q50jRZQJ4:3* ڠٰ 0 0r b0R B~02a "`0} |_^A@#"" j氥d T0C 30# 0 0 Ӌ0̨m0l|klN\ML00? @0ABk|0CdDTED{F4zG$]H\I?I>J!K L> MN O0P Q}0Rl S\0TL U<0V, W0XĠYðYZ奰[Ո\Ň]j^i_L`Ka~i be-c^K dNJ0e>- f.,0g h0h i0j k0lmnѠoаpqvrfsVtFwu6vv/ wXxv xu0yX zW0{: |90} ~0 pYDTYSTTZifESTTZifCSTTZifMSTTZifPSTTZifpYSTTZifs`HST7 . .. LongyearbyenE8 . .. Pacific-NewAlaskaAleutianArizonaCentral East-IndianaWEasternmHawaiiIndiana-StarkeMichiganMountainPacificbSamoaW9 . ..AcreM DeNoronhaEastMWestM: . ..AtlanticCentralEast-Saskatchewan܌EasternMountain Newfoundland2Pacific Saskatchewan2DYukon2; . .. Continentaln EasterIsland< . .. BajaNorteBajaSurGeneral= . ..9Riyadh87:Riyadh88;Riyadh89T12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N Elite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163: # $NetBSD: dot.profile,v 1.2.2.1 1999/06/26 23:56:36 cgd Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=sun export TERM HOME=/ export HOME umask 022 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^H, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^H 9600 # run update, so that installed software is written as it goes. update # get the terminal type _forceloop="" while [ "X${_forceloop}" = X"" ]; do eval `tset -s -m ":?$TERM"` if [ "X${TERM}" != X"unknown" ]; then _forceloop="done" fi done # Installing or upgrading? _forceloop="" while [ "X${_forceloop}" = X"" ]; do echo -n '(I)nstall or (U)pgrade? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; *) _forceloop="" ;; esac done fi ######## TERMINAL TYPE DESCRIPTIONS SOURCE FILE # # Version 9.13.25 # termcap syntax # # Eric S. Raymond (current maintainer) # John Kunze, Berkeley # Craig Leres, Berkeley # # Please e-mail changes to terminfo@ccil.org. The old termcap@berkeley.edu # address is no longer valid. # # PURPOSE OF THIS FILE: # # This file describes the capabilities of various character-cell terminals, # as needed by software such as screen-oriented editors. # # Other terminfo and termcap files exist, supported by various OS vendors # or as relics of various older versions of UNIX. This one is the longest # and most comprehensive one in existence. It subsumes not only the entirety # of the historical 4.4BSD, GNU, System V and SCO termcap files and the BRL # termcap file, but also large numbers of vendor-maintained termcap and # terminfo entries more complete and carefully tested than those in historical # termcap/terminfo versions. # # Pointers to related resources (including the ncurses distribution) may # be found at . # # INTERNATIONALIZATION: # # This file uses only the US-ASCII as the G0/GL character set. # # This file assumes a US-ASCII character set. If you need to fix this, start # by global-replacing \E(B and \E)B with the appropriate ISO 6429 enablers # for your character set. \E(A and \E)A enables the British character set # with the pound sign at position 2/3. # # In order to allow 8bit encodings (right half of ISO8859 character sets, # EUC encondings, etc.), we do not use G1 (and SO/SI) for alternate # character set but use G0 instead, and \E)0 should be avoided in # and initialization strings. # # FILE FORMAT: # # The version you are looking at may be in any of three formats: master # (terminfo with OT capabilities), stock terminfo, or termcap. You can tell # which by the format given in the header above. # # The master format is accepted and generated by the terminfo tools in the # ncurses suite; it differs from stock (System V-compatible) terminfo only # in that it admits a group of capabilities (prefixed `OT') equivalent to # various obsolete termcap capabilities. You can, thus, convert from master # to stock terminfo simply by filtering with `sed "/OT[^,]*,/s///"'; but if # you have ncurses `tic -I' is nicer (among other things, it automatically # outputs entries in a canonical form). # # The termcap version is generated automatically from the master version # using tic -C. This filtering leaves in the OT capabilities under their # original termcap names. All translated entries fit within the 1023-byte # string-table limit of archaic termcap libraries except where explicitly # noted below. Note that the termcap translation assumes that your termcap # library can handle multiple tc capabilities in an entry. 4.4BSD has this # capability. Older versions of GNU termcap, through 1.3, do not. # # For details on these formats, see terminfo(5) in the ncurses distribution, # and termcap(5) in the 4.4BSD Unix Programmer's Manual. Be aware that 4.4BSD # curses has been declared obsolete by the caretakers of the 4.4BSD sources # as of June 1995; they are encouraging everyone to migrate to ncurses. # # Note: unlike some other distributed terminfo files (Novell Unix & SCO's), # no entry in this file has embedded comments. This is so source translation # to termcap only has to carry over leading comments. Also, no name field # contains embedded whitespace (such whitespace confuses rdist). # # Further note: older versions of this file were often installed with an editor # script (reorder) that moved the most common terminal types to the front of # the file. This should no longer be necessary, as the file is now ordered # roughly by type frequency with ANSI/VT100 and other common types up front. # # Some information has been merged in from terminfo files distributed by # USL and SCO (see COPYRIGHTS AND OTHER DELUSIONS below). Much information # comes from vendors who maintain official terminfos for their hardware # (notably DEC and Wyse). # # A detailed change history is included at the end of this file. # # FILE ORGANIZATION: # # Comments in this file begin with # - they cannot appear in the middle # of a terminfo/termcap entry. Individual capabilities are commented out by # placing a period between the colon and the capability name. # # The file is divided up into major sections (headed by lines beginning with # the string "########") and minor sections (beginning with "####"); do # # grep "^####" | more # # to see a listing of section headings. The intent of the divisions is # (a) to make it easier to find things, and (b) to order the database so # that important and frequently-encountered terminal types are near the # front (so that you'll get reasonable search efficiency even if you don't # use reorder). Minor sections usually correspond to manufacturers or # standard terminal classes. Parenthesized words following manufacturer # names are type prefixes or product line names used by that manufacturers. # # HOW TO READ THE ENTRIES: # # The first name in an entry is the canonical name for the model or # type, last entry is a verbose description. Others are mnemonic synonyms for # the terminal. # # Terminal names look like - # The part to the left of the dash, if a dash is present, describes the # particular hardware of the terminal. The part to the right may be used # for flags indicating special ROMs, extra memory, particular terminal modes, # or user preferences. # # All names should be in lower case, for consistency in typing. # # The following are conventionally used suffixes: # -2p Has two pages of memory. Likewise 4p, 8p, etc. # -am Enable auto-margin. # -m Monochrome. Suppress color support # -mc Magic-cookie. Some terminals (notably older Wyses) can # only support one attribute without magic-cookie lossage. # Their base entry is usually paired with another that # uses magic cookies to support multiple attributes. # -na No arrow keys - termcap ignores arrow keys which are # actually there on the terminal, so the user can use # the arrow keys locally. # -nam No auto-margin - suppress :am: capability # -nl No labels - suppress soft labels # -ns No status line - suppress status line # -rv Terminal in reverse video mode (black on white) # -s Enable status line. # -vb Use visible bell (:vb:) rather than :bl:. # -w Wide - in 132 column mode. # If a name has multiple suffixes and one is a line height, that one should # go first. Thus `aaa-30-s-rv' is recommended over `aaa-s-rv'. # # Entries with embedded plus signs are designed to be included through use/tc # capabilities, not used as standalone entries. # # To avoid search clashes, some older all-numeric names for terminals have # been removed (i.e., "33" for the Model 33 Teletype, "2621" for the HP2621). # All primary names of terminals now have alphanumeric prefixes. # # Comments marked "esr" are mostly results of applying the termcap-compiler # code packaged with ncurses and contemplating the resulting error messages. # In many cases, these indicated obvious fixes to syntax garbled by the # composers. In a few cases, I was able to deduce corrected forms for garbled # capabilities by looking at context. All the information in the original # entries is preserved in the comments. # # In the comments, terminfo capability names are bracketed with <> (angle # brackets). Termcap capability names are bracketed with :: (colons). # # INTERPRETATION OF USER CAPABILITIES # # The System V Release 4 and XPG4 terminfo format defines ten string # capabilities for use by applications, .... In this file, we use # certain of these capabilities to describe functions which are not covered # by terminfo. The mapping is as follows: # # u9 terminal enquire string (equiv. to ANSI/ECMA-48 DA) # u8 terminal answerback description # u7 cursor position request (equiv. to VT100/ANSI/ECMA-48 DSR 6) # u6 cursor position report (equiv. to ANSI/ECMA-48 CPR) # # The terminal enquire string should elicit an answerback response # from the terminal. Common values for will be ^E (on older ASCII # terminals) or \E[c (on newer VT100/ANSI/ECMA-48-compatible terminals). # # The cursor position request () string should elicit a cursor position # report. A typical value (for VT100 terminals) is \E[6n. # # The terminal answerback description (u8) must consist of an expected # answerback string. The string may contain the following scanf(3)-like # escapes: # # %c Accept any character # %[...] Accept any number of characters in the given set # # The cursor position report () string must contain two scanf(3)-style # %d format elements. The first of these must correspond to the Y coordinate # and the second to the %d. If the string contains the sequence %i, it is # taken as an instruction to decrement each value after reading it (this is # the inverse sense from the cup string). The typical CPR value is # \E[%i%d;%dR (on VT100/ANSI/ECMA-48-compatible terminals). # # These capabilities are used by tac(1m), the terminfo action checker soon # to be distributed with ncurses. # # TABSET FILES # # All the entries in this file have been edited to assume that the tabset # files directory is /usr/share/tabset, in conformance with the File Hierarchy # Standard for Linux and free BSD systems. Some vendors (notably Sun) use # /usr/lib/tabset or (more recently) /usr/share/lib/tabset. # # No curses package we know of uses these files. If their location is an # issue, you will have to hand-patch the file locations before compiling # this file. # # REQUEST FOR CONTACT INFORMATION AND HISTORICAL MATERIAL: # # As the ANSI/ECMA-48 standard and variants take firmer hold, and as # character-cell terminals are increasingly replaced by X displays, much of # this file is becoming a historical document (this is part of the reason for # the new organization, which puts ANSI types, xterm, free-Unix consoles, # and vt100 up front in confidence that this will catch 95% of new hardware). # # For the terminal types still alive, I'd like to have manufacturer's # contact data (Internet address and/or snail-mail + phone). # # I'm also interested in enriching the comments so that the latter portions of # the file do in fact become a potted history of VDT technology as seen by # UNIX hackers. Ideally, I'd like the headers for each manufacturer to # include its live/dead/out-of-the-business status, and for as many # terminal types as possible to be tagged with information like years # of heaviest use, popularity, and interesting features. # # I'm especially interested in identifying the obscure entries listed under # `Miscellaneous obsolete terminals, manufacturers unknown' before the tribal # wisdom about them gets lost. If you know a lot about obscure old terminals, # please go to the terminfo resource page, grab the UFO file (ufo.ti), and # eyeball it for things you can identify and describe. # # If you have been around long enough to contribute, please read the file # with this in mind and send me your annotations. # # COPYRIGHTS AND OTHER DELUSIONS # # The BSD ancestor of this file had a standard Regents of the University of # California copyright with dates from 1980 to 1993. # # Some information has been merged in from a terminfo file SCO distributes. # It has an obnoxious boilerplate copyright which I'm ignoring because they # took so much of the content from the ancestral BSD versions of this file # and didn't attribute it, thereby violating the BSD Regents' copyright. # # Not that anyone should care. However many valid functions copyrights may # serve, putting one on a termcap/terminfo file with hundreds of anonymous # contributors makes about as much sense as copyrighting a wall-full of # graffiti -- it's legally dubious, ethically bogus, and patently ridiculous. # # This file deliberately has no copyright. It belongs to no one and everyone. # If you claim you own it, you will merely succeed in looking like a fool. # Use it as you like. Use it at your own risk. Copy and redistribute freely. # There are no guarantees anywhere. Svaha! # ######## STANDARD AND SPECIAL TYPES # # This section describes terminal classes and maker brands that are still # quite common. # #### Specials # # Special "terminals". These are used to label tty lines when you don't # know what kind of terminal is on it. The characteristics of an unknown # terminal are the lowest common denominator - they look about like a ti 700. # dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: lpr|printer|line printer:\ :bs:hc:os:\ :co#132:li#66:\ :bl=^G:cr=^M:do=^J:ff=^L:le=^H:sf=^J: glasstty|classic glass tty interpreting ASCII control characters:\ :am:\ :co#80:\ :bl=^G:cl=^L:cr=^M:do=^J:kb=^H:kd=^J:kl=^H:le=^H:nw=^M^J:\ :ta=^I: #### ANSI.SYS/ISO 6429/ECMA-48 Capabilities # # See the end-of-file comment for more on these. # # The IBM PC alternate character set. Plug this into any Intel console entry. # We use \E[11m for rmacs rather than \E[12m so the string can use the # ROM graphics for control characters such as the diamond, up- and down-arrow. # This works with the System V, Linux, and BSDI consoles. It's a safe bet this # will work with any Intel console, they all seem to have inherited \E[11m # from the ANSI.SYS de-facto standard. klone+acs|alternate character set for ansi.sys displays:\ :ac=`\004a\261f\370g\361h\260j\331k\277l\332m\300n\305o~q\304r\362s_t\303u\264v\301w\302x\263y\371z\372{\373|\374}\375~\376.\031-\030\054\021+^P0\333p\304r\304y\363z\362{\343|\330}\234:\ :ae=\E[10m:as=\E[11m: # Highlight controls corresponding to the ANSI.SYS standard. Most # console drivers for Intel boxes obey these. Makes the same assumption # about \E[11m as klone+acs. True ANSI/ECMA-48 would have :se=\E[27m:, # :ue=\E[24m:, but this isn't a documented feature of ANSI.SYS. klone+sgr|attribute control for ansi.sys displays:\ :S2=\E[11m:S3=\E[10m:mb=\E[5m:md=\E[1m:me=\E[0;10m:\ :mk=\E[8m:mr=\E[7m:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m:\ :se=\E[m:so=\E[7m:ue=\E[m:us=\E[4m:\ :tc=klone+acs: # Highlight controls corresponding to the ANSI.SYS standard. *All* # console drivers for Intel boxes obey these. Does not assume \E[11m will # work; uses \E[12m instead, which is pretty bulletproof but loses you the ACS # diamond and arrow characters under curses. klone+sgr-dumb|attribute control for ansi.sys displays (no ESC [ 11 m):\ :as=\E[12m:mb=\E[5m:md=\E[1m:me=\E[0;10m:mk=\E[8m:\ :mr=\E[7m:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;12%;m:\ :se=\E[m:so=\E[7m:ue=\E[m:us=\E[4m:\ :tc=klone+acs: # KOI8 (RFC1489) alternate character set # From: Qing Long , 24 Feb 1996. klone+koi8acs|alternate character set for ansi.sys displays with KOI8 charset:\ :ac=l\202m\204k\203j\205u\207t\206v\210w\211q\200x\201n\212o\213s\214p\216r\217`\004a\237f\234g\232~\225.\037-\036+\020\054\021h\222I\2200\215y\230z\231{\267}L|\274:\ :ae=\E[10m:as=\E[11m: # ANSI.SYS color control. The setb/setf caps depend on the coincidence # between SVr4/XPG4's color numbers and ANSI.SYS attributes. Here are longer # but equivalent strings that don't rely on that coincidence: # setb=\E[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m, # setf=\E[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m, # The DOS 5 manual asserts that these sequences meet the ISO 6429 standard. # They match a subset of ECMA-48. klone+color|color control for ansi.sys and ISO6429-compatible displays:\ :Co#8:NC#3:pa#64:\ :Sb=\E[4%dm:Sf=\E[3%dm:op=\E[37;40m: # This is better than klone+color, it doesn't assume white-on-black as the # default color pair, but many `ANSI' terminals don't grok the cap. ecma+color|color control for ECMA-48-compatible terminals:\ :Co#8:NC#3:pa#64:\ :Sb=\E[4%dm:Sf=\E[3%dm:op=\E[39;49m: # Attribute control for ECMA-48-compatible terminals ecma+sgr|attribute capabilities for true ECMA-48 terminals:\ :se=\E[27m:ue=\E[24m:\ :tc=klone+sgr: # For comparison, here are all the capabilities implied by the Intel # Binary Compatibility Standard (level 2) that fit within terminfo. # For more detail on this rather pathetic standard, see the comments # near the end of this file. ibcs2|Intel Binary Compatibility Standard prescriptions:\ :AL=\E[%dL:DC=\E[%dP:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:\ :RA=\E[?7l:RI=\E[%dC:S1=\E=%p1%dg:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:bt=\E[Z:ch=\E[%i%dG:cl=\Ec:\ :cm=\E[%i%d;%dH:ct=\E[g:cv=\E[%i%dd:ec=\E[%dX:ei=:im=:\ :rc=\E7:sc=\E7:st=\EH: #### ANSI/ECMA-48 terminals and terminal emulators # # See near the end of this file for details on ANSI conformance. # Don't mess with these entries! Lots of other entries depend on them! # # This section lists entries in a least-capable to most-capable order. # if you're in doubt about what `ANSI' matches yours, try them in that # order and back off from the first that breaks. ansi-mini|any ansi terminal with pessimistic assumptions:\ :am:bs:\ :co#80:it#8:li#24:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:do=\E[B:ho=\E[H:\ :le=\E[D:nd=\E[C:ta=^I:up=\E[A: # ANSI X3.64 from emory!mlhhh (Hugh Hansard) via BRL # # The following is an entry for the full ANSI 3.64 (1977). It lacks # padding, but most terminals using the standard are "fast" enough # not to require any -- even at 9600 bps. If you encounter problems, # try including the padding specifications. # # Note: the "as" and "ae" specifications are not implemented here, for # the available termcap documentation does not make clear WHICH alternate # character set to specify. ANSI 3.64 seems to make allowances for several. # Please make the appropriate adjustments to fit your needs -- that is # if you will be using alternate character sets. # # There are very few terminals running the full ANSI 3.64 standard, # so I could only test this entry on one verified terminal (Visual 102). # I would appreciate the results on other terminals sent to me. # # Please report comments, changes, and problems to: # # U.S. MAIL: Hugh Hansard # Box: 22830 # Emory University # Atlanta, GA. 30322. # # USENET {akgua,msdc,sb1,sb6,gatech}!emory!mlhhh. # ansi77|ansi 3.64 standard 1977 version:\ :am:bs:mi:\ :co#80:it#8:li#24:\ :al=5*\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=5*\E[M:\ :do=\E[B:ei=\E[4l:ho=\E[H:im=\E[4h:k1=\EOP:k2=\EOR:k4=\EOS:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :nd=\E[C:nw=^M\ED:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # Procomm and some other ANSI emulations don't recognize all of the ANSI- # standard capabilities. This entry deletes :UP:, :RI:, :DO:, :LE:, and # / capabilities, forcing curses to use repetitions of :up:, # :nd:, :do: and :le:. Also deleted :IC: and :ic:, as QModem up to # 5.03 doesn't recognize these. Finally, we delete :rp: and :sr:, which seem # to confuse many emulators. On the other hand, we can count on these programs # doing :ae:/:as:/:sa:. Older versions of this entry featured # , but now seems to be more common under # ANSI.SYS influence. # From: Eric S. Raymond Oct 30 1995 pcansi-m|pcansi-mono|ibm-pc terminal programs claiming to be ansi (mono mode):\ :am:bs:mi:ms:\ :co#80:it#8:li#24:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:ct=\E[2g:dc=\E[P:dl=\E[M:do=\E[B:\ :ho=\E[H:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=\E[D:nd=\E[C:sf=^J:st=\EH:ta=^I:up=\E[A:\ :tc=klone+sgr-dumb: pcansi-25-m|pcansi25m|ibm-pc terminal programs with 25 lines (mono mode):\ :li#25:tc=pcansi-m: pcansi-33-m|pcansi33m|ibm-pc terminal programs with 33 lines (mono mode):\ :li#33:tc=pcansi-m: pcansi-43-m|ansi43m|ibm-pc terminal programs with 43 lines (mono mode):\ :li#43:tc=pcansi-m: # The color versions. All PC emulators do color... pcansi|ibm-pc terminal programs claiming to be ansi:\ :tc=klone+color:tc=pcansi-m: pcansi-25|pcansi25|ibm-pc terminal programs with 25 lines:\ :li#25:tc=pcansi: pcansi-33|pcansi33|ibm-pc terminal programs with 33 lines:\ :li#33:tc=pcansi: pcansi-43|pcansi43|ibm-pc terminal programs with 43 lines:\ :li#43:tc=pcansi: # ansi-m -- full ANSI X3.64 with ANSI.SYS-compatible attributes, no color. # If you want pound signs rather than dollars, replace `B' with `A' # in the , , , and capabilities. # From: Eric S. Raymond Nov 6 1995 ansi-m|ansi-mono|ANSI X3.64-1979 terminal with ANSI.SYS compatible attributes:\ :5i:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :cb=\E[1K:ch=\E[%i%dG:ct=\E[2g:cv=\E[%i%dd:ec=\E[%dX:ei=:\ :im=:kB=\E[Z:kI=\E[L:kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:\ :nw=\r\E[S:pf=\E[4i:po=\E[5i:..rp=%p1%c\E[%p2%{1}%-%db:\ :s0=\E(B:s1=\E)B:s2=\E*B:s3=\E+B:ta=\E[I:\ :tc=pcansi-m: # ansi -- this terminfo expresses the largest subset of X3.64 that will fit in # standard terminfo. Assumes ANSI.SYS-compatible attributes and color. # From: Eric S. Raymond Nov 6 1995 ansi|ansi/pc-term compatible with color:\ :u6=\E[%i%d;%dR:u7=\E[6n:..u8=\E[?%[;0123456789]c:\ :u9=\E[c:\ :tc=ecma+color:tc=klone+sgr:tc=ansi-m: # # ANSI.SYS entries # # This completely describes the sequences specified in the DOS 2.1 ANSI.SYS # documentation (except for the keyboard key reassignment feature, which # doen't fit the model well). The klone+acs sequences were valid # though undocumented. The capability is untested but should work for # keys F1-F10 (%p1 values outside this range will yield unpredictable results). # From: Eric S. Raymond Nov 7 1995 ansi.sys-old|ANSI.SYS under PC-DOS 2.1:\ :am:bs:mi:ms:xo:\ :co#80:li#25:\ :RA=\E[?7l:SA=\E[?7h:ce=\E[k:cl=\E[2J:cm=\E[%i%d;%dH:\ :do=\E[B:ho=\E[H:is=\E[m\E[?7h:kd=^J:kh=^^:kl=^H:kr=^L:\ :ku=^K:le=^H:nd=\E[C:pk=\E[0;%+:;"%s":rc=\E[u:sc=\E[s:\ :u6=\E[%i%d;%dR:u7=\E[6n:up=\E[A:\ :tc=klone+color:tc=klone+sgr: ansi.sys|ANSI.SYS 3.1 and later versions:\ :ce=\E[K:tc=ansi.sys-old: # # Define IBM PC keypad keys for vi as per MS-Kermit while using ANSI.SYS. # This should only be used when the terminal emulator cannot redefine the keys. # Since redefining keys with ansi.sys also affects PC-DOS programs, the key # definitions must be restored. If the terminal emulator is quit while in vi # or others using :ks:/:ke:, the keypad will not be defined as per PC-DOS. # The PgUp and PgDn are prefixed with ESC so that tn3270 can be used on Unix # (^U and ^D are already defined for tn3270). The ESC is safe for vi but it # does "beep". ESC ESC i is used for Ins to avoid tn3270 ESC i for coltab. # Note that :kl: is always BS, because PC-dos can tolerate this change. # Caution: vi is limited to 256 string bytes, longer crashes or weirds out vi. # Consequently the End keypad key could not be set (it is relatively safe and # actually useful because it sends ^@ O, which beeps and opens a line above). ansi.sysk|ansisysk|PC-DOS 3.1 ANSI.SYS with keypad redefined for vi:\ :is=U2 PC-DOS 3.1 ANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:\ :ke=\E[;71;0;71p\E[;72;0;72p\E[;73;0;73p\E[;77;0;77p\E[;80;0;80p\E[;81;0;81p\E[;82;0;82p\E[;83;0;83p:\ :ks=\E[;71;30p\E[;72;11p\E[;73;27;21p\E[;77;12p\E[;80;10p\E[;81;27;4p\E[;82;27;27;105p\E[;83;127p:\ :tc=ansi.sys: # # Adds ins/del line/character, hence vi reverse scrolls/inserts/deletes nicer. nansi.sys|nansisys|PC-DOS Public Domain NANSI.SYS:\ :al=\E[1L:dc=\E[1P:dl=\E[1M:ei=:ic=\E[1@:im=:\ :is=U3 PC-DOS Public Domain NANSI.SYS 9-23-86\n:tc=ansi.sys: # # See ansi.sysk and nansi.sys above. nansi.sysk|nansisysk|PC-DOS Public Domain NANSI.SYS with keypad redefined for vi:\ :al=\E[1L:dc=\E[1P:dl=\E[1M:ei=:ic=\E[1@:im=:\ :is=U4 PC-DOS Public Domain NANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:tc=ansi.sysk: #### ANSI console types # # This entry is good for the 1.2.13 version of the Linux console driver. # # Note: there are numerous broken linux entries out there, which didn't screw # up BSD termcap but hose ncurses's smarter cursor-movement optimization. # One common pathology is an incorrect tab length of 4. # # *************************************************************************** # * * # * WARNING: * # * Linuxes come with a default keyboard mapping kcbt=^I. This entry, in * # * response to user requests, assumes kcbt=\E[Z, the ANSI/ECMA reverse-tab * # * character. Here are the keymap replacement lines that will set this up: * # * * # keycode 15 = Tab Tab # alt keycode 15 = Meta_Tab # shift keycode 15 = F26 # string F26 ="\033[Z" # * * # * This has to use a key slot which is unfortunate (any unused one will * # # do, F26 is the higher-numbered one). The change ought to be built * # * into the kernel tables. * # * * # *************************************************************************** # # The 1.3.x kernels add color-change capabilities; if yours doesn't have this # and it matters, turn off . The %02x escape used to implement this is # not back-portable to SV curses and not supported in ncurses versions before # 1.9.9. All linux kernels since 1.2.13 (at least) set the screen size # themselves; this entry assumes that capability. # # From: Eric S. Raymond 20 Jun 1997 linux|linux console:\ :am:eo:mi:ms:ut:xn:xo:\ :it#8:\ :&7=^Z:@7=\E[4~:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:F1=\E[23~:\ :F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:F6=\E[29~:\ :F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:IC=\E[%d@:\ :K2=\E[G:al=\E[L:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :ch=\E[%i%dG:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:cv=\E[%i%dd:dc=\E[P:dl=\E[M:\ :do=^J:ec=\E[%dX:ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:\ :k1=\E[[A:k2=\E[[B:k3=\E[[C:k4=\E[[D:k5=\E[[E:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kB=\E[Z:kD=\E[3~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:kd=\E[B:kh=\E[1~:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :nw=^M^J:r1=\Ec:rc=\E8:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p5%t;2%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m:\ :sc=\E7:se=\E[27m:sf=^J:sr=\EM:st=\EH:ta=^I:u6=\E[%i%d;%dR:\ :u7=\E[6n:u8=\E[?6c:u9=\E[c:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:\ :tc=klone+sgr:tc=ecma+color: linux-m|Linux console no color:\ :Co@:pa@:\ :AB@:AF@:Sb@:Sf@:tc=linux: linux-c-nc|linux console 1.3.x hack for ncurses only:\ :cc:\ :..Ic=\E]P%p1%x%p2%02x%p3%02x%p4%02x:oc=\E]R:tc=linux: # From: Dennis Henriksen , 9 July 1996 linux-c|linux console 1.3.6+ with private palette for each virtual console:\ :cc:\ :Co#8:pa#64:\ :..Ic=\E]P%?%p1%{9}%>%t%p1%{10}%-%p'a'%+%c%e%p1%d%p2%{255}%&%Pr%gr%{16}%/%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%gr%{15}%&%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%p3%{255}%&%Pr%gr%{16}%/%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%gr%{15}%&%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%p4%{255}%&%Pr%gr%{16}%/%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%gr%{15}%&%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;:\ :oc=\E]R:\ :tc=linux: # See the note on ICH/ICH1 VERSUS RMIR/SMIR near the end of file linux-nic|linux with ich/ich1 suppressed for non-curses programs:\ :IC@:ei=:ic@:im=:\ :tc=linux: # This assumes you have used setfont(8) to load one of the Linux koi8-r fonts. linux-koi8|linux with koi8 alternate character set:\ :tc=linux:tc=klone+koi8acs: # SCO console and SOS-Syscons console for 386bsd # (scoansi: had unknown capabilities # :Gc=N:Gd=K:Gh=M:Gl=L:Gu=J:Gv=\072:\ # :GC=E:GD=B:GH=D:GL=\64:GU=A:GV=\63:GR=C: # :G1=?:G2=Z:G3=@:G4=Y:G5=;:G6=I:G7=H:G8=<:\ # :CW=\E[M:NU=\E[N:RF=\E[O:RC=\E[P:\ # :WL=\E[S:WR=\E[T:CL=\E[U:CR=\E[V:\ # I renamed GS/GE/HM/EN/PU/PD/RT and added klone+sgr-dumb, based # on the :as:=\E[12m -- esr) scoansi|SCO Extended ANSI standard crt:\ :am:bs:eo:xo:\ :co#80:it#8:li#25:\ :@7=\E[F:al=\E[L:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[@:im=:k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:k5=\E[Q:\ :k6=\E[R:k7=\E[S:k8=\E[T:k9=\E[U:k;=\E[V:kN=\E[G:kP=\E[I:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:\ :mb=\E[5m:md=\E[1m:nd=\E[C:sf=\E[S:sr=\E[T:ta=^I:up=\E[A:\ :tc=klone+sgr-dumb: # This actually describes the generic SVr4 display driver for Intel boxes. # The :mh=\E[2m: isn't documented and therefore may not be reliable. # From: Eric Raymond Mon Nov 27 19:00:53 EST 1995 att6386|at386|386at|AT&T WGS 6386 console:\ :am:bw:eo:xo:\ :co#80:it#8:li#25:\ :@7=\E[Y:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\EOZ:\ :F2=\EOA:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=``a1fxgqh0jYk?lZm@nEooppqDrrsstCu4vAwBx3yyzz{{||}}~~:\ :ae=\E[10m:al=\E[1L:as=\E[12m:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:ch=\E[%i%dG:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :ct=\E[2g:cv=\E[%i%dd:dc=\E[P:dl=\E[1M:do=\E[B:ec=\E[%dX:\ :ei=:ho=\E[H:ic=\E[1@:im=:is=\E[0;10;39m:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\EOT:k6=\EOU:k7=\EOV:k8=\EOW:k9=\EOX:\ :k;=\EOY:kB=^]:kD=\E[P:kI=\E[@:kM=\E0:kN=\E[U:kP=\E[V:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:\ :md=\E[1m:me=\E[0;10m:mh=\E[2m:mk=\E[9m:mr=\E[7m:nd=\E[C:\ :nw=\r\E[S:rc=\E8:\ :..sa=\E[10m\E[0%?%p1%p3%|%t;7%;%?%p2%t;4%;%?%p4%t;5%;%?%p5%t;2%;?%p6%t;1%;%?%p9%t;12%e;10%;%?%p7%t;9%;m:\ :sc=\E7:se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m:ve=\E[=1C:vi=\E[=C:\ :tc=klone+color: # (pc6300plus: removed ":KM=/usr/lib/ua/kmap.s5:"; renamed BO/EE/CI/CV -- esr) pc6300plus|AT&T 6300 plus:\ :am:bs:xo:\ :co#80:li#24:\ :al=\E[1L:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[2J\E[H:\ :cm=\E[%i%2;%2H:cr=^M:ct=\E[3g:dc=\E[1P:dl=\E[1M:do=\E[B:\ :ei=:ho=\E[H:ic=\E[1@:im=:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:\ :k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:k9=\EOk:k;=\EOu:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mh=\E[2m:mk=\E[9m:mr=\E[7m:nd=\E[C:nw=^M^J:\ :se=\E[m:sf=^J:so=\E[7m:st=\EH:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[=1C:vi=\E[=C: # : # Entry for the DNARD OpenFirmware console, close to ANSI but not quite. # # (still unfinished, but good enough so far.) ofcons:\ :bs:bw:co#80:li#30:\ :ku=\233A:kd=\233B:kr=\233C:kl=\233D:kb=^H:kD=\233P:\ :k1=\2330P:k2=\2330Q:k3=\2330W:k4=\2330x:k5=\2330t:k6=\2330u:\ :k7=\2330q:k8=\2330r:k9=\2330p:k;=\2330M:\ :kN=\233/:kP=\233?:\ :mb=\2337;2m:se=\2330m:ue=\2330m:\ :md=\2331m:me=\2330m:mh=\2332m:mk=\2338m:mr=\2337m:\ :..sa=\2330%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :UP=\233%dA:DO=\233%dB:RI=\233%dC:LE=\233%dD:\ :DC=\233%dP:IC=\233%d@:dc=\233P:ic=\233@:\ :DL=\233%dM:dl=\233M:AL=\233%dL:al=\233L:\ :le=\233D:nd=\233C:do=\233B:up=\233A:\ :cl=^L:cr=^M:ta=^I:bl=^G:vb=^G:\ :cm=\233%i%d;%dH:cd=\233J:ce=\233K: # # Terminfo entry for the AT&T Unix PC 7300 # from escape(7) in Unix PC 7300 Manual. # Somewhat similar to a vt100-am (but different enough # to redo this from scratch.) # # /*************************************************************** # * # * FONT LOADING PROGRAM FOR THE UNIX PC # * # * This routine loads a font defined in the file ALTFONT # * into font memory slot #1. Once the font has been loaded, # * it can be used as an alternative character set. # * # * The call to ioctl with the argument WIOCLFONT is the key # * to this routine. For more information, see window(7) in # * the PC 7300 documentation. # ***************************************************************/ # #include /* needed for strcpy call */ # #include /* needed for ioctl call */ # #define FNSIZE 60 /* font name size */ # #define ALTFONT "/usr/lib/wfont/special.8.ft" /* font file */ # /* # * The file /usr/lib/wfont/special.8.ft comes with the # * standard PC software. It defines a graphics character set # * similar to that of the Teletype 5425 terminal. To view # * this or other fonts in /usr/lib/wfont, use the command # * cfont . For further information on fonts see # * cfont(1) in the PC 7300 documentation. # */ # # struct altfdata /* structure for alt font data */ # { # short altf_slot; /* memory slot number */ # char altf_name[FNSIZE]; /* font name (file name) */ # }; # ldfont() # { # int wd; /* window in which altfont will be */ # struct altfdata altf; # altf.altf_slot=1; # strcpy(altf.altf_name,ALTFONT); # for (wd =1; wd < 12; wd++) { # ioctl(wd, WIOCLFONT,&altf); # } # } # # (att7300: added :vi:/:ve:/:ic:/ from the BSDI entry, # they're confirmed by the man page for the System V display---esr) # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att7300|unixpc|pc7300|3b1|s4|AT&T UNIX PC Model 7300:\ :am:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:bt=\E^I:\ :cd=\E[0J:ce=\E[0K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:i1=^O:ic=\E[@:im=:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E5:k6=\E6:k7=\E7:\ :k8=\E8:kD=\Edc:kI=\Eim:kN=\Epg:kP=\EPG:kb=^H:kd=\E[B:\ :kh=\Ehm:kl=\E[D:kr=\E[C:ku=\E[A:md=\E[7m:me=\E[0;10m:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:se=\E[m:sf=^J:so=\E[7m:\ :sr=\EM:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[=1C:vi=\E[=C: # From: Stefan Stapelberg , 24 Feb 1997 # (iris-ansi: added rmam/smam based on init string -- esr) iris-ansi|IRIS emulating 40 line ANSI terminal (almost VT100):\ :am:\ :co#80:it#8:li#40:\ :!2=\E[218q:#2=\E[143q:#4=\E[158q:%9=\E[209q:%f=\E[210q:\ :%i=\E[167q:&7=\E[217q:*4=\E[P:*7=\E[147q:@7=\E[146q:\ :@8=^M:AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:F1=\EOR:F2=\EOS:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :al=\E[L:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:dl=\E[M:do=^J:ho=\E[H:\ :is=\E[?1l\E>\E[?7h\E[100g\E[0m\E7\E[r\E8:k1=\E[001q:\ :k2=\E[002q:k3=\E[003q:k4=\E[004q:k5=\E[005q:k6=\E[006q:\ :k7=\E[007q:k8=\E[008q:k9=\EOP:k;=\EOQ:kB=\E[Z:kD=\177:\ :kI=\E[139q:kM=\E[146q:kN=\E[154q:kP=\E[150q:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:pk=\EP101;%d.y%s\E\:\ :rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[1;7m:sr=\EM:st=\EH:\ :ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[9/y\E[12/y\E[=6l:\ :vs=\E[10/y\E[=1h\E[=2l\E[=6h: iris-ansi-ap|IRIS ANSI in application-keypad mode:\ :F1=\E[011q:F2=\E[012q:is=\E[?1l\E>\E[?7h:k;=\E[010q:\ :ke=\E>:ks=\E=:\ :tc=iris-ansi: # The following is a version of the ibm-pc entry distributed with PC/IX, # (Interactive Systems' System 3 for the Big Blue), modified by Richard # McIntosh at UCB/CSM. The :pt: and :uc: have been removed from the original, # (the former is untrue, and the latter failed under UCB/man); standout and # underline modes have been added. Note: this entry describes the "native" # capabilities of the PC monochrome display, without ANY emulation; most # communications packages (but NOT PC/IX connect) do some kind of emulation. pcix|PC/IX console:\ :am:bw:eo:\ :co#80:li#24:\ :cd=\E[J:ce=\E[K:cl=\Ec:cm=\E[%i%2;%2H:do=\E[B:ho=\E[H:\ :le=^H:me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:ue=\E[m:up=\E[A:\ :us=\E[4m: # (ibmpcx: this entry used to be known as ibmx. # It formerly included the following extension capabilities: # :GC=b:GL=v:GR=t:RT=^J:\ # :GH=\E[196g:GV=\E[179g:\ # :GU=\E[193g:GD=\E[194g:\ # :G1=\E[191g:G2=\E[218g:G3=\E[192g:G4=\E[217g:\ # :CW=\E[E:NU=\E[F:RF=\E[G:RC=\E[H:\ # :WL=\E[K:WR=\E[L:CL=\E[M:CR=\E[N:\ # I renamed GS/GE/WL/WR/CL/CR/PU/PD/HM/EN; also, removed a duplicate # ":kh=\E[Y:". Added IBM-PC forms characters and highlights, they match # what was there before. -- esr) ibmpcx|xenix|ibmx|IBM PC xenix console display:\ :am:bs:ms:\ :co#80:li#25:\ :@7=\E[d:al=\E[L:cd=\E[J:ce=\E[K:cl=^L:cm=\E[%d;%dH:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:k1=\E[K:\ :k2=\E[L:k3=\E[M:k4=\E[N:kN=\E[e:kP=\E[Z:kb=^H:kd=\E[B:\ :kh=\E[Y:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:nd=\E[C:up=\E[A:\ :tc=klone+acs:tc=klone+sgr: # QNX 4.0 Console # Michael's original version of this entry had , :ti=\Ei:, # :te=\Eh\ER:; this was so terminfo applications could write the lower # right corner without triggering a scroll. The ncurses terminfo library can # handle this case with the :ic: capability, and prefers :am: for better # optimization. Bug: The capability resets attributes. # From: Michael Hunter 30 Jul 1996 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) qnx|qnx4|qnx console:\ :km:mi:ms:xt:\ :co#80:it#4:li#25:\ :al=\EE:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:\ :dc=\Ef:dl=\EF:do=^J:ei=:ho=\EH:ic=\Ee:im=:k1=\377\201:\ :k2=\377\202:k3=\377\203:k4=\377\204:k5=\377\205:\ :k6=\377\206:k7=\377\207:k8=\377\210:k9=\377\211:\ :kD=\377\254:kI=\377\253:kN=\377\252:kP=\377\242:\ :kd=\377\251:kh=\377\240:kl=\377\244:kr=\377\246:\ :ku=\377\241:le=^H:mb=\E{:md=\E<:me=\E}\E]\E>\E):mr=\E(:\ :nd=\EC:rp=\Eg%r%+ %.:se=\E):sf=^J:so=\E(:sr=\EI:ta=^I:\ :te=\Eh\ER:ti=\Ei:ue=\E]:up=\EA:us=\E[:ve=\Ey1:vi=\Ey0:\ :vs=\Ey2: #### NetBSD consoles # # pcvt termcap database entries (corresponding to release 3.31) # Author's last edit-date: [Fri Sep 15 20:29:10 1995] # # (For the terminfo master file, I translated these into terminfo syntax. # Then I dropped all the pseudo-HP entries. we don't want and can't use # the :Xs: flag. Then I split :is: into a size-independent :i1: and a # size-dependent :is:. Finally, I added / -- esr) # NOTE: because the 386BSD "vi"/"elvis" seems to have a bug if # both :ic: and :im: are specified (an original VT220 # shows the same buggy behaviour!), :ic: has been taken # out of this entry. for reference, it should be . pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=llmmkkjjuuttvvwwqqxxnnoosspprr``aaffgg~~..--++\054\054hhII00yyzz:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:\ :ve=\E[?25h:vi=\E[?25l: # NetBSD/FreeBSD vt220 terminal emulator console (pc keyboard & monitor) # termcap entries for pure VT220-Emulation and 25, 28, 35, 40, 43 and # 50 lines entries; 80 columns pcvt25|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: # NetBSD/FreeBSD vt220 terminal emulator console (pc keyboard & monitor) # termcap entries for pure VT220-Emulation and 25, 28, 35, 40, 43 and # 50 lines entries; 132 columns pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: # NetBSD/x68k console vt200 emulator. This port runs on a 68K machine # manufactured by Sharp for the Japenese market. # From Minoura Makoto , 12 May 1996 x68k|x68k-ite|NetBSD/x68k ITE:\ :co#96:li#32:\ :%1=\E[28~:kC=\E[9~:tc=vt220: #### FreeBSD console entries # # From: Andrey Chernov 29 Mar 1996 # Andrey Chernov maintains the FreeBSD termcap distributions. # # Note: Users of FreeBSD 2.1.0 and older versions must either upgrade # or comment out the :cb: capability in the console entry. # # Alexander Lukyanov reports: # I have seen FreeBSD-2.1.5R... The old el1 bug changed, but it is still there. # Now el1 clears not only to the line beginning, but also a large chunk # of previous line. But there is another bug - ech does not work at all. # (Accordingly, :ec:=\E[%p1%dX and =\E[1K have been removed.) # # for syscons # common entry without semigraphics # Bug: The capability resets attributes. cons25w|ansiw|ansi80x25-raw|freebsd console (25-line raw mode):\ :NP:am:bw:eo:ms:ut:\ :Co#8:co#80:it#8:li#25:pa#64:\ :@7=\E[F:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[W:\ :F2=\E[X:IC=\E[%d@:K2=\E[E:LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:\ :SR=\E[%dT:Sb=\E[4%dm:Sf=\E[3%dm:UP=\E[%dA:al=\E[L:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%i%d`:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cv=\E[%i%dd:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=:ho=\E[H:ic=\E[@:im=:k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:\ :k5=\E[Q:k6=\E[R:k7=\E[S:k8=\E[T:k9=\E[U:k;=\E[V:kB=\E[Z:\ :kD=\177:kI=\E[L:kN=\E[G:kP=\E[I:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mh=\E[30;1m:mr=\E[7m:nd=\E[C:nw=\E[E:op=\E[x:\ :r1=\E[x\E[m\Ec:se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:\ :up=\E[A: cons25|ansis|ansi80x25|freebsd console (25-line ansi mode):\ :ac=l\332m\300k\277j\331u\264t\303v\301w\302q\304x\263n\305`\004a\260f\370g\361~\371.\031-\030h\261I^U0\333y\363z\362:\ :tc=cons25w: cons25-m|ansis-mono|ansi80x25-mono|freebsd console (25-line mono ansi mode):\ :Co@:pa@:\ :Sb@:Sf@:md@:mh@:op@:ue=\E[m:us=\E[4m:tc=cons25: cons30|ansi80x30|freebsd console (30-line ansi mode):\ :li#30:tc=cons25: cons30-m|ansi80x30-mono|freebsd console (30-line mono ansi mode):\ :li#30:tc=cons25-m: cons43|ansi80x43|freebsd console (43-line ansi mode):\ :li#43:tc=cons25: cons43-m|ansi80x43-mono|freebsd console (43-line mono ansi mode):\ :li#43:tc=cons25-m: cons50|ansil|ansi80x50|freebsd console (50-line ansi mode):\ :li#50:tc=cons25: cons50-m|ansil-mono|ansi80x50-mono|freebsd console (50-line mono ansi mode):\ :li#50:tc=cons25-m: cons60|ansi80x60|freebsd console (60-line ansi mode):\ :li#60:tc=cons25: cons60-m|ansi80x60-mono|freebsd console (60-line mono ansi mode):\ :li#60:tc=cons25-m: cons25r|pc3r|ibmpc3r|cons25-koi8-r|freebsd console w/koi8-r cyrillic:\ :ac=q\200x\201m\204v\211j\205t\206n\212u\207l\202w\210k\203y\230z\231f\234~\225a\220h\221`\004.\031-\030I^U0\215:\ :tc=cons25w: cons25r-m|pc3r-m|ibmpc3r-mono|cons25-koi8r-m|freebsd console w/koi8-r cyrillic (mono):\ :Co@:pa@:\ :Sb@:Sf@:op@:ue=\E[m:us=\E[4m:tc=cons25r: cons50r|cons50-koi8r|freebsd console w/koi8-r cyrillic (50 lines):\ :li#50:tc=cons25r: cons50r-m|cons50-koi8r-m|freebsd console w/koi8-r cyrillic (50-line mono):\ :li#50:tc=cons25r-m: cons60r|cons60-koi8r|freebsd console w/koi8-r cyrillic (60 lines):\ :li#60:tc=cons25r: cons60r-m|cons60-koi8r-m|freebsd console w/koi8-r cyrillic (60-line mono):\ :li#60:tc=cons25r-m: # ISO 8859-1 FreeBSD console cons25l1|cons25-iso8859|freebsd console w/iso 8859-1 chars:\ :ac=l\215m\216k\214j\213u\226t\225v\227w\230q\222x\231n\217o\220s\224p\221r\223`\201a\202f\207g\210~\237.\031-\030+\253\054\273I\247y\232z\233:\ :tc=cons25w: cons25l1-m|cons25-iso-m|freebsd console w/iso 8859-1 chars (mono):\ :Co@:pa@:\ :Sb@:Sf@:md@:mh@:op@:ue=\E[m:us=\E[4m:tc=cons25l1: cons50l1|cons50-iso8859|freebsd console w/iso 8859-1 chars (50 lines):\ :li#50:tc=cons25l1: cons50l1-m|cons50-iso-m|freebsd console w/iso 8859-1 chars (50-line mono):\ :li#50:tc=cons25l1-m: cons60l1|cons60-iso|freebsd console w/iso 8859-1 chars (60 lines):\ :li#60:tc=cons25l1: cons60l1-m|cons60-iso-m|freebsd console w/iso 8859-1 chars (60-line mono):\ :li#60:tc=cons25l1-m: #### 386BSD and BSD/OS Consoles # # This was the original 386BSD console entry (I think). # Some places it's named oldpc3|oldibmpc3. # From: Alex R.N. Wetmore origpc3|origibmpc3|IBM PC 386BSD Console:\ :am:bs:bw:eo:xo:\ :co#80:li#25:\ :ac=l\332q\304k\277x\263j\331m\300w\302u\264v\301t\303n\305:\ :cd=\E[J:ce=\E[K:cl=\Ec:cm=\E[%i%2;%2H:do=\E[B:ho=\E[H:\ :kd=\E[B:kh=\E[Y:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[7m:\ :me=\E[m\E[1;0x\E[2;7x:nd=\E[C:se=\E[1;0x\E[2;7x:\ :sf=\E[S:so=\E[1;7x\E[2;0x:sr=\E[T:ue=\E[1;0x\E[2;7x:\ :up=\E[A:us=\E[1;7x\E[2;0x: # description of BSD/386 console emulator in version 1.0 (supplied by BSDI) oldpc3|oldibmpc3|old IBM PC BSD/386 Console:\ :bs:km:\ :li#25:\ :al=\E[L:bl=^G:cr=^M:dl=\E[M:do=^J:kH=\E[F:kI=\E[L:kN=\E[G:\ :kP=\E[I:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :md=\E[=15F:me=\E[=R:mh=\E[=8F:nw=^M^J:sf=^J:ta=^I: # Description of BSD/OS console emulator in version 1.1, 2.0, 2.1 # Note, the emulator supports many of the additional console features # listed in the iBCS2 (e.g. character-set selection) though not all # are described here. This entry really ought to be upgraded. # Also note, the console will also work with fewer lines after doing # "stty rows NN", e.g. to use 24 lines. # (Color support from Kevin Rosenberg , 2 May 1996) # Bug: The capability resets attributes. bsdos|BSD/OS console:\ :am:bs:bw:eo:km:xo:\ :Co#8:co#80:it#8:li#25:pa#64:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :Sb=\E[4%dm:Sf=\E[3%dm:UP=\E[%dA:al=\E[L:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\Ec:cm=\E[%i%d;%dH:cr=^M:dl=\E[M:do=^J:ho=\E[H:\ :kH=\E[F:kI=\E[L:kN=\E[G:kP=\E[I:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:\ :mh=\E[=8F:mr=\E[7m:nd=\E[C:nw=^M^J:op=\E[x:rc=\E8:sc=\E7:\ :se=\E[0m:sf=^J:so=\E[7m:ta=^I:up=\E[A: bsdos-bold|IBM PC BSD/386 Console with bold instead of underline:\ :ue=\E[0m:us=\E[1m:\ :tc=bsdos: # If you are BSDI, you want the following entries, for the moment. # In release 2.0 they will probably phase out the pc3 and ibmpc3 names pc3|IBM PC BSD/386 Console:\ :mh@:tc=bsdos: ibmpc3|pc3-bold|IBM PC BSD/386 Console with bold instead of underline:\ :us=\E[1m:\ :tc=bsdos-bold: #### DEC VT100 and compatibles # # DEC terminals from the vt100 forward (and the vt52, way obsolete but still # the basis of some emulations) are collected here. Older DEC terminals and # micro consoles can be found in the `obsolete' section. More details on # the relationship between the VT100 and ANSI X3.64/ISO 6429/ECMA-48 may be # found near the end of this file. # # Except where noted, these entries are DEC's official terminfos. # Contact Bill Hedberg of Terminal Support # Engineering for more information. Updated terminfos and termcaps # are kept available at ftp://gatekeeper.dec.com/pub/DEC/termcaps. # # In October 1995 DEC sold its terminals business, including the VT and Dorio # line and trademark, to SunRiver Data Systems. SunRiver has since changed # its name to Boundless Technologies; see http://www.boundless.com. # # (The , :ae:, and :as: capabilities aren't in DEC's official # entry -- esr) vt52|dec vt52:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:do=\EB:ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\ED:nd=\EC:nw=^M^J:sf=^J:sr=\EI:ta=^I:up=\EA: # NOTE: Any VT100 emulation, whether in hardware or software, almost # certainly includes what DEC called the `Level 1 editing extension' codes; # only the very oldest VT100s lacked these and there probably aren't any of # those left alive. To capture these, use one of the VT102 entries. # # Note that the :xn: glitch in vt100 is not quite the same as on the Concept, # since the cursor is left in a different position while in the # weird state (concept at beginning of next line, vt100 at end # of this line) so all versions of vi before 3.7 don't handle # :xn: right on vt100. The correct way to handle :xn: is when # you output the char in column 80, immediately output CR LF # and then assume you are in column 1 of the next line. If :xn: # is on, am should be on too. # # I assume you have smooth scroll off or are at a slow enough baud # rate that it doesn't matter (1200? or less). Also this assumes # that you set auto-nl to "on", if you set it off use vt100-nam # below. # # The padding requirements listed here are guesses. It is strongly # recommended that xon/xoff be enabled, as this is assumed here. # # The vt100 uses and rather than :is:/:ct:/:st: because the # tab settings are in non-volatile memory and don't need to be # reset upon login. Also setting the number of columns glitches # the screen annoyingly. You can type "reset" to get them set. # # Here's a diagram of the VT100 keypad keys with their bindings. # The top line is the name of the key (some DEC keyboards have the keys # labelled somewhat differently, like GOLD instead of PF1, but this is # the most "official" name). The second line is the escape sequence it # generates in Application Keypad mode (where "$" means the ESC # character). The third line contains two items, first the mapping of # the key in terminfo, and then in termcap. # _______________________________________ # | PF1 | PF2 | PF3 | PF4 | # | $OP | $OQ | $OR | $OS | # |_kf1__k1_|_kf2__k2_|_kf3__k3_|_kf4__k4_| # | 7 8 9 - | # | $Ow | $Ox | $Oy | $Om | # |_kf9__k9_|_kf10_k;_|_kf0__k0_|_________| # | 4 | 5 | 6 | , | # | $Ot | $Ou | $Ov | $Ol | # |_kf5__k5_|_kf6__k6_|_kf7__k7_|_kf8__k8_| # | 1 | 2 | 3 | | # | $Oq | $Or | $Os | enter | # |_ka1__K1_|_kb2__K2_|_ka3__K3_| $OM | # | 0 | . | | # | $Op | $On | | # |___kc1_______K4____|_kc3__K5_|_kent_@8_| # # And here, for those of you with orphaned VT100s lacking documentation, is # a description of the soft switches invoked when you do `Set Up'. # # Scroll 0-Jump Shifted 3 0-# # | 1-Smooth | 1-British pound sign # | Autorepeat 0-Off | Wrap Around 0-Off # | | 1-On | | 1-On # | | Screen 0-Dark Bkg | | New Line 0-Off # | | | 1-Light Bkg | | | 1-On # | | | Cursor 0-Underline | | | Interlace 0-Off # | | | | 1-Block | | | | 1-On # | | | | | | | | # 1 1 0 1 1 1 1 1 0 1 0 0 0 0 1 0 <--Standard Settings # | | | | | | | | # | | | Auto XON/XOFF 0-Off | | | Power 0-60 Hz # | | | 1-On | | | 1-50 Hz # | | Ansi/VT52 0-VT52 | | Bits Per Char. 0-7 Bits # | | 1-ANSI | | 1-8 Bits # | Keyclick 0-Off | Parity 0-Off # | 1-On | 1-On # Margin Bell 0-Off Parity Sense 0-Odd # 1-On 1-Even # # The following SET-UP modes are assumed for normal operation: # ANSI_MODE AUTO_XON/XOFF_ON NEWLINE_OFF 80_COLUMNS # WRAP_AROUND_ON JUMP_SCROLL_OFF # Other SET-UP modes may be set for operator convenience or communication # requirements; I recommend # AUTOREPEAT_ON BLOCK_CURSOR MARGIN_BELL_OFF SHIFTED_3_# # Unless you have a graphics add-on such as Digital Engineering's VT640 # (and even then, whenever it can be arranged!) you should set # INTERLACE_OFF # # (I added / based on the init string, also :bs: -- esr) vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 no automargins:\ :am@:xn@:tc=vt100-am: # Ordinary vt100 in 132 column ("wide") mode. vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video no automargin):\ :co#132:li#14:vt@:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: # vt100 with no advanced video. vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:tc=vt100-nav: # vt100 with one of the 24 lines used as a status line. # We put the status line on the top. vt100-s|vt100-s-top|vt100-top-s|vt100 for use with top sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:is=\E7\E[2;24r\E8:\ :ts=\E7\E[1;%p1%dH\E[1K:\ :tc=vt100-am: # Status line at bottom. # Clearing the screen will clobber status line. vt100-s-bot|vt100-bot-s|vt100 for use with bottom sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%p1%dH\E[1K:\ :tc=vt100-am: # Most of the `vt100' emulators out there actually emulate a vt102 # This entry (or vt102-nsgr) is probably the right thing to use for # these. vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: vt102-w|dec vt102 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt102: # Many brain-dead PC comm programs that pretend to be `vt100-compatible' # fail to interpret the ^O and ^N escapes properly. Symptom: the :me: # string in the canonical vt100 entry above leaves the screen littered # with little snowflake or star characters (IBM PC ROM character \017 = ^O) # after highlight turnoffs. This entry should fix that, and even leave # ACS support working, at the cost of making multiple-highlight changes # slightly more expensive. # From: Eric S. Raymond July 22 1995 vt102-nsgr|vt102 no sgr (use if you see snowflakes after highlight changes):\ :me=\E[m:sa@:\ :tc=vt102: # VT125 Graphics CRT. Clear screen also erases graphics vt125|vt125 graphics terminal:\ :cl=\E[H\E[2J\EPpS(E)\E\:tc=vt100: # This isn't a DEC entry, it came from University of Wisconsin. # (vt131: I added / based on the init string, also :bs: -- esr) vt131|dec vt131:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[?7h:SA=\E[?7h:bl=^G:cd=50\E[J:ce=3\E[K:\ :cl=50\E[;H\E[2J:cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :do=^J:ho=\E[H:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:sc=\E7:\ :se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: # vt132 - like vt100 but slower and has ins/del line and such. # I'm told that :im:/:ei: are backwards in the terminal from the # manual and from the ANSI standard, this describes the actual # terminal. I've never actually used a vt132 myself, so this # is untested. # vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:tc=vt100: # vt220: # This vt220 description maps F5--F9 to the second block of function keys # at the top of the keyboard. The "DO" key is used as F10 to avoid conflict # with the key marked (ESC) on the vt220. See vt220d for an alternate mapping. # PF1--PF4 are used as F1--F4. # vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt220-w|vt200-w|DEC vt220 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt220: # # vt220d: # This vt220 description regards F6--F10 as the second block of function keys # at the top of the keyboard. This mapping follows the description given # in the VT220 Programmer Reference Manual and agrees with the labeling # on some terminals that emulate the vt220. There is no support for an F5. # See vt220 for an alternate mapping. # vt220d|DEC VT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:k5@:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :tc=vt220: vt220-nam|v200-nam|VT220 in vt100 mode with no auto margins:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt220-8|dec vt220 8 bit terminal:\ :am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:rc=\E8:sc=\E7:se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: # This was DEC's vt320. Use the purpose-built one below instead #vt320|DEC VT320 in vt100 emulation mode, # use=vt220, # vt220 termcap written Tue Oct 25 20:41:10 1988 by Alex Latzko # (not an official DEC entry!) # The problem with real vt220 terminals is they don't send escapes when in # in vt220 mode. This can be gotten around two ways. 1> don't send # escapes or 2> put the vt220 into vt100 mode and use all the nifty # features of vt100 advanced video which it then has. # # This entry takes the view of putting a vt220 into vt100 mode so # you can use the escape key in emacs and everything else which needs it. # # You probably don't want to use this on a VMS machine since VMS will think # it has a vt220 and will get fouled up coming out of emacs # # From: Alexander Latzko , 30 Dec 1996 vt200-js|vt220-js|dec vt200 series with jump scroll:\ :am:\ :co#80:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:dm=:do=^J:ed=:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[61"p\E[H\E[?3l\E[?4l\E[?1l\E[?5l\E[?6l\E[?7h\E[?8h\E[?25h\E>\E[m:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :nw=^M\ED:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :rf=/usr/lib/tabset/vt100:se=5\E[27m:sf=\ED:so=5\E[7m:\ :sr=\EM:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: # # Use v320n for SCO's LYRIX. Otherwise, use Adam Thompson's vt320-nam. # vt320nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: # These entries are not DEC's official ones, they were purpose-built for the # VT320. Here are the designer's notes: # is end on a PC kbd. Actually 'select' on a VT. Mapped to # 'Erase to End of Field'... since nothing seems to use 'end' anyways... # khome is Home on a PC kbd. Actually 'FIND' on a VT. # Things that use usually use tab anyways... and things that don't use # tab usually use instead... # kprv is same as tab - Backtab is useless... # I left out :sa: because of its RIDICULOUS complexity, # and the resulting fact that it causes the termcap translation of the entry # to SMASH the 1k-barrier... # From: Adam Thompson Sept 10 1995 # (vt320: uncommented :fs: --esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt320|vt300|dec vt320 7 bit terminal:\ :am:es:hs:mi:ms:xn:\ :co#80:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[1$}\E[H\E[K:ue=\E[m:\ :up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt320-nam|vt300-nam|dec vt320 7 bit terminal with no am to make SAS happy:\ :am@:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: # We have to init 132-col mode, not 80-col mode. vt320-w|vt300-w|dec vt320 wide 7 bit terminal:\ :co#132:ws#132:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w-nam|vt300-w-nam|dec vt320 wide 7 bit terminal with no am:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320-w: # VT330 and VT340 -- These are ReGIS and SIXEL graphics terminals # which are pretty much a superset of the VT320. They have the # host writable status line, yet another different DRCS matrix size, # and such, but they add the DEC Technical character set, Multiple text # pages, selectable length pages, and the like. The difference between # the vt330 and vt340 is that the latter has only 2 planes and a monochrome # monitor, the former has 4 planes and a color monitor. These terminals # support VT131 and ANSI block mode, but as with much of these things, # termcap/terminfo doesn't deal with these features. # # Note that this entry is are set up in what was the standard way for GNU # Emacs v18 terminal modes to deal with the cursor keys in that the arrow # keys were switched into application mode at the same time the numeric pad # is switched into application mode. This changes the definitions of the # arrow keys. Emacs v19 is smarter and mines its keys directly out of # your termcap or terminfo entry, # # From: Daniel Glasser , 13 Oct 1993 # (vt340: string capability "sb=\E[M" corrected to "sr"; # also, added / based on the init string -- esr) vt340|dec-vt340|vt330|dec-vt330|dec vt340 graphics terminal with 24 line page:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # DEC doesn't supply a vt400 description, so we add Daniel Glasser's # (originally written with vt420 as its primary name, and usable for it). # # VT400/420 -- This terminal is a superset of the vt320. It adds the multiple # text pages and long text pages with selectable length of the vt340, along # with left and right margins, rectangular area text copy, fill, and erase # operations, selected region character attribute change operations, # page memory and rectangle checksums, insert/delete column, reception # macros, and other features too numerous to remember right now. TERMCAP # can only take advantage of a few of these added features. # # Note that this entry is are set up in what was the standard way for GNU # Emacs v18 terminal modes to deal with the cursor keys in that the arrow # keys were switched into application mode at the same time the numeric pad # is switched into application mode. This changes the definitions of the # arrow keys. Emacs v19 is smarter and mines its keys directly out of # your termcap entry, # # From: Daniel Glasser , 13 Oct 1993 # (vt400: string capability ":sb=\E[M:" corrected to ":sr=\E[M:"; # also, added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt400|vt400-24|dec-vt400|dec vt400 24x80 column autowrap:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:\ :cd=10\E[J:ce=4\E[K:cl=10\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:fs=\E[$}:ho=\E[H:\ :ic=\E[@:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:rc=\E8:sc=\E7:se=\E[27m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # (vt420: I removed :k0:, it collided with . I also restored # a missing :sc: -- esr) vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: # # DECUDK # if (key < 16) then value = key; # else if (key < 21) then value = key + 1; # else if (key < 25) then value = key + 2; # else if (key < 27) then value = key + 3; # else if (key < 30) then value = key + 4; # else value = key + 5; # vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:F4=\E[12;2~:\ :F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:F8=\E[17;2~:\ :F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:FC=\E[21;2~:\ :FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:FG=\E[24~:FH=\E[25~:\ :FI=\E[26~:FJ=\E[28~:FK=\E[29~:FL=\E[31~:FM=\E[32~:\ :FN=\E[33~:FO=\E[34~:FP=\E[35~:FQ=\E[36~:FR=\E[23;2~:\ :FS=\E[24;2~:FT=\E[25;2~:FU=\E[26;2~:FV=\E[28;2~:\ :FW=\E[29;2~:FX=\E[31;2~:FY=\E[32;2~:FZ=\E[33;2~:\ :Fa=\E[34;2~:Fb=\E[35;2~:Fc=\E[36;2~:\ :S6=USR_TERM\072vt420pcdos\072:k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\177:kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\:tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p2%{19}%=%t\E\023\021%e%p2%{32}%<%t\E%p2%c%e%p2%{127}%=%t\E\177%e%p2%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[m:sa@:\ :tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=\177:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:\ :tc=vt420: vt510|DEC VT510:\ :tc=vt420: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: # VT520/VT525 # # The VT520 is a monochrome text terminal capable of managing up to # four independent sessions in the terminal. It has multiple ANSI # emulations (VT520, VT420, VT320, VT220, VT100, VT PCTerm, SCO Console) # and ASCII emulations (WY160/60, PCTerm, 50/50+, 150/120, TVI 950, # 925 910+, ADDS A2). This terminfo data is for the ANSI emulations only. # # Terminal Set-Up is entered by pressing [F3], [Caps Lock]/[F3] or # [Alt]/[Print Screen] depending upon which keyboard and which # terminal mode is being used. If Set-Up has been disabled or # assigned to an unknown key, Set-Up may be entered by pressing # [F3] as the first key after power up, regardless of keyboard type. # (vt520: I added / based on the init string, also :sc: -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:r3=\E[?67h\E[64;1"p:\ :rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # (vt525: I added / based on the init string; # removed :se:=\E[m, :ue:=\E[m, added :sc: -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:r3=\E[?67h\E[64;1"p:\ :rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: #### VT100 emulations # # John Hawkinson tells us that the EWAN telnet for Windows # (the best Windows telnet as of September 1995) presents the name `dec-vt100' # to telnetd. Michael Deutschmann informs us # that this works best with a stock vt100 entry. dec-vt100|EWAN telnet's vt100 emulation:\ :tc=vt100: # From: Adrian Garside <94ajg2@eng.cam.ac.uk>, 19 Nov 1996 dec-vt220|DOS tnvt200 terminal emulator:\ :am@:tc=vt220: # Zstem340 is an (IMHO) excellent VT emulator for PC's. I recommend it to # anyone who needs PC VT340 emulation. (or anything below that level, for # that matter -- DEC's ALL-in-1 seems happy with it, as does INFOPLUS's # RDBM systems, it includes ReGIS and SiXel support! I'm impressed... # I can send the address if requested. # (z340: changed garbled \E[5?l to \E[?5l, DEC smooth scroll off -- esr) # From: Adam Thompson Sept 10 1995 z340|zstem vt340 terminal emulator 132col 42line:\ :li#42:\ :is=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h\E[1;42r\E[42;1H:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h\E[1;42r\E[42;1H:\ :tc=vt320-w: z340-nam|zstem vt340 terminal emulator 132col 42line:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[?5l\E[?7l\E[?8h\E[1;42r\E[42;1H:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?7l\E[?8h\E[1;42r\E[42;1H:\ :tc=z340: #### X terminal emulators # # You can add the following line to your .Xdefaults to change the terminal type # set by the xterms you start up to my-xterm: # # *termName: my-xterm # # System administrators can change the default entry for xterm instances # by adding a similar line to /usr/X11/lib/X11/app-defaults/XTerm. In either # case, xterm will detect and reject an invalid terminal type, falling back # to the default of xterm. # # X10/6.6 11/7/86, minus alternate screen, plus (csr) # (xterm: ":MT:" changed to ":km:"; added / based on init string; # removed (hs, eslok, tsl=\E[?E\E[?%i%dT, fsl=\E[?F, dsl=\E[?E) # as these seem not to work -- esr) x10term|vs100-x10|xterm terminal emulator (X10 window system):\ :am:bs:km:mi:ms:xn:xo:\ :co#80:it#8:li#65:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:RA=\E[?7l:SA=\E[?7h:\ :al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :im=\E[4h:is=\E\E[m\E[?7h\E[?1;4l:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:\ :rs=\E[r\E<\E[m\E[H\E[2J\E[?7h\E[?1;3;4;6l:se=\E[m:\ :sf=^J:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # Compatible with the R5 xterm # (from the XFree86 3.2 distribution, removed) xterm-r5|xterm R5 version:\ :am:bs:km:ms:xn:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:\ :F2=\E[24~:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ei=:ho=\E[H:ic=\E[@:im=:k0=\EOq:k1=\E[11~:\ :k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kA=\E[30~:\ :kD=\E[3~:kE=\E[8~:kI=\E[2~:kL=\E[31~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\E[7~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:r1=\E>\E[1;3;4;5;6l\E[?7h\E[m\E[r\E[2J\E[H:\ :rc=\E8:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:up=\E[A: # Compatible with the R6 xterm # (from XFree86 3.2 distribution, and :it: added, removed) xterm-r6|xterm-old|xterm X11R6 version:\ :am:bs:km:mi:ms:xn:\ :co#80:it#8:li#24:\ :*6=\E[4~:@0=\E[1~:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:\ :DO=\E[%dB:F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:\ :F5=\E[28~:F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:eA=\E(B:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E7\E[r\E[m\E[?7h\E[?1;3;4;6l\E[4l\E8\E>:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:me=\E[m:ml=\El:\ :mr=\E[7m:mu=\Em:nd=\E[C:\ :r2=\E7\E[r\E[m\E[?7h\E[?1;3;4;6l\E[4l\E8\E>:rc=\E8:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :te=\E[2J\E[?47l\E8:ti=\E7\E[?47h:ue=\E[m:up=\E[A:\ :us=\E[4m: # This is the stock xterm entry supplied with XFree86 3.2 # The name has been changed and some aliases have been removed. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) xterm-xf86-v32|xterm terminal emulator (X Window System):\ :am:bs:km:mi:ms:xn:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOy:K3=\EOu:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E7\E[r\E[m\E[?7h\E[?1;3;4;6l\E[4l\E8\E>:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kD=\177:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\EOH:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:\ :me=\E[m\017:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:\ :sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:te=\E[2J\E[?47l\E8:\ :ti=\E7\E[?47h:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # This is the stock xterm entry supplied with XFree86 3.3, which uses VT100 # codes for F1-F4 except while in VT220 mode. xterm-xf86-v33|xterm terminal emulator (X Window System):\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :tc=xterm-xf86-v32: # This is one of the variants from XFree86 3.3 (T.Dickey) xterm-16color|xterm with 16 colors like aixterm:\ :Co#16:NC#32:pa#256:\ :AB@:AF@:\ :..Sb=%p1%{8}%/%{6}%*%{4}%+\E[%d%p1%{8}%m%Pa%?%ga%{1}%=%t4%e%ga%{3}%=%t6%e%ga%{4}%=%t1%e%ga%{6}%=%t3%e%ga%d%;m:\ :..Sf=%p1%{8}%/%{6}%*%{3}%+\E[%d%p1%{8}%m%Pa%?%ga%{1}%=%t4%e%ga%{3}%=%t6%e%ga%{4}%=%t1%e%ga%{6}%=%t3%e%ga%d%;m:\ :tc=xterm-xf86-v33: # This is xterm for ncurses. It mainly adds mappings for more high-half # characters. Note that these will only work for fixed-width fonts. xterm-nc|vs100-nc|xterms-nc|xterm terminal emulator (X Window System):\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~..--++\054\054II00:\ :u6=\E[%i%d;%dR:u7=\E[6n:u8=\E[?1;2c:u9=\E[c:\ :tc=xterm-r6: # This is the standard xterm entry. xterm|vs100|xterms|xterm terminal emulator (X Window System):\ :tc=xterm-r6: # These entries allow access to the X titlebar and icon name as a status line. # Note that twm (and possibly window managers descended from it such as tvtwm, # ctwm, and vtwm) track windows by icon-name; thus, you don't want to mess # with it. xterm+sl|access X title line and icon name:\ :hs:\ :ws#40:\ :ds=\E]0;\007:fs=^G:ts=\E]0;: xterm+sl-twm|access X title line (pacify twm-descended window managers):\ :hs:\ :ws#40:\ :ds=\E]2;\007:fs=^G:ts=\E]2;: # # The following xterm variants don't depend on your base version # xterm-bold|xterm terminal emulator (X11R6 Window System) standout w/bold:\ :so=\E[1m:\ :tc=xterm: # (kterm: this had extension capabilities ":KJ:TY=ascii:" -- esr) kterm|kterm kanji terminal emulator (X window system):\ :es:hs:ds=\E[?H:fs=\E[?F:ts=\E[?E\E[?%i%dT:\ :tc=xterm-r6: # See the note on ICH/ICH1 VERSUS RMIR/SMIR near the end of file xterm-nic|xterm with ich/ich1 suppressed for non-curses programs:\ :IC@:ei=:ic@:im=:\ :tc=xterm: # From: Mark Sheppard , 4 May 1996 xterm1|xterm terminal emulator ignoring the alternate screen buffer:\ :te@:ti@:\ :tc=xterm: # This describes the capabilities of color_xterm, an xterm variant from # before ECMA-64 color support was folded into the main-line xterm release. # This entry is straight from color_xterm's maintainer. # From: Jacob Mandelson , 09 Nov 1996 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) color_xterm|cx|cx100|color_xterm color terminal emulator for X:\ :am:km:mi:ms:xn:\ :co#80:it#8:li#65:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :i1=\E[r\E[m\E[?7h\E[?4;6l\E[4l:im=\E[4h:k1=\E[11~:\ :k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\EOB:kh=\E[7~:kl=\EOD:kr=\EOC:ku=\EOA:le=^H:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:\ :sf=^J:so=\E[7m:sr=\EM:ta=^I:te=\E>\E[?41;1r:\ :ti=\E[?1;41s\E[?1;41h\E=:ue=\E[24m:up=\E[A:us=\E[4m: # From: Mark Olesen & Thomas Dickey 13 Jul 1996 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) rxvt|reduced xterm terminal (X Window System):\ :am:km:mi:ms:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :i1=\E[?47l\E=\E[?1l:ic=\E[@:im=\E[4h:\ :is=\E[r\E[m\E[2J\E[H\E[?7h\E[?1;3;4;6l\E[4l:\ :k0=\E[21~:k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:\ :k5=\E[15~:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:ke=\E>:\ :kh=\E[7~:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:\ :sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:te=\E[?47l\E8:\ :ti=\E7\E[?47h:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # From: David J. MacKenzie 20 Apr 1995 # Here's a termcap entry I've been using for xterm_color, which comes # with BSD/OS 2.0, and the X11R6 contrib tape too I think. Besides the # color stuff, I also have a status line defined as the window manager # title bar. [I have translated it to terminfo -- ESR] xterm-pcolor|xterm with color used for highlights and status line:\ :md=\E[1m\E[43m:mr=\E[7m\E[34m:so=\E[7m\E[31m:\ :us=\E[4m\E[42m:\ :tc=xterm+sl:tc=xterm: # HP ships this, except for the pb#9600 which was merged in from BSD termcap. # (hpterm: added empty , we have no idea what ACS chars look like --esr) xhpterm|X-hpterm|hp X11 terminal emulator:\ :am:da:db:mi:xs:\ :Nl#8:co#80:lh#2:li#24:lm#0:lw#8:pb#9600:sg#0:\ :LF=\E&j@:LO=\E&jB:ac=:ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:\ :cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:\ :cr=^M:ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:do=\EB:ei=\ER:im=\EQ:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:\ :kA=\EL:kC=\EJ:kD=\EP:kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:\ :kM=\ER:kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kT=\E1:ka=\E3:kb=^H:\ :kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:\ :ku=\EA:le=^H:md=\E&dB:me=\E&d@:mh=\E&dH:ml=\El:mr=\E&dB:\ :mu=\Em:nd=\EC:..pk=\E&f%p1%dk%p2%l%dL%p2%s:\ :..pl=\E&f1a%p1%dk%p2%l%dL%p2%s:\ :..pn=\E&f%p1%dk%p2%l%dd0L%p2%s:\ :..px=\E&f2a%p1%dk%p2%l%dL%p2%s:\ :..sa=\E&d%?%p7%t%'s'%c%;%p1%p3%|%p6%|%{2}%*%p2%{4}%*%+%p4%+%p5%{8}%*%+%'@'%+%c%?%p9%t%'\016'%c%e%'\017'%c%;:\ :se=\E&d@:sf=^J:so=\E&dJ:sr=\ET:st=\E1:ta=^I:ue=\E&d@:\ :up=\EA:us=\E&dD: # This entry describes an xterm with Sun-style function keys enabled # via the X resource setting "xterm*sunFunctionKeys:true" # To understand / note that L1,L2 and F11,F12 are the same. # The ... keys are L3-L10. We don't set # because we want it to be seen as . # The ... keys are R1-R15. We treat some of these in accordance # with their Sun keyboard labels instead. # From: Simon J. Gerraty 10 Jan 1996 xterm-sun|xterm with sunFunctionKeys true:\ :%1=\E[196z:&8=\E[195z:@0=\E[200z:@5=\E[197z:@7=\E[220z:\ :F1=\E[192z:F2=\E[193z:F3=\E[194z:F4=\E[195z:F5=\E[196z:\ :F7=\E[198z:F8=\E[199z:F9=\E[200z:FA=\E[201z:FL=\E[208z:\ :FM=\E[209z:FN=\E[210z:FO=\E[211z:FP=\E[212z:FQ=\E[213z:\ :FS=\E[215z:FU=\E[217z:FW=\E[219z:FY=\E[221z:K2=\E[218z:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kI=\E[2z:kN=\E[222z:kP=\E[216z:kh=\E[214z:\ :tc=xterm: xterms-sun|small (80x24) xterm with sunFunctionKeys true:\ :co#80:li#24:tc=xterm-sun: # This is for the extensible terminal emulator on the X11R6 contrib tape. emu|emu native mode:\ :mi:ms:xo:\ :Co#15:co#80:it#8:li#24:pa#64:vt#200:\ :*6=\Esel:@0=\Efind:@8=^M:AL=\EQ%d;:DC=\EI%d;:DL=\ER%d;:\ :DO=\Ep%d;:F1=\EF11:F2=\EF12:F3=\EF13:F4=\EF14:F5=\EF15:\ :F6=\EF16:F7=\EF17:F8=\EF18:F9=\EF19:FA=\EF20:LE=\Eq-%d;:\ :RI=\Eq%d;:Sb=\Es%i%d;:Sf=\Er%i%d;:UP=\Ep-%d;:\ :ac=a\202f\260g261j\213k\214l\215m\216n\217o\220q\222s\224t\225u\226v\227w\230x\231~\244:\ :ae=\200:al=\EQ1;:as=\200:bl=^G:cb=\EL:cd=\EN:ce=\EK:\ :cl=\EP\EE0;0;:cm=\EE%d;%d;:cr=^M:cs=\Ek%d;%d;:ct=\Ej:\ :dc=\EI1;:dl=\ER1;:do=\EB:eA=\200:ec=\Ej%d;:ei=\EX:\ :ho=\EE0;0;:im=\EY:is=\ES\Er0;\Es0;:k0=\EF00:k1=\EF01:\ :k2=\EF02:k3=\EF03:k4=\EF04:k5=\EF05:k6=\EF06:k7=\EF07:\ :k8=\EF08:k9=\EF09:k;=\EF10:kD=\177:kI=\Eins:kN=\Enext:\ :kP=\Eprior:kb=^H:kd=\EB:kl=\EC:kr=\ED:ku=\EA:le=^H:\ :mb=\ES\EW:md=\ES\EU:me=\ES:mr=\ES\ET:nd=\ED:\ :oc=\Es0;\Er0;:r2=\ES\Es0;\Er0;:se=\ES:sf=\EG:so=\ES\ET:\ :sr=\EF:st=\Eh:ta=^I:ue=\ES:up=\EA:us=\ES\EV:ve=\Ea:vi=\EZ:\ :vs=\Ea: ######## MGR # # MGR is a Bell Labs window system lighter-weight than X. # These entries describe MGR's xterm-equivalent. # They are courtesy of Vincent Broman 14 Jan 1997 # mgr|Bellcore MGR (non X) window system terminal emulation:\ :am:km:\ :AL=\E%da:DC=\E%dE:DL=\E%dd:IC=\E%dA:RA=\E5S:SA=\E5s:\ :al=\Ea:bl=^G:cd=\EC:ce=\Ec:cl=^L:cm=\E%r%d;%dM:cr=^M:\ :cs=\E%d;%dt:dc=\EE:dl=\Ed:do=\Ef:ei=:hd=\E1;2f:hu=\E1;2u:\ :ic=\EA:im=:kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :md=\E2n:me=\E0n:mr=\E1n:nd=\Er:nw=^M^J:se=\E0n:sf=^J:\ :so=\E1n:ta=^I:ue=\E0n:up=\Eu:us=\E4n:ve=\Eh:vi=\E9h:\ :vs=\E0h: mgr-sun|Mgr window with Sun keyboard:\ :%1=\E[207z:%6=\E[198z:&8=\E[195z:@0=\E[200z:@5=\E197z:\ :@7=\E[220z:@8=\E[250z:F1=\E[234z:F2=\E[235z:K1=\E[214z:\ :K2=\E[218z:K3=\E[216z:K4=\E[220z:K5=\E[222z:k1=\E[224z:\ :k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:k6=\E[229z:\ :k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:kN=\E[222z:\ :kP=\E[216z:kh=\E[214z:\ :tc=mgr: mgr-linux|Mgr window with Linux keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:K1=\E[H:K2=\E[G:K3=\E[5~:\ :K4=\E[Y:K5=\E[6~:k0=\E[[J:k1=\E[[A:k2=\E[[B:k3=\E[[C:\ :k4=\E[[D:k5=\E[[E:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:k;=\E[21~:kD=\E[3~:kN=\E[6~:kP=\E[5~:kh=\E[1~:tc=mgr: ######## UNIX VIRTUAL TERMINALS, VIRTUAL CONSOLES, AND TELNET CLIENTS # # Columbus UNIX virtual terminal. This terminal also appears in # UNIX 4.0 and successors as line discipline 1 (?), but is # undocumented and does not really work quite right. cbunix|cb unix virtual terminal:\ :am:bs:da:db:\ :co#80:li#24:lm#0:\ :al=\EP:bl=^G:cd=\EL:ce=\EK:cl=\EL:cm=\EG%r%.%.:cr=^M:\ :dc=\EM:dl=\EN:do=^J:ei=:ic=\EO:im=:kd=\EB:kh=\EE:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:nd=\EC:se=\Eb^D:sf=^J:so=\Ea^D:\ :ue=\Eb^A:up=\EA:us=\Ea^A: # (vremote: removed obsolete ":nl@:" -- esr) vremote|virtual remote terminal:\ :am@:\ :co#79:tc=cbunix: pty|4bsd pseudo teletype:\ :cm=\EG%+ %+ :se=\Eb$:so=\Ea$:ue=\Eb\041:us=\Ea\041:tc=cbunix: # The codes supported by the term.el terminal emulation in GNU Emacs 19.30 eterm|gnu emacs term.el terminal emulation:\ :am:mi:xn:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:cb=\E[1K:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :im=\E[4h:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:se=\E[m:\ :sf=^J:so=\E[7m:ta=^I:te=\E[2J\E[?47l\E8:ti=\E7\E[?47h:\ :ue=\E[m:up=\E[A:us=\E[4m: # Entries for use by the FSF's `screen' program. The screen and # screen-w entries came with version 3.7.1. The screen2 and screen3 entries # come from University of Wisconsin and may be older. # (screen: added :ve: on ANSI model -- esr) screen|VT 100/ANSI X3.64 virtual terminal:\ :am:km:mi:ms:xn:\ :Co#8:co#80:it#8:li#24:pa#64:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:\ :F2=\E[24~:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~..--++\054\054hhII00:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E(B:ei=\E[4l:\ :ho=\E[H:im=\E[4h:is=\E(B:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[15~:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kH=\E[4~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:r2=\Ec:rc=\E8:sc=\E7:se=\E[23m:\ :sf=^J:so=\E[3m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\EM:\ :us=\E[4m:vb=\Eg:ve=\E[?25h:vi=\E[?25l:vs=\E[34l:\ :tc=ecma+color: screen-w|VT 100/ANSI X3.64 virtual terminal with 132 cols:\ :co#132:tc=screen: screen2|VT 100/ANSI X3.64 virtual terminal:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ic=:im=\E[4h:k0=\E~:\ :k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:k8=\ER:\ :k9=\E0I:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:\ :me=\E[m:nd=\E[C:nw=^M^J:r1=\Ec:rc=\E8:sc=\E7:se=\E[23m:\ :sf=^J:so=\E[3m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:\ :us=\E[4m: # (screen3: removed unknown ":xv:LP:G0:" -- esr) screen3|VT 100/ANSI X3.64 virtual terminal:\ :km:mi:ms:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:\ :ho=\E[H:im=\E[4h:is=:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\EOB:ke=\E>:kl=\EOD:kr=\EOC:ks=\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:r1=\Ec:\ :rc=\E8:sc=\E7:se=\E[23m:sf=^J:so=\E[3m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[24m:up=\EM:us=\E[4m: #### Pilot Pro Palm-Top # # From: Jason Downs , 15 Jun 1997 (Top Gun Telnet's author) pilot|tgtelnet|Top Gun Telnet on the Palm Pilot Professional:\ :am:xn:\ :co#39:li#16:\ :bl=^G:cl=\Ec:cm=\Em%+ %+ :cr=^M:do=^J:ho=\Em :kN=^L:kP=^K:\ :kb=^H:kd=^J:kl=^H:le=^H:nw=\Em~ :se=\EB:sf=^J:so=\Eb:ta=^I: ######## WORKSTATION CONSOLES # #### Sun consoles # # :is1: resets scrolling region in case a previous user had used "tset vt100" oldsun|Sun Microsystems Workstation console:\ :am:bs:km:mi:ms:\ :co#80:it#8:li#34:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:al=\E[L:bl=^G:\ :cd=\E[J:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:i1=\E[1r:ic=\E[@:im=:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:me=\E[m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:ta=^I:up=\E[A: # From: Alexander Lukyanov , 14 Nov 1995 # :li: capability later corrected by J.T. Conklin sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:r2=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # On a SparcStation 5, :al:/:AL: flake out on the last line. # Unfortunately, without them the terminal has no way to scroll. sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: # If you are using an SS5, change the sun definition to use sun-ss5. sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: # From: Tue Sep 24 13:14:44 1985 sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:\ :tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :li#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: #### Iris consoles # # (wsiris: this had extension capabilities # :HS=\E7F2:HE=\E7F7:\ # :CT#2:CZ=*Bblack,red,green,yellow,blue,magenta,cyan,*Fwhite: # See the note on Iris extensions near the end of this file. # Finally, removed suboptimal :cl:=\EH\EJ and added :do: & # :vb: from BRL -- esr) wsiris|iris40|iris emulating a 40 line visual 50 (approximately):\ :am:bs:nc:pt:\ :co#80:it#8:kn#3:li#40:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\Ev:cm=\EY%+ %+ :dl=\EM:\ :do=\EB:ho=\EH:is=\E7B0\E7F7\E7C2\E7R3:k0=\E0:k1=\E1:\ :k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:k8=\E8:k9=\E9:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:me=\E7F7:mh=\E7F2:nd=\EC:\ :nl=\EB:se=\E0@:sf=^J:so=\E9P:sr=\EI:ta=^I:ue=\E7R3\E0@:\ :up=\EA:us=\E7R2\E9P:vb=\E7F4\E7B1\013\E7F7\E7B0:ve=\E>:\ :vs=\E;: #### NeWS consoles # # Console terminal windows under the NeWS (Sun's Display Postscript windowing # environment). Note: these have nothing to do with Sony's News workstation # line. # # Entry for NeWS's psterm from Eric Messick & Hugh Daniel # (psterm: unknown ":sl=\EOl:el=\ENl:" removed -- esr) psterm|psterm-basic|NeWS psterm-80x34:\ :am:bs:hs:km:ul:\ :co#80:it#8:li#34:\ :al=\EA:cd=\EB:ce=\EC:cl=^L:cm=\E%d;%d;:cs=\EE%d;%d;:\ :dc=\EF:dl=\EK:do=\EP:ei=\ENi:fs=\ENl:ho=\ER:i1=\EN*:\ :im=\EOi:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=\ET:ll=\EU:\ :mb=\EOb:md=\EOd:me=\EN*:mr=\EOr:nd=\EV:rc=^\:sc=^]:se=\ENo:\ :sf=\EW:so=\EOo:sr=\EX:ta=^I:te=\ENt:ti=\EOt:ts=\EOl:\ :ue=\ENu:up=\EY:us=\EOu:vb=\EZ: psterm-96x48|NeWS psterm 96x48:\ :co#96:li#48:tc=psterm: psterm-90x28|NeWS psterm 90x28:\ :co#90:li#28:tc=psterm: psterm-80x24|NeWS psterm 80x24:\ :co#80:li#24:tc=psterm: # This is a faster termcap for psterm. Warning: if you use this termcap, # some control characters you type will do strange things to the screen. # (psterm-fast: unknown ":sl=^Ol:el=^Nl:" -- esr) psterm-fast|NeWS psterm fast version (flaky ctrl chars):\ :am:bs:hs:km:ul:\ :co#80:it#8:li#34:\ :al=^A:cd=^B:ce=^C:cl=^L:cm=\004%d;%d;:cs=\005%d;%d;:dc=^F:\ :dl=^K:do=^P:ei=^Ni:fs=^Nl:ho=^R:i1=^N*:im=^Oi:kd=\E[B:\ :kl=\E[D    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x :kr=\E[C:ku=\E[A:le=^T:ll=^U:mb=^Ob:md=^Od:me=^N*:\ :mr=^Or:nd=^V:rc=^\:sc=^]:se=^No:sf=^W:so=^Oo:sr=^X:ta=^I:\ :te=^Nt:ti=^Ot:ts=^Ol:ue=^Nu:up=^Y:us=^Ou:vb=^Z: #### NeXT Consoles # # Use `glasstty' for the Workspace application # # From: Dave Wetzel 22 Dec 1995 next|NeXT console:\ :am:xt:\ :co#80:it#8:li#24:\ :bl=^G:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:cr=^M:do=^J:ho=\E[H:\ :kb=^H:kd=^J:kl=^H:le=^H:me=\E[m:nd=\E[C:nw=^M^J:se=\E[4;1m:\ :sf=^J:so=\E[4;2m:ta=^I:up=\E[A: nextshell|NeXT Shell application:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:kb=^H:kd=^J:kl=^H:le=^H:nw=^M^J:ta=^I: #### Common Desktop Environment # # This ships with Sun's CDE in Solaris 2.5 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) dtterm|CDE desktop terminal:\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#24:lm#0:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E F\E>\E[?1l\E[?7h\E[?45l:k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:\ :rc=\E8:sc=\E7:se=\E[22;27m:sf=\ED:so=\E[2;7m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l:\ :ve=\E[?25h:vi=\E[?25l: ### Non-Unix Consoles # # This entry fits the Windows NT console when the _POSIX_TERM environment # variable is set to 'on'. While the Windows NT POSIX console is seldom used, # the obnoxious Telnet client supplied with both the Windows for WorkGroup # 3.11 TCP/IP stack and the Win32 (i.e., Windows 95 and Windows NT 3.1 or # later) operating systems is not, and (surprise!) they match very well. # # This was adapted from MS Knowledge Base item Q108581, dated 13-MAY-1997, # titled "Setting Up VI POSIX Editor for Windows NT 3.1". True to Microsoft # form, not are the installation instructions a pile of mind-numbing # bureaucratese, but the termcap entry is actually broken and unusable as # given; the :do: capability is misspelled "d". # ansi-nt|psx_ansi|Microsoft Windows NT console POSIX ANSI mode:\ :am:bw:ms:\ :co#80:it#8:li#25:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:cr=^M:do=^J:\ :ho=\E[H:kb=^H:kd=\E[V:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :me=\E[0m:mr=\E[7m:nd=\E[C:nw=\r\E[S:rc=\E[u:sc=\E[s:\ :se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:up=\E[A: ######## COMMON TERMINAL TYPES # # This section describes terminal classes and maker brands that are still # quite common, but have proprietary command sets not blessed by ANSI. # #### Altos # # Altos made a moderately successful line of UNIX boxes. In 1990 they were # bought out by Acer, a major Taiwanese manufacturer of PC-clones. # Acer has a web site at http://www.acer.com. # # Altos descriptions from Ted Mittelstaedt 4 Sep 1993 # His comments suggest they were shipped with the system. # # (altos2: had extension capabilities # :c0=^A`\r:c1=^Aa\r:c2=^Ab\r:c3=^Ac\r:\ # :c4=^Ad\r:c5=^Ae\r:c6=^Af\r:c7=^Ag\r:\ # :c8=^Ah\r:c9=^Ai\r:cA=^Aj\r:cB=^Ak\r:\ # :cC=^Al\r:cD=^Am\r:cE=^An\r:cF=^Ao\r: # :XU=^Aq\r:XD=^Ar\r:XR=^As\r:XL=^At\r:\ # :YU=^AQ\r:YD=^AR\r:YR=^AS\r:YL=^AT\r:\ # :HL=^AP\r:SP=\E[i:\ # :IS=\E[@:DE=\E[P:IL=\E[L:NS=\E[S:PS=\E[T:\ # :LO=\E[0q:LC=\E[5q:LL=\E[6q:\ # Comparison with the k* capabilities makes it obvious that the c* things are # shift keys. I have renamed them to keys 32 and up accordingly. Also, # :sr: was given as a boolean-- esr) altos2|alt2|altos-2|altos II:\ :co#80:it#8:li#24:sg#0:\ :*5=^Am\r:*8=^An\r:DL=\E[M:FM=^A`\r:FN=^Aa\r:FO=^Ab\r:\ :FP=^Ac\r:FQ=^Ad\r:FR=^Ae\r:FS=^Af\r:FT=^Ag\r:FU=^Ah\r:\ :FV=^Ai\r:FW=^Aj\r:FX=^Ak\r:RA=\E[?7l:SA=\E[?7h:al=\E[L:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :dc=\E[P:do=\E[1B:ei=:ho=\E[H:ic=\E[@:\ :if=/usr/share/tabset/vt100:im=:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:k0=^AI\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=^AJ\r:kB=^AK\r:kC=^AL\r:\ :kD=^AM\r:kE=^AN\r:kF=^AO\r:kb=^H:kd=\E[B:kh=\E[f:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[1C:nw=^M^J:se=\E[m:\ :sf=^J:so=\E[7m:ta=^I:ue=\E[m:up=\E[1A:us=\E[4m: # (altos3: had extension capabilities # :c0=^A`\r:c1=^Aa\r:c2=^Ab\r:c3=^Ac\r:\ # :c4=^Ad\r:c5=^Ae\r:c6=^Af\r:c7=^Ag\r:\ # :c8=^Ah\r:c9=^Ai\r:cA=^Aj\r:cB=^Ak\r:\ # :cC=^Al\r:cD=^Am\r:cE=^An\r:cF=^Ao\r: # :XU=^Aq\r:XD=^Ar\r:XR=^As\r:XL=^At\r:\ # :HL=^AP\r:SP=\E[i:\ # :IS=\E[@:DE=\E[P:IL=\E[L:NS=\E[S:PS=\E[T:\ altos3|altos5|alt3|alt5|altos-3|altos-5|altos III or V:\ :mb=\E[5p:me=\E[p:sr=\EM:\ :tc=altos2: altos4|alt4|altos-4|altos IV:\ :tc=wy50: # (altos7: had extension capabilities: # :GG#0:GI=\EH8:GF=\EH7:\ # :c0=^A`\r:c1=^Aa\r:c2=^Ab\r:c3=^Ac\r:\ # :c4=^Ad\r:c5=^Ae\r:c6=^Af\r:c7=^Ag\r:\ # :c8=^Ah\r:c9=^Ai\r:cA=^Aj\r:cB=^Ak\r:\ # :cC=^Al\r:cD=^Am\r:cE=^An\r:cF=^Ao\r: # Comparison with the k* capabilities makes it obvious that the c* things are # shift keys. I have renamed them to keys 32 and up accordingly. I have # also made this entry relative to adm12 in order to give it an :sa:. The # imported by use=adm+sgr may work, let me know. -- esr) altos7|alt7|altos VII:\ :am:mi:\ :co#80:li#24:sg#0:\ :*5=^Am\r:*8=^An\r:DL=\ER:FM=^A`\r:FN=^Aa\r:FO=^Ab\r:\ :FP=^Ac\r:FQ=^Ad\r:FR=^Ae\r:FS=^Af\r:FT=^Ag\r:FU=^Ah\r:\ :FV=^Ai\r:FW=^Aj\r:FX=^Ak\r:\ :ac=l2m1k3j5t4u9v=w0q\072x6n8:al=\EE:cd=\EY:ce=\ET:\ :cl=\E+^^:cm=\E=%+ %+ :cr=^M:dc=\EW:do=^J:ei=\Er:ho=^^:\ :im=\Eq:is=\E`\072\Ee(\EO\Ee6\Ec41\E~4\Ec21\Eu\E~2:\ :k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=^AJ\r:kB=^AK\r:\ :kC=^AL\r:kD=^AM\r:kE=^AN\r:kF=^AO\r:kN=\EK:kP=\EJ:kb=^H:\ :kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:mb=\EG2:md=\EGt:mh=\EGp:\ :mk=\EG1:nd=^L:nw=^M^J:pf=\EJ:po=\Ed#:sf=^J:sr=\Ej:ta=^I:\ :up=^K:\ :tc=adm+sgr: altos7pc|alt7pc|altos PC VII:\ :@7=\ET:tc=altos7: #### Hewlett-Packard (hp) # # Hewlett-Packard # 8000 Foothills Blvd # Roseville, CA 95747 # Vox: 1-(916)-785-4363 (Technical response line for VDTs) # 1-(800)-633-3600 (General customer support) # # Generic HP terminal - this should (hopefully) work on any HP terminal. hpgeneric|hp|hewlett-packard generic terminal:\ :am:bs:da:db:mi:pt:xs:\ :co#80:li#24:lm#0:vt#6:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:\ :cm=\E&a%r%dc%dY:cr=^M:ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:\ :do=^J:ei=\ER:im=\EQ:kB=\Ei:kb=^H:le=^H:me=\E&d@:nd=\EC:\ :se=\E&d@:sf=^J:so=\E&dJ:st=\E1:ta=^I:ue=\E&d@:up=\EA:\ :us=\E&dD: hp110|hewlett-packard model 110 portable:\ :li#16:tc=hpgeneric: hp+pfk+cr|hp function keys with CR:\ :k1=\Ep\r:k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:\ :k7=\Ev\r:k8=\Ew\r: hp+pfk-cr|hp function keys w/o CR:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew: # The hp2621s use the same keys for the arrows and function keys, # but not separate escape sequences. These definitions allow the # user to use those keys as arrow keys rather than as function # keys. hp+pfk+arrows|hp alternate arrow definitions:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:kF=\Er\r:kH=\Eq\r:kR=\Es\r:\ :kd=\Ew\r:kh=\Ep\r:kl=\Eu\r:kr=\Ev\r:ku=\Et\r: hp+arrows|hp arrow definitions:\ :kF=\ES:kH=\EF:kR=\ET:kd=\EB:kh=\Eh:kl=\ED:kr=\EC:ku=\EA: # Generic stuff from the HP 262x series # hp262x|HP 262x terminals:\ :xs:\ :cd=\EJ:dc=\EP:ip=:kA=\EL:kD=\EP:kE=\EK:kF=\ES:kI=\EQ:kL=\EM:\ :kM=\ER:kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kd=\EB:ke=\E&s0A:kh=\Eh:\ :kl=\ED:kr=\EC:ks=\E&s1A:ku=\EA:mb=\E&dA:me=\E&d@:mk=\E&dS:\ :mr=\E&dB:\ :..sa=\E&d%'@'%?%p1%t%'B'%|%;%?%p2%t%'D'%|%;%?%p3%t%'B'%|%;%?%p4%t%'A'%|%;%c:\ :se=\E&d@:sf=\ES:so=\E&dB:ta=\011:ue=\E&d@:us=\E&dD: # Note: no :ho: on HPs since that homes to top of memory, not screen. # Due to severe 2621 braindamage, the only way to get the arrow keys to # transmit anything at all is to turn on the function key labels # with :ks:, and even then the user has to hold down shift! # The default 2621 turns off the labels except when it has to to # enable the function keys. If your installation prefers labels # on all the time, or off all the time (at the "expense" of the # function keys), use 2621-nl or 2621-wl. # # Note: there are newer ROMs for 2621's that allow you to set # strap A so the regular arrow keys xmit \EA, etc, as with the # 2645. However, even with this strap set, the terminal stops # xmitting if you reset it, until you unset and reset the strap! # Since there is no way to set/unset the strap with an escape # sequence, we don't use it in the default. # If you like, you can use 2621-ba (brain-damaged arrow keys). hp2621-ba|2621 w/new rom and strap A set:\ :ke@:ks@:tc=hp+arrows:\ :tc=hp2621: # hp2621 with function labels. Most of the time they are off, # but inside vi, the function key labels appear. You have to # hold down shift to get them to xmit. hp2621|hp2621a|hp2621A|2621|2621a|2621A|hp2621-wl|2621-wl|hp 2621 w/labels:\ :is=\E&jA\r:ke=\E&jA:\ :tc=hp2621-fl: hp2621-fl|hp 2621:\ :xo:xs@:\ :pb#19200:\ :bt=\Ei:cm=\E&a%r%dc%dY:dc=\EP:ip=:is=\E&j@\r:ke=\E&j@:\ :ks=\E&jB:me=\E&d@:se=\E&d@:so=\E&dD:ta=\011:ue=\E&d@:\ :us=\E&dD:\ :tc=hp+pfk+cr:tc=hpgeneric: # To use hp2621p printer, setenv TERM=2621p, PRINTER=2612p hp2621p|hp 2621 with printer:\ :pf=\E&p13C:po=\E&p11C:tc=hp2621: hp2621p-a|hp2621p with fn as arrows:\ :tc=hp+pfk+arrows:tc=hp2621p: # hp2621 with k45 keyboard hp2621-k45|hp2621k45|k45|hp 2621 with 45 keyboard:\ :kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:\ :ku=\EA:\ :tc=hp2621: # 2621 using all 48 lines of memory, only 24 visible at any time. hp2621-48|48 line 2621:\ :li#48:\ :cm=\E&a%r%dc%dR:cv=\E&a%dR:ho=\EH:tc=hp2621: # 2621 with no labels ever. Also prevents vi delays on escape. hp2621-nl|hp 2621 with no labels:\ :kd@:ke@:kh@:kl@:kr@:ks@:ku@:tc=hp2621-fl: # Needed for UCB ARPAVAX console, since lsi-11 expands tabs # (wrong). # hp2621-nt|hp 2621 w/no tabs:\ :ta@:tc=hp2621: # Hp 2624 B with 4 or 10 pages of memory. # # Some assumptions are made with this entry. These settings are # NOT set up by the initialization strings. # # Port Configuration # RecvPace=Xon/Xoff # XmitPace=Xon/Xoff # StripNulDel=Yes # # Terminal Configuration # InhHndShk=Yes # InhDC2=Yes # XmitFnctn(A)=No # InhEolWrp=No # # Note: the 2624 DOES have a true :ho:, believe it or not! # # The 2624 has an "error line" to which messages can be sent. # This is CLOSE to what is expected for a "status line". However, # after a message is sent to the "error line", the next carriage # return is EATEN and the "error line" is turned back off again! # So I guess we can't define :hs:, :es:, :ws:, :ds:, :fs:, :ts:. # # This entry supports emacs (and any other program that uses raw # mode) at 4800 baud and less. I couldn't get the padding right # for 9600. # # (hp2624: replaced NUL sequences in flash with mandatory pauses -- esr) hp2624|hp2624a|hp2624b|hp2624b-4p|Hewlett Packard 2624 B:\ :da:db:\ :lm#96:\ :vb=\E&w13F\E&w12F\E&w13F\E&w12F:tc=hp+labels:tc=scrhp: # This hp2626 entry does not use any of the fancy windowing stuff # of the 2626. # # Indeed, terminfo does not yet handle such stuff. Since changing # any window clears memory, it is probably not possible to use # this for screen opt. # # ed is incredibly slow most of the time - I am guessing at the # exact padding. Since the terminal uses xoff/xon this is intended # only for cost computation, so that the terminal will prefer el # or even dl1 which is probably faster! # # \ED\EJ\EC hack for ed from Ed Bradford - apparently ed is only # extra slow on the last line of the window. # # The padding probably should be changed. # hp2626|hp2626a|hp2626p|hp 2626:\ :da:db:\ :lm#0:pb#19200:\ :SF=\E&r%dD:SR=\E&r%dU:cd=\ED\EJ\EC:ip=:is=\E&j@\r:tc=hp+pfk+cr:tc=hp+labels:tc=scrhp: # This entry is for sysline. It allocates a 23 line window with # a 115 line workspace for regular use, and a 1 line window for # the status line. # # This assumes port 2 is being used. # Turn off horizontal line, Create ws #1 with 115 lines, # Create ws #2 with 1 line, Create window #1 lines 1-23, # Create window #2 lines 24-24, Attach cursor to workspace #1. # Note that this clears the tabs so it must be done by tset before # it sets the tabs. # hp2626-s|hp 2626 using only 23 lines:\ :es:hs:\ :li#23:\ :fs=\E&d@\E&w7f2p1I\E&w4f1I:\ :i1=\E&q3t0{0H \E&w0f115n1I \E&w0f1n2I \E&w2f1i0d0u22l0S \E&w2f2i0d23u23l0S \E&w7f2p1I \r:\ :ts=\E&w7f2p2I\E&w4f2I\r\EK\E&a%p1%dC:\ :tc=hp2626: # Force terminal back to 24 lines after being 23. hp2626-ns|hp 2626 using all 24 lines:\ :i1=\E&q3t0{0H \E&w0f118n1I \E&w0f1n2I \E&w2f1i0d0u23l0S \E&w3f2I \E&w7f2p1I \r:tc=hp2626: # Various entries useful for small windows on 2626. hp2626-12|hewlett-packard 2626 12 lines:\ :li#12:tc=hp2626: hp2626-12x40|hewlett-packard 2626 12 lines 40 columns:\ :co#40:li#12:tc=hp2626: hp2626-x40|hewlett-packard 2626 40 columns:\ :co#40:tc=hp2626: hp2626-12-s|hewlett-packard 2626 11 lines plus status:\ :li#11:tc=hp2626-s: # # hp2627 color tubes from University of Wisconsin # hp2627a-rev|hp 2627 with reverse video colors:\ :cr=^M:do=^J:\ :is=\E&v0m1a0b0c1x1y1z1i0a0b1c1x1y1z0i0S\E&j@\r\E3\r:\ :kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:ue=\E&v0S\E&d@:\ :us=\E&dD\E&v1S:\ :tc=hp2621-nl: hp2627a|hp 2627 color terminal with no labels:\ :cr=^M:do=^J:\ :is=\E&v0m1a1b0c1i0a1b1c2i1a0b0c0i0S\E&j@\r\E3\r:\ :kb=^H:kd=^J:kl=^H:nw=^M^J:se=\E&v0S:sf=^J:so=\E&v2S:ta=^I:\ :ue=\E&v0S\E&d@:us=\E&dD\E&v1S:\ :tc=hp2621-nl: hp2627c|hp 2627 color (cyan) terminal with no labels:\ :cr=^M:do=^J:\ :is=\E&v0m1a0b0c2i1a1b0c1i0a1b1c0i0S\E&j@\r\E3\r:\ :kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:\ :tc=hp2627a: # hp2640a doesn't have the Y cursor addressing feature, and C is # memory relative instead of screen relative, as we need. # hp2640a|hp 2640a:\ :cm@:ke@:ks@:tc=hp2645: hp2640b|hp2644a|hp 264x series:\ :ke@:ks@:tc=hp2645: # (hp2641a: removed unknown :gu: -- esr) hp2641a|hp2645a|hp2647a|HP 264?A series BRL entry:\ :am:da:db:mi:xs:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%2C:cl=\EH\EJ:\ :cm=\E&a%r%2c%2Y:cr=^M:cv=\E&a%2Y:dc=\EP:dl=\EM:do=^J:\ :ei=\ER:if=/usr/share/tabset/std:im=\EQ:is=500\EE:kb=^H:\ :kd=^J:kl=^H:le=^H:nd=\EC:nw=^M^J:se=\E&d@:sf=^J:so=\E&dB:\ :ta=^I:up=\EA: # This terminal should be used at 4800 baud or less. It needs padding for # plain characters at 9600, I guessed at an appropriate cr delay. It really # wants ^E/^F handshaking, but that doesn't work well even if you write # software to support it. hp2645|hp45|HP 2645 series:\ :pb#9600:\ :cr=\r:kA=\EL:kD=\EP:kE=\EK:kF=\ES:kI=\EQ:kL=\EM:kM=\ER:\ :kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kT=\E1:kd=\EB:ke=\E&s0A:kh=\Eh:\ :kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:ku=\EA:mb=\E&dA:me=\E&d@:\ :mh=\E&dH:mr=\E&dB:\ :..sa=\E&d%'@'%?%p1%t%'B'%|%;%?%p2%t%'D'%|%;%?%p3%t%'B'%|%;%?%p4%t%'A'%|%;%?%p5%t%'H'%|%;%?%p6%t%'B'%|%;%c:\ :us=\E&dD:\ :tc=hpgeneric: # You should use this terminal at 4800 baud or less. hp2648|hp2648a|HP 2648a graphics terminal:\ :cl=\EH\EJ:cm=\E&a%r%dc%dY:dc=\EP:ip=:tc=hp2645: # The HP 150 terminal is a fairly vanilla HP terminal, with the # clreol standout problem. It also has graphics capabilities and # a touch screen, which we don't describe here. hp150|hewlett packard Model 150:\ :bs:tc=hp2622: # HP 2382a terminals, "the little ones." They don't have any # alternate character set support and sending out ^N/^O will # leave the screen blank. hp2382a|hp2382|hewlett packard 2382a:\ :da:db:\ :lh#1:lm#48:\ :ac@:ae@:as@:me=\E&d@:\ :..pn=\E&f0a%p1%dk%p2%l%Pa%?%ga%t%ga%d%e1%;d0L%?%ga%!%t %;%p2%s:\ :..sa=\E&d%{0}%Pa%?%p4%t%{1}%ga%+%Pa%;%?%p1%p3%|%p6%|%t%{2}%ga%+%Pa%;%?%p2%p6%|%t%{4}%ga%+%Pa%;%?%p1%p5%|%t%{8}%ga%+%Pa%;%?%p7%t%?%ga%ts%ga%'@'%+%e%'S'%;%e%?%ga%t%ga%'@'%+%e%'@'%;%;%c:\ :tc=hp+labels:tc=scrhp: hp2621-a|hp2621a-a|hp2621 with fn as arrows:\ :tc=hp+pfk+arrows:tc=hp2621-fl: # newer hewlett packard terminals newhpkeyboard|generic entry for HP extended keyboard:\ :kA=\EL:kB=\Ei:kC=\EJ:kD=\EP:kE=\EK:kF=\ET:kH=\EF:kI=\EQ:\ :kL=\EM:kM=\ER:kN=\EU:kP=\EV:kR=\ES:kS=\EJ:kb=^H:kd=\EB:\ :ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:ku=\EA:\ :tc=hp+pfk-cr: newhp|generic entry for new hewlett packard terminals:\ :am:bw:mi:xo:xs:\ :co#80:li#24:pb#4800:\ :ac=T1R\041U2S"W3O#V4P$t5u6w7v8\072'9(LQKWlRkT5I3@2[MAJSmFjGdHQ;Y+Z*X\0724>q\054x.n/:\ :ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:cr=^M:ct=\E3:\ :dc=\EP:dl=\EM:do=^J:ei=\ER:i1=\E&jB:im=\EQ:ip=:le=^H:\ :mb=\E&dA:md=\E&dF:me=\E&d@\017:mh=\E&dH:mk=\E&dS:\ :mr=\E&dB:nd=\EC:nw=^M^J:\ :..pk=\E&f0a%p1%dk0d%p2%l%dL%p2%s:\ :..pl=\E&f1a%p1%dk0d%p2%l%dL%p2%s:\ :..px=\E&f2a%p1%dk0d%p2%l%dL%p2%s:r1=\Eg:\ :..sa=\E&d%{0}%Pa%?%p4%t%{1}%ga%+%Pa%;%?%p1%p3%|%p6%|%t%{2}%ga%+%Pa%;%?%p2%p6%|%t%{4}%ga%+%Pa%;%?%p1%p5%|%t%{8}%ga%+%Pa%;%?%p7%t%?%ga%ts%ga%'@'%+%e%'S'%;%e%?%ga%t%ga%'@'%+%e%'@'%;%;%c%?%p9%t\016%e\017%;:\ :se=\E&d@:sf=^J:so=\E&dJ:sr=\ET:st=\E1:ta=\011:ue=\E&d@:\ :up=\EA:us=\E&dD:\ :tc=newhpkeyboard: memhp|memory relative addressing for new HP ttys:\ :vt#6:\ :CM=\E&a%p1%dr%p2%dC:DO=\E&a+%dR:LE=\E&a-%dC:\ :RI=\E&a+%dC:UP=\E&a-%dR:ch=\E&a%dC:cl=\EH\EJ:\ :cm=\E&a%dr%dC:cv=\E&a%dR:ho=\EH:ll=\E&a23R\r:tc=newhp: scrhp|screen relative addressing for new HP ttys:\ :CM=\E&a%p1%dr%p2%dC:DO=\E&a+%dR:LE=\E&a-%dC:\ :RI=\E&a+%dC:UP=\E&a-%dR:ch=\E&a%dC:cl=\E&a0c0Y\EJ:\ :cm=\E&a%dy%dC:cv=\E&a%dY:ho=\E&a0y0C:ll=\E&a0y0C\EA:\ :tc=newhp: # (hp+labels: added label values from a BRL termcap -- esr) hp+labels|"standard" label info for new HP ttys:\ :Nl#8:lh#2:lw#8:\ :LF=\E&j@:LO=\E&jB:l0=f1:l1=f2:l2=f3:l3=f4:l4=f5:l5=f6:l6=f7:\ :l7=f8:\ :..pn=\E&f2a%p1%dk%p2%l%Pa%?%ga%t%ga%d%e1%;d0L%?%ga%!%t %;%p2%s: hp+printer|"standard" printer info for HP ttys:\ :ff=\E&p4u0C:pf=\E&p13C:po=\E&p11C:ps=\EH\E&p4dF: # The new hp2621b is kind of a cross between the old 2621 and the # new 262x series of machines. It has dip-switched options. # The firmware has a bug in it such that if you give it a null # length label, the following character is eaten! hp2621b|hp 2621b with old style keyboard:\ :Nl#8:lh#1:lm#48:lw#8:\ :LO=\E&jB:kF=\ET:kH=\EF:kR=\ES:kd=\EB:kh=\Eh:kl=\ED:kr=\EC:\ :ku=\EA:\ :..pn=\E&f0a%p1%dk%p2%l%Pa%?%ga%t%ga%d%e1%;d3L%?%ga%!%t%{32}%c%;%p2%s\E%'o'%p1%+%c\r:tc=hp2621: hp2621b-p|hp 2621b with printer:\ :tc=hp+printer:tc=hp2621b: # hp2621b - new 2621b with new extended keyboard # these are closer to the new 26xx series than the other 2621b hp2621b-kx|hp 2621b with extended keyboard:\ :tc=newhpkeyboard:tc=hp2621b: hp2621b-kx-p|hp 2621b with new keyboard & printer:\ :tc=hp+printer:tc=hp2621b-kx: # Some assumptions are made in the following entries. # These settings are NOT set up by the initialization strings. # # Port Configuration # RecvPace=Xon/Xoff XmitPace=Xon/Xoff StripNulDel=Yes # # Terminal Configuration # InhHndShk(G)=Yes InhDC2(H)=Yes # XmitFnctn(A)=No InhEolWrp=No # # # Hp 2622a & hp2623a display and graphics terminals # hp2622|hp2622a|hp 2622:\ :da:db:\ :lm#0:pb#19200:\ :is=\E&dj@\r:tc=hp+pfk+cr:tc=hp+labels:tc=scrhp: # The 2623 is a 2622 with extra graphics hardware. hp2623|hp2623a|hp 2623:\ :tc=hp2622: hp2624b-p|hp2624b-4p-p|hewlett packard 2624 B with printer:\ :tc=hp+printer:tc=hp2624: # The hewlett packard B can have an optional extra 6 pages of memory. hp2624-10p|hp2624a-10p|hp2624b-10p|hewlett packard 2624 B w/ 10 pages of memory:\ :lm#240:tc=hp2624: hp2624b-10p-p|hewlett packard 2624 B w/ extra memory & printer:\ :lm#240:tc=hp2624b-p: # Color manipulations for HP terminals hp+color|hp with colors:\ :cc:\ :Co#16:NC#17:pa#7:\ :..Ip=\E&v%?%p2%{1000}%=%t1%e.%p2%d%;a\n%?%p3%{1000}%=%t1%e.%p3%d%;b\n%?%p4%{1000}%=%t1%e.%p4%d%;c\n%?%p5%{1000}%=%t1%e.%p5%d%;x\n%?%p6%{1000}%=%t1%e.%p6%d%;y\n%?%p7%{1000}%=%t1%e.%p7%d%;z\n%p1%dI:\ :oc=\E&v0m1a1b1c0I\E&v1a1I\E&v1b2I\E&v1a1b3I\E&v1c4I\E&v1a1c5I\E&v1b1c6I\E&v1x1y7I:\ :op=\E&v0S:sp=\E&v%dS: # :is: sets the screen to be 80 columns wide hp2397a|hp2397|hewlett packard 2397A color terminal:\ :is=\E&w6f80X:\ :tc=memhp:tc=hp+labels:tc=hp+color: # HP 700/44 Setup parameters: # Terminal Mode HP-PCterm # Inhibit Auto Wrap NO # Status Line Host Writable # PC Character Set YES # Twenty-Five Line Mode YES # XON/XOFF @128 or 64 (sc) # Keycode Mode NO or YES (sc) # Backspace Key BS or BS/DEL # # :is: sets pcterm; autowrap; 25 lines; pc char set; prog DEL key; # \E\\? does not turn off keycode mode # sets alternate start/stop; keycode on hpansi|hp700|hewlett packard 700/44 in HP-PCterm mode:\ :am:eo:xn:xo:\ :co#80:li#25:\ :@7=\E[4~:RA=\E[?7l:S4=\E[>11h\EPO**x0/65;1/67\E\:\ :S5=\E[>11l\EP1**x0/11;1/13\E[m\E\:SA=\E[?7h:XF=g:XN=e:\ :ac=k\277l\332m\300j\331n\305w\302q\304u\264t\303v\301x\263:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[@:im=:\ :is=\E[44"p\E[?7h\E[>10h\E[>12h\EP1;1|3/7F\E\:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:k9=\E[26~:k;=\E[28~:\ :kB=\E[Z:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[1~:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:me=\E[m:nd=\E[C:se=\E[m:sf=^J:\ :so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:\ :vi=\E[?25l: # # (hp2392: copied :ei: here from hpex -- esr) hp2392|239x series:\ :co#80:\ :bt=\Ei:cm=\E&a%dy%dC:cv=\E&a%dY:ei=\ER:im=\EQ:k1=\Ep\r:\ :k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:k7=\Ev\r:\ :k8=\Ew\r:kF=\EU:kN=\Eu:kP=\Ev:kR=\EV:kh=\Eh:ue=\E&d@:\ :us=\E&dD:\ :tc=hpsub: hpsub|hp terminals -- capability subset:\ :am:da:db:mi:xo:xs:\ :li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:cr=^M:\ :dc=\EP:dl=\EM:do=\EB:if=/usr/share/tabset/stdcrt:\ :is=\E&s1A\E<\E&k0\:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:\ :kr=\EC:ks=\E&s1A:ku=\EA:le=^H:me=\E&d@:nd=\EC:se=\E&d@:\ :sf=^J:so=\E&dB:ta=^I:up=\EA: # hpex: # May be used for most 24 x 80 hp terminals, # but has no padding added, so may allow runover in some terminals at high # baud rates. Will not work for hp2640a or hp2640b terminals, hp98x6 and # hp98x5 terminal emulators or hp98x6 consoles. # Adds xy-cursor addressing, vertical cursor addressing, home, # last line, and underline capabilities. # # (hpex: removed memory-lock capabilities ":ml=\El:mu=\Em:", # moved :ei: here from hpsub -- esr) hpex|hp extended capabilites:\ :cm=\E&a%dy%dC:cr=^M:cv=\E&a%dY:do=^J:ei=\ER:im=\EQ:kb=^H:\ :kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:ue=\E&d@:us=\E&dD:\ :tc=hpsub: # From: Ville Sulko , 05 Aug 1996 hp2|hpex2|hewlett-packard extended capabilities newer version:\ :am:da:db:mi:xs:\ :Nl#8:co#80:lh#2:li#24:lm#0:lw#8:sg#0:\ :LF=\E&j@:LO=\E&jB:al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%dC:\ :cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:cr=^M:ct=\E3:cv=\E&a%dY:\ :dc=\EP:dl=\EM:do=\EB:ei=\ER:im=\EQ:k1=\Ep:k2=\Eq:k3=\Er:\ :k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:kA=\EL:kC=\EJ:kD=\EP:\ :kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:kM=\ER:kN=\EU:kP=\EV:\ :kR=\ET:kS=\EJ:kT=\E1:ka=\E3:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:\ :kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:ku=\EA:le=^H:me=\E&d@:\ :ml=\El:mu=\Em:nd=\EC:..pk=\E&f%p1%dk%p2%l%dL%p2%s:\ :..pl=\E&f1a%p1%dk%p2%l%dL%p2%s:\ :..pn=\E&f%p1%dk%p2%l%dd0L%p2%s:\ :..px=\E&f2a%p1%dk%p2%l%dL%p2%s:\ :..sa=\E&d%?%p7%t%'s'%c%;%p1%p3%|%p6%|%{2}%*%p2%{4}%*%+%p4%+%p5%{8}%*%+%'@'%+%c%?%p9%t%'\016'%c%e%'\017'%c%;:\ :se=\E&d@:sf=^J:so=\E&dB:st=\E1:ta=^I:ue=\E&d@:up=\EA:\ :us=\E&dD: # HP 236 console # From: hp236|hp236 internal terminal emulator:\ :am:bs:\ :co#80:li#24:\ :al=\EG:ce=\EK:cl=\EF:cm=\EE%+ %+ :dc=\EJ:dl=\EH:ei=:ic=\EI:\ :im=:le=^H:me=\ECI:se=\ECI:so=\EBI:up=^K:ve=\EDE:vs=\EDB: # This works on a hp300 console running Utah 4.3 BSD # From: Craig Leres hp300h|HP Catseye console:\ :am:bs:da:db:mi:xs:\ :co#128:li#51:lm#0:sg#0:\ :al=\EL:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:ch=\E&a%dC:\ :cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:cr=^M:ct=\E3:cv=\E&a%dY:\ :dc=\EP:dl=\EM:do=\EB:ei=\ER:if=/usr/share/tabset/stdcrt:\ :im=\EQ:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:\ :ks=\E&s1A:ku=\EA:le=^H:me=\E&d@:nd=\EC:se=\E&d@:sf=^J:\ :so=\E&dB:ta=^I:ue=\E&d@:up=\EA:us=\E&dD: # From: Greg Couch hp9837|hp98720|hp98721|HP 9000/300 workstations:\ :am:bs:da:db:mi:xs:\ :co#128:it#8:li#46:lm#0:\ :al=\EL:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:ch=\E&a%dC:\ :cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:ct=\E3:cv=\E&a%dY:dc=\EP:\ :dl=\EM:do=\EB:ei=\ER:im=\EQ:is=\E&v0m1b0i&j@:kA=\EL:\ :kD=\EP:kE=\EK:kI=\EQ:kL=\EM:kN=\EU:kP=\EV:kS=\EJ:kb=^H:\ :kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:ku=\EA:\ :le=^H:me=\E&d@:nd=\EC:se=\E&v0S:sf=^J:so=\E&v5S:st=\E1:\ :ta=^I:ue=\E&d@:up=\EA:us=\E&dD: # HP 9845 desktop computer from BRL # (hp9845: removed unknown capability :gu: -- esr) hp9845|HP 9845:\ :am:bs:da:db:eo:mi:xs:\ :co#80:li#21:\ :al=\EL:bc=\ED:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\E&a%r%2c%2Y:\ :dc=\EP:dl=\EM:ei=\ER:if=/usr/share/tabset/std:im=\EQ:\ :nd=\EC:se=\E&d@:so=\E&dB:up=\EA: # From: Charles A. Finnell of MITRE , developed 07SEP90 # (hp98550: replaced /usr/share/tabset/9837 with std because :it#8:,:st=\E1:; # added empty to avoid warnings re :as:/:ae: --esr) hp98550|hp98550a|HP 9000 Series 300 color console:\ :am:bs:da:db:mi:xs:\ :co#128:it#8:li#49:lm#0:\ :ac=:ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:\ :ch=\E&a%dC:cl=\EH\EJ:cm=\E&a%dy%dC:cr=^M:ct=\E3:\ :cv=\E&a%dY:dc=\EP:dl=\EM:do=^J:ei=\ER:\ :if=/usr/share/tabset/std:im=\EQ:k1=\Ep:k2=\Eq:k3=\Er:\ :k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:kA=\EL:kC=\EJ:kD=\EP:\ :kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:kM=\ER:kN=\EU:kP=\EV:\ :kR=\ET:kS=\EJ:kT=\E1:ka=\E3:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:\ :kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:ku=\EA:le=^H:mb=\E&dA:\ :md=\E&dJ:me=\E&d@:mh=\E&dH:mk=\E&ds:mr=\E&dJ:nd=\EC:\ :se=\E&d@:sf=^J:so=\E&dJ:st=\E1:ta=^I:ue=\E&d@:up=\EA:\ :us=\E&dD:ve=\E*dQ:vi=\E*dR: # From: Victor Duchovni # (hp700-wy: removed obsolete ":nl=^J:"; # replaced /usr/share/tabset/hp700-wy with std because :it#8:,:st=\E1: -- esr) hp700-wy|HP700/41 emulating wyse30:\ :am:bs:bw:mi:ms:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=0.7*\EE:bt=\EI:cd=\EY:ce=10\ET:cl=^Z:cm=\E=%+ %+ :\ :cr=^M:ct=\E0:cv=\E[%+ :dc=\EW:dl=\ER:do=^V:ei=\Er:ho=^^:\ :i1=\E~"\EC\Er\E(\EG0\003\E`9\E`1:\ :if=/usr/share/tabset/stdcrt:im=\Eq:kB=\EI:kC=^Z:kE=\ET:\ :kI=\Eq:kM=\Er:kS=\EY:kT=\EI:kb=\177:kd=^V:kh=^^:kl=^H:kr=^L:\ :ku=^K:le=^H:ll=^^^K:me=10\EG0:nd=^L:se=10\EG0:so=10\EG4:\ :sr=\Ej:st=\E1:ta=^I:ue=10\EG0:up=^K:us=10\EG8: # (hp70092: added empty to avoid warnings re :as:/:ae: --esr) hp70092|hp70092a|hp70092A|HP 700/92:\ :am:da:db:xs:\ :Nl#8:co#80:lh#2:li#24:lm#0:lw#8:\ :LF=\E&j@:LO=\E&jB:ac=:ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:\ :ce=\EK:ch=\E&a%dC:cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:cr=^M:\ :ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:do=\EB:ei=\ER:im=\EQ:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:\ :kA=\EL:kC=\EJ:kD=\EP:kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:\ :kM=\ER:kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kT=\E1:ka=\E3:kb=^H:\ :kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:\ :ku=\EA:le=^H:mb=\E&dA:md=\E&dB:me=\E&d@:mh=\E&dH:mr=\E&dB:\ :nd=\EC:se=\E&d@:so=\E&dJ:sr=\ET:st=\E1:ta=^I:ue=\E&d@:\ :up=\EA:us=\E&dD: bobcat|sbobcat|HP 9000 model 300 console:\ :am:da:db:mi:xs:\ :co#128:it#8:li#47:sg#0:\ :al=10*\EL:bt=\Ei:cd=\EJ:ce=\EK:ch=6\E&a%dC:cl=\EH\EJ:\ :cm=6\E&a%dy%dC:cr=^M:cv=6\E&a%dY:dc=\EP:dl=10*\EM:do=\EB:\ :ei=\ER:im=\EQ:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:\ :ks=\E&s1A:ku=\EA:le=^H:me=\E&d@:nd=\EC:nw=^M^J:se=\E&d@:\ :sf=^J:so=\E&dB:ta=^I:ue=\E&d@:up=\EA:us=\E&dD: gator-t|HP 9000 model 237 emulating extra-tall AAA:\ :li#94:tc=gator: gator|HP 9000 model 237 emulating AAA:\ :bw:km:mi:ul:\ :co#128:it#8:li#47:\ :AL=1*\E[%dL:DC=4\E[%dP:DL=1*\E[%dM:IC=4\E[%d@:al=\E[L:\ :bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%i%d`:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ho=\E[H:\ :ic=\E[@:im=:kb=^H:kd=^J:kl=^H:le=^H:me=\E[m:mr=\E[7m:\ :nd=\E[C:nw=^M^J:rp=1*%.\E[%db:se=\E[m:so=\E[7m:ta=^I:\ :ue=\E[m:up=\EM:us=\E[4m: gator-52|HP 9000 model 237 emulating VT52:\ :co#128:li#47:tc=vt52: gator-52t|HP 9000 model 237 emulating extra-tall VT52:\ :li#94:tc=gator-52: #### Honeywell-Bull # # From: Michael Haardt 11 Jan 93 # # Honeywell Bull terminal. Its cursor and function keys send single # control characters and it has standout/underline glitch. Most programs # do not like these features/bugs. Visual bell is realized by flashing the # "keyboard locked" LED. dku7003-dumb|Honeywell Bull DKU 7003 dumb mode:\ :co#80:li#25:\ :cd=^_:ce=\E[K:cl=^]^_:cm=\E[%i%d;%dH:cr=^M:do=^K:ho=^]:\ :kb=^H:kd=^K:kh=^]:kl=^Y:kr=^X:ku=^Z:le=^Y:nd=^X:nw=^M^J:\ :sf=^J:ta=^I:up=^Z:vb=\E[2h\E[2l: dku7003|Honeywell Bull DKU 7003 all features described:\ :ms:\ :sg#1:ug#1:\ :mb=\E[5m:md=\E[7m:me=\E[m:mh=\E[2m:mr=\E[7m:se=\E[m:\ :so=\E[7m:ue=\E[m:us=\E[4m:\ :tc=dku7003-dumb: #### Lear-Siegler (adm) # # These guys are long since out of the terminals business, but # in 1995 many current terminals still have an adm type as one of their # emulations (usually their stupidest, and usually labeled adm3, though # these `adm3' emulations normally have adm3a+ capabilities). # # WARNING: Some early ADM terminals (including the ADM3 and ADM5) had a # `diagnostic feature' that sending them a ^G while pin 22 (`Ring Indicator') # was being held to ground would trigger a send of the top line on the screen. # A quick fix might be to drop back to a cheesy 4-wire cable with pin 22 # hanging in the air. # adm1a|adm1|lsi adm1a:\ :am:\ :co#80:li#24:\ :bl=^G:cl=\E;:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:le=^H:nd=^L:\ :sf=^J:up=^K: adm2|lsi adm2:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E;:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=^L:sf=^J:up=^K: # (adm3: removed obsolete ":ma=^K^P:" -- esr) adm3|lsi adm3:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=^Z:cr=^M:do=^J:le=^H:sf=^J: # The following ADM-3A switch settings are assumed for normal operation: # SPACE U/L_DISP CLR_SCRN 24_LINE # CUR_CTL LC_EN AUTO_NL FDX # Other switches may be set for operator convenience or communication # requirements. I recommend # DISABLE_KB_LOCK LOCAL_OFF 103 202_OFF # ETX_OFF EOT_OFF # Most of these terminals required an option ROM to support lower case display. # Open the case and look at the motherboard; if you see an open 24-pin DIP # socket, you may be out of luck. # # (adm3a: some capabilities merged in from BRl entry -- esr) adm3a|lsi adm3a:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=1\032:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:kd=^J:kl=^H:\ :kr=^L:ku=^K:le=^H:ma=^K^P:nd=^L:nl=^J:r1=^N:rs=^N:sf=^J:\ :up=^K: adm3a+|adm3a plus:\ :kb=^H:tc=adm3a: # (adm5: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" & duplicate ":do=^J:" -- esr) adm5|lsi adm5:\ :sg#1:\ :bl=^G:cd=\EY:ce=\ET:cr=^M:do=^J:kb=^H:kh=^^:se=\EG:so=\EG:tc=adm3a+: # A lot of terminals other than adm11s use these. Wherever you see # use=adm+sgr with some of its capabilities disabled, try the # disabled ones. They may well work but not have been documented or # expressed in the using entry. We'd like to cook up an :sa: but the # :ae:/:as: sequences of the using entries vary too much. adm+sgr|adm style highlight capabilities:\ :me=\EG0:mk=\EG1:mr=\EG4:se=\EG0:so=\EG4:ue=\EG0:us=\EG8: # LSI ADM-11 from George William Hartwig, Jr. via BRL # Status line additions from Stephen J. Muir # :kh: from . :cl: could also # be ^Z, according to his entry. # (adm11: :us:=\EG4 was obviously erroneous because it also said # :mr:=\EG4. Looking at other ADMs confirms this -- esr) adm11|LSI ADM-11:\ :am:bs:hs:\ :co#80:kn#8:li#24:\ :bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:do=^J:ds=\Eh:\ :fs=\E(\r:ho=^^:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:mb=\EG2:nd=^L:nl=^J:nw=^M^J:ta=^I:\ :ts=\EF\E):up=^K:\ :tc=adm+sgr: # From: Andrew Scott Beals # Corrected by Olaf Siebert , 11 May 1995 # (adm12: removed obsolete ":kn:ma=j^Jk^P^K^Pl ^R^L^L :". This formerly had # :is:=\Eq but that looked wrong; this :is: is from Dave Yost # via BRL. That entry asserted :sg#1:, but I've left that out because # neither earlier nor later ADMSs have it -- esr) adm12|lsi adm12:\ :am:bs:mi:pt:\ :co#80:it#8:li#24:ug#1:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E0:\ :dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:ic=\EQ:im=\Eq:\ :is=\E0 \E1 \E1 \E1 \E1 \E1 \E1 \E1 \E1:\ :k0=^A0\r:k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:k5=^A5\r:\ :k6=^A6\r:k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^J:kl=^H:kr=^L:\ :ku=^K:le=^H:nd=^L:st=\E1:up=^K:\ :tc=adm+sgr: # (adm20: removed obsolete ":kn#7:" -- esr) adm20|lear siegler adm20:\ :am:bs:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:\ :cm=\E=%i%r%+^_%+^_:cr=^M:dc=\EW:dl=\ER:ei=:ho=^^:ic=\EQ:\ :im=:k1=^A:k2=^B:k3=^W:k4=^D:k5=^E:k6=^X:k7=^Z:le=^H:me=\E(:\ :nd=^L:se=\E(:so=\E):ta=^I:up=^K: adm21|lear siegler adm21:\ :sg#1:\ :al=30*\EE:bl=^G:cd=\EY:ce=\ET:cr=^M:dc=\EW:dl=30*\ER:do=^J:\ :ei=:ic=\EQ:im=:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:mk@:sf=^J:\ :tc=adm+sgr:tc=adm3a: # (adm22: ":em=:" was an obvious typo for ":ei=:"; also, # removed obsolete ":kn#7:ma=j^Jk^P^K^Pl ^R^L^L :"; # removed bogus-looking \200 from before :cm:. -- esr) adm22|lsi adm22:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:\ :is=\E%\014\014\014\016\003\200\003\002\003\002\200\200\200\200\200\200\200\200\200\200\200:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:l1=F1:l2=F2:\ :l3=F3:l4=F4:l5=F5:l6=F6:l7=F7:le=^H:me=\E(:nd=^L:se=\E(:\ :so=\E):ta=\Ei:up=^K: # ADM 31 DIP Switches # # This information comes from two versions of the manual for the # Lear-Siegler ADM 31. # # Main board: # rear of case # +-||||-------------------------------------+ # + S1S2 ||S + # + ||3 + # + + # + ||S + # + ||4 + # + + # + + # + + # + + # + + # +-+ +-+ # + + # + S5 S6 S7 + # + == == == + # +----------------------------------------------+ # front of case (keyboard) # # S1 - Data Rate - Modem # S2 - Data Rate - Printer # ------------------------ # Data Rate Setting # ------------------- # 50 0 0 0 0 # 75 1 0 0 0 # 110 0 1 0 0 # 134.5 1 1 0 0 # 150 0 0 1 0 # 300 1 0 1 0 # 600 0 1 1 0 # 1200 1 1 1 0 # 1800 0 0 0 1 # 2000 1 0 0 1 # 2400 0 1 0 1 # 3600 1 1 0 1 # 4800 0 0 1 1 # 7200 1 0 1 1 # 9600 0 1 1 1 # x 1 1 1 1 # # S3 - Interface/Printer/Attributes # --------------------------------- # Printer Busy Control # sw1 sw2 sw3 # --------------- # off off off Busy not active, CD disabled # off off on Busy not active, CD enabled # off on off Busy active on J5-20, CD disabled # on off off Busy active on J5-19, CD disabled - Factory Set. # on off on Busy active on J5-19, CD enabled # # sw4 Used in conjuction with S4 for comm interface control - Fact 0 # # sw5 Secondary Channel Control (Hardware implementation only) - Fact 0 # # sw6 ON enables printer BUSY active LOW - Factory Setting # OFF enables printer BUSY active HIGH - If set to this, ADM31 senses # # sw7 ON - steady cursor - Factory Setting # OFF - blinking cursor # # sw8 ON causes selected attribute character to be displayed # OFF causes SPACE to be displayed instead - Factory Setting # # S4 - Interface # -------------- # Modem Interface # S3 S4 S4 S4 S4 # sw4 sw1 sw2 sw3 sw4 # --------------------------- # OFF ON OFF ON OFF Enable RS-232C interface, Direct Connect and # Current Loop disabled - Factory Setting # ON ON OFF ON OFF Enable Current Loop interface, Direct Connect # disabled # OFF OFF ON OFF ON Enable Direct Connect interface, RS-232C and # Current Loop Disabled # # sw5 ON disables dot stretching mode - Factory Setting # OFF enables dot stretching mode # sw6 ON enables blanking function # OFF enables underline function - Factory Setting # sw7 ON causes NULLS to be displayed as NULLS # OFF causes NULLS to be displayed as SPACES - Factory Setting # # S5 - Word Structure # ------------------- # sw1 ON enables BREAK key - Factory Setting # OFF disables BREAK key # sw2 ON selects 50Hz monitor refresh rate # OFF selects 60Hz monitor refresh rate - Factory Setting # # Modem Port Selection # sw3 sw4 sw5 # --------------- # ON ON ON Selects 7 DATA bits, even parity, 2 STOP bits # OFF ON ON Selects 7 DATA bits, odd parity, 2 STOP bits # ON OFF ON Selects 7 DATA bits, even parity, 1 STOP bit - Factory Set. # OFF OFF ON Selects 7 DATA bits, odd parity, 1 STOP bit # ON ON OFF Selects 8 DATA bits, no parity, 2 STOP bits # OFF ON OFF Selects 8 DATA bits, no parity, 1 STOP bit # ON OFF OFF Selects 8 DATA bits, even parity, 1 STOP bit # OFF OFF OFF Selects 8 DATA bits, odd parity, 1 STOP bit # # sw6 ON sends bit 8 a 1 (mark) # OFF sends bit 8 as 0 (space) - Factory Setting # sw7 ON selects Block Mode # OFF selects Conversation Mode - Factory Setting # sw8 ON selects Full Duplex operation # OFF selects Half Duplex operation - Factory Setting # # S6 - Printer # ------------ # sw1, sw2, sw6, sw7 Reserved - Factory 0 # # Printer Port Selection # same as Modem above, bit 8 (when 8 DATA bits) is always = 0 # # sw8 ON enables Printer Port # OFF disables Printer Port - Factory Setting # # S7 - Polling Address # -------------------- # sw1-7 Establish ASCII character which designates terminal polling address # ON = logic 0 # OFF = logic 1 - Factory Setting # sw8 ON enables Polling Option # OFF disables Polling Option - Factory Setting # # # On some older adm31s, S4 does not exist, and S5-sw6 is not defined. # # This adm31 entry uses underline as the standout mode. # If the adm31 gives you trouble with standout mode, check the DIP switch in # position 6, bank @c11, 25% from back end of the circuit board. Should be # OFF. If there is no such switch, you have an old adm31 and must use oadm31. # (adm31: removed obsolete ":ma=j^Jk^P^K^Pl ^R^L^L :" -- esr) adm31|lsi adm31 with sw6 set for underline mode:\ :am:bs:mi:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:is=\Eu\E0:k0=^A0\r:\ :k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:k5=^A5\r:k6=^A6\r:\ :k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:\ :me=\EG0:nd=^L:se=\EG0:sf=^J:so=\EG1:ue=\EG0:up=^K:us=\EG1: adm31-old|o31|old adm31:\ :so=\EG4:ue@:us@:tc=adm31: # LSI ADM-36 from Col. George L. Sicherman via BRL adm36|LSI ADM36:\ :bs:pt:\ :kn#4:\ :if=/usr/share/tabset/vt100:\ :is=\E<\E>\E[6;?2;?7;?8h\E[4;20;?1;?3;?4;?5;?6;?18;?19l:tc=vt100: # (adm42: removed obsolete ":ma=^K^P:" -- esr) adm42|lsi adm42:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E;:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=\Er:im=\Eq:ip=:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:mk@:nd=^L:pc=\177:sf=^J:ta=^I:ue@:\ :up=^K:us@:vs=\EC\E3 \E3(:\ :tc=adm+sgr: # The following termcap for the Lear Siegler ADM-42 leaves the # "system line" at the bottom of the screen blank (for those who # find it distracting otherwise) adm42-ns|lsi adm-42 with no system line:\ :al=\EE\EF \011:bt=\EI\EF \011:cd=\EY\EF \011:\ :ce=\ET\EF \011:cl=\E;\EF \011:cm=\E=%+ %+ \EF \011:\ :dc=\EW\EF \011:dl=\ER\EF \011:ei=\Er\EF \011:\ :im=\Eq\EF \011:tc=adm42: # ADM 1178 terminal -- rather like an ADM-42. Manual is dated March 1 1985. # The insert mode of this terminal is commented out because it's broken for our # purposes in that it will shift the position of every character on the page, # not just the cursor line! # From: Michael Driscoll 10 July 1996 adm1178|1178|lsi adm1178:\ :am:\ :co#80:li#24:sg#1:ug#1:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ho=^^:ip=6*:kb=^H:kd=^J:kl=^H:\ :le=^H:md=\E(:me=\E):mr=\EG4:nd=^L:nw=^M^J:pc=\177:se=\EG0:\ :sf=^J:so=\EG4:ta=^I:ue=\EG0:up=^K:us=\EG1:vs=\EC\E3 \E3(: #### Prime # # Yes, Prime makes terminals. These entries were posted by Kevin J. Cummings # on 14 Dec 1992 and lightly edited by esr. # # Standout mode is dim reverse-video. pt100|pt200|wren|fenix|prime pt100/pt200:\ :am:bw:mi:ms:\ :co#80:it#8:li#24:\ :DC=\E[%dP:DL=\E[M:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:al=\E[L\E[t:bt=\E[Z:cd=\E[J\E[r:ce=\E[K\E[t:\ :cl=\E?:cm=\E0%+\%+\:cr=^M:dc=\E[P:do=\ED:ei=\E[4l:ho=\E$B:\ :im=\E[4h:kb=^H:kd=\E[B:ke=\E[>13l:kh=\E$A:kl=\E[D:kr=\E[C:\ :ks=\E[>13h:ku=\E[A:le=^H:me=\E[m:mh=\E[2m:nd=\E[C:nw=^M^J:\ :se=\E[m:sf=^J:so=\E[2;7m:ta=^I:te=:\ :ti=\E[>1l\E[>2l\E[>16l\E[4l\E[>9l\E[20l\E[>3l\E[>7h\E[>12l\E[1Q:\ :ue=\E[m:up=\EM:us=\E[4m:vb=\E$\E$P: pt100w|pt200w|wrenw|fenixw|prime pt100/pt200 in 132-column mode:\ :co#132:\ :cm=\E[%i%d;%dH:tc=pt100: pt250|Prime PT250:\ :se@:so@:tc=pt100: pt250w|Prime PT250 in 132-column mode:\ :se@:so@:tc=pt100w: #### Qume (qvt) # # Qume, Inc. # 3475-A North 1st Street # San Jose CA 95134 # Vox: (800)-457-4447 # Fax: (408)-473-1510 # Net: josed@techsupp.wyse.com (Jose D'Oliveira) # # Qume was bought by Wyse, but still (as of early 1995) has its own support # group and production division. # # Discontinued Qume models: # # The qvt101 and qvt102 listed here are long obsolete; so is the qvt101+ # built to replace them, and a qvt119+ which was a 101+ with available wide # mode (132 columns). There was a qvt103 which added vt100/vt131 emulations # and an ANSI-compatible qvt203 that replaced it. Qume started producing # ANSI-compatible terminals with the qvt323 and qvt61. # # Current Qume models (as of February 1995): # # All current Qume terminals have ANSI-compatible operation modes. # Qume is still producing the qvt62, which features emulations for other # popular lines such as ADDS, and dual-host capabilities. The qvt82 is # designed for use as a SCO ANSI terminal. The qvt70 is a color terminal # with many emulations including Wyse370, Wyse 325, etc. Their newest # model is the qvt520, which is vt420-compatible. # # There are some ancient printing Qume terminals under `Daisy Wheel Printers' qvt101|qvt108|qume qvt 101 and QVT 108:\ :sg#1:tc=qvt101+: # This used to have :vs=\E.2: but no :ve: or :vi:. The BSD termcap # file had :vs=\EM4 \200\200\200:. I've done the safe thing and yanked # both. The :mr: is from BSD, which also claimed bold=\E( and dim=\E). # What seems to be going on here is that this entry was designed so that # the normal highlight is bold and standout is dim plus something else # (reverse-video maybe? But then, are there two :mr: sequences?) qvt101+|qvt101p|qume qvt 101 PLUS product:\ :am:bw:hs:ul:\ :co#80:li#24:sg#0:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:\ :ct=\E3:dc=\EW:dl=\ER:do=^J:ds=\Eg\Ef\r:ei=:fs=^M:ho=^^:\ :ic=\EQ:im=:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:kA=\EE:\ :kB=\EI:kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:mk@:nd=^L:pf=\EA:po=\E@:se=\E(:sf=^J:\ :so=\E0P\E):st=\E1:ta=^I:ts=\Eg\Ef:up=^K:vb=\Eb\Ed:ve=\E.4:\ :tc=adm+sgr: qvt102|qume qvt 102:\ :ve=\E.:tc=qvt101: # (qvt103: added / based on init string -- esr) qvt103|qume qvt 103:\ :am:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :DO=\E[%dB:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: qvt103-w|qume qvt103 132 cols:\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=qvt103: qvt119+|qvt119p|qvt119|qume qvt 119 and 119PLUS terminals:\ :am:hs:mi:ms:\ :co#80:li#24:sg#0:\ :al=\EE:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E*1:cm=\E=%+ %+ :\ :cr=^M:ct=\E3:dc=\EW:dl=\ER:do=^J:ds=\Eg\Ef\r:ei=\Er:fs=^M:\ :ho=^^:im=\Eq:is=\EDF\EC\EG0\Er\E(\E%EX:k0=^AI\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:\ :ku=^K:le=^H:nd=^L:pf=\EA:po=\E@:sf=^J:sr=\EJ:st=\E1:ta=^I:\ :ts=\Eg\Ef:up=^K:us=\EG8:vb=\En0\En1:ve=\E.4:vs=\E.2:\ :tc=adm+sgr: qvt119+-25|qvt119p-25|QVT 119 PLUS with 25 data lines:\ :li#25:tc=qvt119+: qvt119+-w|qvt119p-w|qvt119-w|QVT 119 and 119 PLUS in 132 column mode:\ :co#132:\ :is=\EDF\EC\EG0\Er\E(\E%\EX\En4:tc=qvt119+: qvt119+-25-w|qvt119p-25-w|qvt119-25-w|QVT 119 and 119 PLUS 132 by 25:\ :li#25:tc=qvt119+: qvt203|qvt203+|qume qvt 203 Plus:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:ip=:k0=\E[29~:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:k9=\E[28~:sf=\n:\ :tc=qvt103: qvt203-w|qvt203-w-am|qume qvt 203 PLUS in 132 cols (w/advanced video):\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=qvt203: # # Since a command is present for enabling 25 data lines, # a specific terminfo entry may be generated for the 203. # If one is desired for the QVT 119 PLUS then 25 lines must # be selected in the status line (setup line 9). # qvt203-25|QVT 203 PLUS with 25 by 80 column mode:\ :co#80:li#25:\ :is=\E[=40h\E[?3l:tc=qvt203: qvt203-25-w|QVT 203 PLUS with 25 by 132 columns:\ :co#132:li#25:\ :r2=\E[?3h\E[=40h:tc=qvt203: #### Televideo (tvi) # # TeleVideo # 550 East Brokaw Road # PO Box 49048 95161 # San Jose CA 95112 # Vox: (408)-954-8333 # Fax: (408)-954-0623 # # # There are some tvi terminals that require incredible amounts of padding and # some that don't. I'm assuming tvi912 and tvi920 are the old slow ones, and # tvi912b, tvi912c, tvi920b, tvi920c are the new ones that don't need padding. # # All of these terminals (912 to 970 and the tvipt) are discontinued. Newer # Televideo terminals are ANSI and PC-ANSI compatible. tvi803|televideo 803:\ :cl=\E*:tc=tvi950: # Vanilla tvi910 -- W. Gish 10/29/86 # Switch settings are: # # S1 1 2 3 4 # D D D D 9600 # D D D U 50 # D D U D 75 # D D U U 110 # D U D D 135 # D U D U 150 # D U U D 300 # D U U U 600 # U D D D 1200 # U D D U 1800 # U D U D 2400 # U D U U 3600 # U U D D 4800 # U U D U 7200 # U U U D 9600 # U U U U 19200 # # S1 5 6 7 8 # U D X D 7N1 (data bits, parity, stop bits) (X means ignored) # U D X U 7N2 # U U D D 7O1 # U U D U 7O2 # U U U D 7E1 # U U U U 7E2 # D D X D 8N1 # D D X U 8N2 # D U D D 8O1 # D U U U 8E2 # # S1 9 Autowrap # U on # D off # # S1 10 CR/LF # U do CR/LF when CR received # D do CR when CR received # # S2 1 Mode # U block # D conversational # # S2 2 Duplex # U half # D full # # S2 3 Hertz # U 50 # D 60 # # S2 4 Edit mode # U local # D duplex # # S2 5 Cursor type # U underline # D block # # S2 6 Cursor down key # U send ^J # D send ^V # # S2 7 Screen colour # U green on black # D black on green # # S2 8 DSR status (pin 6) # U disconnected # D connected # # S2 9 DCD status (pin 8) # U disconnected # D duplex # # S2 10 DTR status (pin 20) # U disconnected # D duplex # (tvi910: removed obsolete ":ma=^Kk^Ll^R^L:"; added :kh:, :le:, :do:, # :sf:, , , :am:, :ms: from SCO entry -- esr) tvi910|televideo model 910:\ :am:bs:ms:\ :co#80:it#8:li#24:sg#1:\ :bl=^G:bt=\EI:cd=\EY:ce=\ET:ch=\E]%+ :cl=^Z:cm=\E=%+ %+ :\ :cr=^M:cv=\E[%+ :do=^J:ho=\E=\001\001:\ :if=/usr/share/tabset/stdcrt:k0=^AI\r:k1=^A@\r:k2=^AA\r:\ :k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:\ :k9=^AH\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:mk@:nd=^L:\ :sf=^J:ta=^I:up=^K:\ :tc=adm+sgr: # From: Alan R. Rogers # as subsequently hacked over by someone at SCO # (tvi910+: removed obsolete ":ma=^K^P^L :" -- esr) # # Here are the 910+'s DIP switches (U = up, D = down, X = don't care): # # S1 1 2 3 4: # D D D D 9600 D D D U 50 D D U D 75 D D U U 110 # D U D D 135 D U D U 150 D U U D 300 D U U U 600 # U D D D 1200 U D D U 1800 U D U D 2400 U D U U 3600 # U U D D 4800 U U D U 7200 U U U D 9600 U U U U 19200 # # S1 5 6 7 8: # U D X D 7N1 U D X U 7N2 U U D D 7O1 U U D U 7O2 # U U U D 7E1 U U U U 7E2 D D X D 8N1 D D X U 8N2 # D U D D 8O1 D U U U 8E2 # # S1 9 Autowrap (U = on, D = off) # S1 10 CR/LF (U = CR/LF on CR received, D = CR on CR received) # S2 1 Mode (U = block, D = conversational) # S2 2 Duplex (U = half, D = full) # S2 3 Hertz (U = 50, D = 60) # S2 4 Edit mode (U = local, D = duplex) # S2 5 Cursor type (U = underline, D = block) # S2 6 Cursor down key (U = send ^J, D = send ^V) # S2 7 Screen colour (U = green on black, D = black on green) # S2 8 DSR status (pin 6) (U = disconnected, D = connected) # S2 9 DCD status (pin 8) (U = disconnected, D = connected) # S2 10 DTR status (pin 20) (U = disconnected, D = connected) # tvi910+|televideo 910+:\ :al=\EE:dc=\EW:dl=\ER:ei=:ho=^^:ic=\EQ:im=:k0=^A@\r:k1=^AA\r:\ :k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:\ :k8=^AH\r:k9=^AI\r:ll=\E=7 :\ :tc=tvi910: # (tvi912: removed obsolete ":ma=^K^P^L :", added :vb: and # :kh: from BRL entry -- esr) tvi912|tvi914|tvi920|old televideo 912/914/920:\ :am:bs:ms:pt:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EE:bl=^G:cd=\Ey:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E3:\ :dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:k0=^AI\r:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:k9=^AH\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:\ :nd=^L:se=\Ek:sf=^J:so=\Ej:st=\E1:ta=^I:ue=\Em:up=^K:us=\El:\ :vb=\Eb\Ed: # the 912 has a key that's like shift: 8 xmits "^A8\r". # The 920 has this plus real function keys that xmit different things. # Terminfo makes you use the funct key on the 912 but the real keys on the 920. tvi912c|tvi912b|new televideo 912:\ :al=\EE:dl=\ER:tc=tvi912: # set to page 1 when entering curses application (\E-17 ) # reset to page 0 when exiting curses application (\E-07 ) tvi912-2p|tvi920-2p|tvi-2p|televideo w/2 pages:\ :te=\E-07 :ti=\E-17 :tc=tvi912: # We got some new tvi912c terminals that act really weird on the regular # termcap, so one of our gurus worked this up. Seems that cursor # addressing is broken. tvi912cc|tvi912 at cowell college:\ :cm@:tc=tvi912c: # Here are the switch settings for the tvi920c: # # S1 (Line), and S3 (Printer) baud rates -- put one, and only one, switch down: # 2: 9600 3: 4800 4: 2400 5: 1200 # 6: 600 7: 300 8: 150 9: 75 # 10: 110 # # S2 UART/Terminal options: # Up Down # 1: Not used Not allowed # 2: Alternate character set Standard character set # 3: Full duplex Half duplex # 4: 50 Hz refresh 60 Hz refresh # 5: No parity Send parity # 6: 2 stop bits 1 stop bit # 7: 8 data bits 7 data bits # 8: Not used Not allowed on Rev E or lower # 9: Even parity Odd parity # 10: Steady cursor Blinking cursor # (On Rev E or lower, use W25 instead of switch 10.) # # S5 UART/Terminal options: # Open Closed # 1: P3-6 Not connected DSR received on P3-6 # 2: P3-8 Not connected DCD received on P3-8 # # 3 Open, 4 Open: P3-20 Not connected # 3 Open, 4 Closed: DTR on when terminal is on # 3 Closed, 4 Open: DTR is connected to RTS # 3 Closed, 4 Closed: Not allowed # # 5 Closed: HDX printer (hardware control) Rev. K with extension port off, # all data transmitted out of the modem port (P3) will also be # transmitted out of the printer port (P4). # # 6 Open, 7 Open: Not allowed # 6 Open, 7 Closed: 20ma current loop input # 6 Closed, 7 Open: RS232 input # 6 Closed, 7 Closed: Not allowed # # Jumper options: # If the jumper is installed, the effect will occur (the next time the terminal # is switched on). # # S4/W31: Enables automatic LF upon receipt of CR from # remote or keyboard. # S4/W32: Enables transmission of EOT at the end of Send. If not # installed, a carriage return is sent. # S4/W33: Disables automatic carriage return in column 80. # S4/W34: Selects Page Print Mode as initial condition. If not # installed, Extension Mode is selected. # tvi920b|tvi920c|new televideo 920:\ :al=\EE:dl=\ER:k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:\ :tc=tvi912: # Televideo 921 and variants # From: Tim Theisen 22 Sept 1995 # (tvi921: removed :ko=bt: before translation, I see no backtab cap; # also added empty to suppress tic warning -- esr) tvi921|televideo model 921 with sysline same as page & real vi function:\ :am:bs:hs:pt:xn:xs:\ :co#80:li#24:sg#0:\ :ac=:ae=\E%:al=\EE:as=\E$:cd=\EY:ce=\ET:cl=^Z:cm=3\E=%+ %+ :\ :cr=^M:dc=\EW:dl=1*\ER:do=^V:ds=\Ef\r\Eg:ei=:fs=\Eg:ho=^^:\ :ic=\EQ:if=/usr/share/tabset/stdcrt:im=:\ :is=\El\E"\EF1\E.3\017\EA\E<:kA=\EE:kC=^Z:kD=\EW:kE=\ET:\ :kI=\EQ:kL=1*\ER:kS=\EY:kb=^H:kd=^V:kl=^H:kr=^L:ku=^K:le=^H:\ :mk@:nd=^L:nw=^M^J:sf=^J:ta=^I:ts=\Ef\EG0:up=^K:ve=\E.3:\ :vs=\E.2:\ :tc=adm+sgr: # without the beeper # (tvi92B: removed :ko=bt: before translation, I see no backtab cap; # also added empty to suppress tic warning -- esr) tvi92B|televideo model 921 with sysline same as page & real vi function:\ :am:hs:xn:xs:\ :co#80:li#24:sg#0:\ :ac=:ae=\E%:al=\EE:as=\E$:cd=\EY:ce=\ET:cl=^Z:cm=3\E=%+ %+ :\ :cr=^M:dc=\EW:dl=1*\ER:do=^V:ds=\Ef\r\Eg:ei=:fs=\Eg:ho=^^:\ :ic=\EQ:if=/usr/share/tabset/stdcrt:im=:\ :is=\El\E"\EF1\E.3\017\EA\E<:kA=\EE:kC=^Z:kD=\EW:kE=\ET:\ :kI=\EQ:kL=1*\ER:kS=\EY:kb=^H:kd=^V:kl=^H:kr=^L:ku=^K:le=^H:\ :mk@:nd=^L:nw=^M^J:sf=^J:ta=^I:ts=\Ef\EG0:up=^K:vb=\Eb\Ed:\ :ve=\E.3:vs=\E.2:\ :tc=adm+sgr: # (tvi92D: removed :ko=bt: before translation, I see no backtab cap -- esr) tvi92D|tvi92B with DTR instead of XON/XOFF & better padding:\ :al=2*\EE:dl=2*\ER:is=\El\E"\EF1\E.3\016\EA\E<:kA=2*\EE:\ :kL=2*\ER:\ :tc=tvi92B: # (tvi924: This used to have :ds=\Es0:, :fs=\031:. I put the new strings # in from a BSD termcap file because it looks like they do something the # old ones skip -- esr) tvi924|televideo tvi924:\ :am:bw:hs:in:mi:ms:xn:xo:\ :co#80:it#8:li#24:sg#0:ws#80:\ :F1=^AK\r:F2=^AL\r:F3=^AM\r:F4=^AN\r:F5=^AO\r:al=\EE:bl=^G:\ :bt=\EI:cd=\Ey:ce=\Et:cl=\E*0:cm=\E=%+ %+ :cr=^M:\ :cs=\E_%+ %+ :ct=\E3:dc=\EW:dl=\ER:do=^V:ds=\Es0\Ef\031:\ :ei=:fs=\031\Es1:ho=^^:\ :i1=\017\E%\E'\E(\EDF\EC\EG0\EN0\Es0\Ev0:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:k0=^A@\r:k1=^AA\r:\ :k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:\ :k8=^AH\r:k9=^AI\r:k;=^AJ\r:kA=\EE:kC=\E*0:kD=\EW:kE=\Et:\ :kI=\EQ:kL=\ER:kS=\Ey:kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:\ :l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:l8=F9:l9=F10:\ :la=F11:le=^H:mb=\EG2:mk@:nd=^L:pk=\E|%+1%s\031:sf=^J:\ :sr=\Ej:st=\E1:ta=^I:ts=\Ef:up=^K:vb=\Eb\Ed:ve=\E.3:vi=\E.0:\ :vs=\E.1:\ :tc=adm+sgr: # TVI925 DIP switches. In each of these, D = Down and U = Up, # # Here are the settings for the external (baud) switches (S1): # # Position Baud # 7 8 9 10 [Printer] # 1 2 3 4 [Main RS232] # ----------------------------------------------------- # D D D D 9600 # D D D U 50 # D D U D 75 # D D U U 110 # D U D D 135 # D U D U 150 # D U U D 300 # D U U U 600 # U D D D 1200 # U D D U 1800 # U D U D 2400 # U D U U 3600 # U U D D 4800 # U U D U 7200 # U U U D 9600 # U U U U 19200 # # # Settings for word length and stop-bits (S1) # # Position Description # 5 6 # --------------------------- # U - 7-bit word # D - 8-bit word # - U 2 stop bits # - D 1 stop bit # # # S2 (external) settings # # Position Up Dn Description # -------------------------------------------- # 1 X Local edit # X Duplex edit (transmit editing keys) # -------------------------------------------- # 2 X 912/920 emulation # X 925 # -------------------------------------------- # 3 X # 4 X No parity # 5 X # -------------------------------------------- # 3 X # 4 X Odd parity # 5 X # -------------------------------------------- # 3 X # 4 X Even parity # 5 X # -------------------------------------------- # 3 X # 4 X Mark parity # 5 X # -------------------------------------------- # 3 X # 4 X Space parity # 5 X # -------------------------------------------- # 6 X White on black display # X Black on white display # -------------------------------------------- # 7 X Half Duplex # 8 X # -------------------------------------------- # 7 X Full Duplex # 8 X # -------------------------------------------- # 7 X Block mode # 8 X # -------------------------------------------- # 9 X 50 Hz # X 60 Hz # -------------------------------------------- # 10 X CR/LF (Auto LF) # X CR only # # S3 (internal switch) settings: # # Position Up Dn Description # -------------------------------------------- # 1 X Keyclick off # X Keyclick on # -------------------------------------------- # 2 X English # 3 X # -------------------------------------------- # 2 X German # 3 X # -------------------------------------------- # 2 X French # 3 X # -------------------------------------------- # 2 X Spanish # 3 X # -------------------------------------------- # 4 X Blinking block cursor # 5 X # -------------------------------------------- # 4 X Blinking underline cursor # 5 X # -------------------------------------------- # 4 X Steady block cursor # 5 X # -------------------------------------------- # 4 X Steady underline cursor # 5 X # -------------------------------------------- # 6 X Screen blanking timer (ON) # X Screen blanking timer (OFF) # -------------------------------------------- # 7 X Page attributes # X Line attributes # -------------------------------------------- # 8 X DCD disconnected # X DCD connected # -------------------------------------------- # 9 X DSR disconnected # X DSR connected # -------------------------------------------- # 10 X DTR Disconnected # X DTR connected # -------------------------------------------- # # (tvi925: BSD has :cl=\E*:. I got :is: and :sr: from there -- esr) tvi925|televideo 925:\ :am:bs:bw:hs:ul:\ :co#80:li#24:sg#1:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:\ :ct=\E3:dc=\EW:dl=\ER:do=^V:ds=\Eh:ei=:fs=^M\Eg:ho=^^:ic=\EQ:\ :im=:is=\El\E":k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:\ :kA=\EE:kC=^Z:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^V:\ :kh=^^:kl=^H:kr=^L:ku=^K:le=^H:mk@:nd=^L:sf=^J:sr=\Ej:st=\E1:\ :ta=^I:ts=\Eh\Ef:up=^K:vb=\Eb\Ed:ve=\E.4:vs=\E.2:\ :tc=adm+sgr: # TeleVideo 925 from Mitch Bradley via BRL # to avoid "magic cookie" standout glitch: tvi925-hi|TeleVideo Model 925 with half intensity standout mode:\ :sg@:\ :kb=^H:kd=^J:kl=^H:se=\E(:so=\E):tc=tvi925: # From: Todd Litwin 28 May 1993 # Originally Tim Curry, Univ. of Central Fla., 5/21/82 # for additional capabilities, # The following tvi descriptions from B:pjphar and virus!mike # is for all 950s. It sets the following attributes: # full duplex (\EDF) write protect off (\E() # conversation mode (\EC) graphics mode off (\E%) # white on black (\Ed) auto page flip off (\Ew) # turn off status line (\Eg) clear status line (\Ef\r) # normal video (\E0) monitor mode off (\EX or \Eu) # edit mode (\Er) load blank char to space (\Ee\040) # line edit mode (\EO) enable buffer control (^O) # protect mode off (\E\047) duplex edit keys (\El) # program unshifted send key to send line all (\E016) # program shifted send key to send line unprotected (\E004) # set the following to nulls: # field delimiter (\Ex0\200\200) # line delimiter (\Ex1\200\200) # start-protected field delimiter (\Ex2\200\200) # end-protected field delimiter (\Ex3\200\200) # set end of text delimiter to carriage return/null (\Ex4\r\200) # # TVI 950 Switch Setting Reference Charts # # TABLE 1: # # S1 1 2 3 4 5 6 7 8 9 10 # +-----------------------+-----+-----+-----------------------+ # | Computer Baud Rate |Data |Stop | Printer Baud Rate | # | |Bits |Bits | | # +------+-----------------------+-----+-----+-----------------------+ # | Up | See | 7 | 2 | See | # +------+-----------------------+-----+-----+-----------------------+ # | Down | TABLE 2 | 8 | 1 | TABLE 2 | # +------+-----------------------+-----+-----+-----------------------+ # # # S2 1 2 3 4 5 6 7 8 9 10 # +-----+-----+-----------------+-----+-----------+-----+-----+ # |Edit |Cursr| Parity |Video|Transmiss'n| Hz |Click| # +------+-----+-----+-----------------+-----+-----------+-----+-----+ # | Up | Dplx|Blink| See |GonBk| See | 60 | Off | # +------+-----+-----+-----------------+-----+-----------+-----+-----+ # | Down |Local|St'dy| TABLE 3 |BkonG| CHART | 50 | On | # +------+-----+-----+-----------------+-----+-----------+-----+-----+ # # TABLE 2: # # +-----------+-----+-----+-----+-----+-----------+ # | Display | 1 | 2 | 3 | 4 | Baud | # +-----------+-----+-----+-----+-----+ | # | Printer | 7 | 8 | 9 | 10 | Rate | # +-----------+-----+-----+-----+-----+-----------+ # | D | D | D | D | 9600 | # | U | D | D | D | 50 | # | D | U | D | D | 75 | # | U | U | D | D | 110 | # | D | D | U | D | 135 | # | U | D | U | D | 150 | # | D | U | U | D | 300 | # | U | U | U | D | 600 | # | D | D | D | U | 1200 | # | U | D | D | U | 1800 | # | D | U | D | U | 2400 | # | U | U | D | U | 3600 | # | D | D | U | U | 4800 | # | U | D | U | U | 7200 | # | D | U | U | U | 9600 | # | U | U | U | U | 19200 | # +-----+-----+-----+-----+-----------+ # # TABLE 3: # +-----+-----+-----+-----------+ # | 3 | 4 | 5 | Parity | # +-----+-----+-----+-----------+ # | X | X | D | None | # | D | D | U | Odd | # | D | U | U | Even | # | U | D | U | Mark | # | U | U | U | Space | # +-----+-----+-----+-----------+ # X = don't care # # CHART: # +-----+-----+-----------------+ # | 7 | 8 | Communication | # +-----+-----+-----------------+ # | D | D | Half Duplex | # | D | U | Full Duplex | # | U | D | Block | # | U | U | Local | # +-----+-----+-----------------+ # # (tvi950: early versions had obsolete ":ma=^Vj^Kk^Hh^Ll^^H:". # I also inserted :ic: and :kI:; the :ko: string indicated that :IC: # should be present and all tvi native modes use the same string for this. # Finally, note that BSD has cud1=^V. -- esr) tvi950|televideo 950:\ :am:bs:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:sg#1:\ :ac=d\rc\014e\nb\011i\013:ae=^X:al=\EE:as=^U:bl=^G:bt=\EI:\ :cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :cr=^M:ct=\E3:dc=\EW:\ :dl=\ER:do=^J:ds=\Eg\Ef\r:ei=\Er:fs=^M:ho=^^:ic=\EQ:im=\Eq:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\Ef\r:\ :k0=^A0\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=\EE:kB=\EI:kC=\E*:\ :kD=\EW:kE=\Et:kI=\EQ:kL=\ER:kS=\Ey:kb=^H:kd=^V:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:mk@:nd=^L:pf=\Ea:po=\E`:sf=^J:sr=\Ej:\ :st=\E1:ta=^I:ts=\Eg\Ef:up=^K:vb=\Eb\Ed:\ :tc=adm+sgr: # # is for 950 with two pages adds the following: # set 48 line page (\E\\2) # place cursor at page 0, line 24, column 1 (\E-07 ) # set local (no send) edit keys (\Ek) # # two page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 48 line page (\E\\2) # place cursor at 0,24,1 (\E-07 ) # set duplex (send) edit keys (\El) when entering vi # set local (no send) edit keys (\Ek) when exiting vi # tvi950-2p|televideo950 w/2 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\2\E-07 \011:\ :ke=\Ek:ks=\El:te=\E\2\E-07 :ti=\E\1\E-07 :\ :tc=tvi950: # # is for 950 with four pages adds the following: # set 96 line page (\E\\3) # place cursor at page 0, line 24, column 1 (\E-07 ) # # four page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 96 line page (\E\\3) # place cursor at 0,24,1 (\E-07 ) # tvi950-4p|televideo950 w/4 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\3\E-07 \011:\ :ke=\Ek:ks=\El:te=\E\3\E-07 :ti=\E\1\E-07 :\ :tc=tvi950: # # :is: for reverse video 950 changes the following: # set reverse video (\Ed) # # set vb accordingly (\Ed ...delay... \Eb) # tvi950-rv|televideo950 rev video:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200:\ :vb=\Ed\Eb:\ :tc=tvi950: # tvi950-rv-2p uses the appropriate entries from 950-2p and 950-rv tvi950-rv-2p|televideo950 rev video w/2 pages:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\2\E-07 :\ :ke=\Ek:ks=\El:te=\E\2\E-07 :ti=\E\1\E-07 :vb=\Ed\Eb:\ :tc=tvi950: # tvi950-rv uses the appropriate entries from 950-4p and 950-rv tvi950-rv-4p|televideo950 rev video w/4 pages:\ :is=\EDF\EC\Eb\EG0\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\3\E-07 :\ :ke=\Ek:ks=\El:te=\E\3\E-07 :ti=\E\1\E-07 :vb=\Ed\Eb:\ :tc=tvi950: # From: Andreas Stolcke # (tvi955: removed obsolete ":ma:=^Vj^Kk^Hh^Ll^^H"; # removed incorrect (and overridden) ":do=^J:"; fixed broken continuations in # the :rs: string, inserted the :IC: implied by the termcap :ko: string. Note # the :ko: string had :cl: in it, which means that one of the original # :cl=\E*:, had to be wrong; set because that's what # the 950 has. Finally, corrected the string to match the 950 and what # ko implies -- esr) # If the BSD termcap file was right, :cm=\E=%p1%{32}%+%c%p2%{32}%+%c: would # also work. tvi955|televideo 955:\ :5i:bs:ms@:\ :it#8:sg@:\ :RA=\E[=7l:RX=^N:SA=\E[=7h:SX=^O:\ :ac=0_`RjHkGlFmEnIoPqKsQtMuLvOwNxJ:ae=\E%:as=\E$:\ :cm=\E[%i%d;%dH:do=^V:is=\E[=3l\EF1\Ed\EG0\E[=5l\E%\El:\ :kM=\EQ:kN=\EK:kP=\EJ:kT=\E1:ka=\E3:kt=\E2:mb=\EG2:\ :me=\EG0\E[=5l:mh=\E[=5h:mk=\EG1:ps=\EP:\ :r1=\EDF\EC\Eg\Er\EO\E'\E(\Ew\EX\Ee \017\E0P\E6\200\E0p\E4\200\Ef\r:\ :sf@:ve=\E.2:vi=\E.0:vs=\E.1:\ :tc=tvi950: tvi955-w|955-w|televideo955 w/132 cols:\ :co#132:\ :is=\E[=3h\EF1\Ed\EG0\E[=5l\E%\El:tc=tvi955: # use half-intensity as normal mode, full intensity as :md: tvi955-hb|955-hb|televideo955 half-bright:\ :is=\E[=3l\EF1\Ed\EG0\E[=5h\E%\El:md=\E[=5l:\ :me=\EG0\E[=5h:mh@:tc=tvi955: # From: Humberto Appleton , 880521 UT Austin # (tvi970: removed ":sg#0:"; removed :se:=\E[m, :ue:=\E[m; # added :am:/:cs:/:ho:///:ti:/:te: from BRL. # According to BRL we could have :ke:=\E>, :ks:=\E= but I'm not sure what # it does to the function keys. I deduced /. # also added empty to suppress tic warning, -- esr) tvi970|televideo 970:\ :am:bs:da:db:mi:ms:pt:\ :co#80:it#8:li#24:\ :RA=\E[?7h:SA=\E[?7l:ac=:ae=\E(B:al=\E[L:as=\E(B:bt=\E[Z:\ :cd=\E[J:ce=\E[K:ch=\E[%i%dG:cl=\E[H\E[2J:cm=\E[%i%d;%df:\ :cs=\E[%i%d;%dr:cv=\E[%i%dd:dc=\E[P:dl=\E[M:do=\ED:\ :ds=\Eg\Ef\r:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E<\E[?21l\E[19h\E[1Q\E[10l\E[7l\E[H\E[2J:k1=\E?a:\ :k2=\E?b:k3=\E?c:k4=\E?d:k5=\E?e:k6=\E?f:k7=\E?g:k8=\E?h:\ :k9=\E?i:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:sr=\EM:ta=^I:te=:\ :ti=\E[?20l\E[?7h\E[1Q:ue=\E[m:up=\EM:us=\E[4m:\ :vb=\E[5m\E[m:vs=\E[1Q: tvi970-vb|televideo 970 with visual bell:\ :vb=\E[?5h\200\200\200\200\200\200\200\200\200\200\200\200\200\E[?5l:tc=tvi970: tvi970-2p|televideo 970 with using 2 pages of memory:\ :te=\E[H\E[J\E[V:ti=\E[U\E[?20l\E[?7h\E[1Q:\ :tc=tvi970: # Works with vi and rogue. NOTE: Esc v sets autowrap on, Esc u sets 80 chars # per line (rather than 40), Esc K chooses the normal character set. Not sure # padding is needed, but adapted from the tvi920c termcap. The :so: and # :us: strings are klutzy, but at least use no screen space. # (tvipt: removed obsolete ":ma=^Kk^Ll^R^L:". I wish we knew , # its absence means =\Ev isn't save to use. -- esr) # From: Gene Rochlin 9/19/84. # The :cd:/:k0:/:k1:/:kh:/, and caps are from BRL, which says: # F1 and F2 should be programmed as ^A and ^B; required for UNIFY. tvipt|televideo personal terminal:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :dl=\ER:\ :ho=^^:if=/usr/share/tabset/stdcrt:is=\Ev\Eu\EK:k0=^A:\ :k1=^B:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:pf=^T:\ :po=^R:se=\EF:so=\EG1@A\EH:ue=\EF:up=^K:us=\EG1B@\EH: # From: Nathan Peterson , 03 Sep 1996 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) tvi9065|televideo 9065:\ :am:bw:hs:mi:ms:xn:xo:\ :co#80:it#8:li#25:lm#0:ma#4:vt#0:ws#30:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ae=\E%:\ :al=\EE:as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:\ :cm=\E=%+ %+ :cr=^M:cs=\E[%i%d;%dr:ct=\E3:dc=\EW:dl=\ER:\ :dm=\Er:do=^V:ds=\E_30\r:ec=\E[%d@:ed=\200:ei=\Er:fs=^M:\ :ho=^^:\ :i1=\E"\E%\E'\E(\EG@\EO\EX\E[=5l\E[=6l\E[=7h\Ed\Er:\ :i2=\E<\E[=4l\E[=8h:if=/usr/share/tabset/stdcrt:im=\Eq:\ :ip=:is=\EF2\EG0\E\L:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kb=^H:\ :kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=\E[25;1H:mb=\EG2:\ :md=\EG\054:me=\EG0:mh=\EGp:mr=\EG4:nd=^L:nw=^M^J:\ :rp=\E[%r%db%.:se=\EG0:sf=^J:so=\EGt:sr=\Ej:st=\E1:ta=^I:\ :te=\E.3\Er\E[1;25r\E[25;0H:ti=\E.2:ts=\E[4;1v\E_30:\ :uc=\EG8\EG0:ue=\EG0:up=^K:us=\EG8:vb=\Eb\Ed:ve=\E.3:\ :vi=\E.0:vs=\E.2: #### Visual (vi) # # In September 1993, Visual Technology of Westboro, Massachusetts, # merged with White Pine Software of Nashua, New Hampshire. # # White Pine Software may be contacted at +1 603/886-9050. # Or visit White Pine on the World Wide Web at URL http://www.wpine.com. # # Visual 50 from Beau Shekita, BTL-Whippany # Recently I hacked together the following termcap for Visual # Technology's Visual 50 terminal. It's a slight modification of # the vt52 termcap. # It's intended to run when the Visual 50 is in vt52 emulation mode # (I know what you're thinking; if it's emulating a vt52, then why # another termcap? Well, it turns out that the Visual 50 can handle # :dl: and db(?) among other things, which the vt52 can't) # The termcap works OK for the most part. The only problem is on # character inserts. The whole line gets painfully redrawn for each # character typed. Any suggestions? # Beau's entry is combined with the vi50 entry from University of Wisconsin. # Note especially the :al: function. :k4:-:k6: are really l4-l6 in # disguise; :k7:-:k9: are really l1-l3. vi50|visual 50:\ :am:bs:da:db:ms:pt:\ :co#80:it#8:li#24:\ :al=\EL:bl=^G:bt=4\Ez:cd=\EJ:ce=16\EK:cl=\EH\EJ:\ :cm=\EY%+ %+ :cr=^M:dl=3*\EM:do=\EB:ho=\EH:k1=\EP:k2=\EQ:\ :k3=\ER:k4=\EV:k5=\EE:k6=\E]:k7=\EL:k8=\Ev:k9=\EM:kb=^H:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:nl=^J:\ :nw=^M^J:se=\ET:sf=^J:so=\EU:sr=\EI:ta=^I:ue=\EW:up=\EA:\ :us=\ES: # this one was BSD & SCO's vi50 vi50adm|visual 50 in adm3a mode:\ :am:ms:\ :co#80:it#8:li#24:\ :al=\EL:bl=^G:cd=\Ek:ce=\EK:cl=^Z:cm=\E=%+ %+ :cr=^M:dl=\EM:\ :do=^J:ho=\EH:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:\ :nd=^L:se=\ET:sf=^J:so=\EU:ta=^I:up=^K: # From: Jeff Siegal vi55|Visual 55:\ :am:bs:mi:ms:\ :co#80:it#8:li#24:\ :al=\EL:cd=\EJ:ce=\EK:cl=\Ev:cm=\EY%+ %+ :cs=\E_%+A%+A:\ :dc=\Ew:dl=\EM:do=^J:ei=\Eb:ho=\EH:im=\Ea:\ :is=\Ev\E_AX\Eb\EW\E9P\ET:kb=^H:kd=\EB:kl=\ED:kr=\EC:\ :ku=\EA:le=^H:nd=\EC:se=\ET:so=\EU:sr=\EI:ta=^I:up=\EA: # Visual 200 from BRL # The following switch settings are assumed for normal operation: # FULL_DUPLEX SCROLL CR # AUTO_NEW_LINE_ON VISUAL_200_EMULATION_MODE # Other switches may be set for operator convenience or communication # requirements. # Character insertion is kludged in order to get around the "beep" misfeature. # (This cap is commented out because :im:/:ei: is more efficient -- esr) # Supposedly "4*" delays should be used for :al:, :cd:, :cl:, :dc:, # and :dl: strings, but we seem to get along fine without them. vi200|visual 200:\ :am:bs:mi:ms:pt:\ :co#80:it#8:kn#10:li#24:\ :ac=:ae=\EG:al=\EL:as=\EF:bl=^G:bt=\Ez:cd=\Ey:ce=\Ex:cl=\Ev:\ :cm=\EY%+ %+ :cr=^M:ct=\Eg:dc=\EO:dl=\EM:do=^J:ho=\EH:\ :k0=\E?p:k1=\E?q:k2=\E?r:k3=\E?s:k4=\E?t:k5=\E?u:k6=\E?v:\ :k7=\E?w:k8=\E?x:k9=\E?y:kA=\EL:kC=\Ev:kD=\EO:kE=\Et:kI=\Ei:\ :kL=\EM:kM=\Ej:kS=\EJ:kT=\E1:kb=^H:kd=\EB:ke=\E>:kh=\EH:\ :kl=\ED:kr=\EC:ks=\E=:kt=\E2:ku=\EA:le=^H:me=\E3\Eb:mh=\E4:\ :mk=\Ea:nd=\EC:pf=\EX:po=\EW:ps=\EH\E]:\ :r1=\E3\Eb\Ej\E\\El\EG\Ec\Ek\EX:se=\E3:sf=^J:so=\E4:\ :sr=\EI:st=\E1:ta=^I:up=\EA:ve=\Ec:vs=\Ed: # The older Visuals didn't come with function keys. This entry uses # :ks: and :ke: so that the keypad keys can be used as function keys. # If your version of vi doesn't support function keys you may want # to use vi200-f. vi200-f|visual 200 no function keys:\ :is=\E3\Eb\Ej\E\\El\EG\Ed\Ek:k0=\E?p:k1=\E?q:k2=\E?r:\ :k3=\E?s:k4=\E?t:k5=\E?u:k6=\E?v:k7=\E?w:k8=\E?x:k9=\E?y:\ :ke=\E>:ks=\E=:se@:so@:\ :tc=vi200: vi200-rv|visual 200 reverse video:\ :se=\E3:so=\E4:sr@:ve@:vs@:tc=vi200: # the function keys are programmable but we don't reprogram them to their # default values with :is: because programming them is very verbose. maybe # an initialization file should be made for the 300 and they could be stuck # in it. # (vi300: added / based on init string -- esr) vi300|visual 300 ansi x3.64:\ :am:bw:mi:xn:\ :co#80:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[7s\E[2;3;4;20;?5;?6l\E[12;?7h\E[1Q\E[0;1(D\E[8s:\ :k1=\E_A\E\:k2=\E_B\E\:k3=\E_C\E\:k4=\E_D\E\:k5=\E_E\E\:\ :k6=\E_F\E\:k7=\E_G\E\:k8=\E_H\E\:k9=\E_I\E\:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[C:\ :se=\E[m:sf=^J:so=\E[1m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m: # some of the vi300s have older firmware that has the command # sequence for setting editing extent reversed. vi300-old|visual 300 with old firmware (set edit extent reversed):\ :is=\E[7s\E[2;3;4;20;?5;?6l\E[12;?7h\E[2Q\E[0;1(D\E[8s:\ :tc=vi300: # Visual 500 prototype entry from University of Wisconsin. # The best place to look for the escape sequences is page A1-1 of the # Visual 500 manual. The initialization sequence given here may be # overkill, but it does leave out some of the initializations which can # be done with the menus in set-up mode. # The :xp: line below is so that emacs can understand the padding requirements # of this slow terminal. :xp: is 10 time the padding factor. # (vi500: removed unknown :xp#4: termcap; # also added empty to suppress tic warning -- esr) vi500|visual 500:\ :am:mi:ms:\ :co#80:it#8:li#33:\ :ac=:ae=^O:al=3*\EL\Ex:as=^N:bt=4\Ez:cd=3*\Ey:ce=16\Ex:\ :cl=6*\Ev:cm=\EY%+ %+ :cr=^M:cs=\E(%+ %+ :dc=3*\EO:\ :dl=3*\EM:do=\EB:ei=\Ej:ho=\EH:im=\Ei:\ :is=\E3\E\001\E\007\E\003\Ek\EG\Ed\EX\El\E>\Eb\E\:\ :kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :nw=^M^J:se=\E^G:sf=^J:so=\E^H:ta=8\011:ue=\E^C:up=\EA:\ :us=\E^D: # The visual 550 is a visual 300 with tektronix graphics, # and with 33 lines. clear screen is modified here to # also clear the graphics. vi550|visual 550 ansi x3.64:\ :li#33:\ :cl=\030\E[H\E[2J:tc=vi300: vi603|visual603|visual 603:\ :hs:mi:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:ds=\EP2;1~\E\:ei=\E[4l:\ :fs=\E\:i1=\E>\E[?3l\E[?4l\E[?7h\E[?8h\E[1;24r:\ :im=\E[4h:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:ts=\EP2~:ue=\E[24m:\ :up=\E[A:us=\E[4m:\ :tc=vt100: #### Wyse (wy) # # Wyse Technology # 3471 North First Street # San Jose, CA 95134 # Vox: (408)-473-1200 # Fax: (408) 473-1222 # Web: http://www.wyse.com # # Wyse sales can be reached by phone at 1-800-GET-WYSE. Tech support is at # (800)-800-WYSE (option 5 gets you a human). There's a Web page at the # obvious address, http://www.wyse.com. # # Wyse bought out Link Technology, Inc. in 1990 and closed it down in 1995. # They now own the Qume and Amdek brands, too. So these are the people to # talk with about all Link, Qume, and Amdek terminals. # # Wyse has a BBS containing termcap and terminfo stuff for their terminals # (though this may not last long -- I expect the Web will kill it off by # mid-1997 or so). According to their tech support, at 800-800-9973, it's # at 408-922-4400 thru 4405. The 4400 modem is flaky as of 5/96, so # call 4401 etc. Come in at 9600 hard; don't use autospeed sense. # # All the following entries until (but not including) wy520 are direct from # Wyse technical support and represent their best knowledge as of January 1995. # I canceled the bel capacities in the vb entries. # I made two trivial syntax fixes in the wyse30 entry. # I made some entries relative to adm+sgr. # # # Note: The wyse75, wyse85, and wyse99 have been discontinued. # Although the Wyse 30 can support more than one attribute # it requires magic cookies to do so. Many applications do not # function well with magic cookies. The following terminfo uses # the protect mode to support one attribute (dim) without cookies. # If more than one attribute is needed then the wy30-mc terminfo # should be used. # wy30|wyse30|Wyse 30:\ :5i:am:bs:bw:hs:mi:ms:xo:\ :Nl#8:co#80:lh#1:li#24:lw#8:ma#1:ws#45:\ :#2=\E{:&3=\Er:@8=\E7:LF=\EA11:LO=\EA10:\ :ac=0wa_h[jukslrmqnxqzttuyv]wpxv:ae=\EH^C:al=\EE:\ :as=\EH^B:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:ei=\Er:fs=^M:\ :ho=^^:im=\Eq:ip=:is=\E'\E(\E\1363\E`9\016\024:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:kA=\EE:kB=\EI:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kN=\EK:\ :kP=\EJ:kS=\EY:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:\ :ll=^^^K:me=\E(\EH\003:mh=\E`7\E):mp=\E`7\E):nd=^L:\ :nw=^M^J:pf=^T:pn=\Ez%+/%s\r:po=^X:ps=\EP:px=\Ez%+?%s\177:\ :..sa=%?%p1%p5%p8%|%|%t\E`7\E)%e\E(%;%?%p9%t\EH\002%e\EH\003%;:\ :se=\E(:sf=\n:so=\E`7\E):sr=\Ej:st=\E1:ta=\011:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0: # # This terminal description uses the non-hidden attribute mode # (with magic cookie). # # (wy30-mc: added :ti: to suppress tic warning --esr) wy30-mc|wyse30-mc|wyse 30 with magic cookies:\ :ms@:\ :ma@:sg#1:\ :ae=\EG0\EH\003:as=\EG0\EH\002:mb=\EG2:\ :me=\EG0\E(\EH\003:mh=\EGp:mp=\EG0\E):\ :..sa=\EG%'0'%?%p2%p6%|%t%{8}%|%;%?%p1%p3%|%p6%|%t%{4}%|%;%?%p4%t%{2}%|%;%?%p1%p5%|%t%{64}%|%;%?%p7%t%{1}%|%;%c%?%p8%t\E)%e\E(%;%?%p9%t\EH\002%e\EH\003%;:\ :te=\EG0:ti=:\ :tc=wy30:tc=adm+sgr: # The mandatory pause used by :vb: does not work with # older versions of terminfo. If you see this effect then # unset xon and delete the / from the delay. # i.e. change $<100/> to $<100> wy30-vb|wyse30-vb|wyse 30 visible bell:\ :bl@:tc=wy30: # # The Wyse 50 can support one attribute (e.g. Dim, Inverse, # Normal) without magic cookies by using the protect mode. # The following description uses this feature, but when more # than one attribute is put on the screen at once, all attributes # will be changed to be the same as the last attribute given. # The Wyse 50 can support more attributes when used with magic # cookies. The wy50-mc terminal description uses magic cookies # to correctly handle multiple attributes on a screen. # wy50|wyse50|Wyse 50:\ :5i:am:bs:bw:hs:mi:ms:xo:\ :Nl#8:co#80:lh#1:li#24:lw#8:ma#1:ws#45:\ :#2=\E{:%9=\EP:&3=\Er:@8=\E7:F1=^AJ\r:F2=^AK\r:F3=^AL\r:\ :F4=^AM\r:F5=^AN\r:F6=^AO\r:LF=\EA11:LO=\EA10:\ :ac=0wa_h[jukslrmqnxqzttuyv]wpxv:ae=\EH^C:al=\EE:\ :as=\EH^B:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:ei=\Er:fs=^M:\ :ho=^^:i1=\E`\072\E`9:im=\Eq:ip=:is=\016\024\E'\E(:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:kA=\EE:kB=\EI:kD=\EW:\ :kE=\ET:kI=\EQ:kL=\ER:kN=\EK:kP=\EJ:kS=\EY:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:me=\E(\EH\003:mh=\E`7\E):\ :mp=\E`7\E):mr=\E`6\E):nd=^L:nw=^M^J:pf=^T:pn=\Ez%+/%s\r:\ :po=^X:ps=\EP:px=\Ez%+?%s\177:\ :..sa=%?%p1%p3%|%t\E`6\E)\n%e%p5%p8%|%t\E`7\E)%e\E(%;\n%?%p9%t\EH\002%e\EH\003%;:\ :se=\E(:sf=\n:so=\E`6\E):sr=\Ej:st=\E1:ta=^I:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0: # # This terminal description uses the non-hidden attribute mode # (with magic cookie). # # The mandatory pause used by flash does not work with some # older versions of terminfo. If you see this effect then # unset :xo: and delete the / from the delay. # i.e. change $<100/> to $<100> # (wy50-mc: added :ti: to suppress tic warning --esr) wy50-mc|wyse50-mc|wyse 50 with magic cookies:\ :ms@:\ :ma@:sg#1:\ :ae=\EG0\EH\003:as=\EG0\EH\002:mb=\EG2:\ :me=\EG0\E(\EH\003:mh=\EGp:mp=\EG0\E):\ :..sa=\EG%'0'%?%p2%p6%|%t%{8}%|%;%?%p1%p3%|%p6%|%t%{4}%|%;%?%p4%t%{2}%|%;%?%p1%p5%|%t%{64}%|%;%?%p7%t%{1}%|%;%c%?%p8%t\E)%e\E(%;%?%p9%t\EH\002%e\EH\003%;:\ :so=\EGt:te=\EG0:ti=:\ :tc=wy50:tc=adm+sgr: wy50-vb|wyse50-vb|wyse 50 visible bell:\ :bl@:tc=wy50: wy50-w|wyse50-w|wyse 50 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:i1=\E`;\E`9:tc=wy50: wy50-wvb|wyse50-wvb|wyse 50 132-column visible bell:\ :bl@:\ :tc=wy50-w: # # The Wyse 350 is a Wyse 50 with color. # Unfortunately this means that it has magic cookies. # The color attributes are designed to overlap the reverse, dim and # underline attributes. This is nice for monochrome applications # because you can make underline stuff green (or any other color) # but for true color applications it's not so hot because you cannot # mix color with reverse, dim or underline. # To further complicate things one of the attributes must be # black (either the foreground or the background). In reverse video # the background changes color with black letters. In normal video # the foreground changes colors on a black background. # This terminfo uses some of the more advanced features of curses # to display both color and blink. In the final analysis I am not # sure that the wy350 runs better with this terminfo than it does # with the wy50 terminfo (with user adjusted colors). # # The mandatory pause used by flash does not work with # older versions of terminfo. If you see this effect then # unset xon and delete the / from the delay. # i.e. change $<100/> to $<100> # # Bug: The capability resets attributes. # (untranslatable capabilities removed to fit entry within 1023 bytes) wy350|wyse350|Wyse 350:\ :5i:am:bw:hs:mi:xo:\ :Co#8:NC#55:Nl#8:co#80:lh#1:li#24:lw#8:pa#8:sg#1:ws#45:\ :#2=\E{:%9=\EP:&3=\Er:@8=\E7:F1=^AJ\r:F2=^AK\r:F3=^AL\r:\ :F4=^AM\r:F5=^AN\r:F6=^AO\r:LF=\EA11:LO=\EA10:Sb=:\ :ac=0wa_h[jukslrmqnxqzttuyv]wpxv:ae=\EG0\EH\003:al=\EE:\ :as=\EG0\EH\002:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:\ :ei=\Er:fs=^M:ho=^^:i1=\E`\072\E`9:i2=\E%?:im=\Eq:ip=:\ :is=\016\024\E'\E(:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:\ :kA=\EE:kB=\EI:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kN=\EK:kP=\EJ:\ :kS=\EY:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:\ :mb=\EG2:me=\EG0\E(\EH\003%{0}%PA%{0}%PC:mh=\EGp:\ :mp=\EG0\E):nd=^L:nw=^M^J:oc=\E%?:op=\EG0:pf=^T:\ :pn=\Ez%+/%s\r:po=^X:ps=\EP:px=\Ez%+?%s\177:sf=\n:sr=\Ej:\ :st=\E1:ta=^I:ts=\EF:up=^K:vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: wy350-vb|wyse350-vb|wyse 350 visible bell:\ :bl@:tc=wy350: wy350-w|wyse350-w|wyse 350 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:i1=\E`;\E`9:tc=wy350: wy350-wvb|wyse350-wvb|wyse 350 132-column visible bell:\ :bl@:\ :tc=wy350-w: # # This terminfo description is untested. # The wyse100 emulates an adm31, so the adm31 entry should work. # wy100|wyse 100:\ :hs:mi:\ :co#80:li#24:sg#1:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E;:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ds=\EA31:ei=\Er:fs=^M:im=\Eq:is=\Eu\E0:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:kb=^H:kd=^J:kh=\E{:kl=^H:kr=^L:ku=^K:\ :le=^H:mk@:nd=^L:sf=^J:ts=\EF:up=^K:\ :tc=adm+sgr: # # The Wyse 120/150 has most of the features of the Wyse 60. # This terminal does not need padding up to 9600 baud! # :ms: should be set but the clear screen fails when in # alt-charset mode. Try \EcE\s\s\E+\s if the screen is really clear # then set :ms:. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy120|wyse120|wy150|wyse150|Wyse 120/150:\ :am:bw:hs:km:mi:ms:xo:\ :co#80:it#8:li#24:pb#9601:ws#45:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=^J:ds=\EF\r:ei=\Er:\ :fs=^M:ho=^^:i1=\EcB0\EcC1:i2=\EwJ\Ew1:im=\Eq:ip=:\ :is=\Ed$\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:kN=\EK:kP=\EJ:\ :kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:nd=^L:nw=\r\n:sf=\n:\ :so=\EGt:sr=\Ej:st=\E1:ta=\011:te=\Ew1:ti=\Ew0:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: # wy120-w|wyse120-w|wy150-w|wyse150-w|wyse 120/150 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\E`;:tc=wy120: # wy120-25|wyse120-25|wy150-25|wyse150-25|wyse 120/150 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy120: # wy120-25-w|wyse120-25-w|wy150-25-w|wyse150-25-w|wyse 120/150 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy120-w: # wy120-vb|wyse120-vb|wy150-vb|wyse150-vb|Wyse 120/150 visible bell:\ :bl@:\ :tc=wy120: # wy120-w-vb|wy120-wvb|wyse120-wvb|wy150-w-vb|wyse150-w-vb|Wyse 120/150 132-column visible bell:\ :bl@:\ :tc=wy120-w: # # The Wyse 60 is like the Wyse 50 but with more padding. # The reset strings are slow and the pad times very depending # on other parameters such as font loading. I have tried # to follow the following outline: # # -> set personality # -> set number of columns # -> set number of lines # :i1: -> select the proper font # :is: -> do the initialization # :i3: -> set up display memory (2 pages) # # The Wyse 60's that have vt100 emulation are slower than the # older Wyse 60's. This change happened mid-1987. # The capabilities effected are :dc: :dl: :al: :sf: :sr: # # The meta key is only half right. This terminal will return the # high order bit set when you hit CTRL-function_key # # It may be useful to assign two function keys with the # values \E=(\s look at old data in page 1 # \E=W, look at bottom of page 1 # where \s is a space ( ). # # Note: # The Wyse 60 runs faster when the XON/XOFF # handshake is turned off. # # (wy60: we use \E{ rather than ^^ for home (both are documented) to avoid # a bug reported by Robert Dunn, -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy60|wyse60|Wyse 60:\ :am:bs:bw:hs:km:mi:ms:\ :co#80:li#24:ws#45:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:\ :ei=\Er:fs=^M:ho=\E{:i1=\EcB0\EcC1:i2=\EwJ\Ew1:im=\Eq:ip=:\ :is=\Ed$\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:kN=\EK:kP=\EJ:\ :kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=\E{^K:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:nd=^L:nw=\r\n:sf=\n:\ :so=\EGt:sr=\Ej:st=\E1:ta=\011:te=\Ew1:ti=\Ew0:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: # wy60-w|wyse60-w|wyse 60 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\EeF\E`;:tc=wy60: # wy60-25|wyse60-25|wyse 60 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy60: wy60-25-w|wyse60-25-w|wyse 60 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy60-w: # wy60-42|wyse60-42|wyse 60 80-column 42-lines:\ :li#42:\ :al=\EE:cd=\Ey:cl=\E+:cm=\E=%+ %+ :dc=\EW:dl=\ER:\ :i1=\EcB2\EcC3:ip=:nw=\r\n:r3=\Ee*:sf=\n:sr=\Ej:tc=wy60: wy60-42-w|wyse60-42-w|wyse 60 132-column 42-lines:\ :Nl#16:co#132:lw#7:ws#97:\ :cd=\Ey:cl=\E+:cm=\Ea%i%dR%dC:dc=\EW:ho=\036:ip=:nw=\r\n:\ :r2=\EeF\E`;:\ :tc=wy60-42: # wy60-43|wyse60-43|wyse 60 80-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy60-42: wy60-43-w|wyse60-43-w|wyse 60 132-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy60-42-w: # wy60-vb|wyse60-vb|Wyse 60 visible bell:\ :bl@:tc=wy60: wy60-w-vb|wy60-wvb|wyse60-wvb|Wyse 60 132-column visible bell:\ :bl@:\ :tc=wy60-w: # The Wyse-99GT looks at lot like the Wyse 60 except that it # does not have the 42/43 line mode. In the Wyse-60 the "lines" # setup parameter controls the number of lines on the screen. # For the Wyse 99GT the "lines" setup parameter controls the # number of lines in a page. The screen can display 25 lines max. # The Wyse-99GT also has personalities for the VT220 and # Tektronix 4014. But this has no bearing on the native mode. # # (msgr) should be set but the clear screen fails when in # alt-charset mode. Try \EcE\s\s\E+\s if the screen is really clear # then set msgr, else use msgr@. # # u0 -> enter Tektronix mode # u1 -> exit Tektronix mode # wy99gt|wyse99gt|Wyse 99gt:\ :ms@:\ :al=\EE:cd=\Ey:ce=\Et:cl=\E+:dc=\EW:dl=\ER:i2=\Ew0:ip=:nw@:\ :r2=\E`\072:sf=\n:sr=\Ej:ta=\011:te=\Ew0:ti=\Ew1:\ :u0=\E~>\E8:u1=\E[42h:vb=\E`8\E`9:tc=wy60: # wy99gt-w|wyse99gt-w|wyse 99gt 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cd=\Ey:cl=\E+:cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\E`;:tc=wy99gt: # wy99gt-25|wyse99gt-25|wyse 99gt 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r2=\E`\072:r3=\EwG\Ee):tc=wy99gt: # wy99gt-25-w|wyse99gt-25-w|wyse 99gt 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r2=\E`;:tc=wy99gt-w: # wy99gt-vb|wyse99gt-vb|Wyse 99gt visible bell:\ :bl@:tc=wy99gt: # wy99gt-w-vb|wy99gt-wvb|wyse99gt-wvb|Wyse 99gt 132-column visible bell:\ :bl@:\ :tc=wy99gt-w: # # The Wyse 160 is combination of the WY-60 and the WY-99gt. # The reset strings are slow and the pad times very depending # on other parameters such as font loading. I have tried # to follow the following outline: # # -> set personality # -> set number of columns # -> set number of lines # :i1: -> select the proper font # :is: -> do the initialization # :i3: -> set up display memory (2 pages) # # The display memory may be used for either text or graphics. # When "Display Memory = Shared" the terminal will have more pages # but garbage may be left on the screen when you switch from # graphics to text. If "Display Memory = Unshared" then the # text area will be only one page long. # # (wy160: we use \E{ rather than ^^ for home (both are documented) to avoid # a bug reported by Robert Dunn, -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy160|wyse160|Wyse 160:\ :am:bw:hs:km:mi:ms:\ :co#80:li#24:ws#38:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:\ :ei=\Er:fs=^M:ho=\E{:i1=\EcB0\EcC1:i2=\Ew0:im=\Eq:ip=:\ :is=\Ed$\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:kN=\EK:kP=\EJ:\ :kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=\E{^K:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:nd=^L:nw=\r\n:sf=\n:\ :so=\EGt:sr=\Ej:st=\E1:ta=^I:te=\Ew0:ti=\Ew1:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: # wy160-w|wyse160-w|wyse 160 132-column:\ :Nl#16:co#132:lw#7:ws#90:\ :cm=\Ea%i%dR%dC:dc=\EW:r2=\EeF\E`;:tc=wy160: # wy160-25|wyse160-25|wyse 160 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy160: wy160-25-w|wyse160-25-w|wyse 160 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy160-w: # wy160-42|wyse160-42|wyse 160 80-column 42-lines:\ :li#42:\ :al=\EE:cd=\Ey:cl=\E+:dl=\ER:i1=\EcB2\EcC3:nw=\r\n:r3=\Ee*:\ :sf=\n:sr=\Ej:\ :tc=wy160: wy160-42-w|wyse160-42-w|wyse 160 132-column 42-lines:\ :Nl#16:co#132:lw#7:ws#90:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\EeF\E`;:tc=wy160-42: # wy160-43|wyse160-43|wyse 160 80-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy160-42: wy160-43-w|wyse160-43-w|wyse 160 132-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy160-42-w: # wy160-vb|wyse160-vb|Wyse 160 visible bell:\ :bl@:tc=wy160: wy160-w-vb|wy160-wvb|wyse160-wvb|Wyse 160 132-column visible bell:\ :bl@:\ :tc=wy160-w: # # The Wyse 75 is a vt100 lookalike without advanced video. # # The Wyse 75 can support one attribute (e.g. Dim, Inverse, # Underline) without magic cookies. The following description # uses this capability, but when more than one attribute is # put on the screen at once, all attributes will be changed # to be the same as the last attribute given. # The Wyse 75 can support more attributes when used with magic # cookies. The wy75-mc terminal description uses magic cookies # to correctly handle multiple attributes on a screen. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy75|wyse75|wyse 75:\ :am:bs:hs:mi:ms:xn:xo:\ :co#80:li#24:ma#1:pb#1201:ws#78:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[>\\054\001\001\E[>-\001\001:ec=\E[%dX:ei=\E[4l:\ :fs=^A:ho=\E[H:\ :i1=\E[2;4;20;30l\E[?1;10l\E[12h\E[?7;8;25h:i2=\E[m:\ :im=\E[4h:ip=:is=\E>\E(B:k1=\E[?5i:k2=\E[?3i:\ :k3=\E[2i:k4=\E[@:k5=\E[M:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[@:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:ke=\E>:\ :kh=\E[H:kl=\E[D:kr=\E[C:ks=\E[?1l\E[?7h\E=:ku=\E[A:le=^H:\ :me=\E[m\017:mh=\E[0t\E[2m:mr=\E[1t\E[7m:nd=\E[C:rc=\E8:\ :sc=\E7:se=\E[m:sf=\n:so=\E[1t\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[>\\054\001:ue=\E[m:up=\E[A:us=\E[2t\E[4m:\ :vb=\E[30h\E\\054\E[30l:ve=\E[?25h:vi=\E[?25l: # # This terminal description uses the non-hidden attribute mode # (with magic cookie). # wy75-mc|wyse75-mc|wyse 75 with magic cookies:\ :ms@:\ :ma@:sg#1:ug#1:\ :ae=\E[0p\017:as=\E[0p\016:i2=\E[m\E[p:mb=\E[2p:\ :me=\E[0p\017:mh=\E[1p:mk=\E[4p:mr=\E[16p:\ :..sa=\E[%{0}%?%p2%p6%|%t%{8}%|%;%?%p1%p3%|%p6%|%t%{16}%|%;%?%p4%t%{2}%|%;%?%p1%p5%|%t%{1}%|%;%?%p7%t%{4}%|%;%dp%?%p9%t\016%e\017%;:\ :se=\E[0p:so=\E[17p:ue=\E[0p:us=\E[8p:\ :tc=wy75: wy75-vb|wyse75-vb|wyse 75 with visible bell:\ :pb@:\ :bl@:tc=wy75: wy75-w|wyse75-w|wyse 75 in 132 column mode:\ :co#132:ws#130:\ :r2=\E[35h\E[?3h:tc=wy75: wy75-wvb|wyse75-wvb|wyse 75 with visible bell 132 columns:\ :pb@:\ :bl@:tc=wy75-w: # # Wyse 85 emulating a vt220 7 bit mode. # 24 line screen with status line. # # The vt220 mode permits more function keys but it wipes out # the escape key. I strongly recommend that be set to # escape (esc). # The terminal may have to be set for 8 data bits and 2 stop # bits for the arrow keys to work. # The Wyse 85 runs faster with XON/XOFF enabled. Also the # :DC: and :IC: work best when XON/XOFF is set. :IC: and # :DC: leave trash on the screen when used without XON/XOFF. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy85|wyse85|wyse 85:\ :am:bs:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ds=\E[40l:\ :ec=\E[%dX:ei=\E[4l:fs=\E[1;24r\E8:ho=\E[H:\ :i1=\E[62;1"p\E[?5W:i2=\E>\E(B\E[m:im=\E[4h:ip=:\ :is=\E[2;4;20;30l\E[?1;4;10;16l\E[12h\E[?7;8;25h:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:ke=\E>:kh=\E[26~:kl=\E[D:kr=\E[C:\ :ks=\E[?1l\E=:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:sf=\n:\ :so=\E[7m:sr=\EM:st=\EH:ta=\011:\ :ts=\E[40h\E7\E[25;%i%p1%dH:ue=\E[m:up=\E[A:us=\E[4m:\ :vb=\E[30h\E\\054\E[30l:ve=\E[?25h:vi=\E[?25l: # # Wyse 85 with visual bell. wy85-vb|wyse85-vb|wyse 85 with visible bell:\ :bl@:vb=\E[30h\E\\054\E[30l:tc=wy85: # # Wyse 85 in 132-column mode. wy85-w|wyse85-w|wyse 85 in 132-column mode:\ :co#132:ws#132:\ :r2=\E[35h\E[?3h:tc=wy85: # # Wyse 85 in 132-column mode with visual bell. wy85-wvb|wyse85-wvb|wyse 85 with visible bell 132-columns:\ :bl@:\ :tc=wy85-w: # # Wyse 185 emulating a vt320 7 bit mode. # # This terminal always displays 25 lines. These lines may be used # as 24 data lines and a terminal status line (top or bottom) or # 25 data lines. The 48 and 50 line modes change the page size # and not the number of lines on the screen. # # The Compose Character key can be used as a meta key if changed # by set-up. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy185|wyse185|wyse 185:\ :am:hs:km:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E7\E[99;0H\E[K\E8:ec=\E[%dX:ei=\E[4l:\ :fs=\E[1;24r\E8:ho=\E[H:i1=\E[?5W:\ :i2=\E>\E(B\E[m:im=\E[4h:ip=:\ :is=\E[2;4;20;30l\E[?1;4;10;16l\E[12h\E[?7;8;25h:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:ke=\E>:kh=\E[26~:kl=\E[D:kr=\E[C:\ :ks=\E[?1l\E=:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:sf=\n:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:te=\E[ R:ti=\E[ Q:\ :ts=\E7\E[99;%i%p1%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[30h\E\\054\E[30l:ve=\E[34h\E[?25h:vi=\E[?25l:\ :vs=\E[?25h\E[34l: # # Wyse 185 with 24 data lines and top status (terminal status) wy185-24|wyse185-24|wyse 185 with 24 data lines:\ :hs@:\ :ds@:fs@:r3=\E[?5l\E[47h\E[40l\E[1;24r:ts@:tc=wy185: # # Wyse 185 with visual bell. wy185-vb|wyse185-vb|wyse 185+flash:\ :bl@:tc=wy185: # # Wyse 185 in 132-column mode. wy185-w|wyse185-w|wyse 185 in 132-column mode:\ :co#132:ws#132:\ :DC=\E[%dP:IC=\E[%d@:dc=\E[P:ei=:im=:ip=:r2=\E[35h\E[?3h:tc=wy185: # # Wyse 185 in 132-column mode with visual bell. wy185-wvb|wyse185-wvb|wyse 185+flash+132 cols:\ :bl@:tc=wy185-w: # wy325 terminfo entries # Done by Joe H. Davis 3-9-92 # lines 25 columns 80 # # (untranslatable capabilities removed to fit entry within 1023 bytes) wy325|wyse325|Wyse epc:\ :5i:am:bw:hs:mi:\ :Nl#8:co#80:lh#1:li#24:lw#8:pb#9601:ws#45:\ :#2=\E{:%9=\EP:&3=\Er:@8=\E7:F1=^AJ\r:F2=^AK\r:F3=^AL\r:\ :F4=^AM\r:F5=^AN\r:F6=^AO\r:LF=\EA11:LO=\EA10:RA=\Ed.:\ :SA=\Ed/:\ :ac=+/\\054.0[Iha2fxgqh1jYk?lZm@nEqDtCu4vAwBx3yszr{c~~:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:\ :ei=\Er:fs=^M:ho=^^:i1=\EcB0\EcC1:i2=\Ew0:im=\Eq:ip=:\ :is=\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:kA=\EE:kB=\EI:kD=\EW:\ :kE=\ET:kI=\Eq:kL=\ER:kN=\EK:kP=\EJ:kS=\EY:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:mp=\E):nd=^L:pf=^T:\ :pl=\EZ2%+?%s\177:pn=\Ez%+/%s\r:po=\Ed#:ps=\EP:\ :px=\EZ1%+?%s\177:r1=\E~\041\E~4:r2=\EeF\E`\072:\ :r3=\EwG\Ee(:sf=\n:so=\EGt:sr=\Ej:st=\E1:ta=^I:te=\Ew0:\ :ti=\Ew1:ts=\EF:up=^K:vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: # # lines 24 columns 80 vb # wy325-vb|wyse325-vb|wyse-325 with visual bell:\ :bl@:tc=wy325: # # lines 24 columns 132 # wy325-w|wyse325-w|wy325w-24|wyse-325 in wide mode:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\E`;:tc=wy325: # # lines 25 columns 80 # wy325-25|wyse325-25|wy325-80|wyse-325|wyse-325 25 lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325: # # lines 25 columns 132 # wy325-25w|wyse325-25w|wy325 132 columns:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325-w: # # lines 25 columns 132 vb # wy325-w-vb|wy325-wvb|wyse325-wvb|wyse-325 wide mode reverse video:\ :bl@:\ :tc=wy325-w: # # lines 42 columns 80 # wy325-42|wyse325-42|wyse-325 42 lines:\ :Nl@:lh@:li#42:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325: # # lines 42 columns 132 # wy325-42w|wyse325-42w|wyse-325 42 lines wide mode:\ :Nl@:lh@:li#42:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325-w: # # lines 42 columns 132 vb # wy325-42w-vb|wy325-42wvb|wyse-325 42 lines wide mode visual bell:\ :bl@:\ :tc=wy325-w: # # lines 43 columns 80 # wy325-43|wyse325-43|wyse-325 43 lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:tc=wy325: # # lines 43 columns 132 # wy325-43w|wyse325-43w|wyse-325 43 lines wide mode:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325-w: # # lines 43 columns 132 vb # wy325-43w-vb|wy325-43wvb|wyse-325 43 lines wide mode visual bell:\ :bl@:\ :tc=wy325-w: # Wyse 370 -- 24 line screen with status line. # # The terminal may have to be set for 8 data bits and 2 stop # bits for the arrow keys to work. # # If you change keyboards the terminal will send different # escape sequences. # The following definition is for the basic terminal without # function keys. # # -> enter Tektronix 4010/4014 mode # -> exit Tektronix 4010/4014 mode # -> enter ASCII mode (from any ANSI mode) # -> exit ASCII mode (goto native ANSI mode) # -> enter Tek 4207 ANSI mode (from any ANSI mode) # -> exit Tek 4207 mode (goto native ANSI mode) # # Bug: The capability resets attributes. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy370-nk|wyse 370 without function keys:\ :am:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ds=\E[40l:\ :ec=\E[%dX:ei=\E[4l:fs=\E[1;24r\E8:ho=\E[H:\ :i1=\E[90;1"p\E[?5W:i2=\E>\017\E(B\E[63;0w\E[m:\ :im=\E[4h:ip=:\ :is=\E[2;4;20;30;40l\E[?1;10;16l\E[12h\E[?7;8;25h:\ :ke=\E>:ks=\E[?1l\E=:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:sf=\n:\ :so=\E[7m:sr=\EM:st=\EH:ta=\011:te=\E[ R:ti=\E[ Q:\ :ts=\E[40l\E[40h\E7\E[99;%i%p1%dH:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[30h\E\\054\E[30l:ve=\E[34h\E[?25h:\ :vi=\E[?25l:vs=\E[?25h\E[34l: # # Function key set for the ASCII (wy-50 compatible) keyboard # This is the default 370. # wy370|wyse370|wy370-101k|Wyse 370 with 101 key keyboard:\ :@8=\EOM:F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:\ :F5=\E[28~:F6=\E[29~:k1=\E[?4i:k2=\E[?3i:k3=\E[2i:k4=\E[@:\ :k5=\E[M:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kA=\EOP:kB=\E[Z:kD=\EOQ:kI=\EOP:kL=\EOQ:kN=\E[U:\ :kP=\E[V:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :tc=wy370-nk: # # Function key set for the VT-320 (and wy85) compatible keyboard # wy370-105k|Wyse 370 with 105 key keyboard:\ :%1=\E[28~:*6=\E[4~:@0=\E[1~:@8=\EOM:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F5=\E[28~:F6=\E[29~:F7=\E[31~:\ :F8=\E[32~:F9=\E[33~:FA=\E[34~:K1=\EOw:K2=\EOu:K3=\EOy:\ :K4=\EOq:K5=\EOs:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\E[3~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[26~:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=PF1:l2=PF2:l3=PF3:l4=PF4:\ :tc=wy370-nk: # # Function key set for the PC compatible keyboard # wy370-EPC|Wyse 370 with 102 key keyboard:\ :@7=\E[1~:@8=\EOM:F1=\E[23~:F2=\E[24~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[M:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:k;=\E[21~:kB=\E[Z:kI=\E[2~:kN=\E[U:kP=\E[V:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :tc=wy370-nk: # # Wyse 370 with visual bell. wy370-vb|Wyse 370 with visible bell:\ :bl@:tc=wy370: # # Wyse 370 in 132-column mode. wy370-w|Wyse 370 in 132-column mode:\ :co#132:ws#132:\ :r2=\E[35h\E[?3h:tc=wy370: # # Wyse 370 in 132-column mode with visual bell. wy370-wvb|Wyse 370 with visible bell 132-columns:\ :vb=\E[30h\E\\054\E[30l:tc=wy370-w: wy370-rv|Wyse 370 reverse video:\ :r3=\E[32h\E[?5h:tc=wy370: # # Wyse 99gt Tektronix 4010/4014 emulator, # wy99gt-tek|Wyse 99gt Tektronix 4010/4014 emulator:\ :am:os:\ :co#74:li#35:\ :bl=^G:cl=\E^L:\ :..cm=\035%{3040}%{89}%p1%*%-%Py\n%p2%{55}%*%Px\n%gy%{128}%/%{31}%&%{32}%+%c\n%gy%{3}%&%{4}%*%gx%{3}%&%+%{96}%+%c\n%gy%{004}%/%{31}%&%{96}%+%c\n%gx%{128}%/%{31}%&%{32}%+%c\n%gx%{004}%/%{31}%&%{64}%+%c\037:\ :cr=^M:do=^J:ff=^L:\ :hd=\036HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH\037:\ :ho=^]7`x @\037:\ :hu=\036DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\037:\ :is=\E8:le=^H:nd= :nw=^M^J:u0=\E~>\E8:u1=\E[42h:up=^K: # # Wyse 160 Tektronix 4010/4014 emulator, # wy160-tek|Wyse 160 Tektronix 4010/4014 emulator:\ :..cm=\035%{3103}%{91}%p1%*%-%Py\n%p2%{55}%*%Px\n%gy%{128}%/%{31}%&%{32}%+%c\n%gy%{3}%&%{4}%*%gx%{3}%&%+%{96}%+%c\n%gy%{004}%/%{31}%&%{96}%+%c\n%gx%{128}%/%{31}%&%{32}%+%c\n%gx%{004}%/%{31}%&%{64}%+%c\037:\ :ho=^]8`g @\037:\ :tc=wy99gt-tek: # # Wyse 370 Tektronix 4010/4014 emulator, # wy370-tek|Wyse 370 Tektronix 4010/4014 emulator:\ :am:os:\ :co#80:li#36:\ :bl=^G:cl=\E^L:\ :..cm=\035%{775}%{108}%p1%*%{5}%/%-%Py\n%p2%{64}%*%{4}%+%{5}%/%Px\n%gy%{32}%/%{31}%&%{32}%+%c\n%gy%{31}%&%{96}%+%c\n%gx%{32}%/%{31}%&%{32}%+%c\n%gx%{31}%&%{64}%+%c\037:\ :cr=^M:do=^J:ff=^L:\ :hd=\036HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH\037:\ :ho=^]8g @\037:\ :hu=\036DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\037:\ :is=\E8:kb=^H:kd=^J:kl=^H:kr=^I:ku=^K:le=^H:nd= :nw=^M^J:\ :u0=\E[?38h\E8:u1=\E[?38l:up=^K: # Vendor-supplied Wyse entries end here. # #TITLE: TERMINFO ENTRY WY520 #DATE: 8/5/93 # The WY520 terminfo is based on the WY285 entry published on the WYSE # BBS with the addition of more function keys and special keys. # # rs1 -> set personality # rs2 -> set number of columns # rs3 -> set number of lines # is1 -> select the proper font # is2 -> do the initialization # is3 -> If this string is empty then rs3 gets sent. # # Wyse 520 emulating a vt420 7 bit mode with default ANSI keyboard # - The BS key is programmed to generate BS in smcup since # is2 doesn't seem to work. # - Remove and shift/Remove: delete a character # - Insert : enter insert mode # - Find : delete to end of file # - Select : clear a line # - F11, F12, F13: send default sequences (not ESC, BS, LF) # - F14 : Home key # - Bottom status line (host writable line) is used. # - smkx,rmkx are removed because this would put the numeric # keypad in Dec application mode which doesn't seem to work # with SCO applications. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy520|wyse520|wyse 520:\ :am:hs:km:mi:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOy:K3=\EOu:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ds=\E[0$~:\ :ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:i1=\E[?5W:\ :i2=\E>\E(B\017\E[m:im=\E[4h:ip=:\ :is=\E[2;4;20;30l\E[?1;4;10;16l\E[12h\E[?7;8;25;67h:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kh=\E[26~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :rc=\E8:sc=\E7:se=\E[m:sf=\n:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :te=\E[ R:ti=\E[ Q\E[?67;8h:ts=\E[2$~\E[1$}\E[%i%p1%d`:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[34h\E[?25h:vi=\E[?25l:\ :vs=\E[?25h\E[34l: # # Wyse 520 with 24 data lines and status (terminal status) wy520-24|wyse520-24|wyse 520 with 24 data lines:\ :hs@:\ :ds@:fs@:r3=\E[?5l\E[47h\E[40l\E[1;24r:ts@:tc=wy520: # # Wyse 520 with visual bell. wy520-vb|wyse520-vb|wyse 520 with visible bell:\ :vb=\E[30h\E\\054\E[30l:tc=wy520: # # Wyse 520 in 132-column mode. wy520-w|wyse520-w|wyse 520 in 132-column mode:\ :co#132:ws#132:\ :DC=\E[%dP:IC=\E[%d@:dc=\E[P:ei=:im=:ip=:r2=\E[35h\E[?3h:tc=wy520: # # Wyse 520 in 132-column mode with visual bell. wy520-wvb|wyse520-wvb|wyse 520 with visible bell 132-columns:\ :vb=\E[30h\E\\054\E[30l:\ :tc=wy520-w: # # # Wyse 520 emulating a vt420 7 bit mode. # The DEL key is programmed to generate BS in is2. # With EPC keyboard. # - 'End' key will clear till end of line on EPC keyboard # - Shift/End : ignored. # - Insert : enter insert mode. # - Delete : delete a character (have to change interrupt character # to CTRL-C: stty intr '^c') for it to work since the # Delete key sends 7FH. wy520-epc|wyse520-epc|wyse 520 with EPC kb:\ :@7=\E[4~:k0=\E[21~:k1=\E[11~:k2=\E[12~:k3=\E[13~:\ :k4=\E[14~:k5=\E[15~:kD=\177:kE=\E[4~:kh=\E[H:\ :tc=wy520: # # Wyse 520 with 24 data lines and status (terminal status) # with EPC keyboard. wy520-epc-24|wyse520-pc-24|wyse 520 with 24 data lines:\ :hs@:\ :ds@:fs@:r3=\E[?5l\E[47h\E[40l\E[1;24r:ts@:tc=wy520-epc: # # Wyse 520 with visual bell. wy520-epc-vb|wyse520-pc-vb|wyse 520 with visible bell:\ :vb=\E[30h\E\\054\E[30l:\ :tc=wy520-epc: # # Wyse 520 in 132-column mode. wy520-epc-w|wyse520-epc-w|wyse 520 in 132-column mode:\ :co#132:ws#132:\ :DC=\E[%dP:IC=\E[%d@:dc=\E[P:ei=:im=:ip=:r2=\E[35h\E[?3h:tc=wy520-epc: # # Wyse 520 in 132-column mode with visual bell. wy520-epc-wvb|wyse520-p-wvb|wyse 520 with visible bell 132-columns:\ :vb=\E[30h\E\\054\E[30l:\ :tc=wy520-epc-w: # # Wyse 520 in 80-column, 36 lines wy520-36|wyse520-36|wyse 520 with 36 data lines:\ :hs@:\ :li#36:\ :ds@:fs@:r3=\E[?5l\E[36*|\E[36t\E[40l\E[1;36r:ts@:tc=wy520: # # Wyse 520 in 80-column, 48 lines wy520-48|wyse520-48|wyse 520 with 48 data lines:\ :hs@:\ :li#48:\ :ds@:fs@:r3=\E[?5l\E[48*|\E[48t\E[40l\E[1;48r:ts@:tc=wy520: # # Wyse 520 in 132-column, 36 lines wy520-36w|wyse520-36w|wyse 520 with 36 data lines:\ :co#132:ws#132:\ :r2=\E[?3h:\ :r3=\E[?5l\E[36*|\E[36t\E[40l\E[1;36r\E[132$|:tc=wy520-36: # # Wyse 520 in 132-column, 48 lines wy520-48w|wyse520-48w|wyse 520 with 48 data lines:\ :co#132:ws#132:\ :r2=\E[?3h:\ :r3=\E[?5l\E[48*|\E[48t\E[40l\E[1;48r\E[132$|:tc=wy520-48: # # # Wyse 520 in 80-column, 36 lines with EPC keyboard wy520-36pc|wyse520-36pc|wyse 520 with 36 data lines:\ :hs@:\ :li#36:\ :ds@:fs@:r3=\E[?5l\E[36*|\E[36t\E[40l\E[1;36r:ts@:tc=wy520-epc: # # Wyse 520 in 80-column, 48 lines with EPC keyboard wy520-48pc|wyse520-48pc|wyse 520 with 48 data lines:\ :hs@:\ :li#48:\ :ds@:fs@:r3=\E[?5l\E[48*|\E[48t\E[40l\E[1;48r:ts@:tc=wy520-epc: # # Wyse 520 in 132-column, 36 lines with EPC keyboard wy520-36wpc|wyse520-36wpc|wyse 520 with 36 data lines:\ :co#132:ws#132:\ :r2=\E[?3h:\ :r3=\E[?5l\E[36*|\E[36t\E[40l\E[1;36r\E[132$|:tc=wy520-36pc: # # Wyse 520 in 132-column, 48 lines with EPC keyboard wy520-48wpc|wyse520-48wpc|wyse 520 with 48 data lines:\ :co#132:ws#132:\ :r2=\E[?3h:\ :r3=\E[?5l\E[48*|\E[48t\E[40l\E[1;48r\E[132$|:tc=wy520-48pc: # From: John Gilmore # (wyse-vp: removed :if=/usr/share/tabset/wyse-adds:, there's no such # file and we don't know what :st: is -- esr) wyse-vp|wyse|Wyse 50 in ADDS Viewpoint emulation mode with "enhance" on:\ :am:bs:\ :co#80:it#8:li#24:\ :al=\EM:bl=^G:cd=\Ek:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:dc=\EW:\ :dl=\El:do=^J:ei=\Er:ho=^A:im=\Eq:is=\E`\072\E`9\017\Er:\ :kb=^H:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:le=^H:ll=^A^Z:me=^O:\ :nd=^F:nw=^M^J:r1=\E`\072\E`9\017\Er:se=^O:sf=^J:so=^N:\ :ta=^I:ue=^O:up=^Z:us=^N: wy75ap|wyse75ap|wy-75ap|wyse-75ap|Wyse WY-75 Applications and Cursor keypad:\ :is=\E[1;24r\E[?10;3l\E[?1;25h\E[4l\E[m\E(B\E=:kb=^H:\ :kd=\EOB:ke=10\E[?1l\E>:kh=\EOH:kl=\EOD:kr=\EOC:\ :ks=10\E[?1h\E=:ku=\EOA:tc=wy75: # From: Eric Freudenthal wy100q|Wyse 100 for Quotron:\ :bs:\ :co#80:li#24:sg#1:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :dc=\EW:\ :dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:\ :is=\E`\072\200\EC\EDF\E0\E'\E(\EA21:kd=^J:kl=^H:kr=^L:\ :ku=^K:le=^H:mk@:nd=^L:sr=\Ej:up=^K:\ :tc=adm+sgr: #### Kermit terminal emulations # # Obsolete Kermit versions may be listed in the section describing obsolete # non-ANSI terminal emulators later in the file. # # KERMIT standard all versions. # Straight ascii keyboard. :sr=\EI: not avail. many versions + bug prone in vi. # (kermit: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" -- esr) # From: greg small 9-25-84 kermit|standard kermit:\ :bs:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :ho=\EH:\ :is=K0 Standard Kermit 9-25-84\n:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=\EC:up=\EA: kermit-am|standard kermit plus auto-margin:\ :am:\ :is=K1 Standard Kermit plus Automatic Margins\n:tc=kermit: # IBMPC Kermit 1.2. # Bugs: :cd:, :ce:: do not work except at beginning of line! :cl: does # not work, but fake with :cl=\EH\EJ (since :cd=\EJ: works at beginning of # line). # From: greg small 8-30-84 pckermit|pckermit12|UCB IBMPC Kermit 1.2:\ :am:\ :li#25:\ :cd@:ce@:cl=\EH\EJ:\ :is=K2 UCB IBMPC Kermit 1.2 8-30-84\n:tc=kermit: # IBMPC Kermit 1.20 # Cannot use line 25, now acts funny like ansi special scrolling region. # Initialization must escape from that region by cursor position to line 24. # Cannot use character insert because 1.20 goes crazy if insert at col 80. # Does not use :am: because autowrap is lost when kermit dropped and restarted. # From: greg small 12-19-84 pckermit120|UCB IBMPC Kermit 1.20:\ :it#8:li#24:\ :al=\EL:dc=\EN:dl=\EM:do=\EB:ei@:im@:\ :is=\EO\Eq\EJ\EY7 K3 UCB IBMPC Kermit 1.20 12-19-84\n:\ :se=\Eq:so=\Ep:ta=^I:vs=\EO\Eq\EEK3:\ :tc=kermit: # MS-DOS Kermit 2.27 for the IBMPC # Straight ascii keyboard. :sr=\EI: not avail. many versions + bug prone in vi. # Cannot use line 25, now acts funny like ansi special scrolling region. # Initialization must escape from that region by cursor position to line 24. # Does not use am: because autowrap is lost when kermit dropped and restarted. # Reverse video for standout like H19. # (msk227: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" -- esr) # From: greg small 3-17-85 msk227|mskermit227|MS-DOS Kermit 2.27 for the IBMPC:\ :am@:bs:\ :co#80:it#8:li#24:\ :al=\EL:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :dc=\EN:dl=\EM:\ :do=\EB:ei=\EO:ho=\EH:im=\E@:\ :is=\EO\Eq\EG\Ew\EJ\EY7 K4 MS Kermit 2.27 for the IBMPC 3-17-85\n:\ :kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=\EC:rc=\Ek:sc=\Ej:\ :se=\Eq:so=\Ep:ta=^I:up=\EA:vs=\EO\Eq\EG\EwK4: # MS-DOS Kermit 2.27 with automatic margins # From: greg small 3-17-85 msk227am|mskermit227am|UCB MS-DOS Kermit 2.27 with automatic margins:\ :am:\ :is=\EO\Eq\EG\Ev\EJ\EY7 K5 MS Kermit 2.27 +automatic margins 3-17-85\n:\ :vs=\EO\Eq\EG\EvK5:\ :tc=msk227: # MS-DOS Kermit 2.27 UCB 227.14 for the IBM PC # Automatic margins now default. Use ansi :sa: for highlights. # Define function keys. # (msk22714: removed obsolete ":kn#10:" -- esr) # From: greg small 3-17-85 msk22714|mskermit22714|UCB MS-DOS Kermit 2.27 UCB 227.14 IBM PC:\ :am:\ :is=\EO\Eq\EG\Ev\EJ\EY7 K6 MS Kermit 2.27 UCB 227.14 IBM PC 3-17-85\n:\ :k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:\ :k8=\E8:k9=\E9:md=\E[1m:me=\E[m:mr=\E[7m:se=\E[m:so=\E[1m:\ :ue=\E[m:us=\E[4m:vs=\EO\Eq\EG\EvK6:\ :tc=mskermit227: # This was designed for a VT320 emulator, but it is probably a good start # at support for the VT320 itself. # Please send changes with explanations to bug-gnu-emacs@prep.ai.mit.edu. # (vt320-k3: I added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt320-k3|MS-Kermit 3.00's vt320 emulation:\ :am:es:hs:km:mi:ms:xn:\ :co#80:it#8:li#49:pb#9600:vt#3:\ :AL=\E[%dL:CC=\E:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SR=\E[%dL:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[0$~:ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E F\E[?1l\E[?7h\E[r\E[2$~:k0=\E[21~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:\ :sc=\E7:se=\E[27m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\r\E[K:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l\E[?5h\E[?5l\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: # From: Joseph Gil 13 Dec 1991 # ACS capabilities from Philippe De Muyter 30 May 1996 # (I removed a bogus boolean :mo: and added :ms:, , -- esr) vt320-k311|dec vt320 series as defined by kermit 3.11:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=3\E[L:as=^N:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: ######## NON-ANSI TERMINAL EMULATIONS # #### Avatar # # These entries attempt to describe Avatar, a terminal emulation used with # MS-DOS bulletin-board systems. It was designed to give ANSI-like # capabilities, but with cheaper (shorter) control sequences. Messy design, # excessively dependent on PC idiosyncracies, but apparently rather popular # in the BBS world. # # No color support. Avatar doesn't fit either of the Tektronix or HP color # models that terminfo knows about. An Avatar color attribute is the # low 7 bits of the IBM-PC display-memory attribute. Bletch. # # I wrote these entries while looking at the Avatar spec. I don't have # the facilities to test them. Let me know if they work, or don't. # # From: Eric S. Raymond 1 Nov 1995 # (The :mb:/:md:/:mr:/:as:/:us:/:so: capabilities exist only to # tell ncurses that the corresponding highlights exist; it should use :sa:, # which is the only method that will actually work for multiple highlights.) avatar0|avatar terminal emulator level 0:\ :am:ms:ut:\ :co#80:it#8:li#25:\ :as=:ce=^V^G:cm=\026\010%.%.:cr=^M:do=^V^D:le=^V^E:\ :mb=^A^V\177:md=^V^A^P:me=^V^A^G:mk=^V^A\200:mr=^A^Vp:\ :nd=^V^F:r2=^L:rp=\031%.%d:\ :..sa=\026\001%{0}%?%p1%t%{112}%|%;%?%p2%t%{1}%|%;%?%p3%t%{112}%|%;%?%p4%t{128}%|%;%?%p6%t%{16}%|%;:\ :sf=^J:so=^A^Vp:up=^V^C:us=^V^A:\ :tc=klone+acs: # From: Eric S. Raymond 1 Nov 1995 avatar0+|avatar terminal emulator level 0+:\ :dc=^V^N:ei=\026\n\200\200\200\200:im=^V^I:tc=avatar0: # From: Eric S. Raymond 1 Nov 1995 avatar|avatar1|avatar terminal emulator level 1:\ :RA=^V":SA=^V$:al=^V+:dl=^V-:ei=^V^P:ve=^V'^A:vi=^V'^B:\ :vs=^V^C:\ :tc=avatar0+: #### RBcomm # # RBComm is a lean and mean terminal emulator written by the Interrupt List # mantainer, Ralf Brown. It was fairly popular in the late DOS years (early # '90s), especially in the BBS world, and still has some loyal users due to # its very small memory footprint and to a cute macro language. rbcomm|IBM PC with RBcomm and EMACS keybindings:\ :am:bw:mi:ms:xn:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DL=\E[%dM:al=^K:bl=^G:bt=\E[Z:cd=^F5:ce=^P^P:\ :cl=^L:cm=\037%r%+ %+ :cr=^M:cs=\E[%i%d;%dr:dc=^W:dl=^Z:\ :dm=:do=^C:ec=\E[%dX:ed=:ei=^]:im=^\:\ :is=\017\035\E(B\E[?7h\E[?3l\E[>8g:kb=^H:kd=^N:\ :ke=\E>:kh=^A:kl=^B:kr=^F:ks=\E=:ku=^P:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mk=\E[8m:mr=^R:nd=^B:nw=^M\ED:\ :r1=\017\E(B\025\E[?3l\E[>8g:rc=\E8:rp=\030%.%.:\ :sc=\E7:se=^U:sf=\ED:so=^R:sr=\EM:ta=^I:te=:ti=:ue=^U:up=^^:\ :us=^T:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: rbcomm-nam|IBM PC with RBcomm, no autowrap:\ :am@:\ :bl=^G:cr=^M:do=^J:\ :is=\017\035\E(B\E[?7l\E[?3l\E[>8g:kb=^H:kd=^J:\ :kl=^H:nw=^M^J:sf=^J:ta=^I:\ :tc=rbcomm: rbcomm-w|IBM PC with RBcomm, 132 column mode:\ :co#132:\ :bl=^G:cr=^M:do=^J:\ :is=\017\035\E(B\E[?7h\E[?3h\E[>8g:kb=^H:kd=^J:\ :kl=^H:nw=^M^J:sf=^J:ta=^I:\ :tc=rbcomm: ######## OLDER TERMINAL TYPES # # This section is devoted to older commercial terminal brands that are now # discontinued, but known to be still in use or represented by emulations. # #### AT&T (att, tty) # # This section also includes Teletype-branded VDTs. # # The AT&T/Teletype terminals group was sold to SunRiver Data Systems (now # Boundless Technologies); for details, see the header comment on the ADDS # section. # # These are AT&T's official terminfo entries. All-caps aliases have been # removed. # att2300|sv80|AT&T 2300 Video Information Terminal 80 column mode:\ :am:eo:mi:ms:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[11r:\ :F2=\E[12r:F3=\E[13r:F4=\E[14r:F5=\E[15r:F6=\E[16r:\ :IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:im=\E[4h:\ :k1=\E[1r:k2=\E[2r:k3=\E[3r:k4=\E[4r:k5=\E[5r:k6=\E[6r:\ :k7=\E[7r:k8=\E[8r:k9=\E[9r:k;=\E[10r:kA=\E[L:kB=\E[Z:\ :kC=\E[J:kD=\E[P:kI=\E[@:kL=\E[M:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:mr=\E[7m:nd=\E[C:\ :pf=\E[4i:po=\E[5i:ps=\E[0i:se=\E[m:sf=^J:so=\E[7m:ta=^I:\ :up=\E[A: att2350|AT&T 2350 Video Information Terminal 80 column mode:\ :pf@:po@:ps@:\ :tc=att2300: # Must setup RETURN KEY - CR, REC'VD LF - INDEX. # Seems upward compatible with vt100, plus ins/del line/char. # On sgr, the protection parameter is ignored. # No check is made to make sure that only 3 parameters are output. # standout= reverse + half-intensity = 3 | 5. # bold= reverse + underline = 2 | 3. # note that half-bright blinking doesn't look different from normal blinking. # NOTE:you must program the function keys first, label second! # (att4410: a BSD entry has been seen with the following capabilities: # :is=\E[?6l:, :k1=\EOc:, :k2=\EOd:, :k3=\EOe:, :k4=\EOg:, # :k6=\EOh:, :k7=\EOi:, :k8=\EOj:, -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) att5410v1|att4410v1|tty5410v1|AT&T 4410/5410 80 columns - version 1:\ :am:hs:mi:ms:xo:\ :Nl#8:co#80:it#8:lh#2:li#24:lw#8:ws#80:\ :ac=``aaffhhggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~00++--\054\054..:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=:fs=\E8:ho=\E[H:i1=\E[?3l:\ :i2=\E[1;03q f1 \EOP\E[2;03q f2 \EOQ\E[3;03q f3 \EOR\E[4;03q f4 \EOS\E[5;03q f5 \EOT\E[6;03q f6 \EOU\E[7;03q f7 \EOV\E[8;03q f8 \EOW:\ :ic=\E[@:im=:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOT:\ :k6=\EOU:k7=\EOV:k8=\EOW:kC=\E[2J:kH=\E[24;1H:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[2;7m:me=\E[m\017:mh=\E[2m:mk=\E[8m:\ :mr=\E[7m:nd=\E[C:nw=^M^J:r2=\Ec\E[?3l\E[2;0y:rc=\E8:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :ts=\E7\E[25;%p1%{1}%+%dH:ue=\E[m:up=\E[A:us=\E[4m: att4410v1-w|att5410v1-w|tty5410v1-w|AT&T 4410/5410 132 columns - version 1:\ :co#132:ws#132:\ :i1=\E[?3h:r2=\Ec\E[?3h\E[2;0y:tc=att5410v1: att4410|att5410|tty5410|AT&T 4410/5410 80 columns - version 2:\ :bs:\ :..px=\E[%p1%d;%p2%l%02dq f%p1%d %p2%s:tc=att5410v1: att5410-w|att4410-w|4410-w|tty5410-w|5410-w|AT&T 4410/5410 in 132 column mode:\ :co#132:ws#132:\ :i1=\E[?3h:r2=\Ec\E[?3h\E[2;0y:tc=att4410: # 5410 in terms of a vt100 # (v5410: added / based on init string -- esr) v5410|att5410 in terms of a vt100:\ :am:mi:ms:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:RA=\E[?7l:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E(B:ei=:ho=\E[H:\ :ic=\E[@:im=:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:kb=^H:\ :kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # # Teletype Model 5420 -- A souped up 5410, with multiple windows, # even! the 5420 has three modes: scroll, window or page mode # this terminfo should work in scroll or window mode, but doesn't # take advantage of any of the differences between them. # # Has memory below (2 lines!) # 3 pages of memory (plus some spare) # The 5410 sequences for :cm:, :vs:, :DC:, :DL:, :ec:, :vb:, :ho:, # , :st: would work for these, but these work in both scroll and window # mode... Unset insert character so insert mode works # :i1: sets 80 column mode, # :is: escape sequence: # 1) turn off all fonts # 2) function keys off, keyboard lock off, control display off, # insert mode off, erasure mode off, # 3) full duplex, monitor mode off, send graphics off, nl on lf off # 4) reset origin mode # 5) set line wraparound # 6) exit erasure mode, positional attribute mode, and erasure extent mode # 7) clear margins # 8) program ENTER to transmit ^J, # We use \212 to program the ^J because a bare ^J will get translated by # UNIX into a CR/LF. The enter key is needed for AT&T uOMS. # 1 2 3 4 5 6 7 8 # :i3: set screen color to black, # No representation in terminfo for the delete word key: kdw1=\Ed # Key capabilities assume the power-up send sequence... # This :te: is not strictly necessary, but it helps maximize # memory usefulness: :te=\Ez:, # Alternate sgr0: :me=\E[m\EW^O:, # Alternate sgr: :sa=\E[%?%p1%t2;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p5%t;2%;%?%p7%t;8%;m%?%p8%t\EV%;%?%p9%t^N%e^O%;:, # smkx programs the SYS PF keys to send a set sequence. # It also sets up labels f1, f2, ..., f8, and sends edit keys. # This string causes them to send the strings :k1:-:k8: # when pressed in SYS PF mode. # (att4415: I added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) att4415|tty5420|att5420|AT&T 4415/5420 80 cols:\ :bs:db:mi:xo:\ :Nl#8:lh#2:lm#78:lw#8:ws#55:\ :@1=\Et:@7=\Ez:@8=\Eent:AL=\E[%dL:CM=\E[%i%p1%d;%p2%dt:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:LF=\E|:\ :LO=\E~:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dE:SR=\E[%dF:\ :UP=\E[%dA:bt=\E[Z:ch=\E[%+^AG:cl=\E[x\E[J:\ :cm=\E[%i%d;%dx:ct=\E[3g:cv=\E[%+^Ad:ec=\E[%ds\E[%dD:\ :ei=\E[4l:ho=\E[x:i1=\E[?3l:i2=\E[?5l:ic@:im=\E[4h:\ :is=\E[m\017\E[1;2;3;4;6l\E[12;13;14;20l\E[?6;97;99l\E[?7h\E[4i\Ex\E[21;1j\212:\ :k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:\ :k8=\EOj:kA=\E[L:kB=\E[Z:kD=\E[P:kE=\E[2K:kF=\E[T:kH=\Eu:\ :kI=\E[4h:kL=\E[M:kN=\E[U:kP=\E[V:kR=\E[S:\ :ke=\E[19;0j\E[21;1j\212:ks=\E[19;1j\E[21;4j\Eent:\ :l1=F1:l2=F2:l3=F3:l4=F4:l5=F5:l6=F6:l7=F7:l8=F8:ll=\Ew:\ :me=\E[m\017:mp=\EV:pf=\E[?9i:po=\E[?4i:ps=\E[?2i:st=\EH:\ :ts=\E7\E[25;%p1%{8}%+%dH:vb=\E[?5h\E[?5l:ve=\E[11;0j:\ :vs=\E[11;1j:\ :tc=att4410: att4415-w|tty5420-w|att5420-w|AT&T 4415/5420 132 cols:\ :co#132:lm#54:ws#97:\ :i1=\E[?3h:tc=att4415: att4415-rv|tty5420-rv|att5420-rv|AT&T 4415/5420 80 cols/rv:\ :i2=\E[?5h:vb=\E[?5l\E[?5h:\ :tc=att4415: att4415-w-rv|tty5420-w-rv|att5420-w-rv|AT&T 4415/5420 132 cols/rv:\ :co#132:lm#54:ws#97:\ :i1=\E[?3h:i2=\E[?5h:vb=\E[?5l\E[?5h:tc=att4415: # Note that this mode permits programming USER PF KEYS and labels # However, when you program user pf labels you have to reselect # user pf keys to make them appear! att4415+nl|tty5420+nl|att5420+nl|generic AT&T 4415/5420 changes for not changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :..pn=\E[%p1%d;0;0;1q%p2%:-16.16s:\ :..px=\E[%p1%d;%p2%l%02d;0;1q F%p1%d %p2%s: att4415-nl|tty5420-nl|att5420-nl|AT&T 4415/5420 without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :tc=att4415+nl:tc=att4415: att4415-rv-nl|tty5420-rv-nl|att5420-rv-nl|AT&T 4415/5420 reverse video without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :tc=att4415+nl:tc=att4415-rv: att4415-w-nl|tty5420-w-nl|att5420-w-nl|AT&T 4415/5420 132 cols without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :tc=att4415+nl:tc=att4415-w: att4415-w-rv-n|tty5420-w-rv-n|att5420-w-rv-n|AT&T 4415/5420 132 cols reverse without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :tc=att4415+nl:tc=att4415-w-rv: # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att5420_2|AT&T 5420 model 2 80 cols:\ :am:db:hs:mi:ms:xo:\ :co#80:it#8:li#24:lm#78:ws#55:\ :AL=\E[%dL:CM=\E[%i%p1%d;%p2%dt:DC=\E[%dP:DL=\E[%dM:\ :IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:SF=\E[%dE:SR=\E[%dF:\ :UP=\E[%dA:ae=^O:al=\E[L:as=^N:bt=\E[1Z:cd=\E[0J:ce=\E[0K:\ :cl=\EH\EJ:cm=\E[%i%d;%dH:cr=\EG:cs=\E[%i%d;%dr:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=\E[1B:ec=\E[%ds\E[%dD:ei=:fs=\E8:\ :ho=\E[H:\ :i1=\E[0;23r\Ex\Ey\E[2;0j\E[3;3j\E[4;0j\E[5;0j\E[6;0j\E[7;0j\E[8;0j\E[9;1j\E[10;0j\E[15;0j\E[16;1j\E[19;0j\E[20;1j\E[29;0j\E[1;24r:\ :ic=\E[@:im=:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:\ :k6=\EOh:k7=\EOi:k8=\EOj:kD=\E[P:kH=\Eu:kI=\E[4h:kN=\E[U:\ :kP=\E[V:kb=^H:kd=\E[B:ke=\E[19;0j:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[19;1j:ku=\E[A:le=^H:ll=\Ew:mb=\E[5m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[1C:nw=^M^J:rc=\E8:sc=\E7:se=\E[m:\ :sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E7\E[25;%p1%{8}%+%dH:ue=\E[m:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[11;0j:vs=\E[11;1j: att5420_2-w|AT&T 5420 model 2 in 132 column mode:\ :co#132:\ :i1=\E[0;23r\Ex\Ey\E[2;0j\E[3;3j\E[4;0j\E[5;1j\E[6;0j\E[7;0j\E[8;0j\E[9;1j\E[10;0j\E[15;0j\E[16;1j\E[19;0j\E[20;1j\E[29;0j\E[1;24r:tc=att5420_2: att4418|att5418|AT&T 5418 80 cols:\ :am:xo:\ :co#80:li#24:\ :@8=\E[:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[n:\ :F2=\E[o:F3=\E[H:F4=\E[I:F5=\E[J:F8=\E[K:F9=\E[L:FA=\E[E:\ :FB=\E[_:FC=\E[M:FD=\E[N:FE=\E[O:IC=\E[%d@:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[1L:as=\E(0:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[1P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :i1=\E[?3l:ic=\E[1@:im=:is=\E?6l\E?5l:k1=\E[h:k2=\E[i:\ :k3=\E[j:k6=\E[k:k7=\E[l:k8=\E[f:k9=\E[w:k;=\E[m:kC=\E[%:\ :kd=\EU:kh=\Ec:kl=\E@:kr=\EA:ku=\ES:le=\E[D:mb=\E[5m:\ :me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:\ :se=\E[m:sf=^J:so=\E[7m:ue=\E[m:up=\E[A:us=\E[4m: att4418-w|att5418-w|AT&T 5418 132 cols:\ :co#132:\ :i1=\E[?3h:tc=att5418: att4420|tty4420|teletype 4420:\ :bs:da:db:eo:ms:ul:xo:\ :co#80:li#24:lm#72:\ :al=\EL:bl=^G:cd=\EJ:ce=\Ez:cl=\EH\EJ:cm=\EY%+ %+ :cr=\EG:\ :dc=\EP:dl=\EM:dm@:do=\EB:ed@:ho=\EH:k0=\EU:k3=\E@:kA=\EL:\ :kB=\EO:kC=\EJ:kD=\EP:kF=\ES:kI=\E\136:kL=\EM:kR=\ET:kd=\EB:\ :kh=\EH:kl=^H:kr=\EC:ku=\EA:l0=segment advance:\ :l3=cursor tab:le=\ED:nd=\EC:se=\E~:sf=\EH\EM\EY7 :so=\E}:\ :ue=\EZ:up=\EA:us=\E\: # The following is a terminfo entry for the Teletype 4424 # asynchronous keyboard-display terminal. It supports # the vi editor. The terminal must be set up as follows, # # HIGHLIGHT DEFINITION 3-TONE # DISPLAY FUNCTION GROUP III # # The second entry below provides limited (a la adm3a) # operation under GROUP II. # # This must be used with DISPLAY FUNCTION GROUP I or III # and HIGHLIGHT DEFINITION 3-TONE # The terminal has either bold or blink, depending on options # # (att4424: commented out :ti:=\E[1m, we don't need bright locked on -- esr) att4424|tty4424|teletype 4424:\ :am:bs:xo:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\EL:as=\E(0:bl=^G:bt=\EO:cd=\EJ:ce=\Ez:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\EF:\ :dc=\EP:dl=\EM:do=\EB:ei=:ho=\E[H:ic=\E\136:im=:\ :is=\E[20l\E[?7h:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kC=\EJ:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E3:\ :md=\E3:me=\EX\E~\EZ\E4\E(B:mh=\EW:mr=\E}:nd=\EC:nw=\EE:\ :..sa=\E[%?%p1%t7%;%?%p2%t;4%;%?%p3%t;7%;%?%p6%t;1%;%?%p6%p4%|%t;5%;%?%p5%t;0%;m:\ :se=\E~:sf=^J:so=\E}:sr=\ET:st=\EH:ta=^I:ue=\EZ:up=\EA:\ :us=\E\: att4424-1|tty4424-1|teletype 4424 in display function group I:\ :kC@:kd=\EB:kh@:kl=\ED:kr=\EC:ku=\EA:\ :tc=att4424: # This entry is not one of AT&T's official ones, it was translated from the # 4.4BSD termcap file. The highlight strings are different from att4424. # I have no idea why this is -- older firmware version, maybe? # The following two lines are the comment originally attached to the entry: # This entry appears to avoid the top line - I have no idea why. # From: jwb Wed Mar 31 13:25:09 1982 remote from ihuxp att4424m|tty4424m|teletype 4424M:\ :am:da:db:mi:\ :co#80:it#8:li#23:\ :al=\EL:bl=^G:ce=\E[K:cl=\E[2;H\E[J:cm=\E[%i%2;%2H\E[B:\ :cr=^M:dc=\EP:dl=\EM:do=^J:ei=:ic=\E\136:im=:ip=2:\ :is=\E[m\E[2;24r:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:\ :nd=\E[C:nw=^M^J:se=\E[m:sf=^J:so=\E[7m:sr=\ET:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # The Teletype 5425 is really version 2 of the Teletype 5420. It # is quite similar, except for some minor differences. No page # mode, for example, so all of the :cm: sequences used above have # to change back to what's being used for the 5410. Many of the # option settings have changed their numbering as well. # # This has been tested on a preliminary model. # # (att5425: added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att5425|tty5425|att4425|AT&T 4425/5425:\ :am:da:db:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:lm#78:ws#55:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dE:SR=\E[%dF:UP=\E[%dA:ae=^O:\ :al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ec=\E[%ds\E[%dD:ei=\E[4l:fs=\E8:ho=\E[H:\ :i1=\E<\E[?3l:i2=\E[?5l:im=\E[4h:\ :is=\E[m\017\E[1;2;3;4;6l\E[12;13;14;20l\E[?6;97;99l\E[?7h\E[4i\Ex\E[25;1j\212:\ :k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:\ :k8=\EOj:kD=\E[P:kI=\E[4h:kb=^H:kd=\E[B:\ :ke=\E[21;0j\E[25;1j\212:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[21;1j\E[25;4j\Eent\E~:ku=\E[A:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[2;7m:me=\E[m\017:mh=\E[2m:mr=\E[7m:\ :nd=\E[C:nw=^M^J:rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:\ :sr=\EM:st=\EH:ta=^I:ts=\E7\E[25;%p1%{8}%+%dH:ue=\E[m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[12;0j:\ :vs=\E[12;1j: att5425-nl|tty5425-nl|att4425-nl|AT&T 4425/5425 80 columns no labels:\ :ks=\E[21;1j\E[25;4j\Eent:\ :tc=att4425: att5425-w|att4425-w|tty5425-w|teletype 4425/5425 in 132 column mode:\ :co#132:lm#54:ws#97:\ :i1=\E[?3h:tc=tty5425: # (att4426: his had bogus capabilities: :ri=\EM:, :ri=\E[1U:. # I also added / -- esr) att4426|tty4426|teletype 4426S:\ :am:da:db:xo:\ :co#80:li#24:lm#48:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\EL:as=\E(0:bl=^G:cd=\E[J:ce=\E[0K:ch=\E[%dG:\ :cl=\E[H\E[2J\E[1U\E[H\E[2J\E[1V:cm=\E[%i%d;%dH:cr=^M:\ :ct=\E[3g:cv=\E[%dd:dc=\EP:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :i1=\Ec\E[?7h:ic=\E\136:im=:is=\E[m\E[1;24r:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOT:k6=\EOU:k7=\EOV:k8=\EOW:\ :kB=\EO:kC=\E[2J:kH=\E[24;1H:kb=^H:kd=\EB:kh=\E[H:kl=\ED:\ :kr=\EC:ku=\EA:le=\E[D:ll=\E[24H:md=\E[5m:me=\E[m\E(B:\ :mr=\E[7m:nd=\E[C:nw=^M^J:r2=\Ec\E[?3l\E[2;0y:rc=\E8:\ :sc=\E7:se=\E[m:sf=^J:so=\E[5m:sr=\ET:st=\E1:ta=^I:ue=\E[m:\ :up=\EA:us=\E[4m: # Terminfo entry for the AT&T 510 A Personal Terminal # Function keys 9 - 16 are available only after the # screen labeled (soft keys/action blocks) are labeled. Function key # 9 corresponds to the leftmost touch target on the screen, # function key 16 corresponds to the rightmost. # # This entry is based on one done by Ernie Rice at Summit, NJ and # changed by Anne Gallup, Skokie, IL, ttrdc!anne # (untranslatable capabilities removed to fit entry within 1023 bytes) att510a|bct510a|AT&T 510A Personal Terminal:\ :am:mi:ms:xn:xo:\ :Nl#8:co#80:lh#2:li#24:lw#7:\ :#4=\E[u:%i=\E[v:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:\ :F1=\EOe:F2=\EOf:F3=\EOg:F4=\EOh:F5=\EOi:F6=\EOj:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:\ :ac=hrisjjkkllmmnnqqttuuvvwwxx{{||}}~~-f\054h.e+g`b:\ :ae=\E(B:al=\E[L:as=\E(1:bl=^G:bt=\E[Z:cb=\E[1K:cd=\E[0J:\ :ce=\E[0K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=\E[1B:eA=\E(B:ff=^L:ho=\E[H:\ :i1=\E(B\E[2l:i2=\E[21;1|\212:k1=\EOm:k2=\EOV:\ :k3=\EOu:k4=\ENj:k5=\ENe:k6=\ENf:k7=\ENh:k8=\E[H:k9=\EOc:\ :k;=\EOd:kB=\E[Z:kF=\E[S:kR=\E[T:kb=^H:kd=\E[B:ke=\E[19;0|:\ :kl=\E[D:kr=\E[C:ks=\E[19;1|:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[2;7m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[?8i:po=\E[?4i:ps=\E[0i:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[11;3|:vi=\E[11;0|:vs=\E[11;2|: # Terminfo entry for the AT&T 510 D Personal Terminal # Function keys 9 through 16 are accessed by bringing up the # system blocks. # Function key 9 corresponds to the leftmost touch target on the screen, # function key 16 corresponds to the rightmost. # # There are problems with soft key labeling. These are due to # strangenesses in the native terminal that are impossible to # describe in a terminfo. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att510d|bct510d|AT&T 510D Personal Terminal:\ :am:da:db:mi:ms:xn:xo:\ :co#80:li#24:lm#48:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ae=\E(B:\ :al=\E[L:as=\E(1:bl=^G:bt=\E[Z:cd=\E[0J:ce=\E[0K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[1B:\ :ei=\E[4l:ff=^L:ho=\E[H:i1=\E(B\E[5;0|:\ :i2=\E[21;1|\212:im=\E[4h:k1=\EOm:k2=\EOV:k3=\EOu:k4=\ENj:\ :k5=\ENe:k6=\ENf:k7=\ENh:k8=\E[H:k9=\EOc:kb=^H:kd=\E[B:\ :ke=\E[19;0|:kl=\E[D:kr=\E[C:ks=\E[19;1|:ku=\E[A:le=^H:\ :ll=\E#2:mb=\E[5m:md=\E[2;7m:me=\E[m\017:mh=\E[2m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[11;3|:vs=\E[11;2|: # (att500: I merged this with the att513 entry, att500 just used att513 -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att500|att513|AT&T 513 using page mode:\ :am:mi:ms:xn:xo:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dE:SR=\E[%dF:UP=\E[%dA:ae=^O:\ :al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=%i\E[%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :i1=\E?\E[3;3|\E[10;0|\E[21;1|\212\E[6;1|\E[1{\E[?99l:\ :im=\E[4h:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:\ :k7=\EOi:k8=\EOj:kD=\ENf:kI=\ENj:kN=\E[U:kP=\E[V:kb=^H:\ :kd=\E[B:ke=\E[19;0|\E[21;1|\212:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[19;1|\E[21;4|\Eent:ku=\E[A:le=^H:ll=\E#2:mb=\E[5m:\ :md=\E[2;7m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m:ve=\E[11;0|:vs=\E[11;1|: # 01-07-88 # printer must be set to EMUL ANSI to accept ESC codes # :up: stops at top margin # :i1: sets cpi 10,lpi 6,form 66,left 1,right 132,top 1,bottom 66,font # and alt font ascii,wrap on,tabs cleared # :is: disables newline on LF,Emphasized off # The capability sets form length # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att5310|att5320|AT&T Model 53210 or 5320 matrix printer:\ :co#132:it#8:li#66:\ :DO=\E[%de:RI=\E[%da:cr=^M:do=^J:ff=^L:i1=\Ec:is=\E[20l\r:\ :nd= :ta=^I:up=\EM: # Teletype 5620, firmware version 1.1 (8;7;3) or earlier from BRL # The following SET-UP modes are assumed for normal operation: # CR_DEF=CR NL_DEF=INDEX DUPLEX=FULL # Other SET-UP modes may be set for operator convenience or communication # requirements. This termcap description is for the Resident Terminal Mode. # No delays specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # The BRL entry also said: UNSAFE :ll=\E[70H: att5620-1|tty5620-1|dmd1|Teletype 5620 with old ROMs:\ :am:xo:\ :co#88:it#8:li#70:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:SF=\E[%dS:\ :SR=\E[%dT:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ho=\E[H:\ :ic=\E[@:im=:kC=\E[2J:kH=\E[70;1H:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:nd=\E[C:nw=^M^J:r1=\Ec:\ :rc=\E8:sc=\E7:sf=^J:sr=\E[T:ta=^I:up=\E[A: # 5620 terminfo (2.0 or later ROMS with char attributes) # The following SET-UP modes are assumed for normal operation: # DUPLEX=FULL GEN_FLOW=ON NEWLINE=INDEX RETURN=CR # Other SET-UP modes may be set for operator convenience or communication # requirements. This termcap description is for Resident Terminal Mode. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # assumptions: :sf: (scroll forward one line) is only done at screen bottom # Be aware that older versions of the dmd have a firmware bug that affects # parameter defaulting; for this terminal, the 0 in \E[0m is not optional. # :ms: is from an otherwise inferior BRL for this terminal. That entry # also has :ll:=\E[70H commented out and marked unsafe. # For more, see the 5620 FAQ maintained by David Breneman . att5620|dmd|tty5620|ttydmd|5620|5620 terminal 88 columns:\ :NL:NP:am:bs:ms:xo:\ :co#88:it#8:li#70:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:SF=\E[%dS:\ :SR=\E[%dT:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[@:im=:kC=\E[2J:kH=\E[70;1H:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[2m:me=\E[0m:mh=\E[2m:\ :mr=\E[7m:nd=\E[C:nw=^J:..px=\E[%p1%d;%p2%l%dq%p2%s:\ :r1=\Ec:rc=\E8:sc=\E7:se=\E[0m:sf=\E[S:so=\E[7m:sr=\E[T:\ :ta=^I:ue=\E[0m:up=\E[A:us=\E[4m: att5620-24|tty5620-24|dmd-24|teletype dmd 5620 in a 24x80 layer:\ :li#24:tc=att5620: att5620-34|tty5620-34|dmd-34|teletype dmd 5620 in a 34x80 layer:\ :li#34:tc=att5620: # 5620 layer running the "S" system's downloaded graphics handler: att5620-s|tty5620-s|layer|vitty|5620 S layer:\ :am:bs:pt:\ :co#80:it#8:li#72:\ :al=\EI:bl=^G:ce=\EK:cl=^L:cm=\EY%r%+ %+ :cr=^M:dl=\ED:\ :do=^J:kC=\E[2J:kH=\E[70;1H:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:sf=^J:ta=^I:up=^K:vb=\E^G: # Entries for thru refer to the shifted system pf keys. # # Entries for thru refer to the alternate keypad mode # keys: = * / + 7 8 9 - 4 5 6 , 1 2 3 0 . ENTER # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att605|AT&T 605 80 column 102key keyboard:\ :am:eo:xo:\ :co#80:li#24:ws#80:\ :DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:ae=\E(B:al=\E[L:as=\E(0:\ :bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:fs=\E8:\ :i1=\E[8;0|\E[?\E[13;20l\E[?\E[12h:ic=\E[@:im=\E[4h:\ :is=\E[m\017:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:\ :k6=\EOh:k7=\EOi:k8=\EOj:k9=\ENo:kD=\E[P:kI=\E[@:kN=\E[U:\ :kP=\E[V:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:ll=\E[24H:mb=\E[5m:md=\E[1m:me=\E[m\017:mh=\E[2m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:ta=^I:ts=\E7\E[25;%i%p1%dx:ue=\E[m:up=\E[A:\ :us=\E[4m: att605-pc|ATT 605 in pc term mode:\ :@7=\E[F:AL=\E[L:S4=250\E[?11l\E[50;1|:S5=400\E[50;0|:\ :XF=g:XN=e:\ :ac=k\277l\332m\300j\331n\305w\302q\304u\264t\303v\301x\263:\ :al=\E[L:bt=\E[Z:dc=\E[P:dl=\E[M:do=\E[B:ei=:ic=\E[@:im=:\ :k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:k5=\E[Q:k6=\E[R:k7=\E[S:\ :k8=\E[T:k9=\E[U:k;=\E[V:kB=\E[Z:kD=\E[P:kI=\E[@:kL=\E[M:\ :kN=\E[G:kP=\E[I:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=\E[D:nd=\E[C:up=\E[A:\ :tc=att605: att605-w|AT&T 605-w 132 column 102 key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h\E(B:tc=att605: # (att610: I added / based on the init string. I also # added :SF: and :SR: because the BSD file says the att615s have them, # and the 615 is like a 610 with a big keyboard, and most of their other # smart terminals support the same sequence -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att610|AT&T 610; 80 column; 98key keyboard:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ae=\E(B:\ :al=\E[L:as=\E(0:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=\E[4l:fs=\E8:ho=\E[H:\ :i1=\E[8;0|\E[?3;4;5;13;15l\E[13;20l\E[?7h\E[12h\E(B:\ :i2=\E(B:im=\E[4h:is=\E[m\017:k1=\EOc:k2=\EOd:k3=\EOe:\ :k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:k9=\ENo:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:\ :ts=\E7\E[25;%i%p1%dx:ue=\E[m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h\E[?12l:vi=\E[?25l:\ :vs=\E[?12;25h: att610-w|AT&T 610; 132 column; 98key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att610: att610-103k|AT&T 610; 80 column; 103key keyboard:\ :!1=\EOO:!2=\EOP:!3=\EOS:#1=\EOM:%0=\EOt:%1=\EOm:%2=\ENi:\ :%3=\EOl:%4=\ENc:%5=\ENh:%6=\EOv:%7=\EOr:%8=\ENg:%9=\EOz:\ :%a=\EOL:%b=\ENC:%c=\ENH:%d=\EOR:%e=\ENG:%f=\EOZ:%g=\EOT:\ :%h=\EOY:%j=\EOQ:&0=\EOW:&1=\EOb:&2=\ENa:&3=\EOy:&4=\EOB:\ :&5=\EOq:&6=\EOo:&7=\EOp:&8=\EOs:&9=\ENB:*0=\EOX:*1=\EOU:\ :*2=\END:*3=\EON:*4=\ENF:*5=\ENE:*6=\ENI:*7=\ENN:*8=\EOA:\ :*9=\EOK:@0=\EOx:@1=\E9:@2=\EOw:@3=\EOV:@4=\EOu:@5=\ENd:\ :@6=\EOn:@7=\E0:@8=^M:@9=\EOk:F1@:F2@:F3@:F4@:k9@:k;@:kD=\ENf:\ :kE=\EOa:kI=\ENj:kL=\ENe:kM=\ENj:kN=\E[U:kP=\E[V:\ :tc=att610: att610-103k-w|AT&T 610; 132 column; 103key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att610-103k: att615|AT&T 615; 80 column; 98key keyboard:\ :#4=\E[ A:%i=\E[ @:F5=\EOC:F6=\EOD:F7=\EOE:F8=\EOF:F9=\EOG:\ :FA=\EOH:FB=\EOI:FC=\EOJ:FD=\ENO:FE=\ENP:FF=\ENQ:FG=\ENR:\ :FH=\ENS:FI=\ENT:FJ=\EOP:FK=\EOQ:FL=\EOR:FM=\EOS:FN=\EOw:\ :FO=\EOx:FP=\EOy:FQ=\EOm:FR=\EOt:FS=\EOu:FT=\EOv:FU=\EOl:\ :FV=\EOq:FW=\EOr:FX=\EOs:FY=\EOp:FZ=\EOn:Fa=\EOM:\ :tc=att610: att615-w|AT&T 615; 132 column; 98key keyboard:\ :#4=\E[ A:%i=\E[ @:F5=\EOC:F6=\EOD:F7=\EOE:F8=\EOF:F9=\EOG:\ :FA=\EOH:FB=\EOI:FC=\EOJ:FD=\ENO:FE=\ENP:FF=\ENQ:FG=\ENR:\ :FH=\ENS:FI=\ENT:FJ=\EOP:FK=\EOQ:FL=\EOR:FM=\EOS:FN=\EOw:\ :FO=\EOx:FP=\EOy:FQ=\EOm:FR=\EOt:FS=\EOu:FT=\EOv:FU=\EOl:\ :FV=\EOq:FW=\EOr:FX=\EOs:FY=\EOp:FZ=\EOn:Fa=\EOM:\ :tc=att610-w: att615-103k|AT&T 615; 80 column; 103key keyboard:\ :#4=\E[ A:%i=\E[ @:\ :tc=att610-103k: att615-103k-w|AT&T 615; 132 column; 103key keyboard:\ :#4=\E[ A:%i=\E[ @:\ :tc=att610-103k-w: # (att620: I added / based on the init string and # :SR:/:SF: from a BSD termcap -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att620|AT&T 620; 80 column; 98key keyboard:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:fs=\E8:ho=\E[H:\ :i1=\E[8;0|\E[?3;4;5;13;15l\E[13;20l\E[?7h\E[12h:\ :i2=\E(B:im=\E[4h:is=\E[m\017:k1=\EOc:k2=\EOd:k3=\EOe:\ :k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:k9=\ENo:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[1m:me=\E[m\E(B\017:mh=\E[2m:mr=\E[7m:\ :nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[7m:\ :sr=\EM:ta=^I:ts=\E7\E[25;%i%p1%dx:ue=\E[m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[?25h\E[?12l:vi=\E[?25l:\ :vs=\E[?12;25h: att620-w|AT&T 620; 132 column; 98key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att620: att620-103k|AT&T 620; 80 column; 103key keyboard:\ :!1=\EOO:!2=\EOP:!3=\EOS:#1=\EOM:%0=\EOt:%1=\EOm:%2=\ENi:\ :%3=\EOl:%4=\ENc:%5=\ENh:%6=\EOv:%7=\EOr:%8=\ENg:%9=\EOz:\ :%a=\EOL:%b=\ENC:%c=\ENH:%d=\EOR:%e=\ENG:%f=\EOZ:%g=\EOT:\ :%h=\EOY:%j=\EOQ:&0=\EOW:&1=\EOb:&2=\ENa:&3=\EOy:&4=\EOB:\ :&5=\EOq:&6=\EOo:&7=\EOp:&8=\EOs:&9=\ENB:*0=\EOX:*1=\EOU:\ :*2=\END:*3=\EON:*4=\ENF:*5=\ENE:*6=\ENI:*7=\ENN:*8=\EOA:\ :*9=\EOK:@0=\EOx:@1=\E9:@2=\EOw:@3=\EOV:@4=\EOu:@5=\ENd:\ :@6=\EOn:@7=\E0:@8=^M:@9=\EOk:F1@:F2@:F3@:F4@:F5@:F6@:F7@:F8@:\ :F9@:FA@:FB@:FC@:FD@:FE@:FF@:FG@:FH@:FI@:FJ@:FK@:FL@:FM@:FN@:FO@:FP@:\ :FQ@:FR@:FS@:FT@:FU@:FV@:FW@:FX@:FY@:FZ@:Fa@:k9@:k;@:kD=\ENf:\ :kE=\EOa:kI=\ENj:kL=\ENe:kM=\ENj:kN=\E[U:kP=\E[V:\ :tc=att620: att620-103k-w|AT&T 620; 132 column; 103key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att620-103k: # AT&T (formerly Teletype) 630 Multi-Tasking Graphics terminal # The following SETUP modes are assumed for normal operation: # Local_Echo=Off Gen_Flow=On Return=CR Received_Newline=LF # Font_Size=Large Non-Layers_Window_Cols=80 # Non-Layers_Window_Rows=60 # Other SETUP modes may be set for operator convenience or communication # requirements. Some capabilities assume a printer attached to the Aux EIA # port. This termcap description is for the Fixed Non-Layers Window. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # (att630: added :ic:, :mb: and :mh: from a BSD termcap file -- esr) att630|AT&T 630 windowing terminal:\ :NP:am:bs:da:db:mi:ms:xo:\ :co#80:it#8:li#60:lm#0:\ :@8=^M:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\ENq:\ :F2=\ENr:F3=\ENs:F4=\ENt:F5=\ENu:F6=\ENv:F7=\ENw:F8=\ENx:\ :F9=\ENy:FA=\ENz:FB=\EN{:FC=\EN|:FD=\EN}:FE=\EN~:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :al=\E[L:bl=^G:bt=\E[Z:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:is=\E[m:k9=\ENo:k;=\ENp:\ :kA=\E[L:kB=\E[Z:kC=\E[2J:kD=\E[P:kI=\E[@:kL=\E[M:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :me=\E[m:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=^M^J:pf=\E[?4i:\ :po=\E[?5i:..px=\E[%p1%d;%p2%l%dq%p2%s:r2=\Ec:rc=\E8:\ :..sa=\E[0%?%p2%t;4%;%?%p1%p3%|%p4%|%p5%|%t;7%;m:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: att630-24|5630-24|5630DMD-24|630MTG-24|AT&T 630 windowing terminal 24 lines:\ :li#24:tc=att630: # This entry was modified 3/13/90 by JWE. # fixes include additions of , correcting :rp:, and modification # of . (See comments below) # att730 has status line of 80 chars # These were commented out: :SF=\E[%p1%dS:, :SR=\E[%p1%dT:, # the and up keys are used for shifted system Fkeys # NOTE: JWE 3/13/90 The 98 key keyboard translation for shift/HOME is # currently the same as :kh: (unshifted HOME or \E[H). On the 102, 102+1 # and 122 key keyboards, the 730's translation is \E[2J. For consistency # has been commented out. The user can uncomment if using the # 102, 102+1, or 122 key keyboards # kHOM=\E[2J, # (att730: I added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att730|AT&T 730 windowing terminal:\ :am:da:db:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#60:lm#0:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:fs=\E8:\ :ho=\E[H:\ :i1=\E[8;0|\E[?3;4;5;13;15l\E[13;20l\E[?7h\E[12h\E(B\E)B:\ :i2=\E(B:im=\E[4h:is=\E[m\017:k1=\EOc:k2=\EOd:k3=\EOe:\ :k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:k9=\ENo:kI=\E[@:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :nw=\EE:rc=\E8:sc=\E7:se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:\ :ta=^I:ts=\E7\E[;%i%p1%dx:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h\E[?12l:vi=\E[?25l:\ :vs=\E[?12;25h: att730-41|730MTG-41|AT&T 730-41 windowing terminal Version:\ :li#41:tc=att730: att730-24|730MTG-24|AT&T 730-24 windowing terminal Version:\ :li#24:tc=att730: att730r|730MTGr|AT&T 730 rev video windowing terminal Version:\ :i1=\E[8;0|\E[?3;4;13;15l\E[?5h\E[13;20l\E[?7h\E[12h\E(B\E)B:\ :vb=\E[?5l\E[?5h:\ :tc=att730: att730r-41|730MTG-41r|AT&T 730r-41 rev video windowing terminal Version:\ :li#41:tc=att730r: att730r-24|730MTGr-24|AT&T 730r-24 rev video windowing terminal Version:\ :li#24:tc=att730r: # The following represents the screen layout along with the associated # bezel buttons for the 5430/pt505 terminal. The "kf" designations do # not appear on the screen but are shown to reference the bezel buttons. # The "CMD", "MAIL", and "REDRAW" buttons are shown in their approximate # position relative to the screen. # # # # +----------------------------------------------------------------+ # | | # XXXX | kf0 kf24 | XXXX # | | # | | # XXXX | kf1 kf23 | XXXX # | | # | | # XXXX | kf2 kf22 | XXXX # | | # | | # XXXX | kf3 kf21 | XXXX # | | # | | # XXXX | kf4 kf20 | XXXX # | | # | | # XXXX | kf5 kf19 | XXXX # | | # | | # XXXX | kf6 kf18 | XXXX # | | # | | # XXXX | | XXXX # | | # | | # +----------------------------------------------------------------+ # # XXXX XXXX XXXX XXXX XXXX XXXX XXXX XXXX XXXX XXXX # # Note: XXXX represents the screen buttons # CMD REDRAW # # MAIL # # version 1 note: # The character string sent by key 'kf26' may be user programmable # to send either \E[16s, or \E[26s. # The character string sent by key 'krfr' may be user programmable # to send either \E[17s, or \E[27s. # # Depression of the "CMD" key sends \E! (kcmd) # Depression of the "MAIL" key sends \E[26s (kf26) # "REDRAW" same as "REFRESH" (krfr) # # "kf" functions adds carriage return to output string if terminal is in # 'new line' mode. # # The following are functions not covered in the table above: # # Set keyboard character (SKC): \EPn1;Pn2w # Pn1= 0 Back Space key # Pn1= 1 Break key # Pn2= Program char (hex) # # Screen Definition (SDF): \E[Pn1;Pn2;Pn3;Pn4;Pn5t # Pn1= Window number (1-39) # Pn2-Pn5= Y;X;Y;X coordinates # # Screen Selection (SSL): \E[Pnu # Pn= Window number # # Set Terminal Modes (SM): \E[Pnh # Pn= 3 Graphics mode # Pn= > Cursor blink # Pn= < Enter new line mode # Pn= = Enter reverse insert/replace mode # Pn= ? Enter no scroll mode # # Reset Terminal Mode (RM): \E[Pnl # Pn= 3 Exit graphics mode # Pn= > Exit cursor blink # Pn= < Exit new line mode # Pn= = Exit reverse insert/replace mode # Pn= ? Exit no scroll mode # # Screen Status Report (SSR): \E[Pnp # Pn= 0 Request current window number # Pn= 1 Request current window dimensions # # Device Status Report (DSR): \E[6n Request cursor position # # Call Status Report (CSR): \E[Pnv # Pn= 0 Call failed # Pn= 1 Call successful # # Transparent Button String (TBS): \E[Pn1;Pn2;Pn3;{string # Pn1= Button number to be loaded # Pn2= Character count of "string" # Pn3= Key mode being loaded: # 0= Unshifted # 1= Shifted # 2= Control # String= Text string (15 chars max) # # Screen Number Report (SNR): \E[Pnp # Pn= Screen number # # Screen Dimension Report (SDR): \E[Pn1;Pn2r # Pn1= Number of rows available in window # Pn2= Number of columns available in window # # Cursor Position Report (CPR): \E[Pn1;Pn2R # Pn1= "Y" Position of cursor # Pn2= "X" Position of cursor # # Request Answer Back (RAB): \E[c # # Answer Back Response (ABR): \E[?;*;30;VSV # *= 0 No printer available # *= 2 Printer available # V= Software version number # SV= Software sub version number # (printer-available field not documented in v1) # # Screen Alignment Aid: \En # # Bell (lower pitch): \E[x # # Dial Phone Number: \EPdstring\ # string= Phone number to be dialed # # Set Phone Labels: \EPpstring\ # string= Label for phone buttons # # Set Clock: \EPchour;minute;second\ # # Position Clock: \EPsY;X\ # Y= "Y" coordinate # X= "X" coordinate # # Delete Clock: \Epr\ # # Programming The Function Buttons: \EPfPn;string\ # Pn= Button number (00-06, 18-24) # (kf00-kf06, kf18-kf24) # string= Text to sent on button depression # # The following in version 2 only: # # Request For Local Directory Data: \EPp12;\ # # Local Directory Data to host: \EPp11;LOCAL...DIRECTORY...DATA\ # # Request for Local Directory Data in print format: \EPp13;\ # # Enable 'Prt on Line' mode: \022 (DC2) # # Disable 'Prt on Line' mode: \024 (DC4) # # 05-Aug-86: # The following Terminfo entry describes functions which are supported by # the AT&T 5430/pt505 terminal software version 2 and later. att505|pt505|att5430|gs5430|AT&T Personal Terminal 505 or 5430 GETSET terminal:\ :am:xo:\ :co#80:it#8:li#24:\ :&2=\E[27s:@4=\E\041:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:\ :DO=\E[%dB:F8=\E[18s:F9=\E[19s:FA=\E[20s:FB=\E[21s:\ :FC=\E[22s:FD=\E[23s:FE=\E24s:FG=\E26s:LE=\E[%dD:\ :RA=\E[11;1j:RI=\E[%dC:SA=\E[11;0j:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:cb=\E2K:cd=\E[0J:\ :ce=\E[0K:cl=\E[2J\E[H:cm=\E[%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\EPr\E[0u\E[2J\E[0;0H\E[m\E[3l\E[l\E[=l\E[?l:\ :im=\E[4h:k0=\E[00s:k1=\E[01s:k2=\E[02s:k3=\E[03s:\ :k4=\E[04s:k5=\E[05s:k6=\E[06s:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:r1=\Ec:rc=\E8:sc=\E7:\ :se=\E[m:sf=^J:so=\E[1m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[>l:vs=\E[>h: # The following Terminfo entry describes functions which are supported by # the AT&T 5430/pt505 terminal software version 1. att505-24|pt505-24|gs5430-24|AT&T PT505 or 5430 GETSET version 1 24 lines:\ :li#24:\ :RA@:SA@:pf@:po@:rc@:sc@:tc=att505: tt505-22|pt505-22|gs5430-22|AT&T PT505 or 5430 GETSET version 1 22 lines:\ :li#22:tc=att505: # # -------------------- TERMINFO FILE CAN BE SPLIT HERE ----------------------- # This cut mark helps make life less painful for people running ncurses tic # on machines with relatively little RAM. The file can be broken in half here # cleanly and compiled in sections -- no `use' references cross this cut # going forward. # #### Ampex (Dialogue) # # Yes, these are the same people who are better-known for making audio- and # videotape. I'm told they are located in Redwood City, CA. # # From: Fri Sep 11 22:38:32 1981 # (ampex80: some capabilities merged in from SCO's entry -- esr) ampex80|a80|d80|dialogue|dialogue80|ampex dialogue 80:\ :am:bs:bw:ul:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :\ :cr=^M:ct=\E3:dc=\EW:dl=\ER:do=^J:ei=:ic=\EQ:im=:is=\EA:le=^H:\ :nd=^L:se=\Ek:sf=^J:so=\Ej:st=\E1:ta=^I:ue=\Em:up=^K:us=\El: # This entry was from somebody anonymous, Tue Aug 9 20:11:37 1983, who wrote: ampex175|ampex d175:\ :am:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\Ey:ce=\Et:cl=\E+:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:is=\EX\EA\EF:\ :kA=\EE:kD=\EW:kI=\EQ:kL=\ER:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:\ :le=^H:ll=^^^K:nd=^L:se=\Ek:sf=^J:so=\Ej:te=\EF:ti=\EN:\ :ue=\Em:up=^K:us=\El: # No backspace key in the main QWERTY cluster. Fortunately, it has a # NEWLINE/PAGE key just above RETURN that sends a strange single-character # code. Given a suitable Unix (one that lets you set an echo-erase-as-BS-SP-BS # mode), this key can be used as the erase key; I find I like this. Because # some people and some systems may not, there is another termcap ("ampex175") # that suppresses this little eccentricity by omitting the relevant capability. ampex175-b|ampex d175 using left arrow for erase:\ :kb=^_:\ :tc=ampex175: # From: Richard Bascove # (ampex210: removed obsolete ":kn#10:" -- esr) ampex210|a210|ampex a210:\ :am:bs:hs:xn:\ :co#80:it#8:li#24:sg#1:\ :al=\EE:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :dc=\EW:\ :dl=\ER:ei=:fs=\E.2:ho=^^:ic=\EQ:if=/usr/share/tabset/std:\ :im=:is=\EC\Eu\E'\E(\El\EA\E%\E{\E.2\EG0\Ed\En:\ :k0=^A0\r:k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:k5=^A5\r:\ :k6=^A6\r:k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^V:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:mk@:nd=^L:ta=^I:ts=\E.0\Eg\E}\Ef:up=^K:\ :vb=\EU\EX\EU\EX\EU\EX\EU\EX:\ :tc=adm+sgr: # (ampex219: I added / based on the init string, added :vs: # from ampex219w, added :ve:=\E[?3l, irresistibly suggested by :vs:, # and moved the padding to be *after* the caps -- esr) ampex219|ampex-219|amp219|Ampex with Automargins:\ :hs:xn:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=%i\E[%2;%2r:\ :do=\E[B:ho=\E[H:\ :is=\E>\E[?1l\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:k0=\E[21~:\ :k1=\E[7~:k2=\E[8~:k3=\E[9~:k4=\E[10~:k5=\E[11~:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:kd=\E[B:ke=\E>:kh=\E[H:\ :kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mh=\E[1m:mr=\E[7m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:\ :sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?3l:vs=\E[?3h: ampex219w|ampex-219w|amp219w|Ampex 132 cols:\ :co#132:li#24:\ :bl=^G:cr=^M:do=^J:is=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h:\ :sf=^J:\ :tc=ampex219: # (ampex232: removed :if=/usr/share/tabset/ampex:, no file and no :st: --esr) ampex232|ampex-232|Ampex Model 232:\ :am:\ :co#80:li#24:sg#1:\ :al=5*\EE:bt=\EI:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :dc=\EW:\ :dl=5*\ER:do=^V:ei=:ic=\EQ:im=:is=\Eg\El:k0=^A@\r:k1=^AA\r:\ :k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:\ :k8=^AH\r:k9=^AI\r:kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:\ :mk@:nd=^L:ta=^I:up=^K:vb=\Eb\Ed:ve=\E.4:vi=\E.0:\ :tc=adm+sgr: # (ampex: removed :if=/usr/share/tabset/amp-132:, no file and no :st: -- esr) ampex232w|Ampex Model 232 / 132 columns:\ :co#132:li#24:\ :is=\E\034Eg\El:tc=ampex232: #### Ann Arbor (aa) # # Ann Arbor made dream terminals for hackers -- large screen sizes and huge # numbers of function keys. At least some used monitors in portrait mode, # allowing up to 76-character screen heights! They were reachable at: # # Ann Arbor Terminals # 6175 Jackson Road # Ann Arbor, MI 48103 # (313)-663-8000 # # But in 1996 the phone number reaches some kitschy retail shop, and Ann Arbor # can't be found on the Web; I fear they're long dead. R.I.P. # # Originally from Mike O'Brien@Rand and Howard Katseff at Bell Labs. # Highly modified 6/22 by Mike O'Brien. # split out into several for the various screen sizes by dave-yost@rand # Modifications made 3/82 by Mark Horton # Modified by Tom Quarles at UCB for greater efficiency and more diversity # status line moved to top of screen, :vb: removed 5/82 # Some unknown person at SCO then hacked the init strings to make them more # efficient. # # assumes the following setup: # A menu: 0000 1010 0001 0000 # B menu: 9600 0100 1000 0000 0000 1000 0000 17 19 # C menu: 56 66 0 0 9600 0110 1100 # D menu: 0110 1001 1 0 # # Briefly, the settings are for the following modes: # (values are for bit set/clear with * indicating our preference # and the value used to test these termcaps) # Note that many of these settings are irrelevent to the terminfo # and are just set to the default mode of the terminal as shipped # by the factory. # # A menu: 0000 1010 0001 0000 # Block/underline cursor* # blinking/nonblinking cursor* # key click/no key click* # bell/no bell at column 72* # # key pad is cursor control*/key pad is numeric # return and line feed/return for :cr: key * # repeat after .5 sec*/no repeat # repeat at 25/15 chars per sec. * # # hold data until pause pressed/process data unless pause pressed* # slow scroll/no slow scroll* # Hold in area/don't hold in area* # functions keys have default*/function keys disabled on powerup # # show/don't show position of cursor during page transmit* # unused # unused # unused # # B menu: 9600 0100 1000 0000 0000 1000 0000 17 19 # Baud rate (9600*) # # 2 bits of parity - 00=odd,01=even*,10=space,11=mark # 1 stop bit*/2 stop bits # parity error detection off*/on # # keyboard local/on line* # half/full duplex* # disable/do not disable keyboard after data transmission* # # transmit entire page/stop transmission at cursor* # transfer/do not transfer protected characters* # transmit all characters/transmit only selected characters* # transmit all selected areas/transmit only 1 selected area* # # transmit/do not transmit line separators to host* # transmit/do not transmit page tab stops tabs to host* # transmit/do not transmit column tab stop tabs to host* # transmit/do not transmit graphics control (underline,inverse..)* # # enable*/disable auto XON/XOFF control # require/do not require receipt of a DC1 from host after each LF* # pause key acts as a meta key/pause key is pause* # unused # # unused # unused # unused # unused # # XON character (17*) # XOFF character (19*) # # C menu: 56 66 0 0 9600 0110 1100 # number of lines to print data on (printer) (56*) # # number of lines on a sheet of paper (printer) (66*) # # left margin (printer) (0*) # # number of pad chars on new line to printer (0*) # # printer baud rate (9600*) # # printer parity: 00=odd,01=even*,10=space,11=mark # printer stop bits: 2*/1 # print/do not print guarded areas* # # new line is: 01=LF,10=CR,11=CRLF* # unused # unused # # D menu: 0110 1001 1 0 # LF is newline/LF is down one line, same column* # wrap to preceding line if move left from col 1*/don't wrap # wrap to next line if move right from col 80*/don't wrap # backspace is/is not destructive* # # display*/ignore DEL character # display will not/will scroll* # page/column tab stops* # erase everything*/erase unprotected only # # editing extent: 0=display,1=line*,2=field,3=area # # unused # annarbor4080|aa4080|ann arbor 4080:\ :am:bs:\ :co#80:li#40:\ :bl=^G:cl=\014:\ :..cm=\017%p2%{10}%/%{16}%*%p2%{10}%m%+%c%p1%?%p1%{19}%>%t%{12}%+%;%'@'%+%c:\ :cr=^M:ct=^^P^P:do=^J:ho=^K:kb=^^:kd=^J:kh=^K:kl=^H:kr=^_:\ :ku=^N:le=^H:nd=^_:sf=^J:st=^]^P1:ta=^I:up=^N: # Strange Ann Arbor terminal from BRL aas1901|Ann Arbor K4080 w/S1901 mod:\ :am:\ :co#80:li#40:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=^K:kb=^H:kd=^J:kl=^H:le=^H:\ :ll=^O\200c:nd=^_:nw=^M^J:sf=^J:ta=^I:up=^N: # If you're using the GNU termcap library, add # :cS=\E[%p1%d;%p2%d;%p3%d;%p4%dp: # to these capabilities. This is the nonstandard GNU termcap scrolling # capability, arguments are: # 1. Total number of lines on the screen. # 2. Number of lines above desired scroll region. # 3. Number of lines below (outside of) desired scroll region. # 4. Total number of lines on the screen, the same as the first parameter. # The generic Ann Arbor entry is the only one that uses this. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) aaa+unk|aaa-unk|ann arbor ambassador (internal - don't use this directly):\ :am:bs:km:mi:xo:\ :co#80:it#8:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :ct=\E[2g:dc=\E[P:dl=\E[M:do=^K:ei=:ho=\E[H:\ :i1=\E[m\E7\E[H\E9\E8:i2=\E[1Q\E[>20;30l\EP`+x~M\E\:\ :ic=\E[@:im=:k1=\EOA:k2=\EOB:k3=\EOC:k4=\EOD:k5=\EOE:\ :k6=\EOF:k7=\EOG:k8=\EOH:k9=\EOI:kD=\E[P:kI=\E[@:kb=^H:\ :kd=\E[B:\ :ke=\EP`>y~[[J`8xy~[[A`4xy~[[D`6xy~[[C`2xy~[[B\E\:\ :kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\EP`>z~[[J`8xz~[[A`4xz~[[D`6xz~[[C`2xz~[[B\E\:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mm=\E[>52h:\ :mo=\E[>52l:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:sf=^K:\ :so=\E[7m:st=\EH:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: aaa+rv|ann arbor ambassador in reverse video:\ :i1=\E[7m\E7\E[H\E9\E8:mb=\E[5;7m:md=\E[1;7m:\ :me=\E[7m\016:mk=\E[7;8m:mr=\E[m:r1=\E[H\E[7m\E[J:\ :..sa=\E[%?%p1%p3%|%!%t7;%;%?%p2%t4;%;%?%p4%t5;%;%?%p6%t1;%;%?%p7%t8;%;m:\ :se=\E[7m:so=\E[m:ue=\E[7m:us=\E[4;7m: # Ambassador with the DEC option, for partial vt100 compatibility. aaa+dec|ann arbor ambassador in dec vt100 mode:\ :ac=aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}:\ :ae=^N:as=^O:cs=\E[%i%d;%dr:eA=\E(0:\ :..sa=\E[%?%p1%p3%|%!%t7;%;%?%p2%t4;%;%?%p4%t5;%;%?%p6%t1;%;%?%p7%t8;%;m%?%p9%t\017%e\016%;: aaa-18|ann arbor ambassador/18 lines:\ :li#18:\ :is=\E7\E[60;0;0;18p\E8:te=\E[60;0;0;18p\E[60;1H\E[K:\ :ti=\E[18;0;0;18p:\ :tc=aaa+unk: aaa-18-rv|ann arbor ambassador/18 lines+reverse video:\ :tc=aaa+rv:tc=aaa-18: aaa-20|ann arbor ambassador/20 lines:\ :li#20:\ :is=\E7\E[60;0;0;20p\E8:te=\E[60;0;0;20p\E[60;1H\E[K:\ :ti=\E[20;0;0;20p:\ :tc=aaa+unk: aaa-22|ann arbor ambassador/22 lines:\ :li#22:\ :is=\E7\E[60;0;0;22p\E8:te=\E[60;0;0;22p\E[60;1H\E[K:\ :ti=\E[22;0;0;22p:\ :tc=aaa+unk: aaa-24|ann arbor ambassador/24 lines:\ :li#24:\ :is=\E7\E[60;0;0;24p\E8:te=\E[60;0;0;24p\E[60;1H\E[K:\ :ti=\E[24;0;0;24p:\ :tc=aaa+unk: aaa-24-rv|ann arbor ambassador/24 lines+reverse video:\ :tc=aaa+rv:tc=aaa-24: aaa-26|ann arbor ambassador/26 lines:\ :li#26:\ :is=\E7\E[60;0;0;26p\E8:te=\E[60;0;0;26p\E[26;1H\E[K:\ :ti=\E[H\E[J\E[26;0;0;26p:\ :tc=aaa+unk: aaa-28|ann arbor ambassador/28 lines:\ :li#28:\ :is=\E7\E[60;0;0;28p\E8:te=\E[60;0;0;28p\E[28;1H\E[K:\ :ti=\E[H\E[J\E[28;0;0;28p:\ :tc=aaa+unk: aaa-30-s|aaa-s|ann arbor ambassador/30 lines w/status:\ :es:hs:\ :li#29:\ :ds=\E7\E[60;0;0;30p\E[1;1H\E[K\E[H\E8\r\n\E[K:\ :fs=\E[>51l:is=\r\n\E[A\E7\E[60;1;0;30p\E8:\ :te=\E[60;1;0;30p\E[29;1H\E[K:\ :ti=\E[H\E[J\E[30;1;0;30p\E[30;1H\E[K:\ :ts=\E[>51h\E[1;%p1%dH\E[2K:tc=aaa+unk: aaa-30-s-rv|aaa-s-rv|ann arbor ambassador/30 lines+status+reverse video:\ :tc=aaa+rv:tc=aaa-30-s: aaa-s-ctxt|aaa-30-s-ctxt|ann arbor ambassador/30 lines+status+save context:\ :te=\E[60;1;0;30p\E[59;1H\E[K:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:tc=aaa-30-s: aaa-s-rv-ctxt|aaa-30-s-rv-ct|ann arbor ambassador/30 lines+status+save context:\ :te=\E[60;1;0;30p\E[59;1H\E[K:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:tc=aaa-30-s-rv: aaa|aaa-30|ambas|ambassador|ann arbor ambassador/30 lines:\ :li#30:\ :is=\E7\E[60;0;0;30p\E8:te=\E[60;0;0;30p\E[30;1H\E[K:\ :ti=\E[H\E[J\E[30;0;0;30p:\ :tc=aaa+unk: aaa-30-rv|aaa-rv|ann arbor ambassador/30 lines in reverse video:\ :tc=aaa+rv:tc=aaa-30: aaa-30-ctxt|aaa-ctxt|ann arbor ambassador/30 lines; saving context:\ :te=\E[60;0;0;30p\E[60;1H\E[K:ti=\E[30;0;0;30p:\ :tc=aaa-30: aaa-30-rv-ctxt|aaa-rv-ctxt|ann arbor ambassador/30 lines reverse video; saving context:\ :te=\E[60;0;0;30p\E[60;1H\E[K:ti=\E[30;0;0;30p:\ :tc=aaa+rv:tc=aaa-30: aaa-36|ann arbor ambassador/36 lines:\ :li#36:\ :is=\E7\E[60;0;0;36p\E8:te=\E[60;0;0;36p\E[36;1H\E[K:\ :ti=\E[H\E[J\E[36;0;0;36p:\ :tc=aaa+unk: aaa-36-rv|ann arbor ambassador/36 lines+reverse video:\ :tc=aaa+rv:tc=aaa-36: aaa-40|ann arbor ambassador/40 lines:\ :li#40:\ :is=\E7\E[60;0;0;40p\E8:te=\E[60;0;0;40p\E[40;1H\E[K:\ :ti=\E[H\E[J\E[40;0;0;40p:\ :tc=aaa+unk: aaa-40-rv|ann arbor ambassador/40 lines+reverse video:\ :tc=aaa+rv:tc=aaa-40: aaa-48|ann arbor ambassador/48 lines:\ :li#48:\ :is=\E7\E[60;0;0;48p\E8:te=\E[60;0;0;48p\E[48;1H\E[K:\ :ti=\E[H\E[J\E[48;0;0;48p:\ :tc=aaa+unk: aaa-48-rv|ann arbor ambassador/48 lines+reverse video:\ :tc=aaa+rv:tc=aaa-48: aaa-60-s|ann arbor ambassador/59 lines+status:\ :es:hs:\ :li#59:\ :ds=\E7\E[60;0;0;60p\E[1;1H\E[K\E[H\E8\r\n\E[K:\ :fs=\E[>51l:is=\r\n\E[A\E7\E[60;1;0;60p\E8:\ :ts=\E[>51h\E[1;%p1%dH\E[2K:tc=aaa+unk: aaa-60-s-rv|ann arbor ambassador/59 lines+status+reverse video:\ :tc=aaa+rv:tc=aaa-60-s: aaa-60-dec-rv|ann arbor ambassador/dec mode+59 lines+status+rev video:\ :tc=aaa+dec:tc=aaa+rv:tc=aaa-60-s: aaa-60|ann arbor ambassador/60 lines:\ :li#60:\ :is=\E7\E[60;0;0;60p\E[1Q\E[m\E[>20;30l\E8:tc=aaa+unk: aaa-60-rv|ann arbor ambassador/60 lines+reverse video:\ :tc=aaa+rv:tc=aaa-60: aaa-db|ann arbor ambassador 30/destructive backspace:\ :bs@:\ :i2=\E[1Q\E[m\E[>20l\E[>30h:le=\E[D:tc=aaa-30: guru|guru-33|guru+unk|ann arbor guru/33 lines 80 cols:\ :li#33:\ :i2=\E[>59l:is=\E7\E[255;0;0;33;80;80p\E8\E[J:\ :te=\E[255p\E[255;1H\E[K:ti=\E[33p:vb=\E[>59h\E[>59l:\ :tc=aaa+unk: guru+rv|guru changes for reverse video:\ :i2=\E[>59h:vb=\E[>59l\E[>59h: guru-rv|guru-33-rv|ann arbor guru/33 lines+reverse video:\ :tc=guru+rv:tc=guru-33: guru+s|guru status line:\ :es:hs:\ :ds=\E7\E[;0p\E[1;1H\E[K\E[H\E8\r\n\E[K:fs=\E[>51l:\ :te=\E[255;1p\E[255;1H\E[K:ti=:\ :ts=\E[>51h\E[1;%p1%dH\E[2K: guru-nctxt|guru with no saved context:\ :ti=\E[H\E[J\E[33p\E[255;1H\E[K:tc=guru: guru-s|guru-33-s|ann arbor guru/33 lines+status:\ :li#32:\ :is=\r\n\E[A\E7\E[255;1;0;33;80;80p\E8\E[J:\ :ti=\E[33;1p\E[255;1H\E[K:tc=guru+s:\ :tc=guru+unk: guru-24|ann arbor guru 24 lines:\ :co#80:li#24:\ :is=\E7\E[255;0;0;24;80;80p\E8\E[J:ti=\E[24p:tc=guru+unk: guru-44|ann arbor guru 44 lines:\ :co#97:li#44:\ :is=\E7\E[255;0;0;44;97;100p\E8\E[J:ti=\E[44p:tc=guru+unk: guru-44-s|ann arbor guru/44 lines+status:\ :li#43:\ :is=\r\n\E[A\E7\E[255;1;0;44;80;80p\E8\E[J:\ :ti=\E[44;1p\E[255;1H\E[K:tc=guru+s:\ :tc=guru+unk: guru-76|guru with 76 lines by 89 cols:\ :co#89:li#76:\ :is=\E7\E[255;0;0;76;89;100p\E8\E[J:ti=\E[76p:tc=guru+unk: guru-76-s|ann arbor guru/76 lines+status:\ :co#89:li#75:\ :is=\r\n\E[A\E7\E[255;1;0;76;89;100p\E8\E[J:\ :ti=\E[76;1p\E[255;1H\E[K:tc=guru+s:\ :tc=guru+unk: guru-76-lp|guru-lp|guru with page bigger than line printer:\ :co#134:li#76:\ :is=\E7\E[255;0;0;76;134;134p\E8\E[J:ti=\E[76p:tc=guru+unk: guru-76-w|guru 76 lines by 178 cols:\ :co#178:li#76:\ :is=\E7\E[255;0;0;76;178;178p\E8\E[J:ti=\E[76p:tc=guru+unk: guru-76-w-s|ann arbor guru/76 lines+status+wide:\ :co#178:li#75:\ :is=\r\n\E[A\E7\E[255;1;0;76;178;178p\E8\E[J:\ :ti=\E[76;1p\E[255;1H\E[K:\ :tc=guru+s:tc=guru+unk: guru-76-wm|guru 76 lines by 178 cols with 255 cols memory:\ :co#178:li#76:\ :is=\E7\E[255;0;0;76;178;255p\E8\E[J:ti=\E[76p:tc=guru+unk: aaa-rv-unk|ann arbor unknown type:\ :Nl#0:lh#0:lw#0:\ :ho=\E[H:i1=\E[7m\E7\E[H\E9\E8:mb=\E[5;7m:md=\E[1;7m:\ :me=\E[7m:mk=\E[7;8m:mr=\E[m:r1=\E[H\E[7m\E[J:\ :..sa=\E[%?%p1%!%t7;%;%?%p2%t4;%;%?%p3%t7;%;%?%p4%t5;%;%?%p6%t1;%;%?%p7%t8;%;m:\ :se=\E[7m:so=\E[m:ue=\E[7m:us=\E[4;7m: #### Applied Digital Data Systems (adds) # # ADDS itself is long gone. ADDS was bought by NCR, and the same group made # ADDS and NCR terminals. When AT&T and NCR merged, the engineering for # terminals was merged again. Then AT&T sold the terminal business to # SunRiver, which later changed its name to Boundless Technologies. The # engineers from Teletype, AT&T terminals, ADDS, and NCR (who are still there # as of early 1995) are at: # # Boundless Technologies # 100 Marcus Boulevard # Hauppauge, NY 11788-3762 # Vox: (800)-231-5445 # Fax: (516)-342-7378 # # Their voice mail used to describe the place as "SunRiver (formerly ADDS)". # In 1995 Boundless acquired DEC's terminals business. # # Regent: lowest common denominator, works on all regents. # (regent: renamed ":bc:" to ":le:" -- esr) regent|Adds Regent Series:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=\EY :le=^U:ll=^A:nd=^F:sf=^J:\ :up=^Z: # Regent 100 has a bug where if computer sends escape when user is holding # down shift key it gets confused, so we avoid escape. regent100|Adds Regent 100:\ :sg#1:ug#1:\ :bl=^G:cm=\013%+ %B\020%.:k0=^B1\r:k1=^B2\r:k2=^B3\r:\ :k3=^B4\r:k4=^B5\r:k5=^B6\r:k6=^B7\r:k7=^B8\r:l0=F1:l1=F2:\ :l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:me=\E0@:se=\E0@:so=\E0P:\ :ue=\E0@:us=\E0`:\ :tc=regent: regent20|Adds Regent 20:\ :bl=^G:cd=\Ek:ce=\EK:cm=\EY%+ %+ :tc=regent: regent25|Adds Regent 25:\ :bl=^G:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:tc=regent20: regent40|Adds Regent 40:\ :sg#1:ug#1:\ :al=\EM:bl=^G:dl=\El:k0=^B1\r:k1=^B2\r:k2=^B3\r:k3=^B4\r:\ :k4=^B5\r:k5=^B6\r:k6=^B7\r:k7=^B8\r:l0=F1:l1=F2:l2=F3:\ :l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:me=\E0@:se=\E0@:so=\E0P:\ :ue=\E0@:us=\E0`:\ :tc=regent25: regent40+|Adds Regent 40+:\ :is=\EB:tc=regent40: regent60|regent200|Adds Regent 60:\ :dc=\EE:ei=\EF:im=\EF:is=\EV\EB:kD=\EE:kI=\EF:kM=\EF:\ :se=\ER\E0@\EV:so=\ER\E0P\EV:\ :tc=regent40+: # From: Thu Jul 9 09:27:33 1981 # (viewpoint: added :kr:, function key, and :dl: capabilities -- esr) viewpoint|addsviewpoint|adds viewpoint:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cd=\Ek:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:dl=\El:do=^J:\ :is=\017\E0`:k0=^B1:k2=^B2:k3=^B\041:k4=^B":k5=^B#:kd=^J:\ :kh=^A:kl=^U:kr=^F:ku=^Z:le=^H:ll=^A:me=^O:nd=^F:se=^O:sf=^J:\ :so=^N:ue=^O:up=^Z:us=^N:ve=\017\E0`:vs=\017\E0P: # Some viewpoints have bad ROMs that foo up on ^O screwpoint|adds viewpoint with ^O bug:\ :se@:so@:ue@:us@:vs@:tc=viewpoint: # From: Jay S. Rouman 5 Jul 92 # The :vi:/:ve:/:sa:/:me: strings were added by ESR from specs. # Theory; the vp3a+ wants \E0%c to set highlights, where normal=01000000, # underline=01100000, rev=01010000, blink=01000010,dim=01000001, # invis=01000100 and %c is the logical or of desired attributes. # There is also a `tag bit' enabling attributes, set by \E) and unset by \E(. vp3a+|viewpoint3a+|adds viewpoint 3a+:\ :am:bw:\ :co#80:it#8:li#24:\ :cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:kb=^H:\ :kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:me=\E(:nd=^L:nw=^M^J:\ :..sa=\E0%'@'%?%p1%tQ%|%;%?%p2%t%'`'%|%;%?%p3%tP%|%;%?%p4%t%{2}%|%;%?%p5%t%{1}%|%;%?%p7%tD%|%;%c\E):\ :se=\E(:sf=^J:so=\E0Q\E):ta=^I:up=^K:ve=^X:vi=^W: vp60|viewpoint60|addsvp60|adds viewpoint60:\ :tc=regent40: # # adds viewpoint 90 - from cornell # Note: emacs sends ei occasionally to insure the terminal is out of # insert mode. This unfortunately puts the viewpoint90 IN insert # mode. A hack to get around this is :ic=\EF\s\EF^U:. (Also, # - :ei=:im=: must be present in the termcap translation.) # - :xs: indicates glitch that attributes stick to location # - :ms: means it's safe to move in standout mode # - :cl=\EG\Ek:: clears screen and visual attributes without affecting # the status line # Function key and label capabilities merged in from SCO. vp90|viewpoint90|adds viewpoint 90:\ :bs:bw:ms:xs:\ :co#80:li#24:\ :cd=\Ek:ce=\EK:cl=\EG\Ek:cm=\EY%+ %+ :dc=\EE:dl=\El:do=^J:\ :ei=:ho=\EY :ic=\EF \EF\025:im=:k0=^B1\r:k1=^B2\r:\ :k2=^B3\r:k3=^B4\r:k4=^B5\r:k5=^B6\r:k6=^B7\r:k7=^B8\r:\ :k8=^B9\r:k9=^B\072\r:k;=^B;\r:kb=^H:kd=^J:kh=^A:kl=^U:\ :kr=^F:ku=^Z:l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:\ :l8=F9:l9=F10:la=F11:le=^H:ll=^A:me=\ER\E0@\EV:nd=^F:\ :se=\ER\E0@\EV:sf=^J:so=\ER\E0Q\EV:ta=^I:ue=\ER\E0@\EV:\ :up=^Z:us=\ER\E0`\EV: # Note: if return acts weird on a980, check internal switch #2 # on the top chip on the CONTROL pc board. adds980|a980|adds consul 980:\ :am:bs:\ :co#80:li#24:\ :al=\E\016:bl=^G:cl=\014\013@:cm=\013%+@\E\005%2:cr=^M:\ :dl=\E\017:do=^J:k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:\ :k6=\E6:k7=\E7:k8=\E8:k9=\E9:le=^H:me=^O:nd=\E^E01:se=^O:\ :sf=^J:so=^Y^^^N: #### C. Itoh Electronics # # As of 1995 these people no longer make terminals (they're still in the # printer business). Their terminals were all clones of the DEC VT series. # They're located in Orange County, CA. # # CIT 80 - vt-52 emulator, the termcap has been modified to remove # the delay times and do an auto tab set rather than the indirect # file used in vt100. cit80|cit-80|citoh 80:\ :am:bs:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=\E[H\EJ:cm=\E[%i%2;%2H:cr=^M:ff=^L:\ :is=\E>:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:nd=\E[C:sf=^J:up=\E[A: # From: Tim Wood Fri Sep 27 09:39:12 PDT 1985 # (cit101: added / based on init string, merged this with c101 -- esr) cit101|citc|C.itoh fast vt100:\ :am:bs:xn:\ :co#80:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=:ic=\E[@:\ :im=:is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[3g\E[>5g:\ :kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:ue=\E[m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[V\E8:vs=\E7\E[U: # CIE Terminals CIT-101e from Geoff Kuenning via BRL # The following termcap entry was created from the Callan cd100 entry. The # last two lines (with the capabilities in caps) are used by RM-cobol to allow # full selection of combinations of reverse video, underline, and blink. # (cit101e: emoved unknown :f0=\EOp:f1=\EOq:f2=\EOr:f3=\EOs:f4=\EOt:f5=\EOu:\ # f6=\EOv:f7=\EOw:f8=\EOx:f9=\EOy:AB=\E[0;5m:AL=\E[m:AR=\E[0;7m:AS=\E[0;5;7m:\ # :NB=\E[0;1;5m:NM=\E[0;1m:NR=\E[0;1;7m:NS=\E[0;1;5;7m: -- esr) cit101e|C. Itoh CIT-101e:\ :am:bs:mi:ms:pt:\ :co#80:it#8:li#24:\ :ac=:ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%2;%2H:cs=\E[%i%2;%2r:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:if=/usr/share/tabset/vt100:im=\E[4h:k0=\EOT:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOm:k6=\EOl:k7=\EOM:\ :k8=\EOn:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:\ :nd=\E[C:rc=\E8:sc=\E7:se=\E[m:so=\E[7m:sr=\EM:ue=\E[m:\ :up=\E[A:us=\E[4m:ve=:vs=\E[?1l\E[?4l\E[?7h: cit101e-n|CIT-101e w/o am:\ :am@:\ :kb=^H:kd=^J:kl=^H:vs=\E[?1l\E[?4l\E[?7l:tc=cit101e: cit101e-132|CIT-101e, 132 cols:\ :co#132:\ :kb=^H:kd=^J:kl=^H:tc=cit101e: cit101e-n132|CIT-101e, 132 cols w/o am:\ :am@:\ :co#132:\ :kb=^H:kd=^J:kl=^H:vs=\E[?1l\E[?4l\E[?7l:tc=cit101e: # CIE Terminals CIT-500 from BRL # The following SET-UP modes are assumed for normal operation: # GENERATE_XON/XOFF:YES DUPLEX:FULL NEWLINE:OFF # AUTOWRAP:ON MODE:ANSI SCREEN_LENGTH:64_LINES # DSPLY_CNTRL_CODES?NO PAGE_WIDTH:80 EDIT_MODE:OFF # Other SET-UP modes may be set for operator convenience or communication # requirements. # Hardware tabs are assumed to be set every 8 columns; they can be set up # by the "reset", "tset", or "tabs" utilities. No delays are specified; use # "stty ixon -ixany" to enable DC3/DC1 flow control! # (cit500: I added / based on the init string -- esr) cit500|CIE Terminals CIT-500:\ :bs:mi:ms:pt:xo:\ :co#80:it#8:kn#10:li#64:vt#3:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RA=\E[?7l:\ :RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:ac=:ae=\E(B:al=\E[L:as=\E(0:\ :bl=^G:bt=\E[Z:cd=\EJ:ce=\EK:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ei=\E[4l:ho=\E[H:im=\E[4h:is=\E<:k0=\EOP:k1=\EOQ:\ :k2=\EOR:k3=\EOS:k4=\EOU:k5=\EOV:k6=\EOW:k7=\EOX:k8=\EOY:\ :k9=\EOZ:kA=\E[L:kB=\E[Z:kD=\E[P:kE=\EK:kI=\E[4h:kL=\E[M:\ :kM=\E[4l:kS=\EJ:kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\E[H:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=PF1:l1=PF2:l2=PF3:\ :l3=PF4:l4=F15:l5=F16:l6=F17:l7=F18:l8=F19:l9=F20:le=^H:\ :ll=\E[64H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:\ :r1=\E<\E2\E[20l\E[?6l\E[r\E[m\E[q\E(B\017\E>:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\EM:us=\E[4m: # C. Itoh printers begin here citoh|ci8510|8510|c.itoh 8510a:\ :co#80:it#8:\ :is=\E(009\054017\054025\054033\054041\054049\054057\054065\054073.:\ :le@:md=\E\041:me=\E"\EY:rp=\ER%r%03%.:sr=\Er:ue=\EY:\ :us=\EX:\ :tc=lpr: citoh-pica|citoh in pica:\ :i1=\EN:tc=citoh: citoh-elite|citoh in elite:\ :co#96:\ :i1=\EE:\ :is=\E(009\054017\054025\054033\054041\054049\054057\054065\054073\054081\054089.:tc=citoh: citoh-comp|citoh in compressed:\ :co#136:\ :i1=\EQ:\ :is=\E(009\054017\054025\054033\054041\054049\054057\054065\054073\054081\054089\054097\054105\054113\054121\054129.:tc=citoh: # citoh has infinite cols because we don't want lp ever inserting \n\t**. citoh-prop|citoh-ps|ips|citoh in proportional spacing mode:\ :co#32767:\ :i1=\EP:tc=citoh: citoh-6lpi|citoh in 6 lines per inch mode:\ :i2=\EA:tc=citoh: citoh-8lpi|citoh in 8 lines per inch mode:\ :li#88:\ :i2=\EB:tc=citoh: #### Control Data (cdc) # cdc456|cdc 456 terminal:\ :am:bs:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=^X:ce=^V:cl=^Y^X:cm=\E1%+ %+ :cr=^M:dl=\EJ:\ :do=^J:ho=^Y:le=^H:nd=^L:sf=^J:up=^Z: # Assorted CDC terminals from BRL (improvements by DAG & Ferd Brundick) cdc721|CDC Viking:\ :am:bs:\ :co#80:li#24:\ :ce=^K:cl=^L:cm=\002%r%+ %+ :ho=^Y:kd=^J:kh=^Y:kl=^H:kr=^I:\ :ku=^W:nd=^X:up=^W: cdc721ll|CDC Vikingll:\ :am:bs:\ :co#132:li#24:\ :ce=^K:cl=^L:cm=\002%r%+ %+ :ho=^Y:kd=^J:kh=^Y:kl=^H:kr=^I:\ :ku=^W:nd=^X:up=^W: # (cdc752: the BRL entry had :ll=\E1 ^Z: commented out cdc752|CDC 752:\ :am:bs:bw:xs:\ :co#80:li#24:\ :bl=^G:ce=^V:cl=\030\E1 :cm=\E1%r%+ %+ :cr=^M:do=^J:\ :ho=\E1 :le=^H:ll=^Y:nd=^U:r1=\E1 \030\002\003\017:\ :sf=^J:up=^Z: # CDC 756 # The following switch/key settings are assumed for normal operation: # 96 chars SCROLL FULL duplex not BLOCK # Other switches may be set according to communication requirements. # Insert/delete-character cannot be used, as the whole display is affected. # "so" & "se" are commented out until jove handles "sg" correctly. cdc756|CDC 756:\ :am:bs:bw:\ :co#80:kn#10:li#24:\ :al=6*\EL:bl=^G:cd=^X:ce=^V:cl=^Y^X:cm=\E1%r%+ %+ :cr=^M:\ :dl=6*\EJ:do=^J:ho=^Y:k0=\EA:k1=\EB:k2=\EC:k3=\ED:k4=\EE:\ :k5=\EF:k6=\EG:k7=\EH:k8=\Ea:k9=\Eb:kA=\EL:kD=\EI:kE=^V:\ :kI=\EK:kL=\EL:kS=^X:kT=^O:kb=^H:kd=^J:kh=^Y:kl=^H:kr=^U:\ :ku=^Z:l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:l8=F9:\ :l9=F10:le=^H:ll=^Y^Z:nd=^U:r1=\031\030\002\003\017:sf=^J:\ :up=^Z: # # CDC 721 from Robert Viduya, Ga. Tech. via BRL. # # Part of the long initialization string defines the "DOWN" key to the left # of the tab key to send an ESC. The real ESC key is positioned way out # in right field. # # The termcap won't work in 132 column mode due to the way it it moves the # cursor. Termcap doesn't have the capability (as far as I could tell) to # handle the 721 in 132 column mode. # # (cdc721: changed :ri: to :sr: -- esr) cdc721-esc|Control Data 721:\ :am:bs:bw:ms:pt:xo:\ :co#80:it#8:kn#10:li#30:\ :al=^^R:bl=^G:bt=^^^K:cd=^^P:ce=^K:cl=^L:cm=\002%r%+ %+ :\ :ct=^^^RY:dc=^^N:dl=^^Q:do=^Z:ei=:ho=^Y:ic=^^O:im=:\ :is=\036\022B\003\036\035\017\022\025\035\036E\036\022H\036\022J\036\022L\036\022N\036\022P\036\022Q\036\022\\036\022\136\036\022b\036\022i\036W =\036\022Z\036\011C1-` `\041k/o:\ :k0=^^q:k1=^^r:k2=^^s:k3=^^t:k4=^^u:k5=^^v:k6=^^w:k7=^^x:\ :k8=^^y:k9=^^z:kb=^H:kd=^Z:ke=^^^Rl:kh=^Y:kl=^H:kr=^X:\ :ks=^^^Rk:ku=^W:le=^H:ll=^B =:mb=^N:\ :me=\017\025\035\036E\036\022\:mh=^\:mk=^^^R[:mr=^^D:\ :nd=^X:se=^^E:sf=\036W =\036U:so=^^D:sr=\036W =\036V:\ :st=^^^RW:ue=^]:up=^W:us=^\: #### Getronics # # Getronics is a Dutch electronics company that at one time was called # `Geveke' and made async terminals; but (according to the company itself!) # they've lost all their documentation on the command set. The hardware # documentation suggests the terminals were actually manufactured by a # Taiwanese electronics company named Cal-Comp. There are known # to have been at least two models, the 33 and the 50. # # The 50 seems to be a top end vt220 clone, with the addition of a higher # screen resolution, a larger screen, at least 1 page of memory above and # below the screen, apparently pages of memory right and left of the screen # which can be panned, and about 75 function keys (15 function keys x normal, # shift, control, func A, func B). It also has more setup possibilities than # the vt220. The monitor case is dated November 1978 and the keyboard case is # May 1982. # # The vt100 emulation works as is. The entry below describes the rather # non-conformant (but more featureful) ANSI mode. # # From: Stephen Peterson , 27 May 1995 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) visa50|geveke visa 50 terminal in ansi 80 character mode:\ :bw:mi:ms:\ :co#80:li#25:\ :AL=\E[%dL:DC=\E[%dX:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\E[f:K2=\EOP:K3=\EOQ:K4=\EOR:K5=\EOS:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E[3l:al=\E[L:as=\E3h:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[X:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E0;2m\E[1;25r\E[25;1H\E[?3l\E[?7h\E[?8h:k0=\E010:\ :k1=\E001:k2=\E002:k3=\E003:k4=\E004:k5=\E005:k6=\E006:\ :k7=\E007:k8=\E008:k9=\E009:kD=\177:kb=^H:kd=\E[A:ke=\E>:\ :kh=\E[f:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=\E[D:mb=\E[5m:\ :md=\E[1m:me=\E[0;2m:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=^M^J:\ :se=\E[0;2m:sf=^J:so=\E[2;7m:ta=^I:ue=\E[0m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: #### Human Designed Systems (Concept) # # Human Designed Systems # 400 Fehley Drive # King of Prussia, PA 19406 # Vox: (610)-277-8300 # Fax: (610)-275-5739 # Net: support@hds.com # # John Martin is their termcap expert. They're mostly out of # the character-terminal business now (1995) and making X terminals. In # particular, the whole `Concept' line described here was discontinued long # ago. # # From: Sat Jun 27 07:41:20 1981 # Extensive changes to c108 by arpavax:eric Feb 1982 # Some unknown person at SCO then translated it to terminfo. # # There seem to be a number of different versions of the C108 PROMS # (with bug fixes in its Z-80 program). # # The first one that we had would lock out the keyboard of you # sent lots of short lines (like /usr/dict/words) at 9600 baud. # Try that on your C108 and see if it sends a ^S when you type it. # If so, you have an old version of the PROMs. # # You should configure the C108 to send ^S/^Q before running this. # It is much faster (at 9600 baud) than the c100 because the delays # are not fixed. # new status line display entries for c108-8p: # :i3: - init str #3 - setup term for status display - # set programmer mode, select window 2, define window at last # line of memory, set bkgnd stat mesg there, select window 0. # # :ts: - to status line - select window 2, home cursor, erase to # end-of-window, 1/2 bright on, goto(line#0, col#?) # # :fs: - from status line - 1/2 bright off, select window 0 # # :ds: - disable status display - set bkgnd status mesg with # illegal window # # # There are probably more function keys that should be added but # I don't know what they are. # # No delays needed on c108 because of ^S/^Q handshaking # c108|concept108|c108-8p|concept108-8p|concept 108 w/8 pages:\ :i2=\EU\E z"\Ev\001\177 \041p\E ;"\E z \Ev \001\177p\Ep\n:\ :te=\Ev \001\177p\Ep\r\n:\ :tc=c108-4p: c108-4p|concept108-4p|concept 108 w/4 pages:\ :bs:es:hs:xo:\ :pb@:\ :ac=l\qLkTxUmMjE:ae=\Ej :as=\Ej\041:\ :..cm=\Ea%p1%?%p1%{95}%>%t\001%{96}%-%;%{32}%+%c%p2%?%p2%{95}%>%t\001%{96}%-%;%{32}%+%c:\ :cr=^M:dc=\E 1:ds=\E ;\177:fs=\Ee\E z :i1=\EK\E\041\E F:\ :i2=\EU\E z"\Ev\177 \041p\E ;"\E z \Ev \001 p\Ep\n:\ :sf=^J:te=\Ev \001 p\Ep\r\n:ti=\EU\Ev 8p\Ep\r\E\025:\ :ts=\E z"\E?\E\005\EE\Ea %+ :ve=\Ew:vs=\EW:\ :tc=c100: c108-rv|c108-rv-8p|concept 108 w/8 pages in reverse video:\ :te=\Ev \002 p\Ep\r\n:ti=\EU\Ev 8p\Ep\r:\ :tc=c108-rv-4p: c108-rv-4p|concept108rv4p|concept 108 w/4 pages in reverse video:\ :i1=\Ek:se=\Ee:so=\EE:vb=\EK\Ek:\ :tc=c108-4p: c108-w|c108-w-8p|concept108-w-8|concept108-w8p|concept 108 w/8 pages in wide mode:\ :co#132:\ :i1=\E F\E":te=\Ev ^A0\001D\Ep\r\n:\ :ti=\EU\Ev 8\001D\Ep\r:tc=c108-8p: # Concept 100: # These have only window relative cursor addressing, not screen # relative. To get it to work right here, smcup/rmcup (which # were invented for the concept) lock you into a one page # window for screen style programs. # # To get out of the one page window, we use a clever trick: # we set the window size to zero ("\Ev " in rmcup) which the # terminal recognizes as an error and resets the window to all # of memory. # # This trick works on c100 but does not on c108, sigh. # # Some tty drivers use cr3 for concept, others use nl3, hence # the delays on cr and ind below. This padding is only needed at # 9600 baud and up. One or the other is commented out depending on # local conventions. # # 2 ms padding on :te: isn't always enough. 6 works fine. Maybe # less than 6 but more than 2 will work. # # Note: can't use function keys f7-f10 because they are # indistinguishable from arrow keys (!), also, del char and # clear eol use xon/xoff so they probably won't work very well. # # Also note that we don't define insrt/del char/delline/eop/send # because they don't transmit unless we reset them - I figured # it was a bad idea to clobber their definitions. # # The sequence changes the escape character to ^^ so that # escapes will be passed through to the printer. Only trouble # is that ^^ won't be - ^^ was chosen to be unlikely. # Unfortunately, if you're sending raster bits through to be # plotted, any character you choose will be likely, so we lose. # # \EQ"\EY(^W (send anything from printer to host, for xon/xoff) # cannot be # in is2 because it will hang a c100 with no printer # if sent twice. c100|concept100|concept|c104|c100-4p|hds concept 100:\ :am:bs:eo:mi:ul:xn:\ :co#80:li#24:pb#9600:vt#8:\ :al=\E\022:bl=^G:cd=\E\005:ce=\E\025:cl=\E?\E\005:\ :cm=\Ea%+ %+ :cr=\r:dc=\E\021:dl=\E\002:do=^J:ei=\E :\ :i1=\EK:i2=\Ev \Ep\n:im=\E^P:ip=:\ :is=\EU\Ef\E7\E5\E8\El\ENH\E\200\Eo&\200\Eo'\E\Eo\041\200\E\007\041\E\010A@ \E4#\072"\E\072a\E4#;"\E\072b\E4#<"\E\072c:\ :k1=\E5:k2=\E6:k3=\E7:k4=\E8:k5=\E9:k6=\E\072a:k7=\E\072b:\ :k8=\E\072c:kA=\E^R:kB=\E':kD=\E^Q:kE=\E^S:kF=\E[:kI=\E^P:\ :kL=\E^B:kM=\E\200:kN=\E-:kP=\E.:kR=\E\:kS=\E^C:kT=\E]:\ :kb=^H:kd=\E<:ke=\Ex:kh=\E?:kl=\E>:kr=\E=:ks=\EX:kt=\E_:\ :ku=\E;:le=^H:mb=\EC:me=\EN@:mh=\EE:mk=\EH:mp=\EI:mr=\ED:\ :nd=\E=:pf=\036o \E\EQ\041\EYP\027:\ :po=\EQ"\EY(\027\EYD\Eo \036:rp=\Er%.%+ :se=\Ed:sf=^J:\ :so=\ED:ta=\011:te=\Ev \Ep\r\n:\ :ti=\EU\Ev 8p\Ep\r\E\025:ue=\Eg:up=\E;:us=\EG:vb=\Ek\EK: c100-rv|c100-rv-4p|concept100-rv|c100 rev video:\ :i1=\Ek:se=\Ee:so=\EE:vb=\EK\Ek:ve@:vs@:tc=c100: oc100|oconcept|c100-1p|old 1 page concept 100:\ :in:\ :i3@:tc=c100: # :ta: through :ce: included to specify padding needed in raw mode. # (avt-ns: added empty to suppress a tic warning --esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) avt-ns|concept avt no status line:\ :am:bs:eo:mi:ul:xn:xo:\ :co#80:it#8:li#24:lm#192:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(1:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[2g:dc=\E[P:dl=\E[M:do=^J:ei=\E4l:\ :ho=\E[H:i1=\E[=103l\E[=205l:ic=\E[@:im=\E1:ip=:\ :is=\E[1*q\E[2\041t\E[7\041t\E[=4;101;119;122l\E[=107;118;207h\E[1Q\EW\E[\041y\E[\041z\E>\E[0\0720\07232\041r\E[0*w\E[w\E2\r\n\E[2;27\041t:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kD=\E^B\r:kI=\E^A\r:kb=^H:\ :kd=\E[B:ke=\E[\041z\E[0;2u:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[1\041z\E[0;3u:ku=\E[A:le=^H:ll=\E[24H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mh=\E[1\041{:mr=\E[7m:nd=\E[C:rc=\E8:\ :sc=\E7:se=\E[7\041{:sf=\n:so=\E[7m:sr=\EM:st=\EH:ta=\011:\ :te=\E[w\E2\r\n:ti=\E[=4l\E[1;24w\E2\r:ue=\E[4\041{:\ :up=\E[A:us=\E[4m:ve=\E[=119l:vs=\E[=119h: avt-rv-ns|concept avt in reverse video mode/no status line:\ :i1=\E[=103l\E[=205h:vb=\E[=205l\E[=205h:\ :tc=avt-ns: avt-w-ns|concept avt in 132 column mode/no status line:\ :i1=\E[=103h\E[=205l:ti=\E[H\E[1;24;1;132w:\ :tc=avt-ns: avt-w-rv-ns|concept avt in 132 column mode/no status line/reverse video:\ :i1=\E[=103h\E[=205h:ti=\E[H\E[1;24;1;132w:\ :vb=\E[=205l\E[=205h:tc=avt-ns: # Concept AVT with status line. We get the status line using the # "Background status line" feature of the terminal. We swipe the # first line of memory in window 2 for the status line, keeping # 191 lines of memory and 24 screen lines for regular use. # The first line is used instead of the last so that this works # on both 4 and 8 page AVTs. (Note the lm#191 or 192 - this # assumes an 8 page AVT but lm isn't currently used anywhere.) # avt+s|concept avt status line changes:\ :es:hs:\ :lm#191:\ :ds=\E[0*w:fs=\E[1;1\041w:\ :i2=\E[2w\E[2\041w\E[1;1;1;80w\E[H\E[2*w\E[1\041w\E2\r\n:\ :te=\E[2w\E2\r\n:ti=\E[2;25w\E2\r:\ :ts=\E[2;1\041w\E[;%p1%dH\E[2K: avt|avt-s|concept-avt|avt w/80 columns:\ :tc=avt+s:tc=avt-ns: avt-rv|avt-rv-s|avt reverse video w/sl:\ :i1=\E[=103l\E[=205h:vb=\E[=205l\E[=205h:tc=avt+s:tc=avt-ns: avt-w|avt-w-s|concept avt 132 cols+status:\ :i1=\E[=103h\E[=205l:ti=\E[H\E[1;24;1;132w:tc=avt+s:tc=avt-ns: avt-w-rv|avt-w-rv-s|avt wide+status+rv:\ :i1=\E[=103h\E[=205h:ti=\E[H\E[1;24;1;132w:\ :vb=\E[=205l\E[=205h:tc=avt+s:\ :tc=avt-ns: #### Contel Business Systems. # # Contel c300 and c320 terminals. contel300|contel320|c300|Contel Business Systems C-300 or C-320:\ :am:in:xo:\ :co#80:li#24:sg#1:\ :al=\EL:bl=^G:cd=\EJ:ce=\EI:cl=\EK:cm=\EX%+ \EY%+ :cr=^M:\ :ct=\E3:dc=\EO:dl=\EM:do=^J:ei=:ho=\EH:ic=\EN:im=:ip=:k0=\ERJ:\ :k1=\ERA:k2=\ERB:k3=\ERC:k4=\ERD:k5=\ERE:k6=\ERF:k7=\ERG:\ :k8=\ERH:k9=\ERI:kb=^H:le=^H:ll=\EH\EA:me=\E\041\200:\ :nd=\EC:se=\E\041\200:sf=^J:so=\E\041\r:st=\E1:up=\EA:\ :vb=\020\002\020\003: # Contel c301 and c321 terminals. contel301|contel321|c301|c321|Contel Business Systems C-301 or C-321:\ :ei=:ic@:im=:ip@:se=\E\041\200:so=\E\041\r:vb@:\ :tc=contel300: #### Data General (dg) # # According to James Carlson writing in January 1995, # the terminals group at Data General was shut down in 1991; all these # terminals have thus been discontinued. # # According to the 4.4BSD termcap file, the dg200 :cm: should be the # termcap equivalent of \020%p2%{128}%+%c%p1%{128}%+%c (in termcap # notation that's "^P%r%+\200%+\200"). Those \200s are suspicious, # maybe they were originally nuls (which would fit). dg200|data general dasher 200:\ :NL:am:bs:bw:\ :co#80:li#24:\ :bl=^G:ce=^K:cl=^L:cm=\020%r%.%.:cr=^M:do=^Z:ho=^H:k0=^^z:\ :k1=^^q:k2=^^r:k3=^^s:k4=^^t:k5=^^u:k6=^^v:k7=^^w:k8=^^x:\ :k9=^^y:kd=^Z:kh=^H:kl=^Y:kr=^X:ku=^W:l0=f10:le=^Y:nd=^X:\ :nw=^J:se=^^E:sf=^J:so=^^D:ue=^U:up=^W:us=^T: # Data General 210/211 (and 410?) from Lee Pearson (umich!lp) via BRL dg210|dg-ansi|Data General 210/211:\ :am:\ :co#80:li#24:\ :cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:do=\E[B:ho=\E[H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:nl=\E[B:\ :nw=\r\E[H\E[A\n:se=\E[0;m:so=\E[7;m:ue=\E[0;m:up=\E[A:\ :us=\E[4;m: # From: Peter N. Wan # courtesy of Carlos Rucalde of Vantage Software, Inc. # (dg211: this had :cm=\020%r%.%:., which was an ancient termcap hangover. # I suspect the d200 function keys actually work on the dg211, check it out.) dg211|Data General d211:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb=^Y:l0@:nw=^M^Z:\ :se=00\036E\200/>:sf@:so=5\036D:ta=^I:te=^L:ti=^L^R:ve=^L:\ :vs=^L^R:\ :tc=dg200: # dg450 from cornell dg450|dg6134|data general 6134:\ :le@:nd=^X:tc=dg200: # Note: lesser Dasher terminals will not work with vi because vi insists upon # having a command to move straight down from any position on the bottom line # and scroll the screen up, or a direct vertical scroll command. The 460 and # above have both, the D210/211, for instance, has neither. We must use ANSI # mode rather than DG mode because standard UNIX tty drivers assume that ^H is # backspace on all terminals. This is not so in DG mode. # (dg460-ansi: removed obsolete ":kn#6:"; also removed ":mu=\EW:", on the # grounds that there is no matching ":ml:" # fixed garbled ":k9=\E[00\:z:" capability -- esr) dg460-ansi|Data General Dasher 460 in ANSI-mode:\ :am:bs:ms:ul:\ :co#80:it#8:li#24:\ :al=\E[L:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%2;%2H:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:is=^^F@:k0=\E[001z:\ :k1=\E[002z:k2=\E[003z:k3=\E[004z:k4=\E[005z:k5=\E[006z:\ :k6=\E[007z:k7=\E[008z:k8=\E[009z:k9=\E[010z:kb=\E[D:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:l0=f1:l1=f2:l2=f3:\ :l3=f4:l4=f5:l5=f6:l6=f7:l7=f8:l9=f10:le=^H:mb=\E[5m:me=\E[m:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:nl=\ED:se=\E[m:sf=\E[S:so=\E[7m:\ :sr=\E[T:ta=^I:ue=\E[05:up=\E[A:us=\E[4m: # From: Wayne Throop # Data General 605x # Ought to work for a Model 6242, Type D210 as well as a 605x. # Note that the cursor-down key transmits ^Z. Job control users, beware! # This also matches a posted description of something called a `Dasher 100' # so there's a dg100 alias here. # (dg6053: the 4.4BSD file had :le=^H:, :do=^J:, :nd=^S:. -- esr) dg6053|dg100|data general 6053:\ :am:bs:bw:ul:\ :co#80:li#24:\ :bc=^Y:bl=^G:ce=^K:cl=^L:cm=\020%r%.%.:cr=^M:do=^Z:ho=^H:\ :is=^R:k0=^^q:k1=^^r:k2=^^s:k3=^^t:k4=^^u:k5=^^v:k6=^^w:\ :k7=^^x:k8=^^y:k9=^^z:kb=^Y:kd=^Z:kh=^H:kl=^Y:kr=^X:ku=^W:\ :le=^Y:nd=^X:se=\200^^E:so=\200\200\200\200\200\036D:\ :ta=^I:te=^L:ti=^L^R:ue=^U:up=^W:us=^T:ve=^L:vs=^L^R: #### Datamedia (dm) # # Datamedia was headquartered in Nashua, New Hampshire in 1993. # As of early 1996, at least one company called `Datamedia' has been taken # over by: # # Axent Technologies, Inc. # 2400 Research Boulevard # Rockville, Maryland 20850 # voice: +1 301/258-5043 # fax: +1 301/330-5756 # email: # # makers of OmniGuard client/server security software. They are a software # only company and no longer make terminals. However, the operator there # told me that she had once spoken to a customer looking for Datamedia # terminals who'd mentioned a Datamedia in New Jersey. This is backed up # by comp.terminals poosting describing the ID plate on the back of a # "Datamedia 3000" terminal. Was this an earlier incarnation of Axent? # Inquiring minds want to know... # cs10|colorscan|Datamedia Color Scan 10:\ :ms:\ :co#80:li#24:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%02;%02H:cr=^M:\ :do=^J:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[C:se=\E[m:sf=^J:\ :so=\E[7m:ue=\E[m:up=\E[A:us=\E[4m: cs10-w|Datamedia Color Scan 10 with 132 columns:\ :co#132:\ :cm=\E[%i%02;%03H:tc=cs10: # (dm1520: removed obsolete ":ma=^\ ^_^P^YH:" -- esr) dm1520|dm1521|datamedia 1520:\ :am:bs:xn:\ :co#80:it#8:li#24:\ :bl=^G:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :cr=^M:do=^J:ho=^Y:\ :kd=^J:kh=^Y:kl=^H:kr=^\:ku=^_:le=^H:nd=^\:sf=^J:ta=^I:up=^_: dm2500|datamedia2500|datamedia 2500:\ :bs:nc:\ :co#80:li#24:\ :al=\020\n\030\035\030\035:bl=^G:ce=^W:cl=^^^^\177:\ :cm=\014%r%n%.%.:dc=\020\010\030\035:\ :dl=\020\032\030\035:dm=^P:do=^J:ed=^X^]:\ :ei=\377\377\030\035:ho=^B:ic=\020\034\030\035:im=^P:\ :le=^H:nd=^\:pc=\377:se=^X^]:sf=^J:so=^N:up=^Z: # dmchat is like DM2500, but DOES need "all that padding" (jcm 1/31/82) # also, has a meta-key. # From: # (dmchat: ":MT:" changed to ":km:" -- esr) dmchat|dmchat version of datamedia 2500:\ :km:\ :al=1*\020\n\030\035\030\035:dl=2\020\032\030\035:tc=dm2500: # (dm3025: ":MT:" changed to ":km:" -- esr) dm3025|datamedia 3025a:\ :bs:km:\ :co#80:it#8:li#24:\ :al=\EP\n\EQ:bl=^G:cd=\EJ:ce=\EK:cl=\EM:cm=\EY%r%+ %+ :\ :cr=^M:dc=\010:dl=\EP\EA\EQ:dm=\EP:do=^J:ed=\EQ:ei=\EQ:\ :ho=\EH:im=\EP:ip=:is=\EQ\EU\EV:le=^H:nd=\EC:se=\EO0:sf=^J:\ :so=\EO1:ta=^I:up=\EA: dm3045|datamedia 3045a:\ :am:bs:eo:km@:ul:xn:\ :al@:dc=\EB:dl@:dm@:ed@:ei=\EP:is=\EU\EV:k0=\Ey\r:k1=\Ep\r:\ :k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:k7=\Ev\r:\ :k8=\Ew\r:k9=\Ex\r:kh=\EH:kr=\EC:ku=\EA:pc=\177:se@:so@:\ :tc=dm3025: # Datamedia DT80 soft switches: # 1 0=Jump 1=Smooth # Autorepeat 0=off 1=on # Screen 0=Dark 1=light # Cursor 0=u/l 1=block # # 2 Margin Bell 0=off 1=on # Keyclick 0=off 1=on # Ansi/VT52 0=VT52 1=Ansi # Xon/Xoff 0=Off 1=On # # 3 Shift3 0=Hash 1=UK Pound # Wrap 0=Off 1=On # Newline 0=Off 1=On # Interlace 0=Off 1=On # # 4 Parity 0=Odd 1=Even # Parity 0=Off 1=On # Bits/Char 0=7 1=8 # Power 0=60Hz 1=50Hz # # 5 Line Interface 0=EIA 1=Loop # Aux Interface 0=EIA 1=Loop # Local Copy 0=Off 1=On # Spare # # 6 Aux Parity 0=Odd 1=Even # Aux Parity 0=Off 1=On # Aux Bits/Char 0=7 1=8 # CRT Saver 0=Off 1=On # dm80/1 is a vt100 lookalike, but it doesn't seem to need any padding. dm80|dmdt80|dt80|datamedia dt80/1:\ :cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=%i\E[%d;%dH:do=^J:\ :ho=\E[H:me=\E[m:nd=\E[C:pf=\E[4i:po=\E[5i:ps=\E[0i:\ :se=\E[m:so=\E[7m:sr=\EM:ue=\E[m:up=\E[A:us=\E[4m:\ :tc=vt100: # except in 132 column mode, where it needs a little padding. # This is still less padding than the vt100, and you can always turn on # the ^S/^Q handshaking, so you can use vt100 flavors for things like # reverse video. dm80w|dmdt80w|dt80w|datamedia dt80/1 in 132 char mode:\ :co#132:\ :cd=20\E[0J:ce=20\E[0K:cl=50\E[H\E[2J:cm=5\E[%i%d;%dH:\ :do=^J:up=5\E[A:\ :tc=dm80: # From: Adam Thompson Sept 10 1995 dt80-sas|Datamedia DT803/DTX for SAS usage:\ :am:bw:\ :co#80:li#24:\ :ac=``a1fxgqh0jYk?lZm@nEooppqDrrsstCu4vAwBx3yyzz{{||}}~~:\ :ae=\EG:al=\EL:as=\EF:bl=^G:cd=^K:ce=^]:cl=^L:\ :cm=\E=%r%+ %+ :cr=^M:\ :..cs=\E=%p1%' '%+%c%' '%c\E#1\E=%p2%' '%+%c%' '%c\E#2:\ :ct=\E'0:dl=\EM:do=\EB:ff=^L:ho=^Y:is=\E)0\E<\EP\E'0\E$2:\ :kC=^L:kE=^]:kS=^K:kd=^J:kh=^Y:kl=^H:kr=^\:ku=^_:le=^H:me=^X:\ :mr=\E$2\004:nd=^\:pf=^O:po=^N:se=^X:sf=\EB:so=\E$2\004:\ :sr=\EI:st=\E'1:ta=^I:up=^_: # Datamedia Excel 62, 64 from Gould/SEL UTX/32 via BRL # These aren't end-all Excel termcaps; but do insert/delete char/line # and name some of the extra function keys. (Mike Feldman ccvaxa!feldman) # The naming convention has been bent somewhat, with the use of E? (where # E is for 'Excel') as # a name. This was done to distinguish the entries # from the other Datamedias in use here, and yet to associate a model of # the Excel terminals with the regular datamedia terminals that share # major characteristics. excel62|excel64|datamedia Excel 62:\ :dc=\E[P:ei=\E[4l:im=\E[4h:k5=\EOu:k6=\EOv:k7=\EOw:k8=\EOx:\ :k9=\EOy:kb=^H:kd=^J:kl=^H:\ :tc=dt80: excel62-w|excel64-w|datamedia Excel 62 in 132 char mode:\ :dc=\E[P:ei=\E[4l:im=\E[4h:k5=\EOu:k6=\EOv:k7=\EOw:k8=\EOx:\ :k9=\EOy:kb=^H:kd=^J:kl=^H:\ :tc=dt80w: excel62-rv|excel64-rv|datamedia Excel 62 in reverse video mode:\ :dc=\E[P:ei=\E[4l:im=\E[4h:k5=\EOu:k6=\EOv:k7=\EOw:k8=\EOx:\ :k9=\EOy:kb=^H:kd=^J:kl=^H:vb=\E[?5l\E[?5h:\ :tc=dt80: #### Falco # # Falco Data Products # 440 Potrero Avenue # Sunnyvale, CA 940864-196 # Vox: (800)-325-2648 # Fax: (408)-745-7860 # Net: techsup@charm.sys.falco.com # # Current Falco models as of 1995 are generally ANSI-compatible and support # emulations of DEC VT-series, Wyse, and Televideo types. # # Test version for Falco ts-1. See for info # This terminal was released around 1983 and was discontinued long ago. # The standout and underline highlights are the same. falco|ts1|ts-1|falco ts-1:\ :am:bs:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET\EG0\010:cl=\E*:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:is=\Eu\E3:\ :k0=^A0\r:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:me=\Eg0:nd=^L:\ :se=\Eg0:sf=^J:so=\Eg1:ta=^I:ue=\Eg0:up=^K:us=\Eg1: falco-p|ts1p|ts-1p|falco ts-1 with paging option:\ :am:bs:da:db:mi:ms:ul:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET\EG0\010\Eg0:cl=\E*:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=\E[B:ei=\Er:im=\Eq:\ :is=\EZ\E3\E_c:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:me=\Eg0:nd=\E[C:se=\Eg0:sf=^J:so=\Eg4:ta=^I:te=\E_b:\ :ti=\E_d:ue=\Eg0:up=\E[A:us=\Eg1: # (ts100: I added / based on the init string -- esr) ts100|ts100-sp|falco ts100-sp:\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E~E:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E~W:dl=\E~R:do=^J:eA=\E(B:ei=:ho=\E[H:\ :i1=\E~)\E~ea:ic=\E~Q:im=:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: ts100-ctxt|falco ts-100 saving context:\ :te=\E~_b:ti=\E~_d\E[2J:tc=ts100: #### Florida Computer Graphics # # Florida Computer Graphics Beacon System, using terminal emulator program # "host.com", as provided by FCG. This description is for an early release # of the "host" program. Known bug: :cd: clears the whole screen, so it's # commented out. # From: David Bryant 1/7/83 beacon|FCG Beacon System:\ :am:da:db:\ :co#80:li#32:\ :al=\EE:bl=\ESTART\r\E37\r\EEND\r:ce=\ET:cl=\EZ:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=:ho=\EH:ic=\EQ:\ :im=:le=^H:mb=\ESTART\r\E61\0541\r\EEND\r:\ :me=\ESTART\r\E78\r\E70\0540\r\EEND\r:\ :mr=\ESTART\r\E59\0541\r\EEND\r:nd=\EV:\ :se=\ESTART\r\E70\0540\r\EEND\r:sf=^J:\ :so=\ESTART\r\E70\0546\r\EEND\r:te=:\ :ti=\ESTART\r\E2\0540\r\E12\r\EEND\r:\ :ue=\ESTART\r\E60\0540\r\EEND\r:up=\EU:\ :us=\ESTART\r\E60\0541\r\EEND\r: #### Fluke # # The f1720a differences from ANSI: no auto margin, destructive # tabs, # of lines, funny highlighting and underlining f1720|f1720a|fluke 1720A:\ :xt:\ :co#80:li#16:sg#1:ug#1:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :do=\E[B:is=\E[H\E[2J:kd=^]:kl=^_:kr=^^:ku=^\:le=^H:me=\E[m:\ :nd=\E[C:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ue=\E[m:up=\E[A:\ :us=\E[4m: #### Liberty Electronics (Freedom) # # Liberty Electronics # 48089 Fremont Blvd # Fremont CA 94538 # Vox: (510)-623-6000 # Fax: (510)-623-7021 # From: # (f100: added empty to suppress a tic warning; # made this relative to adm+sgr -- note that isn't # known to work for f100 but does on the f110. --esr) f100|freedom|freedom100|freedom model 100:\ :am:bs:bw:hs:mi:ms:xo:\ :co#80:li#24:\ :ac=:ae=\E$:al=\EE:as=\E%:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :ch=\E]%+ :cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E3:cv=\E[%+ :\ :dc=\EW:dl=\ER:do=^J:ds=\Eg\Ef\r:ei=\Er:fs=^M:ho=^^:im=\Eq:\ :ip=:is=\Eg\Ef\r\Ed:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:\ :kB=\EI:kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:sf=^J:\ :sr=\Ej:st=\E1:ta=^I:ts=\Eg\Ef:up=^K:vb=\Eb\Ed:\ :tc=adm+sgr: f100-rv|freedom-rv|freedom 100 in reverse video:\ :is=\Eg\Ef\r\Eb:vb=\Ed\Eb:tc=f100: # The f110 and f200 have problems with vi(1). They use the ^V # code for the down cursor key. When kcud1 is defined in terminfo # as ^V, the Control Character Quoting capability (^V in insert mode) # is lost! It cannot be remapped in vi because it is necessary to enter # a ^V to to quote the ^V that is being remapped!!! # # f110/f200 users will have to decide whether # to lose the down cursor key or the quoting capability. We will opt # initially for leaving the quoting capability out, since use of VI # is not generally applicable to most interactive applications # (f110: added :ta:, :kh: & from f100 -- esr) f110|freedom110|Liberty Freedom 110:\ :bw@:es:\ :it#8:ws#80:\ :ae=\E%%:al=\EE:as=\E$:dl=\ER:do=^V:ds=\Ef\r:ei=\Er\EO:\ :im=\EO\Eq:ip@:is@:k0=^AI\r:k;@:kA=\EE:kC=^^:kD=\EW:kE=\ET:\ :kI=\EQ:kL=\ER:kS=\EY:mb=\EG2:md=\EG0:mh=\EG@:pf=\Ea:po=\E`:\ :so=\EG<:sr=\EJ:ts=\Ef:vb=\Eb\Ed:ve=\E.2:vi=\E.1:vs=\E.2:\ :tc=f100: f110-14|Liberty Freedom 110 14inch:\ :dc@:tc=f110: f110-w|Liberty Freedom 110 - 132 cols:\ :co#132:tc=f110: f110-14w|Liberty Freedom 110 14in/132 cols:\ :co#132:\ :dc@:tc=f110: # (f200: added to suppress tic warnings re :as:/:ae: --esr) f200|freedom200|Liberty Freedom 200:\ :am:bs:es:hs:mi:ms:xo:\ :co#80:it#8:li#24:ws#80:\ :ac=:ae=\E%%:al=\EE:as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :ch=\E]%+ :cl=^Z:cm=\E=%+ %+ :cr=^M:cs=\Em0%+ %+ :ct=\E3:\ :cv=\E[%+ :dc=\EW:dl=\ER:do=^V:ds=\Ef\r:ei=\Er:fs=^M:ho=^^:\ :im=\Eq:k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=\EE:kC=^^:\ :kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^V:kl=^H:kr=^L:\ :ku=^K:le=^H:mb=\EG2:md=\EG0:mh=\EG@:nd=^L:pf=\Ea:po=\E`:\ :sf=^J:so=\EG<:sr=\EJ:st=\E1:ts=\Ef:up=^K:vb=\Eo\En:ve=\E.1:\ :vi=\E.0:vs=\E.1:\ :tc=adm+sgr: f200-w|Liberty Freedom 200 - 132 cols:\ :co#132:tc=f200: # The f200 has the ability to reprogram the down cursor key. The key is # reprogrammed to ^J (linefeed). This value is remembered in non-volatile RAM, # so powering the terminal off and on will not cause the change to be lost. f200vi|Liberty Freedom 200 for vi:\ :kd=^J:vb=\Eb\Ed:tc=f200: f200vi-w|Liberty Freedom 200 - 132 cols for vi:\ :co#132:tc=f200vi: #### GraphOn (go) # # Graphon Corporation # 544 Division Street # Campbell, CA 95008 # Vox: (408)-370-4080 # Fax: (408)-370-5047 # Net: troy@graphon.com (Troy Morrison) # # # The go140 and go225 have been discontinued. GraphOn now makes X terminals, # including one odd hybrid that starts out life on power-up as a character # terminal, than can be switched to X graphics mode (driven over the serial # line) by an escape sequence. No info on this beast yet. # (go140: I added / based on the init string -- esr) go140|graphon go-140:\ :bs:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=10\E[J:ce=\E[K:\ :cl=10\E[H\E[2J:cm=\E[%i%2;%2H:dc=\E[P:dl=\E[M:ei=\E[4l:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E<\E=\E[?3l\E[?7l\E(B\E[J\E7\E[;r\E8\E[m\E[q:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kd=\EOB:ke=\E[?1l\E>:\ :kh=\E[H:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: go140w|graphon go-140 in 132 column mode:\ :am:\ :co#132:\ :is=\E<\E=\E[?3h\E[?7h\E(B\E[J\E7\E[;r\E8\E[m\E[q:tc=go140: # Hacked up vt200 termcap to handle GO-225/VT220 # From: # (go225: I added / based on the init string -- esr) go225|go-225|Graphon 225:\ :am:bs:mi:xn:\ :co#80:it#8:li#25:vt#3:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=^J:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:ke=\E>:kh=\E[H:kl=\E[D:\ :kr=\E[C:ks=\E=:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:r1=\E[\041p\E[?7h\E[2;1;1#w:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:te=\E[\041p\E[?7h\E[2;1;1#w:\ :ti=\E[2;0#w\E[1;25r:ue=\E[24m:up=\E[A:us=\E[4m: #### Harris (Beehive) # # Bletch. These guys shared the Terminal Brain Damage laurels with Hazeltine. # Their terminal group is ancient history now (1995) though the parent # company is still in business. # # Beehive documentation is undated and marked Preliminary and has no figures # so we must have early Superbee2 (Model 600, according to phone conversation # with mfr.). It has proved reliable except for some missing padding # (notably after \EK and at bottom of screen). # # The key idea is that AEP mode is poison for :cm: & that US's in # the local memory should be avoided like the plague. That means # that the 2048 character local buffer is used as 25 lines of 80 # characters, period. No scrolling local memory, folks. It also # appears that we cannot use naked INS LINE feature since it uses # US. The sbi fakes :al: with an 80-space insert that may be too # slow at low speeds; also spaces get converted to \040 which is # too long for some programs (not vi). DEL LINE is ok but slow. # # The string is designed for last line of screen ONLY; cup to # 25th line corrects the motion inherent in scrolling to Page 1. # # There is one understood bug. It is that the screen appears to # pop to a new (blank) page after a :nw:, or leave a half-line # ellipsis to a quad that is the extra 48 memory locations. The # data received is dumped into memory but not displayed. Not to # worry if :cm: is being used; the lines not displayed will be, # whenever the cursor is moved up there. Since :cm: is addressed # relative to MEMORY of window, nothing is lost; but beware of # relative cursor motion (:up:,:do:,:nd:,:le:). Recommended, # therefore, is setenv MORE -c . # # WARNING: Not all features tested. # # Timings are assembled from 3 sources. Some timings may reflect # SB2/Model 300 that were used if more conservative. # Tested on a Model 600 at 1200 and 9600 bd. # # The BACKSPACEkb option is cute. The NEWLINE key, so cleverly # placed on the keyboard and useless because of AEP, is made # into a backspace key. In use ESC must be pressed twice (to send) # and sending ^C must be prefixed by ESC to avoid that weird # transmit mode associated with ENTER key. # # IF TERMINAL EVER GOES CATATONIC with the cursor buzzing across # the screen, then it has dropped into ENTER mode; hit # RESET--ONLINE--!tset. # # As delivered this machine has a FATAL feature that will throw # it into that strange transmit state (SPOW) if the space bar is # hit after a CR is received, but before receiving a LF (or a # few others). # # The circuits MUST be modified to eliminate the SPOW latch. # This is done by strapping on chip A46 of the I/O board; cut # the p.c. connection to Pin 5 and strap Pin 5 to Pin 8 of that # chip. This mod has been checked out on a Mod 600 of Superbee II. # With this modification absurdly high timings on cr are # unnecessary. # # NOTE WELL that the rear panel switch should be set to CR/LF, # not AEP! # sb1|beehive superbee:\ :am:bs:bw:da:db:mi:ul:xb:\ :co#80:li#25:sg#1:ug#1:\ :al=\EN\EL\EQ \EP \EO\ER\EA:\ :bl=^G:bt=\E`:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EF%r%03%03:cr=\r:\ :ct=\E3:dc=\EP:dl=\EM:do=^J:ei=\ER:ho=\EH:im=\EQ\EO:\ :is=\EE\EX\EZ\EO\Eb\Eg\ER:k0=\E2:k1=\Ep:k2=\Eq:k3=\Er:\ :k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:k9=\E1:kE=\EK:kI=\EQ\EO:\ :kL=\EM:kM=\ER:kS=\EJ:kb=^_:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :ku=\EA:l0=TAB CLEAR:l9=TAB SET:le=^H:me=\E_3:nd=\EC:\ :se=\E_3:sf=^J:so=\E_1:st=\E1:ta=^I:te=:ti=\EO:ue=\E_3:\ :up=\EA:us=\E_0: sbi|superbee|beehive superbee at Indiana U.:\ :xb:\ :al=1\EN\EL\EQ \EP \EO\ER\EA:cr=\r:tc=sb1: # Alternate (older) description of Superbee - f1=escape, f2=^C. # Note: there are at least 3 kinds of superbees in the world. The sb1 # holds onto escapes and botches ^C's. The sb2 is the best of the 3. # The sb3 puts garbage on the bottom of the screen when you scroll with # the switch in the back set to CRLF instead of AEP. This description # is tested on the sb2 but should work on all with either switch setting. # The f1/f2 business is for the sb1 and the :xb: can be taken out for # the other two if you want to try to hit that tiny escape key. # This description is tricky: being able to use cup depends on there being # 2048 bytes of memory and the hairy string. superbee-xsb|beehive super bee:\ :am:da:db:xb:\ :co#80:it#8:li#25:\ :cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EF%r%3%3:cr=\r:ct=\E3:dc=\EP:\ :dl=\EM:do=^J:ho=\EH:is=\EH\EJ:k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:\ :k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :ku=\EA:le=^H:me=\E_3:nd=\EC:se=\E_3:\ :sf=\n\200\200\200\n\200\200\200\EA\EK\200\200\200\ET\ET:\ :so=\E_1:st=\E1:ta=^I:up=\EA:ve=^J: # This loses on lines > 80 chars long, use at your own risk superbeeic|super bee with insert char:\ :ei=\ER:ic=:im=\EQ:tc=superbee-xsb: sb2|sb3|fixed superbee:\ :xb@:tc=superbee: # Reports are that most of these Beehive entries (except superbee) have not # been tested and do not work right. :se: is a trouble spot. Be warned. # (bee: :ic: was empty, which is obviously bogus -- esr) beehive|bee|harris beehive:\ :am:bs:mi:\ :co#80:li#24:\ :al=\EL:bt=\E>:cd=\EJ:ce=\EK:cl=\EE:cm=\EF%+ %+ :dc=\EP:\ :dl=\EM:do=\EB:ei=\E@:ho=\EH:im=\EQ:kA=\EL:kB=\E>:kC=\EE:\ :kD=\EP:kE=\EK:kI=\EQ:kL=\EM:kM=\E@:kb=^H:kd=\EB:kh=\EH:\ :kl=\ED:kr=\EC:ku=\EA:le=^H:me=\Ed@:nd=\EC:se=\Ed@:so=\EdP:\ :ue=\Ed@:up=\EA:us=\Ed`: # set tab is ^F, clear (one) tab is ^V, no way to clear all tabs. # good grief - does this entry make :sg:/:ug: when it doesn't have to? # look at those spaces in :se:/:so:. Seems strange to me... # (beehive: :if=/usr/share/tabset/beehive: removed, no such file. If you # really care, cook up one using ^F -- esr) beehive3|bh3m|beehiveIIIm|harris beehive 3m:\ :am:bs:\ :co#80:it#8:li#20:\ :al=\023:bl=^G:cd=^R:ce=^P:cl=^E^R:cr=^M:dl=\021:do=^J:ho=^E:\ :le=^H:ll=^E^K:nd=^L:se= ^_:sf=^J:so=^] :st=^F:ta=^I:up=^K: beehive4|bh4|beehive 4:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EE:cr=^M:do=^J:ho=\EH:le=\ED:nd=\EC:\ :sf=^J:up=\EA: microb|microbee|micro bee series:\ :am:bs:\ :co#80:it#8:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EE:cm=\EF%+ %+ :cr=^M:do=^J:k1=\Ep:\ :k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:k9=\Ex:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:me=\Ed@:nd=\EC:\ :se=\Ed@:sf=^J:so= \EdP:ta=^I:ue=\Ed@:up=\EA:us=\Ed`: # 8675, 8686, and bee from Cyrus Rahman # (8675: changed k10, k11...k16 to k;, F1...F6 -- esr) ha8675|harris 8675:\ :F1=^W:F2=\ER:F3=\EE:F4=\EI:F5=\Ei:F6=\Eg:\ :is=\ES\E#\E*\Eh\Em\E?\E1\E9\E@\EX\EU:k1=^F:k2=^P:k3=^N:\ :k4=^V:k5=^J:k6=^T:k7=^H:k8=\177:k9=\Ee:k;=\Ed:\ :tc=bee: # (8686: changed k10, k11...k16 to k;, F1...F6; fixed broken continuation # in :is: -- esr) ha8686|harris 8686:\ :F1=\EW:F2=\002\E{\003:F3=\002\E|\003:F4=\002\E}\003:\ :F5=\002\E~\003:F6=\002\E\177\003:\ :is=\ES\E#\E*\Eh\Em\E?\E1\E9\E@\EX\EU\E"*Z01\E"8F35021B7C83#\E"8F45021B7D83#\E"8F55021B7E83#\E"8F65021B7F83#\E"8F75021B7383#\E"8F851BD7#\E"8F95021B7083#\E"8FA5021B7183#\E"8FB5021B7283#:\ :k1=\002\Ep\003:k2=\002\Eq\003:k3=\002\Er\003:\ :k4=\002\Es\003:k5=\E3:k6=\EI:k7=\ER:k8=\EJ:k9=\E(:k;=\Ej:tc=bee: #### Hazeltine # # Hazeltine appears to be out of the business now (1995). These guys were # co-owners of the Terminal Brain Damage Hall Of Fame along with Harris. # They have a hazeltine.com domain and can be reached at: # # Hazeltine # 450 East Pulaski Road # Greenlawn, New York 11740 # # As late as 1993, manuals for the terminal product line could still be # purchased from: # # TRW Customer Service Division # 15 Law Drive # P.O. Box 2076 # Fairfield, NJ 07007-2078 # # Since :nd: is blank, when you want to erase something you # are out of luck. You will have to do ^L's a lot to # redraw the screen. h1000 is untested. It doesn't work in # vi - this terminal is too dumb for even vi. (The code is # there but it isn't debugged for this case.) hz1000|hazeltine 1000:\ :bs:\ :co#80:li#12:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=^K:le=^H:nd= :sf=^J: # From: Thu Aug 20 09:09:18 1981 hz1420|hazeltine 1420:\ :am:bs:\ :co#80:li#24:\ :al=\E^Z:bl=^G:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E\021%r%.%+ :\ :cr=^M:dl=\E^S:do=^J:le=^H:nd=^P:se=\E^Y:sf=^J:so=\E^_:ta=^N:\ :up=\E^L: # New "safe" cursor movement (11/87) from . Prevents # freakout with out-of-range args and tn3270. No hz since it needs to # receive tildes. hz1500|hazeltine 1500:\ :am:bs:hz:\ :co#80:li#24:\ :al=~\032:bl=^G:cd=~\030:ce=~^O:cl=~^\:\ :cm=~\021%r%>^^ %+`%+`:cr=^M:dl=~\023:do=~^K:ho=~^R:kd=^J:\ :kh=~^R:kl=^H:kr=^P:ku=~^L:le=^H:nd=^P:se=~^Y:sf=^J:so=~^_:\ :up=~^L: # h1510 assumed to be in sane escape mode. Else use h1500. # (h1510: early versions of this entry apparently had ":se=\E^_:, # :so=\E^Y:, but these caps were commented out in 8.3; also, # removed incorrect and overridden ":do=^J:" -- esr) hz1510|hazeltine 1510:\ :am:bs:\ :co#80:li#24:\ :al=\E^Z:bl=^G:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E\021%r%.%.:\ :cr=^M:dl=\E^S:do=\E^K:le=^H:nd=^P:sf=^J:up=\E^L: # Hazeltine 1520 # The following switch settings are assumed for normal operation: # FULL CR U/L_CASE ESCAPE # FORMAT_OFF EOM_A_OFF EOM_B_OFF WRAPAROUND_ON # Other switches may be set for operator convenience or communication # requirements. hz1520|Hazeltine 1520:\ :am:bs:bw:ms:\ :co#80:li#24:\ :al=\E^Z:bl=^G:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E\021%r%.%.:\ :cr=^M:dl=\E^S:do=^J:ho=\E^R:kA=\E^Z:kC=\E^\:kE=\E^O:\ :kL=\E^S:kS=\E^X:kb=^H:kd=\E^K:kh=\E^R:kl=^H:kr=^P:ku=\E^L:\ :le=^H:md=\E^_:me=\E^Y:nd=^P:r1=\E$\E\005\E?\E\031:\ :se=\E^Y:sf=^J:so=\E^_:up=\E^L: # This version works with the escape switch off # (h1520: removed incorrect and overridden ":do=^J:" -- esr) hz1520-noesc|hazeltine 1520:\ :am:hz:\ :co#80:li#24:\ :al=~^Z:bl=^G:cd=~^X:ce=~^O:cl=~^\:cm=~\021%r%.%.:cr=^M:\ :dl=~^S:do=~^K:ho=~^R:le=^H:nd=^P:se=~^Y:sf=^J:so=~^_:up=~^L: # Note: the h1552 appears to be the first Hazeltine terminal which # is not braindamaged. It has tildes and backprimes and everything! # Be sure the auto lf/cr switch is set to cr. hz1552|hazeltine 1552:\ :bs:\ :al=\EE:dl=\EO:do=^J:k1=\EP:k2=\EQ:k3=\ER:l1=blue:l2=red:\ :l3=green:\ :tc=vt52: hz1552-rv|hazeltine 1552 reverse video:\ :do=^J:se=\ET:so=\ES:tc=hz1552: # Note: h2000 won't work well because of a clash between upper case and ~'s. hz2000|hazeltine 2000:\ :am:bs:nc:\ :co#74:li#27:\ :al=~\032:bl=^G:cl=~\034:cm=~\021%r%.%.:dl=~\023:do=^J:\ :ho=~^R:le=^H:pc=\177:sf=^J: # Date: Fri Jul 23 10:27:53 1982. Some unknown person wrote: # I tested this termcap entry for the Hazeltine Esprit with vi. It seems # to work ok. There is one problem though if one types a lot of garbage # characters very fast vi seems not able to keep up and hangs while trying # to insert. That's in insert mode while trying to insert in the middle of # a line. It might be because the Esprit doesn't have insert char and delete # char as a built in function. Vi has to delete to end of line and then # redraw the rest of the line. esprit|Hazeltine Esprit I:\ :am:bs:bw:\ :co#80:li#24:\ :al=\E^Z:bl=^G:bt=\E^T:cd=\E^W:ce=\E^O:cl=\E^\:\ :cm=\E\021%r%.%.:cr=^M:dl=\E^S:do=\E^K:ho=\E^R:is=\E?:\ :k0=^B0^J:k1=^B1^J:k2=^B2^J:k3=^B3^J:k4=^B4^J:k5=^B5^J:\ :k6=^B6^J:k7=^B7^J:k8=^B8^J:k9=^B9^J:kb=^H:kd=\E^K:ke=\E>:\ :kh=\E^R:kl=^H:kr=^P:ks=\E<:ku=\E^L:l0=0:l1=1:l2=2:l3=3:l4=4:\ :l5=5:l6=6:l7=7:l8=8:l9=9:le=^H:nd=^P:se=\E^Y:sf=^J:so=\E^_:\ :up=\E^L: esprit-am|hazeltine esprit auto-margin:\ :am:tc=esprit: # Hazeltine Modular-1 from Cliff Shackelton via BRL # Vi it seems always wants to send a control J for "do" and it turned out # that the terminal would work somewhat if the auto LF/CR was turned off. # (hmod1: removed :dn=~^K: -- esr) hmod1|Hazeltine Modular 1:\ :am:bs:hz:\ :co#80:li#24:\ :al=~^Z:bl=^G:bt=~^T:cl=~^\:cm=~\021%r%.%.:cr=^M:dl=~^S:\ :do=~^K:ho=~^R:kd=~^K:kh=~^R:kl=^H:kr=^P:ku=~^L:le=^H:me=~^Y:\ :nd=^P:rc=~^Q:sc=~^E:se=~^Y:sf=^J:so=~^_:up=~^L: # # Hazeltine Executive 80 Model 30 (1554?) # from Will Martin via BRL # Like VT100, except for different "am" behavior. hazel|exec80|h80|he80|Hazeltine Executive 80:\ :am:bs:pt:\ :co#80:it#8:li#24:vt#3:\ :bl=^G:cd=50\E[J:ce=3\E[K:cl=50\E[;H\E[2J:\ :cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:do=^J:ho=\E[H:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:me=2\E[m:mr=2\E[7m:\ :nd=2\E[C:nl=^J:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:se=2\E[m:\ :so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:us=2\E[4m: #### IBM # ibm327x|line mode IBM 3270 style:\ :gn:\ :ce=^M:cl=^M^J:ho=^M: # Beware! The 3101 entry IBM shipped with AIX 3 is *wrong*. Losers... # From: J.B. Nicholson-Owens 8 Mar 94 # (ibm3101: :if=/usr/share/tabset/ibm3101: removed, no such file -- esr) ibm3101|i3101|IBM 3101-10:\ :am:bs:xo:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EK:cm=\EY%+ %+ :cr=^M:ct=\E1:do=^J:\ :ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :nw=^M^J:sf=^J:st=\E0:ta=^I:up=\EA: # Received from the IBM terminals division (given to DRB) # June 1988 for PS/2 OS 2.2.3 cut ibm3151|i3151|IBM 3151:\ :me=\E4@:\ :..sa=\E4%{64}%?%p1%{0}%>%p1%{4}%<%&%t%{8}%|%;%?%p1%{7}%=%t%{16}%|%;%?%p2%t%{1}%|%;%?%p3%t%{4}%|%;%?%p4%t%{2}%|%;%c:\ :se=\E4@:so=\E4A:ue=\E4@:us=\E4B:\ :tc=ibm3163: # From: Mark Easter 29 Oct 1992 # I've commented out or translated some IBM extensions. ibm3161|ibm3163|wy60-316X|wyse60-316X|IBM 3161/3163 display:\ :am:bs:mi:ms:\ :co#80:it#8:li#24:\ :F1=\Ek\r:F2=\El\r:F3=\E\041a\r:F4=\E\041b\r:\ :F5=\E\041c\r:F6=\E\041d\r:F7=\E\041e\r:F8=\E\041f\r:\ :F9=\E\041g\r:FA=\E\041h\r:FB=\E\041i\r:FC=\E\041j\r:\ :FD=\E\041k\r:FE=\E\041l\r:\ :ac=l\354q\361k\353x\370j\352m\355w\367u\365v\366t\364n\356:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:dc=\EQ:\ :dl=\EO:do=\EB:ho=\EH:k1=\Ea\r:k2=\Eb\r:k3=\Ec\r:k4=\Ed\r:\ :k5=\Ee\r:k6=\Ef\r:k7=\Eg\r:k8=\Eh\r:k9=\Ei\r:k;=\Ej\r:\ :kA=\EN:kB=\E2:kC=\EL\r:kD=\EQ:kE=\EI:kI=\EP \010:kL=\EO:\ :kS=\EJ:kT=\E0:ka=\E 1:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :kt=\E1:ku=\EA:le=\ED:mb=\E4D:md=\E4H:me=\E4@\E<@:mk=\E4P:\ :mr=\E4A:nd=\EC:\ :..sa=\E4%'@'%?%p1%t%'A'%|%;\n%?%p2%t%'B'%|%;\n%?%p3%t%'A'%|%;\n%?%p4%t%'D'%|%;\n%?%p5%t%'@'%|%;\n%?%p6%t%'H'%|%;\n%?%p7%t%'P'%|%;%c\n%?%p9%t\E>A%e\E<@%;:\ :se=\E4@:sf=^J:so=\E4A:te=\E>A:ti=\E>A:ue=\E4@:up=\EA:\ :us=\E4B: # How the 3164 sgr string works: # %{32} # push space for no special video characteristics # %?%p2%t%{1}%|%; # if p2 set, then OR the 1 bit for reverse # %?%p3%t%{4}%|%; # if p3 set, then OR the 4 bit for blink # %?%p4%t%{2}%|%; # if p4 set, then OR the 2 bit for underline # %c # pop Pa1 # %{39}%p1%- # calculate 32 + (7 - p1) for foreground # %c # pop Pa2 # %{64} # use only black background for now # %c # pop Pa3 ibm3164|i3164|IBM 3164:\ :mb=\E4D:md=\E4H:me=\E4@:\ :..sa=\E4%{32}%?%p2%t%{1}%|%;%?%p3%t%{4}%|%;%?%p4%t%{2}%|%;%c%{39}%p1%-%c%{64}%c:tc=ibm3163: ibmaed|IBM Experimental display:\ :am:bs:eo:ms:\ :co#80:it#8:li#52:\ :al=\EN:cd=\EJ:ce=\EI:cl=\EH\EK:cm=\EY%+ %+ :dc=\EQ:dl=\EO:\ :do=\EB:ei=:ho=\EH:ic=\EP:im=:kb=^H:kd=\EB:kl=\ED:kr=\EC:\ :ku=\EA:le=^H:me=\E0:nd=\EC:se=\E0:so=\E0:ta=^I:up=\EA:\ :vb=\EG: ibm-apl|apl|IBM apl terminal simulator:\ :li#25:tc=dm1520: # (ibmmono: this had an unknown `sb' boolean, I changed it to `bs'. # Also it had ":I0=f10:" which pretty obviously should be "l0=f10" -- esr) ibmmono|ibm5151|IBM workstation monochrome:\ :es:hs:\ :al=\EL:dl=\EM:ds=\Ej\EY8 \EI\Ek:fs=\Ek:k0=\E<:k1=\ES:\ :k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:k8=\ER:k9=\EY:\ :kF=\EE:kI=\200:kN=\EE:kP=\Eg:kR=\EG:kb=^H:kh=\EH:l0=f10:\ :md=\EZ:me=\Ew\Eq\Ez\EB:mk=\EF\Ef0;\Eb0;:mr=\Ep:se=\Ez:\ :so=\EZ:sr=\EA:ts=\Ej\EY8%+ \Eo:ue=\Ew:us=\EW:\ :tc=ibm3101: ibmega|ibm5154|IBM Enhanced Color Display:\ :cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ibmmono: ibmega-c|ibm5154-c|IBM Enhanced Color Display:\ :se=\EB:so=\EF\Ef3;:ue=\EB:us=\EF\Ef2;:tc=ibmmono: ibmvga-c|IBM VGA display color termcap:\ :cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ibmega-c: ibmvga|IBM VGA display:\ :cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ibmega: # ibmapa* and ibmmono entries come from ACIS 4.3 distribution rtpc|ibmapa16|ibm6155|IBM 6155 Extended Monochrome Graphics Display:\ :li#32:\ :ds=\Ej\EY@ \EI\Ek:ts=\Ej\EY@%+ \Eo:tc=ibmmono: # Advanced Monochrome (6153) and Color (6154) Graphics Display: ibmapa8c|ibmapa8|ibm6154|ibm6153|IBM 6153/4 Advanced Graphics Display:\ :li#31:\ :ds=\Ej\EY? \EI\Ek:ts=\Ej\EY?%+ \Eo:tc=ibmmono: ibmapa8c-c|ibm6154-c|IBM 6154 Advanced Color Graphics Display:\ :li#31:\ :ds=\Ej\EY? \EI\Ek:mh=\EF\Ef7;:ts=\Ej\EY?%+ \Eo:tc=ibmega-c: # From: Marc Pawliger # also in /usr/lpp/bos/bsdsysadmin. # (hft-c: this entry had :kb=\E[D:kf=\E[C: on the line with ku/kd/kh; this was # pretty obviously mislabeled for :le: and :nd:; also ":ul=\E[4m:" was clearly # a typo for ":us=\E[4m:"; also ":el=\E[K:" was a typo for ":ce=\E[K:". # I also added / based on the terminal reset string. # There was an unknown boolean ":ht:" which I assume was meant to set hardware # tabs, so I have inserted it#8. Finally, :ac=^N: paired with the :ae: looked # like a typo for :as=^N:; finally, added empty to quiet tic -- esr) ibm8512|ibm8513|hft-c|IBM High Function Terminal:\ :am:mi:ms:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DL=\E[%dM:RA=\E[?7l:SA=\E[?7h:ac=:ae=^O:al=\E[L:\ :as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:dl=\E[M:\ :dm=\E[4h:do=^J:ec=\E[%dX:ed=\E[4l:ei=\E[4l:ho=\E[H:\ :im=\E[4h:is=\Eb\E[m\017\E[?7h:k0=\E[010q:k1=\E[001q:\ :k2=\E[002q:k3=\E[003q:k4=\E[004q:k5=\E[005q:k6=\E[006q:\ :k7=\E[007q:k8=\E[008q:k9=\E[009q:kd=\E[B:kh=\E[H:ku=\E[A:\ :le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r1=\Eb\E[m\017\E[?7h\E[H\E[J:rc=\E[u:sc=\E[s:se=\E[m:\ :so=\E[7m:te=\E[20h:ti=\E[20;4l\E[?7h\Eb:ue=\E[m:up=\E[A:\ :us=\E[4m: hft|AIWS High Function Terminal:\ :am:xo:\ :co#80:li#25:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=\E6:ho=\E[H:\ :ic=\E[@:im=\E6:k1=\E[001q:k2=\E[002q:k3=\E[003q:\ :k4=\E[004q:k5=\E[005q:k6=\E[006q:k7=\E[007q:k8=\E[008q:\ :k9=\E[009q:kN=\E[153q:kP=\E[159q:ka=\E[010q:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mk=\E[8m:mr=\E[7m:nd=\E[C:se=\E[m:sf=^J:\ :so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: ibm-system1|system1|ibm system/1 computer:\ :am:xt:\ :co#80:li#24:\ :bl=^G:cl=^Z:cm=\005%+ %+ :ho=^K:le=^H:nd=^\:sf=^J:up=^^: # From: ibm5081|ibmmpel|IBM 5081 1024x1024 256/4096 color display:\ :es:hs:\ :li#33:\ :ds=\Ej\EYA \EI\Ek:fs=\Ek:ts=\Ej\EYA%+ \Eo:tc=ibmmono: ibm5081-c|ibmmpel-c|IBM 5081 1024x1024 256/4096 enhanced color display:\ :es:hs:\ :li#33:\ :ds=\Ej\EYA \EI\Ek:fs=\Ek:ts=\Ej\EYA%+ \Eo:tc=ibmega-c: ibm8514|IBM 8514 color display:\ :es:hs:\ :li#41:\ :cr=^M:do=^J:ds=\Ej\EYI \EI\Ek:fs=\Ek:kb=^H:kd=^J:kl=^H:\ :nw=^M^J:sf=^J:ta=^I:ts=\Ej\EYI%+ \Eo:\ :tc=ibmega: ibm8514-c|IBM 8514 color display:\ :es:hs:\ :li#41:\ :cr=^M:do=^J:ds=\Ej\EYI \EI\Ek:fs=\Ek:kb=^H:kd=^J:kl=^H:\ :nw=^M^J:sf=^J:ta=^I:ts=\Ej\EYI%+ \Eo:\ :tc=ibmega-c: # # AIX entries. IBM ships these with AIX 3. # AIX extension caps are commented out, # except for box1 which has been translated to an string. # aixterm-m|IBM AIXterm Monochrome Terminal Emulator:\ :es:hs:\ :ac=llqqkkxxjjmmwwuuvvttnn:ds=\E[?E:fs=\E[?F:md=\E[1m:\ :me=\E[0;10m\E(B:s0=\E(B:s1=\E(0:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sr@:ts=\E[?%p1%dT:\ :tc=ibm6153: aixterm-m-old|IBM AIXterm Monochrome Terminal Emulator:\ :es:hs:\ :ds=\E[?E:fs=\E[?F:md=\E[1m:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sr@:ts=\E[?%p1%dT:\ :tc=ibm6153: jaixterm-m|IBM Kanji AIXterm Monochrome Terminal Emulator:\ :ac@:\ :tc=aixterm-m: #### Infoton/General Terminal Corp. # # gt100 sounds like something DEC would come out with. Let's hope they don't. i100|gt100|gt100a|General Terminal 100A (formerly Infoton 100):\ :am:bs:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=^L:cm=\Ef%r%+ %+ :cr=^M:\ :dl=\EM:do=^J:ho=\EH:le=^H:nd=\EC:se=\Ea:sf=^J:so=\Eb:up=\EA:\ :vb=\Eb\Ea: i400|infoton 400:\ :am:bs:\ :co#80:li#25:\ :al=\E[L:bl=^G:ce=\E[N:cl=\E[2J:cm=%i\E[%3;%3H:cr=^M:\ :dc=\E[4h\E[2Q\E[P\E[4l\E[0Q:dl=\E[M:do=^J:\ :ei=\E[4l\E[0Q:im=\E[4h\E[2Q:le=^H:nd=\E[C:sf=^J:up=\E[A: # (addrinfo: removed obsolete ":bc=^Z:" -- esr) addrinfo:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^K:cl=^L:..cm=\037%p1%{1}%-%c%p2%{1}%-%c:cr=^M:\ :do=^J:ho=^H:le=^Z:ll=^H^\:nd=^Y:sf=^J:up=^\: # (infoton: used to have the no-ops , , -- esr) infoton:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^K:cl=^L:cr=^M:do=^J:le=^Z:ll=^H^\:nd=^Y:sf=^J:\ :up=^\: #### Interactive Systems Corp # # ISC used to sell OEMed and customized hardware to support ISC UNIX. # ISC UNIX still exists in 1995, but ISC itself is no more; they got # bought out by Sun. # # From: Wed Sep 16 08:06:44 1981 # (intext: removed obsolete ":ma=^K^P^R^L^L ::bc=^_:", also the # ":le=^_:" later overridden -- esr) intext|Interactive Systems Corporation modified owl 1200:\ :am:bs:\ :co#80:it#8:li#24:sg#1:\ :al=\020:bl=^G:bt=^Y:cd=\026J:ce=^Kp^R:cl=\014:\ :cm=\017%+ %+ :cr=^M:dc=\022:dl=\021:do=^J:ei=^V<:im=^V;:\ :ip=:k0=^VJ\r:k1=^VA\r:k2=^VB\r:k3=^VC\r:k4=^VD\r:k5=^VE\r:\ :k6=^VF\r:k7=^VG\r:k8=^VH\r:k9=^VI\r:kb=^H:kd=^J:ke=^V9:\ :kh=^Z:kl=^_:kr=^^:ks=\036\072\264\026%:ku=^\:le=^H:nd=^^:\ :se=^V# :sf=^J:so=^V$\054:ta=^I:up=^\: intext2|intextii|INTERACTIVE modified owl 1251:\ :am:bw:ul:\ :co#80:li#24:sg#0:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%+^AG:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=:ic=\E[@:im=:k0=\E@\r:k1=\EP\r:k2=\EQ\r:\ :k3=\ES\r:k4=\ET\r:k5=\EU\r:k6=\EV\r:k7=\EW\r:k8=\EX\r:\ :k9=\EY\r:kb=^H:kd=\EB\r:kh=\ER\r:kl=\ED\r:kr=\EC\r:\ :ku=\EA\r:l0=REFRSH:l1=DEL CH:l2=TABSET:l3=GOTO:l4=+PAGE:\ :l5=+SRCH:l6=-PAGE:l7=-SRCH:l8=LEFT:l9=RIGHT:nd=\E[C:\ :se=\E[2 D:sf=\E[S:so=\E[6 D:sr=\E[T:ta=^I:ue=\E[2 D:\ :up=\E[A:us=\E[18 D:\ :vb=\E[;;;;;;;;;2;;u\E[;;;;;;;;;1;;u: #### Kimtron (abm, kt) # # Kimtron entries include (undocumented) codes for: enter dim mode, # enter bold mode, enter reverse mode, turn off all attributes. # # Kimtron ABM 85 added by Dual Systems # (abm85: removed duplicated ":kd=^J:" -- esr) abm85|Kimtron ABM 85:\ :am:bs:bw:ms:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EE:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :dc=\EW:\ :dl=\ER:do=^J:ei=\Er:if=/usr/share/tabset/stdcrt:im=\EQ:\ :is=\EC\EX\Eg\En\E%\Er\E(\Ek\Em\Eq:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\Ek:so=\Ej:ta=^I:ue=\Em:\ :up=^K:us=\El: # Kimtron ABM 85H added by Dual Systems. # Some notes about the abm85h entries: # 1) there are several firmware revs of 85H in the world. Use abm85h-old for # firmware revs prior to SP51 # 2) Make sure to use abm85h entry if the terminal is in 85h mode and the # abm85e entry if it is in tvi920 emulation mode. They are incompatible # in some places and NOT software settable i.e., :is: can't fix it) # 3) In 85h mode, the arrow keys and special functions transmit when # the terminal is in dup-edit, and work only locally in local-edit. # Vi won't swallow `del char' for instance, but :ti: turns on # dup-edit anyway so that the arrow keys will work right. If the # arrow keys don't work the way you like, change :ti:, :te:, and # :is:. Note that 920E mode does not have software commands to toggle # between dup and local edit, so you get whatever was set last on the # terminal. # 4) :vb: attribute is nice, but seems too slow to work correctly # (\Eb:pc:\Ed) # 5) Make sure `hidden' attributes are selected. If `embedded' attributes # are selected, the entry should be removed. # 6) auto new-line should be on (selectable from setup mode only) # # From: Erik Fair Sun Oct 27 07:21:05 1985 abm85h|Kimtron ABM 85H native mode:\ :hs:\ :sg@:\ :bl=^G:ds=\Ee:fs=^M:im=\EZ:\ :is=\EC\EN\EX\024\016\EA\Ea\E%\E9\Ee\Er\En\E"\E}\E'\E(\Ef\r\EG0\Ed\E.4\El:\ :kd=^V:me=\E(\EG0:mh=\E):mk@:ts=\Eg\Ef:vb@:ve=\E.4:vs=\E.2:\ :tc=adm+sgr:tc=abm85: abm85e|Kimtron ABM 85H in 920E mode:\ :sg@:\ :bl=^G:im=\EZ:\ :is=\EC\EX\EA\E%\E9\Ee\Er\En\E"\E}\E'\E(\Ef\r\Ek\Eq\Em:\ :me=\E(\Ek:mh=\E):mr=\Ej:vb@:\ :tc=abm85: abm85h-old|oabm85h|o85h|Kimtron ABM 85H with old firmware rev.:\ :sg@:\ :bl=^G:im=\EZ:\ :is=\E}\EC\EX\Ee\En\E%\Er\E(\Ek\Em\Eq\Ed\ET\EC\E9\EF:\ :me=\E(\Ek:mh=\E):mr=\Ej:\ :tc=abm85: # From: # (kt7: removed obsolete :ma=^V^J^L :" -- esr) kt7|kimtron model kt-7:\ :am:bs:\ :co#80:it#8:li#24:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :dc=\EW:\ :dl=\ER:do=^V:ei=:fs=\Eg:ho=^^:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:is=\El\E":k0=^AI\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=\EE:kB=\EI:kC=^Z:kD=\EW:\ :kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:\ :ku=^K:le=^H:mk@:nd=^L:ta=^I:ts=\Ef:up=^K:\ :tc=adm+sgr: # Renamed TB=^I to :ta:, BE=^G to :bl:, BS=^H to :kb:, N to :kS: (based on the # other kt7 entry and the adjacent key capabilities). Removed EE which is # identical to :mh:. Removed :ES=\EGD: which is some kind of highlight # but we can't figure out what. kt7ix|kimtron model kt-7 or 70 in IX mode:\ :am:bw:\ :co#80:it#8:li#25:\ :@7=\EY:PU=\EK:ac=lZm@k?jYt4uCvAwBqDx3nE:ae=\E%:al=\EE:\ :as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^V:ds=\Ef\r:ei=:fs=^M:ho=^^:ic=\EQ:\ :im=:is=\EG0\E s\017\E~:k0=^AI\r:k1=^A@\r:k2=^AA\r:\ :k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:\ :k9=^AH\r:kA=\EE:kB=\EI:kC=\E*:kE=\ET:kI=\EQ:kL=\ER:kN=\EJ:\ :kS=\EY:kb=^H:kd=\E[B:kh=^^:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\EG2:me=\EG0:mh=\EG@:nd=^L:nw=^M^J:se=\EG0:sf=^J:\ :so=\EG4:ta=^I:ts=\Ef:ue=\EG0:up=^K:us=\EG8:ve=\E.3:vi=\E.0: #### Microdata/MDIS # # This was a line of terminals made by McDonnell-Douglas Information Systems. # These entries come direct from MDIS documentation. I have edited them only # to move primary names of the form p[0-9] * to aliases, and to comment out # :ae:/:as: in a couple of entries without strings. I have # also removed the change history; the last version indicates this is # version 4.3 by A.Barkus, September 1990 (earliest entry is October 1989). # # McDonnell Information Systems Terminal Family History # ========================================= # # Prism-1, Prism-2 and P99: # Ancient Microdata and CMC terminals, vaguely like Adds Regent 25. # # Prism-4 and Prism-5: # Slightly less ancient range of Microdata terminals. Follow-on from # Prism-2, but with many enhancements. P5 has eight display pages. # # Prism-6: # A special terminal for use with library systems, primarily in Germany. # Limited numbers. Similar functionality to P5 (except attributes?). # # Prism-7, Prism-8 and Prism-9: # More recent range of MDIS terminals, in which P7 and P8 # replace the P4 & P5, with added functionality, and P9 is the flagship. # The P9 has two emulation modes - P8 and ANSI - and includes a # large number of the DEC VT220 control sequences. Both # P8 and P9 support 80c/24ln/8pg and 132cl/24li/4pg formats. # # Prism-12 and Prism-14: # Latest range, functionally very similar to the P9. The P14 has a # black-on-white overscanning screen. # # The terminfo definitions given here are: # # p2 - Prism-2 (or Prism-1 or P99). # # p4 - Prism-4 (and older P7s & P8s). # p5 - Prism-5 (or Prism-6). # # p7 - Prism-7. # p8 - Prism-8 (in national or multinational mode). # p8-w - 132 column version of p8. # p9 - Prism-9 in ANSI mode. # p9-w - 132 column version of p9. # p9-8 - Prism-9 in Prism-8 emulation mode. # p9-8-w - As p9-8, but with 132 columns. # # p12 - Prism-12 in ANSI mode. # p12-w - 132 column version of p12. # p12-m - Prism-12 in MDC emulation mode. # p12-m-w - As p12-m, but with 132 columns. # p14 - Prism-14 in ANSI mode. # p14-w - 132 column version of p14. # p14-m - Prism-14 in MDC emulation mode. # p14-m-w - As p14-m, but with 132 columns. # # p2: Prism-2 # ----------- # # Includes Prism-1 and basic P99 without SP or MP loaded. # The simplest form of Prism-type terminal. # Basic cursor movement and clearing operations only. # No video attributes. # Notes: # Horizontal cursor qualifiers of NUL, XON and XOFF are mapped to the next # value up, followed by backspace. # P2|MDC Prism-2:\ :am:bw:ms:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:\ :..ch=\020%p1%{10}%/%{16}%*%p1%{10}%m%+%Pc%?%{17}%gc%=%{19}%gc%=%|%gc%!%|%t%{1}%gc%+%c%{8}%e%gc%;%c:\ :cl=\014:\ :..cm=\013%p1%' '%+%c\020%p2%{10}%/%{16}%*%p2%{10}%m%+%Pc%?%{17}%gc%=%{19}%gc%=%|%gc%!%|%t%{1}%gc%+%c%{8}%e%gc%;%c:\ :cr=^M:cv=\013%+ :do=^J:ho=^A:kb=^H:kh=^A:le=^H:nd=^F:sf=^J:\ :up=^Z: # p4: Prism-4 # ----------- # # Includes early versions of P7 & P8. # Basic family definition for most Prisms (except P2 and P9 ANSI). # Notes: # Horizontal cursor qualifiers of NUL, XON and XOFF are mapped to the next # value up, followed by backspace. # Cursor key definitions removed because they interfere with vi and csh keys. # prism4|p4|P4|MDC Prism-4:\ :5i:am:bw:hs:ms:\ :co#80:li#24:sg#1:ug#1:ws#72:\ :bl=^G:cd=\EJ:ce=\EK:\ :..ch=\020%p1%{10}%/%{16}%*%p1%{10}%m%+%Pc%?%{17}%gc%=%{19}%gc%=%|%gc%!%|%t%{1}%gc%+%c%{8}%e%gc%;%c:\ :cl=\014:\ :..cm=\013%p1%' '%+%c\020%p2%{10}%/%{16}%*%p2%{10}%m%+%Pc%?%{17}%gc%=%{19}%gc%=%|%gc%!%|%t%{1}%gc%+%c%{8}%e%gc%;%c:\ :cr=^M:cv=\013%+ :do=^J:ds=\035\343\035\345:fs=^]\345:\ :ho=^A^J:kb=^H:kh=^A:le=^H:mb=^CB:me=^C :mh=^CA:mk=^CH:\ :mr=^CD:nd=^F:pf=\ET:po=\ER:ps=\EU:\ :..sa=\003%'@'%?%p1%p3%|%t%{4}%+%;%?%p2%t%{16}%+%;%?%p4%t%{2}%+%;%?%p5%t%{1}%+%;%?%p7%t%{8}%+%;%c%?%p9%t\016%e\017%;:\ :se=^C :sf=^J:so=^CD:ts=^]\343:ue=^C :up=^Z:us=^CP:\ :ve=^]\342:vi=^]\344: # p5: Prism-5 # ----------- # # Same definition as p4. Includes Prism-6 (not tested!). # Does not use any multi-page features. # prism5|p5|P5|MDC Prism-5:\ :tc=p4: # p7: Prism-7 # ----------- # # Similar definition to p4. Uses ANSI cursor motion to avoid network problems. # Notes: # Use p4 for very early models of P7. # Rev-index removed; can't send nulls to terminal in 8-bit modes. # prism7|p7|P7|MDC Prism-7:\ :ch@:cm=\E[%i%d;%dH:cv@:tc=p4: # p8: Prism-8 # ----------- # # Similar definition to p7. Uses ANSI cursor motion to avoid network problems. # Supports national and multinational character sets. # Notes: # Alternate char set operations only work in multinational mode. # Use p4 for very early models of P8. # Rev-index removed; can't send nulls to terminal in 8-bit modes. # (esr: commented out :as:/:ae: because there's no ) # prism8|p8|P8|MDC Prism-8:\ :ch=\E[%i%d`:cm=\E[%i%d;%dH:cv=\E[%i%dd:is=\E[<12h:tc=p4: # p8-w: Prism-8 in 132 column mode # -------------------------------- # # 'Wide' version of p8. # Notes: # Rev-index removed; can't send nulls to terminal in 8-bit modes. # prism8-w|p8-w|P8-W|MDC Prism-8 in 132 column mode:\ :co#132:\ :is=\E[<12h\E[<14h:tc=p8: # p9: Prism-9 in ANSI mode # ------------------------- # # The "flagship" model of this generation of terminals. # ANSI X3.64 (ISO 6429) standard sequences, plus many DEC VT220 ones. # Notes: # Tabs only reset by "reset". Otherwise assumes default (8 cols). # Fixes to deal with terminal firmware bugs: # . 'ri' uses insert-line since rev index doesn't always # . 'sgr0' has extra '0' since esc[m fails # . 'fsl' & 'dsl' use illegal char since cr is actioned wrong on line 25 # Not covered in the current definition: # . Labels # . Programming Fn keys # . Graphic characters (defaults correctly to vt100) # . Padding values (sets xon) # (esr: commented out :as:/:ae: because there's no ) # # (untranslatable capabilities removed to fit entry within 1023 bytes) prism9|p9|P9|MDC Prism-9 in ANSII mode:\ :5i:am:bw:hs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:ws#72:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:\ :F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:F6=\E[29~:\ :F7=\E[31~:F8=\E[32~:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%i%d`:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%d%v:ct=\E[2g:\ :cv=\E[%i%dd:dc=\E[P:dl=\E[M:do=^J:ds=\E[%}\024:ec=\E[%dX:\ :ei=\E[4l:fs=^T:ho=\E[H:im=\E[4h:is=\E[&p\E[<12l\E F:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kC=^L:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mp=\E[32%{:mr=\E[7m:nd=\E[C:\ :nw=^M^J:pf=\E[4i:po=\E[5i:ps=\E[i:\ :r2=\E[&p\E[<12l\E F\E[3g\E[9;17;25;33;41;49;57;65;73 N:\ :rc=\E[%z:rp=\E[%r%db%.:sc=\E[%y:se=\E[27m:sf=^J:so=\E[7m:\ :sr=\E[L:st=\EH:ta=^I:ts=\E[%i%p1%d%%}:ue=\E[24m:up=\E[A:\ :us=\E[4m:ve=\E[<4h:vi=\E[<4l: # p9-w: Prism-9 in 132 column mode # -------------------------------- # # 'Wide' version of p9. # prism9-w|p9-w|P9-W|MDC Prism-9 in 132 column mode:\ :co#132:\ :is=\E[&p\E[<12l\E F\E[<14h:\ :r2=\E[&p\E[<12l\E F\E[<14h:tc=p9: # p9-8: Prism-9 in P8 mode # ------------------------ # # P9 terminal in P8 emulation mode. # Similar to p8 definition. # Insertion and deletion operations possible. # prism9-8|p9-8|P9-8|MDC Prism-9 in P8 mode:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:al=\E[L:dc=\E[P:\ :dl=\E[M:ei=:ic=\E[@:im=:\ :tc=p8: # p9-8-w: Prism-9 in P8 and 132 column modes # ------------------------------------------ # # P9 terminal in P8 emulation mode and 132 column mode. # prism9-8-w|p9-8-w|P9-8-W|MDC Prism-9 in Prism 8 emulation and 132 column mode:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:al=\E[L:dc=\E[P:\ :dl=\E[M:ei=:ic=\E[@:im=:\ :tc=p8-w: # p12: Prism-12 in ANSI mode # --------------------------- # # See p9 definition. # prism12|p12|P12|MDC Prism-12 in ANSI mode:\ :tc=p9: # p12-w: Prism-12 in 132 column mode # ---------------------------------- # # 'Wide' version of p12. # prism12-w|p12-w|P12-W|MDC Prism-12 in 132 column mode:\ :tc=p9-w: # p12-m: Prism-12 in MDC emulation mode # ------------------------------------- # # P12 terminal in MDC emulation mode. # Similar to p8 definition. # Insertion and deletion operations possible. # prism12-m|p12-m|P12-M|MDC Prism-12 in MDC emulation mode:\ :tc=p9-8: # p12-m-w: Prism-12 in MDC emulation and 132 column modes # ------------------------------------------------------- # # P12 terminal in MDC emulation mode and 132 column mode. # prism12-m-w|p12-m-w|P12-M-W|MDC Prism-12 in MDC emulation and 132 column mode:\ :tc=p9-8-w: # p14: Prism-14 in ANSII mode # --------------------------- # # See p9 definition. # prism14|p14|P14|MDC Prism-14 in ANSII mode:\ :tc=p9: # p14-w: Prism-14 in 132 column mode # ---------------------------------- # # 'Wide' version of p14. # prism14-w|p14-w|P14-W|MDC Prism-14 in 132 column mode:\ :tc=p9-w: # p14-m: Prism-14 in MDC emulation mode # ------------------------------------- # # P14 terminal in MDC emulation mode. # Similar to p8 definition. # Insertion and deletion operations possible. # prism14-m|p14-m|P14-M|MDC Prism-14 in MDC emulation mode:\ :tc=p9-8: # p14-m-w: Prism-14 in MDC emulation and 132 column modes # ------------------------------------------------------- # # P14 terminal in MDC emulation mode and 132 column mode. # prism14-m-w|p14-m-w|P14-M-W|MDC Prism-14 in MDC emulation and 132 column mode:\ :tc=p9-8-w: # End of McDonnell Information Systems Prism definitions # These things were popular in the Pick database community at one time # From: George Land 24 Sep 1996 p8gl|prism8gl|McDonnell-Douglas Prism-8 alternate definition:\ :am:bw:hs:mi:\ :co#80:li#24:ma#1:sg#1:ug#1:ws#78:\ :F2=^AJ\r:F3=^AK\r:F4=^AL\r:F5=^AM\r:F6=^AN\r:F7=^AO\r:\ :bl=^G:cd=\EJ:ce=\EK:cl=^L:cm=\E[%i%d;%dH:cr=^M:dc= ^H:\ :dl=^P:do=^J:ho=^A:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:\ :kD= ^H:kE=\EK:kL=^P:kS=\EJ:kb=^H:kd=^J:kh=^A:kl=^U:kr=^F:\ :ku=^Z:l1=F1:l2=F2:l3=F3:l4=F4:l5=F5:l6=F6:l7=F7:l8=F8:l9=F9:\ :la=F10:le=^U:mb=^CB:me=^C :mh=^CA:mk=^CH:mr=^CD:nd=^F:\ :nw=^J^M:pc=\200:se=^C :sf=^J:so=^CE:ue=^C :up=^Z:us=^C0: #### Microterm (act, mime) # # The mime1 entries refer to the Microterm Mime I or Mime II. # The default mime is assumed to be in enhanced act iv mode. # # New "safe" cursor movement (5/87) from . Prevents # freakout with out-of-range args on Sytek multiplexors. No :so=^N: and # :se=^N: since it gets confused and it's too dim anyway. No :ic: # since Sytek insists ^S means xoff. # (act4: found ":ic=2^S:ei=:im=:ip=.1*^V:" commented out in 8.3 -- esr) act4|microterm|microterm act iv:\ :am:bs:\ :co#80:li#24:\ :al=2.3*\001<2.3*/>:bl=^G:cd=2.2*\037:ce=.1*\036:\ :cl=12\014:cm=\024%+^X%>/0%+P:cr=^M:dc=.1*\004:\ :dl=2.3*\027:do=^K:ho=^]:kd=^K:kl=^H:kr=^X:ku=^Z:le=^H:nd=^X:\ :sf=^J:up=^Z: # The padding on :sr: and :ta: for act5 and mime is a guess and not final. # The act 5 has hardware tabs, but they are in columns 8, 16, 24, 32, 41 (!)... # (microterm5: removed obsolete ":ma==^Z^P^Xl^Kj:" -- esr) act5|microterm5|microterm act v:\ :kd=^K:kl=^H:kr=^X:ku=^Z:sr=\EH:uc=^H\EA:tc=act4: # Mimes using brightness for standout. Half bright is really dim unless # you turn up the brightness so far that lines show up on the screen. mime-fb|full bright mime1:\ :is=^S\E:se=^S:so=^Y:tc=mime: mime-hb|half bright mime1:\ :is=^Y\E:se=^Y:so=^S:tc=mime: # (mime: removed obsolete ":ma=^X ^K^J^Z^P:"; removed ":do=^K:" that overrode # the more plausible ":do=^J:" -- esr) # uc was at one time disabled to get around a curses bug, be wary of it mime|mime1|mime2|mimei|mimeii|microterm mime1:\ :am:bs:\ :co#80:it#8:li#24:vt#9:\ :al=\001:bl=^G:cd=^_:ce=^^:cl=^]^C:cm=\024%+^X%> 0%+P:\ :cr=^M:dl=\027:do=^J:ho=^]:is=^S\E^Q:kd=^K:kl=^H:kr=^X:ku=^Z:\ :le=^H:nd=^X:sf=^J:sr=\022:ta=\011:uc=^U:up=^Z: # These termcaps (for mime2a) put the terminal in low intensity mode # since high intensity mode is so obnoxious. mime2a-s|microterm mime2a (emulating an enhanced soroc iq120):\ :am:bs:\ :co#80:li#24:\ :al=\001:bl=^G:cd=\EJ:ce=\EK:cl=\EL:cm=\E=%+ %+ :cr=^M:\ :dc=\ED:dl=\027:do=^J:ei=^Z:ho=^^:im=\EE:ip=:is=\E):kd=^J:\ :kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\E;:sf=^J:so=\E\072:sr=\EI:\ :ue=\E7:up=\EI:us=\E6: # This is the preferred mode (but ^X can't be used as a kill character) mime2a|mime2a-v|microterm mime2a (emulating an enhanced vt52):\ :bs:\ :co#80:it#8:li#24:\ :al=\001:bl=^G:cd=\EQ:ce=\EP:cl=\EL:cm=\EY%+ %+ :cr=^M:\ :dc=^N:dl=\027:do=^J:ei=^Z:ho=\EH:im=^O:ip=:is=^Y:kd=\EB:\ :kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\E9:sf=^J:so=\E8:\ :sr=\EA:ta=^I:ue=\E5:up=\EA:us=\E4: # (mime3a: removed obsolete ":ma=^X ^K^J^Z^P:" -- esr) mime3a|mime1 emulating 3a:\ :am@:\ :kd=^K:kl=^H:kr=^X:ku=^Z:tc=adm3a: mime3ax|mime-3ax|mime1 emulating enhanced 3a:\ :it#8:\ :al=\001:cd=^_:ce=^X:dl=\027:ta=\011:tc=mime3a: # Wed Mar 9 18:53:21 1983 # We run our terminals at 2400 baud, so there might be some timing problems at # higher speeds. The major improvements in this model are the terminal now # scrolls down and insert mode works without redrawing the rest of the line # to the right of the cursor. This is done with a bit of a kludge using the # exit graphics mode to get out of insert, but it does not appear to hurt # anything when using vi at least. If you have some users using act4s with # programs that use curses and graphics mode this could be a problem. mime314|mm314|mime 314:\ :am:\ :co#80:li#24:\ :al=^A:cd=^_:ce=^^:cl=^L:cm=\024%.%.:dc=^D:dl=^W:ei=^V:ho=^]:\ :im=^S:kd=^K:kl=^H:kr=^X:ku=^Z:le=^H:nd=^X:ta=^I:up=^Z: # Microterm mime 340 from University of Wisconsin mm340|mime340|mime 340:\ :co#80:li#24:\ :al=46\EU:cd=2*\037:ce=2.1\EL:cl=12\032:cm=\E=%+ %+ :\ :cr=^M:dc=2.1*\E#:dl=49.6\EV:do=^J:is=\E\054:kb=^H:kd=^J:\ :kl=^H:ku=^K:le=^H:nd=^L:nw=^M^J:sf=^J:ta=^I:up=^K: # This came from University of Wisconsin marked "astro termcap for jooss". # (mt4520-rv: removed obsolete ":kn#4:" and incorrect ":ri=\E[C:"; # also added / based on the init string -- esr) mt4520-rv|micro-term 4520 reverse video:\ :am:hs:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[g:dc=\E[P:dl=\E[M:do=\E[B:ei=:\ :fs=\E[?5l\E[?5h:ho=\E[H:ic=\E[@:im=:\ :is=\E(B\E[2l\E>\E[20l\E[?3l\E[?5h\E[?7h\E[1;24r\E[24;1H\E[H\E[J:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:ll=\E[24;1H:me=\E[m:\ :nd=\E[C:nw=\EE:\ :r1=\E(B\E[2l\E>\E[20l\E[?3l\E[?5h\E[?7h\E[H\E[J:\ :rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:se=\E[0m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[25;1H:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5l\E[?5h:ve=\E[0V\E8:\ :vs=\E7\E[0U: # Fri Aug 5 08:11:57 1983 # This entry works for the ergo 4000 with the following setups: # ansi,wraparound,newline disabled, xon/xoff disabled in both # setup a & c. # # WARNING!!! There are multiple versions of ERGO 4000 microcode # Be advised that very early versions DO NOT WORK RIGHT !! # Microterm does have a ROM exchange program- use it or lose big # (ergo400: added / based on the init string -- esr) ergo4000|microterm ergo 4000:\ :da:db:ms:\ :co#80:li#66:\ :AL=\E[1L:RA=\E[?7l:SA=\E[?7m:bl=^G:cd=\E[0J:ce=\E[0K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[1P:dl=\E[1M:\ :do=\E[B:ei=\E[4l:im=\E[4h:\ :is=\E<\E=\E[?1l\E[?4l\E[?5l\E[?7h\E[?8h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kd=\E[B:ke=\E=:kl=\E[D:kr=\E[C:\ :ks=\E=:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:me=\E[m:\ :nd=\E[C:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:up=\E[A: #### NCR # # NCR's terminal group was merged with AT&T's when AT&T bought the company. # For what happened to that group, see the ADDS section. # # There is an NCR4103 terminal that's just a re-badged Wyse-50. # # NCR7900 DIP switches: # # Switch A: # 1-4 - Baud Rate # 5 - Parity (Odd/Even) # 6 - Don't Send or Do Send Spaces # 7 - Parity Enable # 8 - Stop Bits (One/Two) # # Switch B: # 1 - Upper/Lower Shift # 2 - Typewriter Shift # 3 - Half Duplex / Full Duplex # 4 - Light/Dark Background # 5-6 - Carriage Return Without / With Line Feed # 7 - Extended Mode # 8 - Suppress Keyboard Display # # Switch C: # 1 - End of line entry disabled/enabled # 2 - Conversational mode / (Local?) Mode # 3 - Control characters displayed / not displayed # 4 - (2-wire?) / 4-wire communications # 5 - RTS on and off for each character # 6 - (50Hz?) / 60 Hz # 7 - Exit after level zero diagnostics # 8 - RS-232 interface # # Switch D: # 1 - Reverse Channel (yes / no) # 2 - Manual answer (no / yes) # 3-4 - Cursor appearance # 5 - Communication Rate # 6 - Enable / Disable EXT turnoff # 7 - Enable / Disable CR turnoff # 8 - Enable / Disable backspace # # From , init string hacked by SCO. ncr7900i|ncr7900|ncr 7900 model 1:\ :am:bw:ul:\ :co#80:li#24:sg#1:ug#1:\ :bl=^G:cd=\Ek:ce=\EK:cl=^L:cm=\E1%r%.%.:cr=^M:do=^J:\ :is=\E0@\010\E3\E4\E7:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:le=^H:\ :ll=^A:mb=\E0B:me=\E0@:mh=\E0A:mr=\E0P:nd=^F:pf=^T:po=^R:\ :..sa=\E0%p5%'@'%+%p4%{2}%*%+%p3%{16}%*%+%p2%{32}%*%+%p1%{17}%*%+%c:\ :se=\E0@:sf=^J:so=\E0Q:ue=\E0@:up=^Z:us=\E0`: ncr7900iv|ncr 7900 model 4:\ :am:bw:es:hs:\ :co#80:li#24:\ :al=\E^N:bl=^G:cl=^L:cm=\013%+@\E\005%02:cr=^M:dl=\E^O:\ :do=^J:ds=\Ey1:fs=\Ek\Ey5:ho=\013@\E^E00:k1=\ES:k2=\ET:\ :k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:k8=\ER:kb=^H:kd=\EB:\ :kh=\EH:kl=\ED:kr=\EC:ku=\EA:l6=blue:l7=red:l8=white:le=^H:\ :nw=^M^J:sf=^J:ts=\Ej\Ex5\Ex1\EY8%p1%{32}%+%c\Eo: ncr7901|ncr 7901 model:\ :am:bw:ul:\ :co#80:li#24:\ :bl=^G:cd=\Ek:ce=\EK:ch=\020%+^J:cl=^L:cm=\EY%+ %+ :cr=^M:\ :cv=\013%+@:do=^J:is=\E4^O:kC=^L:kd=^J:kh=^H:kl=^U:kr=^F:\ :ku=^Z:le=^H:ll=^A:mb=\E0B:me=^O:mh=\E0A:mr=\E0P:nd=^F:pf=^T:\ :po=^R:\ :..sa=\E0%p5%'@'%+%p4%{2}%*%+%p3%{16}%*%+%p2%{32}%*%+%p1%{17}%*%+%c\016:\ :se=^O:sf=^J:so=\E0Q\016:ue=^O:up=^Z:us=\E0`\016:ve=^X:\ :vi=^W: #### Perkin-Elmer (Owl) # # These are official terminfo entries from within Perkin-Elmer. # bantam|pe550|pe6100|perkin elmer 550:\ :bs:\ :co#80:li#24:\ :bl=^G:ce=\EI:cl=\EK:cm=\EX%+ \EY%+ :cr=^M:do=^J:ho=\EH:\ :le=^H:ll=\EH\EA:nd=\EC:sf=^J:up=\EA: fox|pe1100|perkin elmer 1100:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EH\EJ:cm=\EX%+ \EY%+ :cr=^M:\ :ct=\E3:do=^J:ho=\EH:le=^H:ll=\EH\EA:nd=\EC:sf=^J:st=\E1:\ :up=\EA:vb=\020\002\020\003: owl|pe1200|perkin elmer 1200:\ :am:bs:in:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EI:cl=\EH\EJ:cm=\EX%+ \EY%+ :\ :cr=^M:ct=\E3:dc=\EO:dl=\EM:do=^J:ei=:ho=\EH:ic=\EN:im=:ip=:\ :k0=\ERJ:k1=\ERA:k2=\ERB:k3=\ERC:k4=\ERD:k5=\ERE:k6=\ERF:\ :k7=\ERG:k8=\ERH:k9=\ERI:kb=^H:le=^H:ll=\EH\EA:\ :me=\E\041\200:nd=\EC:se=\E\041\200:sf=^J:so=\E\041^H:\ :st=\E1:up=\EA:vb=\020\002\020\003: pe1251|pe6300|pe6312|perkin elmer 1251:\ :am:\ :co#80:it#8:li#24:pb#300:sg#1:vt#8:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EK:cm=\EX%+ \EY%+ :cr=^M:ct=\E3:\ :do=\EB:ho=\EH:k0=\ERA:k1=\ERB:k2=\ERC:k3=\ERD:k4=\ERE:\ :k5=\ERF:k6=\ERG:k7=\ERH:k8=\ERI:k9=\ERJ:k;=\ERK:le=\ED:\ :nd=\EC:sf=^J:st=\E1:up=\EA: # (pe7000m: this had # rmul=\E!\0, smul=\E!\040, # which is probably wrong, it collides with kf0 pe7000m|perkin elmer 7000 series monochrome monitor:\ :am:\ :co#80:li#24:\ :bl=^G:bt=\E\041Y:cd=\EJ:ce=\EI:cl=\EK:cm=\ES%+ %+ :cr=^M:\ :do=\EB:ho=\EH:i1=\E\041\200\EW 7o\Egf\ES7 :\ :k0=\E\041\200:k1=\E\041^A:k2=\E\041^B:k3=\E\041^C:\ :k4=\E\041^D:k5=\E\041^E:k6=\E\041^F:k7=\E\041^G:\ :k8=\E\041^H:k9=\E\041^I:k;=\E\041^J:kb=^H:kd=\E\041U:\ :kh=\E\041S:kl=\E\041V:kr=\E\041W:ku=\E\041T:le=\ED:\ :ll=\ES7 :nd=\EC:sf=^J:sr=\ER:up=\EA: pe7000c|perkin elmer 7000 series colour monitor:\ :i1=\E\041\200\EW 7o\Egf\Eb0\Ec7\ES7 :se=\Eb0:so=\Eb2:\ :ue=\E\041\200:us=\E\041 :\ :tc=pe7000m: #### Sperry Univac # # Sperry Univac has merged with Burroughs to form Unisys. # # This entry is for the Sperry UTS30 terminal running the TTY # utility under control of CP/M Plus 1R1. The functionality # provided is comparable to the DEC vt100. # (uts30: I added / based on the init string -- esr) uts30|sperry uts30 with cp/m@1R1:\ :am:bw:hs:\ :co#80:li#24:ws#40:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7m:SF=\E[%dB:\ :SR=\E[%dA:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\Ed:al=\EN:as=\EF:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:cs=\EU%+ %+ :dc=\EM:dl=\EL:do=\EB:\ :ei=:fs=^M:ho=\E[H:ic=\EO:im=:is=\E[U 7\E[24;1H:kb=^H:\ :kd=\EOB:kh=\E[H:kl=\EOD:kr=\EOC:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\EC:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\EX:\ :rf=/usr/share/tabset/vt100:sc=\EW:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EI:ta=^I:ts=\E]:uc=\EPB:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\ES:vi=\ER: #### Tandem # # Tandem builds these things for use with its line of fault-tolerant # transaction-processing computers. They aren't generally available # on the merchant market, and so are fairly uncommon. # tandem6510|adm3a repackaged by Tandem:\ :tc=adm3a: # A funny series of terminal that TANDEM uses. The actual model numbers # have a fourth digit after 653 that designates minor variants. These are # natively block-mode and rather ugly, but they have a character mode which # this doubtless(?) exploits. There is a 6520 that is slightly dumber. # (tandem653: had ":sb=\ES:", probably someone's mistake for sf; also, # removed :if=/usr/share/tabset/tandem653:, no such file -- esr) tandem653|t653x|Tandem 653x multipage terminal:\ :am:bs:da:db:hs:\ :co#80:li#24:sg#1:ug#1:ws#64:\ :cd=\EJ:ce=\EK:cl=\EI:cm=\023%+ %+ :do=^J:ds=\Eo\r:fs=^M:\ :ho=\EH:le=^H:me=\E6 :nd=\EC:se=\E6 :sf=\ES:so=\E6$:sr=\ET:\ :ts=\Eo:ue=\E6 :up=\EA:us=\E60: #### Tandy/Radio Shack # # Tandy has a line of VDTs distinct from its microcomputers. # dmterm|deskmate terminal:\ :am:bw:\ :co#80:li#24:\ :al=\EP:bl=^G:cd=\EJ:ce=\EK:cl=\Ej:cm=\EY%+ %+ :cr=^M:\ :dc=\ES:dl=\ER:do=\EB:ei=:ho=\EH:ic=\EQ:im=:k0=\E1:k1=\E2:\ :k2=\E3:k3=\E4:k4=\E5:k5=\E6:k6=\E7:k7=\E8:k8=\E9:k9=\E0:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:l0=f1:l1=f2:l2=f3:l3=f4:\ :l4=f5:l5=f6:l6=f7:l7=f8:l8=f9:l9=f10:le=^H:ll=\EE:mk@:nd=\EC:\ :sf=\EX:ta=^I:ue@:up=\EA:us@:ve=\EG6:vi=\EG5:\ :tc=adm+sgr: dt100|dt-100|Tandy DT-100 terminal:\ :xo:\ :co#80:li#24:sg#1:ug#1:\ :ac=kkllmmjjnnwwvvttuuqqxx:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\010\E[%i%d;%dH:cr=^M:\ :cs=\E[%2;%2r:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:\ :im=:is=\E[?3l\E(B:k1=\E[?3i:k2=\E[2i:k3=\E[@:k4=\E[M:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[?5i:kN=\E[29~:kP=\E[28~:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:l1=f1:l2=f2:l3=f3:l4=f4:l5=f5:l6=f6:l7=f7:\ :l8=f8:le=^H:me=\E[m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:sr=\EM:\ :ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: dt100w|dt-100w|Tandy DT-100 terminal (wide mode):\ :co#132:tc=dt100: dt110|Tandy DT-110 emulating ansi:\ :xo:\ :co#80:li#24:\ :@7=\E[K:ac=kkllmmjjnnwwvvuuttqqxx:ae=\E(B:al=\E[0L:as=\E(0:\ :bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:cm=\010\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[0P:dl=\E[0M:do=\E[0B:\ :eA=\E(B:ei=:ho=\E[H:ic=\E[0@:im=:is=\E[?3l\E(B:\ :k1=\E[1~:k2=\E[2~:k3=\E[3~:k4=\E[4~:k5=\E[5~:k6=\E[6~:\ :k7=\E[7~:k8=\E[8~:k9=\E[9~:k;=\E[10~:kI=\E[@:kN=\E[26~:\ :kP=\E[25~:kd=\E[B:kh=\E[G:kl=\E[D:kr=\E[C:ku=\E[A:l0=f1:\ :l1=f2:l2=f3:l3=f4:l4=f5:l5=f6:l6=f7:l7=f8:l8=f9:l9=f10:le=^H:\ :me=\E[m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[0A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: pt210|TRS-80 PT-210 printing terminal:\ :hc:os:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: #### Tektronix (tek) # # Tektronix tubes are graphics terminals. Most of them use modified # oscilloscope technology incorporating a long-persistence green phosphor, # and support vector graphics on a main screen with an attached "dialogue # area" for interactive text. # tek|tek4012|tektronix 4012:\ :bs:os:\ :co#75:li#35:\ :bl=^G:cl=\E\014:cr=^M:do=^J:ff=\014:is=\E^O:le=^H: # (tek4013: added to suppress tic warnings re :as:/:ae: --esr) tek4013|tektronix 4013:\ :ac=:ae=\E^O:as=\E^N:tc=tek4012: tek4014|tektronix 4014:\ :co#81:li#38:\ :is=\E\017\E9:tc=tek4012: # (tek4015: added to suppress tic warnings re :as:/:ae: --esr) tek4015|tektronix 4015:\ :ac=:ae=\E^O:as=\E^N:tc=tek4014: tek4014-sm|tektronix 4014 in small font:\ :co#121:li#58:\ :is=\E\017\E\072:tc=tek4014: # (tek4015-sm: added to suppress tic warnings re :as:/:ae: --esr) tek4015-sm|tektronix 4015 in small font:\ :ac=:ae=\E^O:as=\E^N:tc=tek4014-sm: # Tektronix 4023 from Andrew Klossner # # You need to have "stty nl2" in effect. Some versions of tset(1) know # how to set it for you. # # It's got the Magic Cookie problem around stand-out mode. If you can't # live with Magic Cookie, remove the :so: and :se: fields and do without # reverse video. If you like reverse video stand-out mode but don't want # it to flash, change the letter 'H' to 'P' in the :so: field. tek4023|tektronix 4023:\ :am:bs:\ :co#80:dN#4:li#24:sg#1:vt#4:\ :bl=^G:cl=4\E\014:cm=\034%r%+ %+ :cr=^M:do=^J:kb=^H:le=^H:\ :nd=^I:nl=^J:se=^_@:so=^_P: # It is recommended that you run the 4025 at 4800 baud or less; # various bugs in the terminal appear at 9600. It wedges at the # bottom of memory (try "cat /usr/dict/words"); ^S and ^Q typed # on keyboard don't work. You have to hit BREAK twice to get # one break at any speed - this is a documented feature. # Can't use cursor motion because it's memory relative, and # because it only works in the workspace, not the monitor. # Same for home. Likewise, standout only works in the workspace. # # :ce: was commented out since vi and rogue seem to work better # simulating it with lots of spaces! # # :al: and :AL: had 145ms of padding, but that slowed down vi's ^U # and didn't seem necessary. # tek4024|tek4025|tek4027|tektronix 4024/4025/4027:\ :am:bs:da:db:\ :co#80:it#8:li#34:lm#0:\ :AL=\037up\r\037ili %d\r:CC=^_:DL=\037dli %d\r\006:\ :DO=\037dow %d\r:LE=\037lef %d\r:RI=\037rig %d\r:\ :UP=\037up %d\r:al=\037up\r\037ili\r:bl=^G:\ :cd=\037dli 50\r:cl=\037era\r\n\n:cr=^M:dc=\037dch\r:\ :dl=\037dli\r\006:do=^F^J:ei=:ic=\037ich\r \010:im=:\ :is=\041com 31\r\n\037sto 9 17 25 33 41 49 57 65 73\r:\ :ke=\037lea p2\r\037lea p4\r\037lea p6\r\037lea p8\r\037lea f5\r:\ :ks=\037lea p4 /h/\r\037lea p8 /k/\r\037lea p6 / /\r\037lea p2 /j/\r\037lea f5 /H/\r:\ :le=^H:nd=\037rig\r:sf=^F^J:ta=^I:up=^K: tek4025-17|tek 4025 17 line window:\ :li#17:tc=tek4025: tek4025-17-ws|tek 4025 17 line window in workspace:\ :is=\041com 31\r\n\037sto 9 17 25 33 41 49 57 65 73\r\037wor 17\r\037mon 17\r:\ :se=\037att s\r:so=\037att e\r:te=\037mon h\r:\ :ti=\037wor h\r:\ :tc=tek4025-17: tek4025-ex|tek4027-ex|tek 4025/4027 w/!:\ :is=\037com 33\r\n\041sto 9 17 25 33 41 49 57 65 73\r:\ :te=\037com 33\r:ti=\041com 31\r:\ :tc=tek4025: # Tektronix 4025a # From: Doug Gwyn # The following status modes are assumed for normal operation (replace the # initial "!" by whatever the current command character is): # !COM 29 # NOTE: changes command character to GS (^]) # ^]DUP # ^]ECH R # ^]EOL # ^]RSS T # ^]SNO N # ^]STO 9 17 25 33 41 49 57 65 73 # Other modes may be set according to communication requirements. # If the command character is inadvertently changed, termcap can't restore it. # Insert-character cannot be made to work on both top and bottom rows. # Clear-to-end-of-display emulation via !DLI 988 is too grotty to use, alas. # There also seems to be a problem with vertical motion, perhaps involving # delete/insert-line, following a typed carriage return. This terminal sucks. # Delays not specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # (tek4025a: removed obsolete ":xx:". This may mean the tek4025a entry won't # work any more. -- esr) tek4025a|Tektronix 4025A:\ :am:bs:bw:da:db:pt:xo:\ :co#80:it#8:li#34:\ :CC=^]:DC=\035dch %d;:DL=\035dli %d;:DO=\035dow %d;:\ :LE=\035lef %d;:RI=\035rig %d;:SF=\035dow %d;:\ :UP=\035up %d;:al=\013\035ili;:bl=^G:bt=\035bac;:\ :ce=\035dch 80;:ch=\r\035rig %d;:cl=\035era;\n\035rup;:\ :cr=^M:ct=\035sto;:dc=\035dch;:dl=\035dli;:do=^J:le=^H:\ :nd=\035rig;:\ :rs=\041com 29\035del 0\035rss t\035buf\035buf n\035cle\035dis\035dup\035ech r\035eol\035era g\035for n\035pad 203\035pad 209\035sno n\035sto 9 17 25 33 41 49 57 65 73\035wor 0;:\ :sf=^J:ta=^I:up=^K: # From: cbosg!teklabs!davem Wed Sep 16 21:11:41 1981 # Here's the command file that I use to get rogue to work on the 4025. # It should work with any program using the old curses (e.g. it better # not try to scroll, or cursor addressing won't work. Also, you can't # see the cursor.) # (This "learns" the arrow keys for rogue. I have adapted it for termcap - mrh) tek4025-cr|tek 4025 for curses and rogue:\ :am:bs:\ :co#80:it#8:li#33:\ :cl=\037era;:cm=\037jum%i%d\054%d;:do=^F^J:\ :is=\041com 31\r\n\037sto 9 17 25 33 41 49 57 65 73\r:\ :le=^H:nd=\037rig;:sf=^F^J:ta=^I:te=\037wor 0:\ :ti=\037wor 33h:up=^K: # next two lines commented out since curses only allows 128 chars, sigh. # :ti=\037lea p1/b/\037lea p2/j/\037lea p3/n/\037lea p4/h/\037lea p5/ /\037lea p6/l/\037lea p7/y/\037lea p8/k/\037lea p9/u/\037lea p./f/\037lea pt/`era w/13\037lea p0/s/\037wor 33h:\ # :te=\037lea p1\037lea p2\037lea p3\037lea p4\037lea pt\037lea p5\037lea p6\037lea p7\037lea p8\037lea p9/la/13\037lea p.\037lea p0\037wor 0: tek4025ex|4025ex|4027ex|tek 4025 w/!:\ :is=\037com 33\r\n\041sto 9\05417\05425\05433\05441\05449\05457\05465\05473\r:\ :te=\037com 33\r:ti=\041com 31\r:\ :tc=tek4025: tek4105|tektronix 4105:\ :am:bs:mi:ms:ul:xn:xt:\ :co#79:it#8:li#29:\ :ac=:ae=\E[m:al=\E[1L:as=\E[1m:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%2;%2H:cr=^M:ct=\E[1g:\ :dc=\E[1P:dl=\E[1M:do=\E[1B:ei=\E[4l:ho=\E[H:i1=\E%!1\E[m:\ :im=\E[4h:is=\E%!1\E[?6141\E[m:kb=^H:kd=\E[1B:kl=\E[1D:\ :kr=\E[1C:ku=\E[1A:mb=\E[=3;<7m:md=\E[=7;<4m:\ :me=\E[=0;<1m:mh=\E[=1;<6m:mk=\E[=6;<5:mr=\E[=1;<3m:\ :nd=\E[1C:se=\E[=0;<1m:sf=\E[S:so=\E[=2;<3m:sr=\E[T:ta=^I:\ :te=:ti=\E%!1\E[?6l\E[2J:ue=\E[=0;<1m:up=\E[1A:\ :us=\E[=5;<2m: # (tek4105-30: I added / based on the init string -- esr) tek4105-30|4015 emulating 30 line vt100:\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#30:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # Tektronix 4105 from BRL # The following setup modes are assumed for normal operation: # CODE ansi CRLF no DABUFFER 141 # DAENABLE yes DALINES 30 DAMODE replace # DAVISIBILITY yes ECHO no EDITMARGINS 1 30 # FLAGGING input INSERTREPLACE replace LFCR no # ORIGINMODE relative PROMPTMODE no SELECTCHARSET G0 B # SELECTCHARSET G1 0 TABS -2 # Other setup modes may be set for operator convenience or communication # requirements; I recommend # ACURSOR 1 0 AUTOREPEAT yes AUTOWRAP yes # BYPASSCANCEL CURSORKEYMODE no DAINDEX 1 0 0 # EOFSTRING '' EOLSTRING EOMCHARS # GAMODE overstrike GCURSOR 0 100 0 GSPEED 10 1 # IGNOREDEL no KEYEXCHAR
NVDEFINE -53 "" # PROMPTSTRING '' QUEUESIZE 2460 WINDOW 0 0 4095 3132 # XMTDELAY 0 # and factory color maps. After setting these modes, save them with NVSAVE. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # "IC" cannot be used in combination with "im" & "ei". # "tek4105a" is just a guess: tek4105a|Tektronix 4105:\ :bs:ms:pt:xo:\ :co#80:it#8:kn#8:li#30:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ac=:ae=^O:al=\E[L:\ :as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ec=\E[%dX:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E%!1:k0=\EOA:k1=\EOB:k2=\EOC:k3=\EOD:k4=\EOP:k5=\EOQ:\ :k6=\EOR:k7=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:\ :l5=F6:l6=F8:le=^H:ll=\E[30;H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :rs=\030\E%!0\EKC\E\014\EKR0\EKF0\ENM0\ELBH=\ETF8000010F40\ELI100\ELLA>\ELM0\EKE0\ENF1\EKS0\END0\E%!1\Ec\E[?3;5l\E[?7;8h\E[r\E[m\E>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :te=\E%!0\ELBH=\E%!1:ti=\E[?6l:ue=\E[m:up=\EM:us=\E[4m:\ :ve=\E%!0\ETD10\E%!1:vi=\E%!0\ETD00\E%!1:\ :vs=\E%!0\ETD70\E%!1: # # Tektronix 4106/4107/4109 from BRL # The following setup modes are assumed for normal operation: # CODE ansi COLUMNMODE 80 CRLF no # DABUFFER 141 DAENABLE yes DALINES 32 # DAMODE replace DAVISIBILITY yes ECHO no # EDITMARGINS 1 32 FLAGGING input INSERTREPLACE replace # LFCR no LOCKKEYBOARD no ORIGINMODE relative # PROMPTMODE no SELECTCHARSET G0 B SELECTCHARSET G1 0 # TABS -2 # Other setup modes may be set for operator convenience or communication # requirements; I recommend # ACURSOR 1 0 AUTOREPEAT yes AUTOWRAP yes # BYPASSCANCEL CURSORKEYMODE no DAINDEX 1 0 0 # EOFSTRING '' EOLSTRING EOMCHARS # GAMODE overstrike GCURSOR 0 100 0 GSPEED 9 3 # IGNOREDEL no KEYEXCHAR
NVDEFINE -53 "" # PROMPTSTRING '' QUEUESIZE 2620 WINDOW 0 0 4095 3132 # XMTDELAY 0 # and factory color maps. After setting these modes, save them with NVSAVE. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # "IC" cannot be used in combination with "im" & "ei". tek4106brl|tek4107brl|tek4109brl|Tektronix 4106, 4107, or 4109:\ :ms:xo:\ :co#80:it#8:li#32:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ac=:ae=^O:al=\E[L:\ :as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ec=\E[%dX:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E%!1:k0=\EOA:k1=\EOB:k2=\EOC:k3=\EOD:k4=\EOP:k5=\EOQ:\ :k6=\EOR:k7=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:\ :l5=F6:l6=F8:le=^H:ll=\E[32;H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\030\E%!0\EKC\E\014\EKR0\EKF0\ENM0\ELBH=\ETF8000010F40\ELI100\ELLB0\ELM0\EKE0\ENF1\EKS0\END0\ERE0\E%!1\Ec\E[?3;5l\E[?7;8h\E[r\E[m\E>:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7;42m:sr=\EM:st=\EH:\ :ta=^I:te=\E%!0\ELBH=\E%!1:ti=\E[?6l:ue=\E[m:up=\EM:\ :us=\E[4m:ve=\E%!0\ETD10\E%!1:vi=\E%!0\ETD00\E%!1:\ :vs=\E%!0\ETD70\E%!1: tek4107|tek4109|tektronix terminals 4107 4109:\ :am:bs:mi:ms:ul:xn:xt:\ :co#79:it#8:li#29:\ :bl=^G:cd=\EJ:ce=\EK:cl=\ELZ:cm=\EY%+ %+ :cr=^M:do=^J:kb=^H:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:mb=\E%!1\E[5m\E%!0:\ :md=\E%!1\E[1m\E%!0:me=\E%!1\E[m\E%!0:\ :mh=\E%!1\E[<0m\E%!0:mr=\E%!1\E[7m\E%0:nd=\EC:\ :..sa=\E%%\0411\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m\E%%\0410:\ :se=\E%!1\E[m\E%!0:sf=^J:so=\E%!1\E[7;5m\E%!0:sr=\EI:\ :ta=^I:ue=\E%!1\E[m\E%!0:up=\EA:us=\E%!1\E[4m\E%!0:\ :ve=\E%!0:vs=\E%!3: # Tektronix 4207 with sysline. In the ancestral termcap file this was 4107-s; # see the note attached to tek4207. tek4207-s|Tektronix 4207 with sysline but no memory:\ :es:hs:\ :ds=\E7\E[?6l\E[2K\E[?6h\E8:fs=\E[?6h\E8:\ :i1=\E%!1\E[2;32r\E[132D\E[2g\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[J:\ :is=\E7\E[?6l\E[2K\E[?6h\E8:\ :ts=\E7\E[?6l\E[2K\E[;%i%df:tc=tek4107: # The 4110 series may be a wonderful graphics series, but they make the 4025 # look good for screen editing. In the dialog area, you can't move the cursor # off the bottom line. Out of the dialog area, ^K moves it up, but there # is no way to scroll. # # Note that there is a floppy for free from Tek that makes the # 4112 emulate the vt52 (use the vt52 termcap). There is also # an expected enhancement that will use ANSI standard sequences. # # 4112 in non-dialog area pretending to scroll. It really wraps # but vi is said to work (more or less) in this mode. # # 'vi' works reasonably well with this entry. # otek4112|o4112-nd|otek4113|otek4114|old tektronix 4110 series:\ :am:\ :co#80:li#34:\ :bl=^G:cl=\E^L:cr=^M:do=^J:le=^H:sf=^J:te=\EKA1\ELV1:\ :ti=\EKA0\ELV0\EMG0:up=^K: # The 4112 with the ANSI compatibility enhancement tek4112|tek4114|tektronix 4110 series:\ :am:bs:db:\ :co#80:li#34:\ :al=\E[L:bt=\E[Z:cd=\E[0J:ce=\E[0K:cl=\E[2J\E[0;0H:\ :cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=:ic=\E[@:im=:\ :is=\E3\0411:le=^H:me=\E[m:nd=\E[C:se=\E[m:\ :sf=\E7\E[0;0H\E[M\E8:so=\E[7m:sr=\E7\E[0;0H\E[L\E8:\ :ue=\E[m:up=\EM:us=\E[4m: tek4112-nd|4112 not in dialog area:\ :ns:\ :up=^K:tc=tek4112: tek4112-5|4112 in 5 line dialog area:\ :li#5:tc=tek4112: # (tek4113: this used to have ":nd=\LM1\s\LM0:", someone's mistake; # removed ":as=\E^N:, :ae=\E^O:", which had been commented out in 8.3. # Note, the !0 and !1 sequences in :te:/:ti:/:ve:/:vi: were # previously \0410 and \0411 sequences...I don't *think* they were supposed # to be 4-digit octal -- esr) tek4113|tektronix 4113 color graphics with 5 line dialog area:\ :am:bs:da:eo:\ :co#80:li#5:\ :cl=\ELZ:do=^J:is=\EKA1\ELL5\ELV0\ELV1:le=^H:\ :nd=\ELM1 \ELM0:uc=\010\ELM1_\ELM0:\ :vb=\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERB0: tek4113-34|tektronix 4113 color graphics with 34 line dialog area:\ :li#34:\ :is=\EKA1\ELLB2\ELV0\ELV1:tc=tek4113: # :ns: left off to allow vi visual mode. APL font (:as=\E^N:/:ae=\E^O:) not # supported here. :uc: is slow, but looks nice. Suggest setenv MORE -up . # :vb: needs enough delay to let you see the background color being toggled. tek4113-nd|tektronix 4113 color graphics with no dialog area:\ :am:bs:eo:\ :co#80:it#8:li#34:\ :cl=\E^L:do=^J:ho=\ELF7l\177 @:is=\ELZ\EKA0\ELF7l\177 @:\ :le=^H:ll=\ELF hl @:nd=^I:se=\EMT1:so=\EMT2:ta=^I:\ :uc=\010\EMG1_\EMG0:up=^K:\ :vb=\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERB0:\ :vs=\ELZ\EKA0: # This entry is from Tek. Inc. (Brian Biehl) # (tek4115: :bc: renamed to :le:, / added based on init string -- esr) otek4115|Tektronix 4115:\ :am:bs:da:db:eo:\ :co#80:it#8:li#34:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E%!0\E%\014\ELV0\EKA1\ELBB2\ENU@=\ELLB2\ELM0\ELV1\EKYA?\E%!1\E[<1l\E[?7h\E[?8h\E[34;1H\E[34B\E[m:\ :kb=^H:ke=\E>:ks=\E=:le=\E[D:me=\E[m:nd=\E[C:se=\E[m:\ :so=\E[7m:sr=\EM:ta=^I:te=\E%!0\ELBG8\E%!1\E[34;1H\E[J:\ :ti=\E%!0\ELBB2\E%!1:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E%!0\ELBG8\E%!1\E[34;1H:vs=\E%!0\ELBB2\E%!1: tek4115|newer tektronix 4115 entry with more ANSI capabilities:\ :am:xo:\ :co#80:li#34:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:\ :RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:al=\E[L:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%+^AG:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:ct=\E[2g:cv=\E[%+^Ad:dc=\E[P:\ :dl=\E[M:do=^J:ei=:ho=\E[H:ic=\E[@:im=:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mk=\E[8m:mr=\E[7m:nd=\E[C:..rp=%p1%c\E[%p2%{1}%-%db:\ :..sa=\E[%?%p1%t7;%;%?%p2%t4;%;%?%p3%t7;%;%?%p4%t5;%;%?%p6%t1;%;m:\ :se=\E[m:sf=^J:so=\E[7m:st=\EH:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m: # The tek4125 emulates a vt100 incorrectly - the scrolling region # command is ignored. The following entry replaces :cs: with the needed # :AL:, :AL:, and :im:; removes some cursor pad commands that the tek4125 # chokes on; and adds a lot of initialization for the tek dialog area. # Note that this entry uses all 34 lines and sets the cursor color to green. # Steve Jacobson 8/85 # (tek4125: there were two "\!"s in the is that I replaced with "\E!"; # commented out, :im:=\E1 because there's no :ei: -- esr) tek4125|tektronix 4125:\ :li#34:\ :al=\E[1L:cs@:dl=\E[1M:\ :is=\E%\E\0410\EQD1\EUX03\EKA\ELBB2\ELCE0\ELI100\ELJ2\ELLB2\ELM0\ELS1\ELX00\ELV1\E%\E\0411\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :ks=\E=:rc@:sc@:\ :tc=vt100: # From: # (tek4207: This was the termcap file's entry for the 4107/4207, but SCO # supplied another, less capable 4107 entry. So we'll use that for 4107 and # note that if jcoker wasn't confused you may be able to use this one. # I merged in :ms:,:sf:,:sr:,,:ct: from a BRL entry -- esr) tek4207|Tektronix 4207 graphics terminal with memory:\ :am:bw:mi:ms:ul:xn:\ :co#80:it#8:li#32:\ :al=3\E[L:bt=\E[Z:cd=\E[J:ce=5\E[K:cl=156\E[H\E[J:\ :cm=\E[%i%d;%dH:ct=\E[1g:dc=4\E[P:dl=3\E[M:do=^J:ei=:\ :ho=\E[H:ic=4\E[@:im=:\ :is=\E%!0\ELBP0\E%!1\E[H\E[2g\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[J:\ :kd=\ED:kh=\E[H:kl=\E[D:kr=\E[C:ku=\EM:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mk=\E[=6;<5:mr=\E[7m:nd=\E[C:se=\E[m:\ :sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:\ :te=\E[?6h\E%!0\ELBP0\E%!1\E[32;1f:ti=\E[?6l\E[H\E[J:\ :ue=\E[m:up=\EM:us=\E[4m: # From: Thu Oct 31 12:54:27 1985 # (tek4404: There was a "\!" in :ti: that I replaced with "\E!". # Tab had been given as \E2I,that must be the tab-set capability -- esr) tek4404|tektronix 4404:\ :bs:\ :co#80:it#8:li#32:\ :al=\E[1L:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[1M:do=^J:ei=\E[4l:ho=\E[H:\ :im=\E[4h:kd=\E[B:ke=\E[?1h:kl=\E[D:kr=\E[C:ks=\E[?1l:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:nd=\E[C:rc=\E8:\ :sc=\E7:se=\E[27m:so=\E[7m:st=\E[2I:ta=^I:\ :te=\E[1;1H\E[0J\E[?6h\E[?1l:\ :ti=\E%\E\0411\E[1;32r\E[?6l\E>:ue=\E[m:up=\E[A:\ :us=\E[4m: # Some unknown person wrote: # I added the is string - straight Unix has ESC ; in the login # string which sets a ct8500 into monitor mode (aka 4025 snoopy # mode). The is string here cleans up a few things (but not # everything). ct8500|tektronix ct8500:\ :am:bw:da:db:\ :co#80:li#25:\ :al=\E^L:bl=^G:bt=\E^I:cd=\E^U:ce=\E^T:cl=\E^E:\ :cm=\E|%+ %+ :cr=^M:dc=\E^]:dl=\E^M:do=^J:ei=:ic=\E^\:im=:\ :is=\037\EZ\Ek:le=^H:me=\E :nd=\ES:se=\E :sf=^J:so=\E$:\ :sr=\E^A:ta=^I:ue=\E :up=\ER:us=\E\041: # Tektronix 4205 terminal. # # am is not defined because the wrap around occurs not when the char. # is placed in the 80'th column, but when we are attempting to type # the 81'st character on the line. (esr: hmm, this is like the vt100 # version of xenl, perhaps am + xenl would work!) # # Bold, dim, and standout are simulated by colors and thus not allowed # with colors. The tektronix color table is mapped into the RGB color # table by setf/setb. All colors are reset to factory specifications by oc. # The cap uses RGB notation to define colors. for arguments 1-3 the # interval (0-1000) is broken into 8 smaller sub-intervals (125). Each sub- # interval then maps into pre-defined value. # (untranslatable capabilities removed to fit entry within 1023 bytes) tek4205|tektronix 4205:\ :cc:mi:ms:\ :Co#8:NC#49:co#80:it#8:li#30:pa#63:\ :AL=\E[%dL:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[1L:as=\E(0:bl=^G:bt=\E[Z:cb=\E[1K:cd=\E[J:\ :ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:ct=\E[1g:\ :dc=\E[1P:dl=\E[1M:do=\E[B:eA=\E(B:ec=\E%dX:ei=\E[4l:\ :ho=\E[H:i1=\E%!0\ETM1\E%!1\E[m:im=\E[4h:k0=\EOA:k1=\EOB:\ :k2=\EOC:k3=\EOD:k4=\EP:k5=\EQ:k6=\ER:k7=\ES:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:md=\E[=7;<4m:\ :me=\E[=0;<1m\E[24;25;27m\017:mh=\E[=1;<6m:mk=\E[=6;<5:\ :mr=\E[7m:nd=\E[C:\ :oc=\E%!0\n\ETFB0\n0000\n1F4F4F4\n2F400\n30F40\n4A4C because of a bug in old vi (if stty says you have # a "newline" style terminal (-crmode) vi figures all it needs is nl # to get crlf, even if :cr: is not ^M.) # (tty40: removed obsolete ":nl=\EG\EB:", it's just do+cr -- esr) tty40|ds40|ds40-2|dataspeed40|teletype dataspeed 40/2:\ :bs:xo:\ :co#80:li#24:\ :al=\EL:cd=\EJ:cl=\EH\EJ:cr=\EG:ct=\EH\E2:dc=\EP:dl=\EM:\ :do=\EB:ei=:ho=\EH:ic=\E\136:im=:kb=^]:kl=^H:le=^H:nd=\EC:\ :pf=^T:po=\022:r2=\023\ER:se=\E4:sf=\ES:so=\E3:sr=\ET:\ :st=\E1:ta=\E@:up=\E7: tty43|model 43 teletype:\ :am:bs:hc:os:xo:\ :co#132:\ :bl=^G:cr=^M:do=^J:kb=^H:le=^H:sf=^J: #### Tymshare # # You can add :is=\E<: to put this 40-column mode, though I can't # for the life of me think why anyone would want to. scanset|sc410|sc415|Tymshare Scan Set:\ :am:bw:ms:\ :co#80:li#24:\ :ac=l:\ :rc=^C:sc=^B:sf=^J:up=^K: #### Volker-Craig (vc) # # If you saw a Byte Magazine cover with a terminal on it during the early # 1980s, it was probably one of these. Carl Helmers liked them because # they could crank 19.2 and were cheap (that is, until he tried to program # one...) # # Missing in vc303a and vc303 descriptions: they scroll 2 lines at a time # every other linefeed. vc303|vc103|vc203|volker-craig 303:\ :am:bs:ns:\ :co#80:li#24:\ :bl=^G:cl=\014:cr=^M:do=^J:ho=\013:kd=^J:kl=^H:kr=^I:ku=^N:\ :le=^H:ll=\017W:nd=^I:up=^N: vc303a|vc403a|volker-craig 303a:\ :ce=\026:cl=\030:ho=\031:kr=^U:ku=^Z:ll=^P:nd=^U:up=^Z:tc=vc303: # (vc404: removed obsolete ":ma=^Z^P^U :" -- esr) vc404|volker-craig 404:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cd=\027:ce=\026:cl=\030:cm=\020%+ %+ :cr=^M:do=^J:\ :ho=\031:kd=^J:kl=^H:kr=^U:ku=^Z:le=^H:nd=^U:sf=^J:up=^Z: vc404-s|volker-craig 404 w/standout mode:\ :do=^J:se=^O:so=^N:tc=vc404: # From: # (vc414: merged in cup/dl1/home from an old vc414h-noxon) vc414|vc414h|Volker-Craig 414H in sane escape mode.:\ :am:bs:\ :co#80:li#24:\ :al=\E\032:cd=\E^X:ce=10\E\017:cl=\E\034:cm=\E\021%r%.%.:\ :dc=\E3:dl=\E\023:do=\E^K:ei=:ho=\E^R:ic=\E\072:im=:k0=\EA:\ :k1=\EB:k2=\EC:k3=\ED:k4=\EE:k5=\EF:k6=\EG:k7=\EH:kd=\E^K:\ :kh=\E^R:kl=^H:kr=^P:ku=\E^L:l0=PF1:l1=PF2:l2=PF3:l3=PF4:\ :l4=PF5:l5=PF6:l6=PF7:l7=PF8:nd=^P:se=\E^_:so=\E^Y:up=\E^L: vc415|volker-craig 415:\ :cl=^L:tc=vc404: ######## OBSOLETE PERSONAL-MICRO CONSOLES AND EMULATIONS # #### IBM PC and clones # # The pcplot IBM-PC terminal emulation program is really messed up. It is # supposed to emulate a vt-100, but emulates the wraparound bug incorrectly, # doesn't support scrolling regions, ignores add line commands, and ignores # delete line commands. Consequently, the resulting behavior looks like a # crude adm3a-type terminal. # Steve Jacobson 8/85 pcplot|pc-plot terminal emulation program:\ :xn@:\ :AL@:DL@:al@:cs@:dl@:rc@:sc@:tc=vt100: # KayPro II from Richard G Turner # I've found that my KayPro II, running MDM730, continues to emulate an # ADM-3A terminal, just like I was running TERM.COM. On our 4.2 UNIX # system the following termcap entry works well: # I have noticed a couple of minor glitches, but nothing I can't work # around. (I added two capabilities from the BRL entry -- esr) kaypro|kaypro2|kaypro II:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=^W:ce=^X:cl=1\032:cm=\E=%+ %+ :cr=^M:\ :dl=\ER:do=^J:ho=^^:kd=^J:kr=^L:ku=^K:nd=^L:sf=^J:up=^K: # From IBM, Thu May 5 19:35:27 1983 # (ibmpc: commented out :im:=\200R because we don't know :ei: -- esr) ibmpc|ibm-pc|ibm5051|5051|IBM Personal Computer (no ANSI.SYS):\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=^L^K:cr=^M^^:do=^J:ho=^K:kd=^_:le=^]:nd=^\:sf=\n:\ :up=^^: #### Apple II # # Apple II firmware console first, then various 80-column cards and # terminal emulators. For two cents I'd toss all these in the UFO file # along with the 40-column apple entries. # # From: brsmith@umn-cs.cs.umn.edu (Brian R. Smith) via BRL # 'it#8' tells UNIX that you have tabs every 8 columns. This is a # function of TIC, not the firmware. # The clear key on a IIgs will do something like clear-screen, # depending on what you're in. appleIIgs|appleIIe|appleIIc|Apple 80 column firmware interface:\ :am:bs:bw:eo:ms:\ :co#80:it#8:li#24:\ :bl=^G:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :cr=^M:do=^J:ho=^Y:\ :kC=^X:kD=\177:kb=^H:kd=^J:kl=^H:kr=^U:ku=^K:le=^H:nd=^\:\ :nw=^M^W:se=^N:sf=^W:so=^O:sr=^V:ta=^I:up=^_: # Apple //e with 80-column card, entry from BRL # The modem interface is permitted to discard LF (maybe DC1), otherwise # passing characters to the 80-column firmware via COUT (PR#3 assumed). # Auto-wrap does not work right due to newline scrolling delay, which also # requires that you set "stty cr2". # Note: Cursor addressing is only available via the Pascal V1.1 entry, # not via the BASIC PR#3 hook. All this nonsense can be avoided only by # using a terminal emulation program instead of the built-in firmware. apple2e|Apple //e:\ :bw:ms:\ :co#80:li#24:\ :bl=^G:cd=4*\013:ce=4\035:cl=100\014:do=^J:ho=^Y:is=^R^N:\ :kb=^H:kd=^J:kl=^H:kr=^U:ku=^K:le=^H:me=^N:mr=^O:nw=100\r:\ :r1=^R^N:se=^N:sf=^W:so=^O:sr=^V:ta=^I:up=^_: # mcvax!vu44!vu45!wilcke uses the "ap" entry together with Ascii Express Pro # 4.20, with incoming and outgoing terminals both on 0, emulation On. apple2e-p|Apple //e via Pascal:\ :cm=\036%r%+ %+ :kb=^H:kd=^J:kl=^H:tc=apple2e: # (ASCII Express) MouseTalk "Standard Apple //" emulation from BRL # Enable DC3/DC1 flow control with "stty ixon -ixany". apple-ae|ASCII Express:\ :am:bs:bw:ms:nx:xo:\ :co#80:it#8:li#24:\ :bl=500\007:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :cr=^M:do=^J:\ :ho=^Y:is=^R^N:kC=^X:kd=^J:kl=^H:kr=^U:ku=^K:le=^H:me=^N:\ :mr=^O:nd=^U:r1=^R^N:se=^N:sf=^W:so=^O:sr=^V:up=^_: appleII|apple ii plus:\ :am:bs:\ :co#80:it#8:li#24:\ :cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :do=^J:ho=\E^Y:\ :is=\024T1\016:kd=^J:kr=^U:le=^H:me=^N:nd=^\:se=^N:so=^O:\ :ta=^I:up=^_:vb=\024G1\024T1:ve=^TC2:vs=^TC6: # Originally by Gary Ford 21NOV83 # From: Fri Oct 11 21:27:00 1985 apple-80|apple II with smarterm 80 col:\ :am:bs:bw:\ :co#80:li#24:\ :bt=^R:cd=10*\013:ce=10\035:cl=10*\014:cm=\036%r%+ %+ :\ :cr=10*\r:do=^J:ho=^Y:le=^H:nd=^\:up=^_: apple-soroc|apple emulating soroc 120:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:\ :kd=^J:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:sf=^J:up=^K: # From Peter Harrison, Computer Graphics Lab, San Francisco # ucbvax!ucsfmis!harrison .....uucp # ucbvax!ucsfmis!harrison@BERKELEY .......ARPA # "These two work. If you don't have the inverse video chip for the # Apple with videx then remove the :so: and :se: fields." # (apple-videx: this used to be called DaleApple -- esr) apple-videx|Apple with videx videoterm 80 column board with inverse video:\ :am:bs:xn:\ :co#80:it#8:li#24:\ :cd=^K:ce=^]:cl=300\014:cm=\036%r%+ %+ :do=^J:ho=^Y:kd=^J:\ :kh=^Y:kl=^H:kr=^U:le=^H:me=^Z2:nd=^\:se=^Z2:so=^Z3:ta=^I:\ :up=^_: # My system [for reference] : Apple ][+, 64K, Ultraterm display card, # Apple Cat ][ 212 modem, + more all # controlled by ASCII Express: Pro. # From Dave Shaver apple-uterm-vb|Videx Ultraterm for Apple micros with Visible Bell:\ :am:bs:eo:xt:\ :co#80:li#24:\ :ac=:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :ho=^Y:\ :is=^V4^W06\017\rVisible Bell Installed.\016\r\n:\ :nd=^\:se=^N:so=^O:up=^_:vb=^W35^W06: apple-uterm|Ultraterm for Apple micros:\ :am:bs:eo:xt:\ :co#80:li#24:\ :ac=:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :ho=^Y:\ :is=^V4^W06\016:nd=^\:se=^N:so=^O:up=^_: # from trwrba!bwong (Bradley W. Wong): # # This entry assumes that you are using an apple with the UCSD Pascal # language card. SYSTEM.MISCINFO is assumed to be the same as that # supplied with the standard apple except that screenwidth should be set # using SETUP to 80 columns. Note that the right arrow in not mapped in # this termcap entry. This is because that key, on the Apple, transmits # a ^U and would thus preempt the more useful "up" function of vi. # # HMH 2/23/81 apple80p|80-column apple with Pascal card:\ :am:bw:\ :co#80:li#24:\ :cd=^K:ce=^]:cl=^Y^L:cm=\036%r%+ %+ :ho=^Y:kl=^H:nd=^\\072:\ :up=^_: # # Apple II+ equipped with Videx 80 column card # # Terminfo from ihnp4!ihu1g!djc1 (Dave Christensen) via BRL; # manually converted by D A Gwyn # # DO NOT use any terminal emulation with this data base, it works directly # with the Videx card. This has been tested with vi 1200 baud and works fine. # # This works great for vi, except I've noticed in pre-R2, ^U will scroll back # 1 screen, while in R2 ^U doesn't. # For inverse alternate character set add: # :as:=^O::ae:=^N: # (apple-v: added it#8 -- esr) apple-videx2|Apple II+ w/ Videx card (similar to Datamedia h1520):\ :am:xn:\ :co#80:it#8:li#24:\ :bl=100\007:cd=16*\013:ce=^]:cl=16*\014:cm=\036%r%+ %+ :\ :cr=^M:do=^J:ho=^Y:kb=^H:kd=^J:kh=^Y:kl=^H:kr=^\:ku=^_:le=^H:\ :nd=^\:se=^Z2:sf=^J:so=^Z3:ta=8\011:up=^_: apple-videx3|vapple|Apple II with 80 col card:\ :am:bs:\ :co#80:li#24:\ :ce=\Ex:cl=\Ev:cm=\EY%+ %+ :ho=\EH:k0=\EP:k1=\EQ:k2=\ER:\ :k3=\E :k4=\E\041:k5=\E":k6=\E#:k7=\E$:k8=\E%:k9=\E&:kd=\EB:\ :kh=\EH:kl=\ED:kr=\EC:ku=\EA:nd=\EC:up=\EA: #From: decvax!cbosgd!cbdkc1!mww Mike Warren via BRL aepro|Apple II+ running ASCII Express Pro--vt52:\ :bs:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=300\014:cm=\EY%+ %+ :ho=\EH:nd=\EC:\ :up=\EA: # UCSD addition: Yet another termcap from Brian Kantor's Micro Munger Factory apple-vm80|ap-vm80|apple with viewmax-80:\ :bs:\ :co#80:li#24:\ :cd=300\013:ce=^]:cl=300\014:cm=100\036%+ %+ :ho=200\031:\ :nd=^\\072:up=^_: #### Apple Lisa & Macintosh # # (lisa: changed :vs: to :ve: -- esr) lisa|apple lisa console display (black on white):\ :am:bs:eo:ms:\ :co#88:it#8:li#32:\ :ac=lfmekcjdttuvvuwsqax`nb:ae=\E[10m:al=\E[L:as=\E[11m:\ :cd=\E[J:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:is=\E>\E[m\014:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[C:\ :se=\E[m:so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[5l:\ :vi=\E[5h: liswb|apple lisa console display (white on black):\ :is=\E>\E[0;7m\014:se=\E[0;7m:so=\E[m:ue=\E[0;7m:\ :us=\E[4m:tc=lisa: # lisaterm from ulysses!gamma!epsilon!mb2c!jed (John E. Duncan III) via BRL; # :is: revised by Ferd Brundick # # These entries assume that the 'Auto Wraparound' is enabled. # Xon-Xoff flow control should also be enabled. # # The vt100 uses :rs2: and :rf: rather than :is2:/:tbc:/:hts: because the tab # settings are in non-volatile memory and don't need to be reset upon login. # Also setting the number of columns glitches the screen annoyingly. # You can type "reset" to get them set. # lisaterm|Apple Lisa or Lisa/2 running LisaTerm vt100 emulation:\ :am:bs:pt:xn:xo:\ :co#80:it#8:kn#4:li#24:vt#3:\ :DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:do=^J:ho=\E[H:k0=\EOP:k1=\EOQ:\ :k2=\EOR:k3=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=F1:l1=F2:l2=F3:l3=F4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r1=\E>\E[?1l\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # Lisaterm in 132 column ("wide") mode. lisaterm-w|Apple Lisa with Lisaterm in 132 column mode:\ :co#132:\ :kb=^H:kd=^J:kl=^H:tc=lisaterm: # Although MacTerminal has insert/delete line, it is commented out here # since it is much faster and cleaner to use the "lock scrolling region" # method of inserting and deleting lines due to the MacTerminal implementation. # Also, the "Insert/delete ch" strings have an extra character appended to them # due to a bug in MacTerminal V1.1. Blink is disabled since it is not # supported by MacTerminal. mac|macintosh|Macintosh with MacTerminal:\ :xn:\ :dN#30:\ :dc=7\E[P:ei=:ic=9\E[@:im=:ip=7:mb@:tc=lisa: # Lisaterm in 132 column ("wide") mode. mac-w|macterminal-w|Apple Macintosh with Macterminal in 132 column mode:\ :co#132:tc=mac: #### Radio Shack/Tandy # # (coco3: This had "ta" used incorrectly as a boolean and bl given as "bl#7". # I read these as mistakes for ":it#8:" and ":bl=\007:" respectively -- esr) # From: <{pbrown,ctl}@ocf.berkeley.edu> 12 Mar 90 coco3|os9LII|Tandy CoCo3 24*80 OS9 Level II:\ :am:bs:\ :co#80:it#8:li#24:\ :al=^_0:bl=^G:cd=^K:ce=^D:cl=5*\014:cm=2\002%r%+ %+ :\ :dl=^_1:do=^J:ho=^A:kd=^J:kl=^H:kr=^I:ku=^L:le=^H:mb=^_":\ :md=\E\072^A:me=\037\041\E\072\200:mr=^_ :nd=^F:\ :se=^_\041:so=^_ :ue=^_#:up=^I:us=^_":ve=^E\041:vi=^E : # (trs2: removed obsolete ":nl=^_:" -- esr) trs2|trsII|trs80II|Radio Shack Model II using P&T CP/M:\ :am:bs:ms:\ :co#80:it#8:li#24:\ :al=^D:bl=^G:cd=^B:ce=^A:cl=^L:cm=\EY%+ %+ :cr=^M:dl=^K:\ :do=^_:ho=^F:kb=^H:kd=^_:kl=^\:kr=^]:ku=^^:le=^H:me=^O:nd=^]:\ :se=^O:sf=^J:so=^N:ta=^I:up=^^: # From: Kevin Braunsdorf # (This had extension capabilities # :BN=\E[?33h:BF=\E[?33l:UC=\E[_ q:BC=\E[\177 q:\ # :CN=\ERC:CF=\ERc:NR=\ERD:NM=\ER@: # I also deleted the unnecessary ":kn#2:", ":sg#0:" -- esr) trs16|trs-80 model 16 console:\ :am:bs:\ :co#80:it#8:li#24:\ :ac=l_mbk`javewcquxs:ae=\ERg:al=\EL:as=\ERG:bl=^G:cd=\EJ:\ :ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:dc=\EQ:dl=\EM:do=\EB:ei=:\ :ho=\EH:ic=\EP:im=:k0=^A:k1=^B:k2=^D:k3=^L:k4=^U:k5=^P:k6=^N:\ :k7=^S:kb=^H:kd=\EB:kh=^W:kl=\ED:kr=\EC:ku=\EA:l0=f1:l1=f2:\ :l2=f3:l3=f4:l4=f5:l5=f6:l6=f7:l7=f8:le=^H:me=\ER@:nd=\EC:\ :pf=\E]+:po=\E]=:se=\ER@:sf=^J:so=\ERD:ta=^I:up=\EA:ve=\ERC:\ :vi=\ERc: #### Atari ST # # From: Simson L. Garfinkel atari|atari st:\ :am:bs:\ :co#80:it#8:li#25:\ :al=\EL:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :dl=\EM:do=\EB:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=\ED:me=\Eq:nd=\EC:se=\Eq:\ :so=\Ep:sr=\EI:ta=^I:up=\EA: # UniTerm terminal program for the Atari ST: 49-line VT220 emulation mode # From: Paul M. Aoki uniterm|uniterm49|UniTerm VT220 emulator with 49 lines:\ :li#49:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;49r\E[49;1H:tc=vt220: # MiNT VT52 emulation. 80 columns, 25 rows. # MiNT is Now TOS, the operating system which comes with all Ataris now # (mainly Atari Falcon). This termcap is for the VT52 emulation you get # under tcsh/zsh/bash/sh/ksh/ash/csh when you run MiNT in `console' mode # From: Per Persson , 27 Feb 1996 st52|Atari ST with VT52 emulation:\ :am:km:\ :co#80:li#25:\ :K1=\E#7:K2=\E#9:K3=\E#5:K4=\E#1:K5=\E#3:al=\EL:bl=^G:\ :cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:dl=\EM:do=\EB:\ :ho=\EH:k0=\E#D:k1=\E#;:k2=\E#<:k3=\E#=:k4=\E#>:k5=\E#?:\ :k6=\E#@:k7=\E#A:k8=\E#B:k9=\E#C:kA=\E#R:kC=\E#7:kF=\E#2:\ :kR=\E#8:kb=^H:kd=\E#P:kh=\E#G:kl=\E#K:kr=\E#M:ku=\E#H:\ :l0=f10:le=\ED:me=\Eq:nd=\EC:nw=^M^J:r1=\Ez_\Eb@\EcA:\ :rc=\Ek:sc=\Ej:se=\Eq:sf=^J:so=\Ep:sr=\EI:ta=^I:te=:ti=\Ee:\ :up=\EA:ve=\Ee:vi=\Ef: #### Commodore Business Machines # # Formerly located in West Chester, PA; went spectacularly bust in 1994 # after years of shaky engineering and egregious mismanagement. Made one # really nice machine (the Amiga) and boatloads of nasty ones (PET, C-64, # C-128, VIC-20). The C-64 is said to have been the most popular machine # ever (most units sold); they can still be found gathering dust in closets # everywhere. # # From: Kent Polk , 30 May 90 # Added a few more entries, converted caret-type control sequence (^x) entries # to '\0xx' entries since a couple of people mentioned losing '^x' sequences. # # :as:, :ae: Support for alternate character sets. # :ve=\E[\040p:vi=\E[\060\040p: cursor visible/invisible. # :xn: vt100 kludginess at column 80/NEWLINE ignore after 80 cols(Concept) # This one appears to fix a problem I always had with a line ending # at 'width+1' (I think) followed by a blank line in vi. The blank # line tended to disappear and reappear depending on how the screen # was refreshed. Note that this is probably needed only if you use # something like a Dnet Fterm with the window sized to some peculiar # dimension larger than 80 columns. # :k0=\E9~: map F10 to k0 - could have F0-9 -> k0-9, but ... F10 was 'k;' # (amiga: removed obsolete :kn#10:, # also added empty to suppress a warning --esr) amiga|Amiga ANSI:\ :am:bs:bw:xn:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ac=:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=\E[B:ei=:\ :ho=\E[H:ic=\E[@:im=:is=\E[20l:k0=\E[9~:k1=\E[0~:k2=\E[1~:\ :k3=\E[2~:k4=\E[3~:k5=\E[4~:k6=\E[5~:k7=\E[6~:k8=\E[7~:k9=\E[8~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[7;2m:\ :md=\E[1m:me=\E[m:mh=\E[2m:mk=\E[8m:mr=\E[7m:nd=\E[C:\ :rs=\Ec:se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\E[ p:vi=\E[0 p: # From: Hans Verkuil , 4 Dec 1995 # (amiga: added empty to suppress a warning --esr) amiga-bad|Amiga ANSI:\ :bs:bw:ms:\ :co#80:li#24:\ :DC=\233%dP:DO=\233%dB:IC=\233%d@:LE=\233%dD:RI=\233%dC:\ :SF=\233%dS:SR=\233%dT:UP=\233%dA:ac=:ae=^O:as=^N:bl=^G:\ :bt=\233Z:cd=\233J:ce=\233K:cl=\233H\233J:\ :cm=\233%i%d;%dH:cr=^M:dc=\233P:do=\233B:ec=\233%dP:ei=:\ :ho=\233H:ic=\233@:im=:is=\23320l:k0=\2339~:k1=\2330~:\ :k2=\2331~:k3=\2332~:k4=\2333~:k5=\2334~:k6=\2335~:\ :k7=\2336~:k8=\2337~:k9=\2338~:kD=\177:kb=^H:kd=\233B:\ :kl=\233D:kr=\233C:ku=\233A:le=\233D:mb=\2337;2m:\ :md=\2331m:me=\2330m:mh=\2332m:mk=\2338m:mr=\2337m:\ :nd=\233C:nw=\233B\r:r1=\Ec:se=\2330m:sf=\233S:so=\2337m:\ :sr=\233T:ta=^I:te=\233?7h:ti=\233?7l:ue=\2330m:up=\233A:\ :us=\2334m:vb=^G:ve=\233 p:vi=\2330 p: # Commodore B-128 microcomputer from Doug Tyrol # I'm trying to write a termcap for a commodore b-128, and I'm # having a little trouble. I've had to map most of my control characters # to something that unix will accept (my delete-char is a ctrl-t, etc), # and create some functions (like cm), but thats life. # The problem is with the arrow keys - right, and up work fine, but # left deletes the previous character and down I just can't figure out. # Jove knows what I want, but I don't know what it's sending to me (it # isn't thats bound to next-line in jove). # Anybody got any ideas? Here's my termcap. # DAG -- I changed his "^n" entries to "\n"; see if that works. # commodore|b-128|Commodore B-128 micro:\ :am:bw:\ :co#80:dN#20:li#24:pb#150:\ :al=10\Ei:bc=^H:ce=10\Eq:cl=10\E\006:\ :cm=20\E\013%2\054%2\054:cr=^M:dc=10*\177:dl=10*\Ed:\ :do=^J:ei=:ho=\E^E:ic=5\E\n:im=:kd=^J:kh=\E^E:kl=^B:kr=^F:\ :ku=^P:nd=^F:nl=^M:ta=5\011:up=^P: #### North Star # # North Star Advantage from Lt. Fickie via BRL northstar|North Star Advantage:\ :bs:\ :co#80:li#24:\ :cd=200\017:ce=200\016:cl=200\004:cm=1\E=%+ %+ :\ :ho=200\034\032: #### Osborne # # Thu Jul 7 03:55:16 1983 # # As an aside, be careful; it may sound like an anomaly on the # Osborne, but with the 80-column upgrade, it's too easy to # enter lines >80 columns! # # I've already had several comments... # The Osborne-1 with the 80-col option is capable of being # 52, 80, or 104 characters wide; default to 80 for compatibility # with most systems. # # The tab is destructive on the Ozzie; make sure to 'stty -tabs'. osborne-w|osborne1-w|osborne I in 104-column mode:\ :ms:ul:xt:\ :co#104:li#24:\ :al=\EE:bl=^G:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:\ :do=^J:ei=:ic=\EQ:im=:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:\ :se=\E(:sf=^J:so=\E):ue=\Em:up=^K:us=\El: # Osborne I from ptsfa!rhc (Robert Cohen) via BRL osborne|osborne1|osborne I in 80-column mode:\ :am:bs:mi:ms:ul:xs:\ :co#80:dB#4:li#24:\ :al=\EE:ce=\ET:cl=^Z:cm=\E=%+ %+ :dc=4\EW:dl=\ER:do=^J:ei=:\ :im=\EQ:is=^Z:kb=^H:kd=^J:kl=^H:kr=^L:ku=^K:le=\010:nd=^L:\ :se=\E):so=\E(:ue=\Em:up=^K:us=\El: # # Osborne Executive definition from BRL # Similar to tvi920 # Added by David Milligan and Tom Smith (SMU) osexec|Osborne executive:\ :am:bs:\ :co#80:li#24:sg#1:ug#1:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E3:\ :dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:\ :is=\Eq\Ek\Em\EA\Ex0:k0=^A@\r:k1=^AA\r:k2=^AB\r:k3=^AC\r:\ :k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:k8=^AH\r:k9=^AI\r:\ :kb=^H:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:nl=^J:se=\Ek:\ :so=\Ej:st=\E1:ue=\Em:up=^K:us=\El: #### Console types for obsolete UNIX clones # # Coherent, Minix, Venix, and several lesser-known kin were OSs for 8088 # machines that tried to emulate the UNIX look'n'feel. Coherent and Venix # were commercial, Minix an educational tool sold in conjunction with a book. # Memory-segmentation limits and a strong tendency to look like V7 long after # it was obsolete made all three pretty lame. Venix croaked early. Coherent # and Minix were ported to 32-bit Intel boxes, only to be run over by a # steamroller named `Linux' (which, to be fair, traces some lineage to Minix). # Coherent's vendor, the Mark Williams Company, went belly-up in 1994. There # are also, I'm told, Minix ports that ran on Amiga and Atari machines and # even as single processes under SunOS and the Macintosh OS. # # This is the entry provided with minix 1.7.4, with bogus :ri: removed. minix|minix console (v1.7):\ :am:xn:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:cd=\E[0J:\ :ce=\E[K:cl=\E[H\E[0J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:is=\E[0m:k0=\E[Y:\ :k1=\E[V:k2=\E[U:k3=\E[T:k4=\E[S:k5=\E[G:kb=^H:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:l0=End:l1=PgUp:l2=PgDn:\ :l3=Num +:l4=Num -:l5=Num 5:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[0m:mr=\E[7m:nd=\E[C:nw=^M^J:se=\E[0m:sf=^J:so=\E[7m:\ :sr=\EM:ta=^I:ue=\E[0m:up=\E[A:us=\E[4m: # Corrected Jan 14, 1997 by Vincent Broman minix-old|minix console (v1.5):\ :xo:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:cd=\E[0J:\ :ce=\E[K:cl=\E[H\E[0J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:k0=\E[Y:k1=\E[V:\ :k2=\E[U:k3=\E[T:k4=\E[S:k5=\E[G:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:\ :mr=\E[7m:nd=\E[C:nw=^M^J:se=\E[0m:sf=^J:so=\E[7m:sr=\EM:\ :ta=^I:ue=\E[0m:up=\E[A:us=\E[4m: # The linewrap option can be specified by editing /usr/include/minix/config.h # before recompiling the minix 1.5 kernel. minix-old-am|minix console with linewrap:\ :am:tc=minix-old: pc-minix|minix console on an Intel box:\ :tc=klone+acs:tc=minix: # According to the Coherent 2.3 manual, the PC console is similar # to a z19. The differences seem to be (1) 25 lines, (2) no status # line, (3) standout is broken, (4) ins/del line is broken, (5) # has blinking and bold. pc-coherent|pcz19|coherent|IBM PC console running Coherent:\ :am:mi:\ :co#80:it#8:li#25:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :cr=^M:dc=\EN:\ :do=\EB:ei=\EO:ho=\EH:im=\E@:kb=^H:kd=\EB:kh=\EH:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:me=\Eq:nd=\EC:se=\Eq:sf=^J:so=\Ep:\ :sr=\EI:ta=^I:up=\EA: # According to the Venix 1.1 manual, the PC console is similar # to a DEC vt52. Differences seem to be (1) arrow keys send # different strings, (2) enhanced standout, (3) added insert/delete line. # Note in particular that it doesn't have automatic margins. # There are other keys (f1-f10, kpp, knp, kcbt, kich1, kdch1) but they # not described here because this derives from an old termcap entry. pc-venix|venix|IBM PC console running Venix:\ :co#80:it#8:li#25:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:\ :dl=\EM:do=^J:kb=^H:kd=\EP:kh=\EG:kl=\EK:kr=\EM:ku=\EH:le=^H:\ :nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: #### Miscellaneous microcomputer consoles # # If you know anything more about any of these, please tell me. # # basis from Peter Harrison, Computer Graphics Lab, San Francisco # ucbvax!ucsfmis!harrison ...uucp / ucbvax!ucsfmis!harrison@BERKELEY ...ARPA # (basis: removed obsolete ":ma=^K^P^R^L^L :nl=5000*^J:" -- esr) basis|BASIS108 computer with terminal translation table active:\ :cd=\EY:ce=\ET:cl=300\E*:do=5000\n:kb=^H:kd=^J:kl=^H:kr=^L:\ :ku=^K:me=\E):se=\E):so=\E(:\ :tc=adm3a: # luna's BMC terminal emulator luna|luna68k|LUNA68K Bitmap console:\ :co#88:li#46:tc=ansi-mini: megatek|pegasus workstation terminal emulator:\ :am:os:\ :co#83:li#60: # The Xerox 820 was a Z80 micro with a snazzy XEROX PARC-derived # interface (pre-Macintosh by several years) that went nowhere. xerox820|x820|Xerox 820:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^Q:ce=^X:cl=1^Z:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:\ :le=^H:nd=^L:sf=^J:up=^K: #### Videotex and teletext # # \E\:1} switch to te'le'informatique mode (ascii terminal/ISO 6429) # \E[?3l 80 columns # \E[?4l scrolling on # \E[12h local echo off # \Ec reset: G0 U.S. charset (to get #,@,{,},...), 80 cols, clear screen # \E(0 G0 DEC set (line graphics) # # From: Igor Tamitegama , 18 Jan 1997 m2-nam|minitel|minitel-2|minitel-2-nam|France Telecom Minitel 2 mode te'le'informatique:\ :bs:es:hs:xn:\ :co#80:it#8:li#24:sg#0:ws#72:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:SF=^J:SR=\EM:UP=\E[%dA:\ :ac=aaffggjjkkllmmnnooqqssttuuvvwwxx:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:\ :fs=^J:ho=\E[H:i1=\E\0721}\Ec\E[?4l\E[12h:\ :i2=\E[?3l kbs=\010:im=\E[4h:ip=7:is=\Ec\E[12h:\ :k0=\EOp:k1=\EOq:k2=\EOr:k3=\EOs:k4=\EOt:k5=\EOu:k6=\EOv:\ :k7=\EOw:k8=\EOx:k9=\EOy:k;=\EOp:kA=\E[4l:kC=\E[2J:kD=\E[P:\ :kI=\E[4h:kL=\E[M:kN=\EOn:kP=\EOR:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:ll=\E[24;80H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:ps=\E[i:\ :r1=\Ec\E[?4l\E[12h:r2=\Ec:rc=\E8:sc=\E7:se=\E[27m:\ :sf=^J:so=\E[7m:sr=\EM:ta=^I:ts=^_@A:u6=\E[%i%d;%dR:\ :u7=\E[6n:ue=\E[24m:up=\E[A:us=\E[4m:vb=^G:ve=\E[<1l:\ :vi=\E[<1h: ######## OBSOLETE VDT TYPES # # These terminals are *long* dead -- these entries are retained for # historical interest only. #### Amtek Business Machines # # (abm80: early versions of this entry apparently had ":se=\E^_:so=\E^Y", # but these caps were commented out in 8.3; also, removed overridden # ":do=^J:" -- esr) abm80|amtek business machines 80:\ :am:bs:bw:\ :co#80:li#24:\ :al=\E^Z:bt=^T:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E\021%r%+ %+ :\ :dl=\E^S:do=\E^K:ho=\E^R:le=^H:nd=^P:up=\E^L: #### Bell Labs blit terminals # # These were AT&T's official entries. The 5620 FAQ maintained by # David Breneman has this to say: # # Actually, in the beginning was the Jerq, and the Jerq was white with a # green face, and Locanthi and Pike looked upon the Jerq and said the Jerq # was good. But lo, upon the horizon loomed a mighty management-type person # (known now only by the initials VP) who said, the mighty Jerq must stay # alone, and could not go forth into the world. So Locanthi and Pike put the # Jerq to sleep, cloned its parts, and the Blit was brought forth unto the # world. And the Jerq lived the rest of its days in research, but never # strayed from those paths. # # In all seriousness, the Blit was originally known as the Jerq, but when # it started to be shown outside of the halls of the Bell Labs Research # organization, the management powers that be decided that the name could # not remain. So it was renamed to be Blit. This was in late 1981. # # (The AT&T 5620 was the commercialized Blit. Its successors were the 630, # 730, and 730+.) # blit|jerq|blit running teletype rom:\ :am:eo:ul:xo:\ :co#87:it#8:li#72:\ :AL=\EF%+ :DC=\Ee%+ :DL=\EE%+ :IC=\Ef%+ :al=\EF\041:bl=^G:\ :ce=\EK:cl=^L:cm=\EY%r%+ %+ :cr=^M:dc=\Ee\041:dl=\EE\041:\ :do=^J:ei=:ic=\Ef\041:im=:k1=\Ex:k2=\Ey:k3=\Ez:kb=^H:kd=\EB:\ :kl=\ED:kr=\EC:ku=\EA:le=\ED:nd=\EC:sf=^J:ta=^I:up=\EA: # (cbblit: here's a BSD termcap that says :do=\EG: -- esr) cbblit|fixterm|blit running columbus code:\ :co#88:\ :cd=\EJ:ei=\ER:ic@:im=\EQ:pO=\EP%03:pf=^T:po=^R:se=\EV\041:\ :so=\EU\041:ue=\EV":us=\EU":vb=\E^G:\ :tc=blit: oblit|ojerq|first version of blit rom:\ :am:da:db:eo:mi:ul:xo:\ :co#88:it#8:li#72:\ :AL=\Ef%+ :DL=\Ee%+ :al=\EF:bl=^G:cd=\EJ:ce=\EK:cl=^L:\ :cm=\EY%r%+ %+ :cr=^M:dc=\EO:dl=\EE:do=^J:ei=\ER:im=\EQ:\ :kb=^H:le=\ED:nd=\EC:sf=^J:ta=^I:up=\EA:vb=\E^G: #### Bolt, Beranek & Newman (bbn) # # The BitGraph was a product of the now-defunct BBN Computer Corporation. # The parent company, best known as the architects of the Internet, is # still around. # # Entries for the BitGraph terminals. The problem # with scrolling in vi can only be fixed by getting BBN to put # smarter scroll logic in the terminal or changing vi or padding # scrolls with about 500 ms delay. # # I always thought the problem was related to the terminal # counting newlines in its input buffer before scrolling and # then moving the screen that much. Then vi comes along and # paints lines in on the bottom line of the screen, so you get # this big white gap. bitgraph|bg2.0nv|bg3.10nv|bbn bitgraph 2.0 or later (normal video):\ :is=\E>\E[?5l\E[?7h:vb=\E[?5h\E[?5l:\ :tc=bg2.0: bg2.0rv|bg3.10rv|bbn bitgraph 2.0 (reverse video):\ :is=\E>\E[?5h\E[?7h:vb=\E[?5l\E[?5h:tc=bg2.0: bg2.0|bg3.10|bbn bitgraph 2.0 or later (no init):\ :bs:xn:\ :co#85:li#64:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=%i\E[%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dl=\E[M:do=\E[B:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:\ :ku=\E[A:l1=PF1:l2=PF2:l3=PF3:l4=PF4:le=^H:me=\E[m:nd=\E[C:\ :rc=\E8:sc=\E7:se=\E[m:sf=\n:so=\E[7m:ta=^I:up=\E[A: bg1.25rv|bbn bitgraph 1.25 (reverse video):\ :is=\E>\E[?5h\E[?7h:vb=\E[?5l\E[?5h:tc=bg1.25: bg1.25nv|bbn bitgraph 1.25 (normal video):\ :is=\E>\E[?5l\E[?7h:vb=\E[?5h\E[?5l:tc=bg1.25: # (bg1.25: I added / based on the init string -- esr) bg1.25|bbn bitgraph 1.25:\ :co#85:li#64:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=%i\E[%d;%dH:cr=^M:dl=\E[M:do=\E[B:k1=\EP:\ :k2=\EQ:k3=\ER:k4=\ES:kd=\EB:ke=\E>:kl=\ED:kr=\EC:ks=\E=:\ :ku=\EA:l1=PF1:l2=PF2:l3=PF3:l4=PF4:le=^H:ll=\E[64;1H:\ :me=\E[m:nd=\E[C:se=\E[m:sf=\n:so=\E[7m:ta=^I:up=\E[A: #### Chromatics # # I have put the long strings in :ti:/:te:. Ti sets up a window # that is smaller than the screen, and puts up a warning message # outside the window. Te erases the warning message, puts the # window back to be the whole screen, and puts the cursor at just # below the small window. I defined :ve: and :vi: to really turn # the cursor on and off, but I have taken this out since I don't # like the cursor being turned off when vi exits. cg7900|chromatics|chromatics 7900:\ :am:\ :co#80:li#40:\ :al=^A>2:bl=^G:cd=^Al:ce=^A`:cl=^L:cm=\001M%r%d\054%d\054:\ :cr=^M:dc=^A<1:dl=^A<2:do=^J:ei=:ho=^\:ic=^A>1:im=:le=^H:\ :ll=^A|:nd=^]:se=\001C1\054\001c2\054:sf=^J:\ :so=\001C4\054\001c7\054:\ :te=\001W0\05440\05485\05448\054\014\001W0\0540\05485\05448\054\001M0\05440\054:\ :ti=\001P0\001O1\001R1\001C4\054\001c0\054\014\001M0\05442\054WARNING DOUBLE ENTER ESCAPE and \025\001C1\054\001c2\054\001W0\0540\05479\05439\054:\ :uc=\001\001_\001\200:up=^K: #### Computer Automation # ca22851|computer automation 22851:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^\:ce=^]:cl=\014:cm=\002%i%.%.:cr=^M:do=^J:ho=^^:\ :kd=^W:kh=^^:kl=^U:ku=^V:le=^U:nd=^I:sf=^J:up=^V: #### Cybernex # # This entry has correct padding and the undocumented "ri" capability cyb83|xl83|cybernex xl-83:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cd=\020:ce=\017:cl=\014:cm=\027%+ %+ :cr=^M:do=^J:\ :ho=^K:kd=^J:kl=^H:kr=^I:ku=^N:le=^H:nd=^I:sf=^J:sr=^N:up=^N: # (mdl110: removed obsolete ":ma=^Z^P:" and overridden ":cd=145^NA^W:" -- esr) cyb110|mdl110|cybernex mdl-110:\ :am:bs:\ :co#80:li#24:\ :al=\016A\016\035:bl=^G:cd=\016@\026:ce=\016@\026:\ :cl=\030:cm=\020%+ %+ :cr=^M:dc=\016A\036:\ :dl=\016A\016\036:do=^J:ei=:ho=^Y:ic=\016A\035:im=:le=^H:\ :nd=^U:se=^NG:sf=^J:so=^NF:ta=\011:up=^Z: #### Datapoint # # Datapoint is gone. They used to be headquartered in Texas. # They created ARCnet, an Ethernet competitor that flourished for a while # in the early 1980s before 3COM got wise and cut its prices. The service # side of Datapoint still lives (1995) in the form of Intelogic Trace. # dp3360|datapoint|datapoint 3360:\ :am:bs:\ :co#82:li#25:\ :bl=^G:cd=^_:ce=^^:cl=^]^_:cr=^M:do=^J:ho=^]:le=^H:nd=^X:\ :sf=^J:up=^Z: # From: Jan Willem Stumpel , 11 May 1997 # The Datapoint 8242 Workstation was sold at least between 1985 # and 1989. To make the terminal work with this entry, press # CONTROL-INT-INT to take the terminal off-line, and type (opt). # Set the options AUTO ROLL, ROLL DN, and ESC KBD on, and AUTO # CR/LF off. Use control-shift-[] as escape key, control-I as tab, # shift-F1 to shift-F5 as F6 to F10 (unshifted F1 to F5 are in # fact unusable because the strings sent by the terminal conflict # with other keys). # The terminal is capable of displaying "box draw" characters. # For each graphic character you must send 2 ESC's (\E\E) followed # by a control character as follows: # character meaning # ========= ======= # ctrl-E top tee # ctrl-F right tee # ctrl-G bottom tee # ctrl-H left tee # ctrl-I cross # ctrl-J top left corner # ctrl-K top right corner # ctrl-L bottom left corner # ctrl-M bottom right corner # ctrl-N horizontal line # ctrl-O vertical line # Unfortunately this cannot be fitted into the termcap/terminfo # description scheme. dp8242|datapoint 8242:\ :ms:\ :co#80:li#25:\ :al=\E^T:bl=^G:cd=^W:ce=^V:cl=\025\E\004\027\030:\ :cm=\011%r%+\%+\:cr=^M:dl=\E^Z:do=^J:ho=^U:\ :i1=\E\014\E\016\200\230\200\317\025\027\030\E\004:\ :k1=^G\Ee:k2=^I\Ed:k3=^J\Ec:k4=^J\Eb:k5=^S\Ea:k6=\EO\Ee:\ :k7=\EN\Ed:k8=\EM\Ec:k9=\EL\Eb:k;=\EK\Ea:kb=^H:kd=^B:kl=^D:\ :kr=^F:ku=^E:le=^H:nw=^M^J:\ :r1=\E\014\E\016\200\230\200\317\025\027\030\E\004:\ :rp=\E\023%.%.:se=\E^D:sf=^C:so=\E^E:sr=^K:ta=^I:ue=\E^D:\ :us=\E^F:ve=^X:vi=^Y:\ :..wi=\E\014\E\016%p1%'\200'%+%c%p2%'\200'%+%c%p3%'\200'%+%c%p4%'\200'%+%c\025: #### DEC terminals (Obsolete types: DECwriter and vt40/42/50) # # These entries are DEC's official terminfos for its older terminals. # Contact Bill Hedberg of Terminal Support # Engineering for more information. Updated terminfos and termcaps # are kept available at ftp://gatekeeper.dec.com/pub/DEC/termcaps. # gt40|dec gt40:\ :bs:os:\ :co#72:li#30:\ :bl=^G:cr=^M:do=^J:le=^H: gt42|dec gt42:\ :bs:os:\ :co#72:li#40:\ :bl=^G:cr=^M:do=^J:le=^H: vt50|dec vt50:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cr=^M:do=^J:le=^H:nd=\EC:\ :sf=^J:ta=^I:up=\EA: vt50h|dec vt50h:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:do=^J:\ :le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: # (vt61: there's a BSD termcap that claims :dl=\EPd:, :al=\EPf.: :kb=^H:) vt61|vt-61|vt61.5|dec vt61:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=\r:do=^J:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:sf=\n:sr=\EI:ta=^I:\ :up=\EA: # The gigi does standout with red! # (gigi: I added / based on the init string, corrected cub1 -- esr) gigi|vk100|dec gigi graphics terminal:\ :am:bs:xn:\ :co#84:li#24:\ :DO=\E[%dB:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:do=^J:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?20l\E[?7h\E[?8h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kd=\EOB:ke=\E[?1l\E>:kh=\E[H:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:me=\E[m:\ :nd=\E[C:se=\E[m:sf=^J:so=\E[7;31m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: # DEC PRO-350 console (VT220-style). The 350 was DEC's attempt to produce # a PC differentiated from the IBM clones. It was a total, ludicrous, # grossly-overpriced failure (among other things, DEC's OS didn't include # a format program, so you had to buy pre-formatted floppies from DEC at # a hefty premium!). pro350|decpro|dec pro console:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :do=\EB:\ :ho=\EH:k0=\EE:k1=\EF:k2=\EG:k3=\EH:k4=\EI:k5=\EJ:k6=\Ei:\ :k7=\Ej:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :se=\E^N:so=\E^H:sr=\EI:ta=^I:ue=\E^C:up=\EA:us=\E^D: dw1|decwriter I:\ :bs:hc:os:\ :co#72:\ :bl=^G:cr=^M:do=^J:le=^H:sf=^J: dw2|decwriter|dw|decwriter II:\ :bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:kb=^H:le=^H:sf=^J: # \E(B Use U.S. character set (otherwise # => british pound !) # \E[20l Disable "linefeed newline" mode (else puts \r after \n,\f,\v) # \E[w 10 char/in pitch # \E[1;132 full width horizontal margins # \E[2g clear all tab stops # \E[z 6 lines/in # \E[66t 66 lines/page (for \f) # \E[1;66r full vertical page can be printed # \E[4g clear vertical tab stops # \E> disable alternate keypad mode (so it transmits numbers!) # \E[%i%p1%du set tab stop at column %d (origin == 1) # (Full syntax is \E[n;n;n;n;n;...;nu where each 'n' is # a tab stop) # # The dw3 does standout with wide characters. # dw3|la120|decwriter III:\ :bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:\ :i1=\E(B\E[20l\E[w\E[0;132s\E[2g\E[z\E[66t\E[1;66r\E[4g\E>:\ :is=\E[9;17;25;33;41;49;57;65;73;81;89;97;105;113;121;129u\r:\ :kb=^H:le=^H:me=\E[w:se=\E[w:sf=^J:so=\E[6w:ta=^I: dw4|decwriter IV:\ :am:bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:is=\Ec:k0=\EOP:k1=\EOQ:k2=\EOR:k3=\EOS:\ :kb=^H:le=^H:sf=^J:ta=^I: # These aren't official ln03|dec ln03 laser printer:\ :hc:\ :co#80:li#66:\ :bl=^G:cr=^M:do=^J:hd=\EK:hu=\EL:me=\E[m:nw=^M^J:se=\E[22m:\ :sf=^J:so=\E[1m:ta=^I:ue=\E[24m:us=\E[4m: ln03-w|dec ln03 laser printer 132 cols:\ :co#132:\ :bl=^G:cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ln03: #### Delta Data (dd) # # Untested. The cup sequence is hairy enough that it probably needs work. # The idea is ctrl(O), dd(row), dd(col), where dd(x) is x - 2*(x%16) + '9'. # There are BSD-derived termcap entries floating around for this puppy # that are *certainly* wrong. delta|dd5000|delta data 5000:\ :am:bs:\ :co#80:li#27:\ :bl=^G:ce=^NU:cl=^NR:cm=\017%+^P%+^P:dc=^NV:do=^J:ho=^NQ:\ :le=^H:nd=^Y:sf=^J:up=^Z: #### Digital Data Research (ddr) # # (ddr: I added / based on the init string -- esr) ddr|rebus3180|ddr3180|Rebus/DDR 3180 vt100 emulator:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[7l:SA=\E[7l:cd=50\E[J:ce=3\E[K:cl=50\E[H\E[2J:\ :cm=5\E[%i%d;%dH:cs=\E[%i%d;%dr:do=^J:ho=\E[H:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\E[B:ke=\E[?1l\E>:kl=\E[D:kr=\E[C:ks=\E[?1h\E=:\ :ku=\E[A:le=^H:mb=2\E[5m:md=2\E[1m:me=2\E[m:mr=2\E[7m:\ :nd=2\E[C:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[m:sf=5\ED:\ :so=\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:us=2\E[4m: #### Evans & Sutherland # # Jon Leech tells us: # The ps300 was the Evans & Sutherland Picture System 300, a high # performance 3D vector graphics system with a bunch of specialized hardware. # Approximate date of release was 1982 (early 80s, anyway), and it had several # evolutions including (limited) color versions such as the PS330C. PS300s # were effectively obsolete by the late 80s, replaced by raster graphics # systems, although specialized applications like molecular modelling # hung onto them for a while longer. AFAIK all E&S vector graphics systems # are out of production, though of course E&S is very much alive (in 1996). # (ps300: changed ":pt@:" to "it@" -- esr) # ps300|Picture System 300:\ :xt:\ :it@:\ :se@:so@:ue@:us@:tc=vt100: #### General Electric (ge) # terminet1200|terminet300|tn1200|tn300|terminet|GE terminet 1200:\ :bs:hc:os:\ :co#120:\ :bl=^G:cr=^M:do=^J:sf=^J: #### Heathkit/Zenith # # Here is a description of the H19 DIP switches: # # S401 # 0-3 = baud rate as follows: # # 3 2 1 0 # --- --- --- --- # 0 0 1 1 300 baud # 0 1 0 1 1200 baud # 1 0 0 0 2400 baud # 1 0 1 0 4800 baud # 1 1 0 0 9600 baud # 1 1 0 1 19.2K baud # # 4 = parity (0 = no parity) # 5 = even parity (0 = odd parity) # 6 = stick parity (0 = normal parity) # 7 = full duplex (0 = half duplex) # # S402 # 0 = block cursor (0 = underscore cursor) # 1 = no key click (0 = keyclick) # 2 = wrap at end of line (0 = no wrap) # 3 = auto LF on CR (0 = no LF on CR) # 4 = auto CR on LF (0 = no CR on LF) # 5 = ANSI mode (0 = VT52 mode) # 6 = keypad shifted (0 = keypad unshifted) # 7 = 50Hz refresh (1 = 60Hz refresh) # # Factory Default settings are as follows: # 7 6 5 4 3 2 1 0 # S401 1 0 0 0 1 1 0 0 # S402 0 0 0 0 0 0 0 0 # (h19: I added / based on the init string; # also added empty to suppress a tic warning -- esr) h19-a|h19a|heath-ansi|heathkit-a|heathkit h19 ansi mode:\ :am:bs:mi:ms:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:ac=:ae=\E[11m:al=\E[1L:as=\E[10m:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :dc=\E[1P:dl=\E[1M:do=\E[1B:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E<\E[>1;2;3;4;5;6;7;8;9l\E[m\E[11m\E[?7h:k1=\EOS:\ :k2=\EOT:k3=\EOU:k4=\EOV:k5=\EOW:k6=\EOP:k7=\EOQ:k8=\EOR:\ :kb=^H:kd=\E[1B:kh=\E[H:kl=\E[1D:kr=\E[1C:ku=\E[1A:l6=blue:\ :l7=red:l8=white:le=^H:nd=\E[1C:se=\E[m:sf=^J:so=\E[7m:\ :sr=\EM:ta=^I:up=\E[1A:ve=\E[>4l:vs=\E[>4h: h19-bs|heathkit w/keypad shifted:\ :ke=\Eu:ks=\Et:tc=h19-b: h19-smul|heathkit w/keypad shifted/underscore cursor:\ :ke=\Eu:ks=\Et:\ :tc=h19-u: # (h19: merged in :ip: from BSDI hp19-e entry>; # also added empty to suppress a tic warning --esr) h19|heath|h19-b|heathkit|heath-19|z19|zenith|heathkit h19:\ :am:bs:es:hs:mi:ms:\ :co#80:it#8:li#24:\ :ac=:ae=\EG:al=\EL:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EE:\ :cm=\EY%+ %+ :cr=^M:dc=\EN:dl=\EM:do=\EB:ei=\EO:fs=\Ek\Ey5:\ :ho=\EH:im=\E@:ip=1.5<1.5/>:k1=\ES:k2=\ET:k3=\EU:k4=\EV:\ :k5=\EW:k6=\EP:k7=\EQ:k8=\ER:kb=^H:kd=\EB:kh=\EH:kl=\ED:\ :kr=\EC:ku=\EA:l6=blue:l7=red:l8=white:le=^H:nd=\EC:se=\Eq:\ :sf=^J:so=\Ep:sr=\EI:ta=^I:\ :ts=\Ej\Ex5\EY8%p1%{32}%+%c\Eo\Eo:up=\EA:ve=\Ey4:\ :vs=\Ex4: h19-u|heathkit with underscore cursor:\ :ve@:vs@:tc=h19-b: h19-us|h19us|heathkit w/keypad shifted/underscore cursor:\ :ke=\Eu:ks=\Et:\ :tc=h19-u: h19-g|h19g|heathkit w/block cursor:\ :ve=\Ex4:tc=h19-b: alto-h19|altoh19|altoheath|alto-heath|alto emulating heathkit h19:\ :li#60:\ :al=\EL:dl=\EM:tc=h19: # The major problem with the Z29 is that it requires more padding than the Z19. # # The problem with declaring an H19 to be synonymous with a Z29 is that # it needs more padding. It especially loses if a program attempts # to put the Z29 into insert mode and insert text at 9600 baud. It # even loses worse if the program attempts to insert tabs at 9600 # baud. Adding padding to text that is inserted loses because in # order to make the Z29 not die, one must add so much padding that # whenever the program tries to use insert mode, the effective # rate is about 110 baud. # # What program would want to put the terminal into insert mode # and shove stuff at it at 9600 baud you ask? # # Emacs. Emacs seems to want to do the mathematically optimal # thing in doing a redisplay rather than the practical thing. # When it is about to output a line on top of a line that is # already on the screen, instead of just killing to the end of # the line and outputting the new line, it compares the old line # and the new line and if there are any similarities, it # constructs the new line by deleting the text on the old line # on the terminal that is already there and then inserting new # text into the line to transform it into the new line that is # to be displayed. The Z29 does not react kindly to this. # # But don't cry for too long.... There is a solution. You can make # a termcap entry for the Z29 that says the Z29 has no insert mode. # Then Emacs cannot use it. "Oh, no, but now inserting into a # line will be really slow", you say. Well there is a sort of a # solution to that too. There is an insert character option on # the Z29 that will insert one character. Unfortunately, it # involves putting the terminal into ansi mode, inserting the # character, and changing it back to H19 mode. All this takes 12 # characters. Pretty expensive to insert one character, but it # works. Either Emacs doesn't try to use its inserting hack when # it's only given an insert character ability or the Z29 doesn't # require padding with this (the former is probably more likely, # but I haven't checked it out). # (z29: added empty to suppress a tic warning, merged in # status line capabilities from BRL entry --esr) z29|zenith29|z29b|zenith z29b:\ :am:bs:es:hs:mi:ms:pt:\ :co#80:kn#10:li#24:\ :ac=:ae=\EF:al=1\EL:as=\EG:bc=\ED:bl=^G:bt=\E-:cd=\EJ:ce=\EK:\ :cl=\EE:cm=\EY%+ %+ :cr=^M:dc=\EN:dl=1\EM:do=\EB:ds=\Ey1:\ :ei=\EO:fs=\Ek\Ey5:ho=\EH:ic=\E<\E[1@\E[?2h:im=\E@:\ :is=\E<\E[?2h\Ev:k0=\E~:k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:\ :k6=\EP:k7=\EQ:k8=\ER:k9=\E0I:kb=^H:kd=\EB:kh=\EH:kl=\ED:\ :kr=\EC:ku=\EA:l0=home:le=^H:nd=\EC:se=\Eq:sf=\n:so=\Ep:\ :sr=2\EI:ta=^I:ts=\Ej\Ex5\Ex1\EY8%+ \Eo:ue=\Es0:up=\EA:\ :us=\Es8:ve=\Ey4:vs=\Ex4: # z29 in ansi mode. Assumes that the cursor is in the correct state, and that # the world is stable. causes the terminal to be reset to the state # indicated by the name. kc -> key click, nkc -> no key click, uc -> underscore # cursor, bc -> block cursor. # From: Mike Meyers # (z29a: replaced nonexistent :if=/usr/share/tabset/zenith29: befause :st: # looks vt100-compatible -- esr) z29a|z29a-kc-bc|h29a-kc-bc|heath/zenith 29 in ansi mode:\ :am:bs:es:hs:mi:ms:pt:\ :co#80:it#8:kn#10:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:bc=\ED:bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[1P:\ :do=^J:ds=\E[>1l:fs=\E[u\E[>5l:ho=\E[H:\ :if=/usr/share/tabset/vt100:k0=\E[~:k1=\EOS:k2=\EOT:\ :k3=\EOU:k4=\EOV:k5=\EOW:k6=\EOP:k7=\EOQ:k8=\EOR:k9=\EOX:\ :kC=\E[J:kS=\E[J:kb=^H:kd=\EOB:kh=\E[H:kl=\EOD:kr=\EOC:\ :ku=\EOA:l0=help:le=^H:mb=\E[5m:md=\E[2m:me=\E[m:mh=\E[2m:\ :mr=\E[7m:nd=\E[C:nw=^M\ED:ps=\E#7:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>4h\E[>1;2;3;5;6;7;8;9l\E[m\E[11m:\ :rc=\E[r:sc=\E[s:se=\E[m:sf=\ED:so=\E[7;2m:sr=\EM:st=\EH:\ :ta=^I:te=\E[?7h:ti=\E[?7l:\ :ts=\E[s\E[>5;1h\E[25;%i%dH\E[1K:ue=\E[m:up=\E[A:\ :us=\E[4m: z29a-kc-uc|h29a-kc-uc|z29 ansi mode with keyckick and underscore cursor:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>1;2;3;4;5;6;7;8;9l\E[m\E[11m:\ :tc=z29a: z29a-nkc-bc|h29a-nkc-bc|z29 ansi mode with block cursor and no keyclick:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>2;4h\E[>1;3;5;6;7;8;9l\E[m\E[11m:\ :tc=z29a: z29a-nkc-uc|h29a-nkc-uc|z29 ansi mode with underscore cursor and no keyclick:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>2h\E[>1;3;4;5;6;7;8;9l\E[m\E[11m:\ :tc=z29a: # From: Jeff Bartig 31 Mar 1995 z39-a|z39a|zenith39-a|zenith39-ansi|Zenith 39 in ANSI mode:\ :5i:am:es:hs:mi:ms:xo:\ :co#80:li#24:\ :%1=\E[~:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:K1=\EOw:\ :K2=\EOy:K3=\EOu:K4=\EOq:K5=\EOs:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:ac=``aaffggjjkkllmmnnooqqssttuuvvwwxx~~0a:\ :ae=\E(B:al=\E[1L:as=\E(0:bl=^G:bt=\E[1Z:cb=\E[1K:cd=\E[0J:\ :ce=\E[0K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[1P:dl=\E[1M:do=\E[B:\ :ds=\E[>1l:ei=\E[4l:fs=\E[u:ho=\E[H:im=\E[4h:\ :is=\E<\E[>1;3;5;6;7l\E[0m\E[2J:k1=\EOS:k2=\EOT:k3=\EOU:\ :k4=\EOV:k5=\EOW:k6=\EOP:k7=\EOQ:k8=\EOR:k9=\EOX:kS=\E[J:\ :kb=^H:kd=\E[B:ke=\E[>7l:kh=\E[H:kl=\E[D:kr=\E[C:ks=\E[>7h:\ :ku=\E[A:le=^H:ll=\E[24;1H:mb=\E[5m:md=\E[1m:me=\E[0m:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[?19h\E[i:r2=\E<\Ec\200:rc=\E[u:sc=\E[s:se=\E[0m:\ :sf=^J:so=\E[7m:st=\EH:ta=^I:ts=\E[s\E[>1h\E[25;%i%p1%dH:\ :ue=\E[0m:up=\E[A:us=\E[4m:ve=\E[>5l:vi=\E[>5h: # From: Brad Brahms z100|h100|z110|z-100|h-100|heath/zenith z-100 pc with color monitor:\ :ve=\Ey4\Em70:vs=\Ex4\Em71:\ :tc=z100bw: # (z100bw: removed obsolete ":kn#10:", added empty -- esr) z100bw|h100bw|z110bw|z-100bw|h-100bw|heath/zenith z-100 pc:\ :bs:mi:ms:pt:\ :co#80:it#8:kn#10:li#24:\ :ac=:ae=\EG:al=5*\EL:as=\EF:cd=\EJ:ce=\EK:cl=5*\EE:\ :cm=1*\EY%+ %+ :dc=1*\EN:dl=5*\EM:do=\EB:ei=\EO:ho=\EH:\ :im=\E@:k0=\EJ:k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:\ :k7=\EQ:k8=\ER:k9=\EOI:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :ku=\EA:le=^H:nd=\EC:se=\Eq:so=\Ep:sr=\EI:ta=^I:up=\EA:\ :ve=\Ey4:vs=\Ex4: p19|h19-b with il1/dl1:\ :al=2*\EL:dl=2*\EM:tc=h19-b: # From: # (ztx: removed duplicate :sr: -- esr) ztx|ztx11|zt-1|htx11|ztx-1-a|ztx-10 or 11:\ :am:bs:es:hs:\ :co#80:it#8:li#24:\ :al=\EL:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :dl=\EM:do=^J:\ :ds=\Ey1:fs=\Ek\Ey5:ho=\EH:\ :is=\Ej\EH\Eq\Ek\Ev\Ey1\Ey5\EG\Ey8\Ey9\Ey>:k0=\ES:\ :k1=\EB:k2=\EU:k3=\EV:k4=\EW:k5=\EP:k6=\EQ:k7=\ER:kb=^H:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\Eq:so=\Es5:\ :sr=\EI:ta=^I:ts=\Ej\Ex5\Ex1\EY8%+ \Eo:ue=\Eq:up=\EA:\ :us=\Es2: #### IMS International (ims) # # There was a company called IMS International located in Carson City, # Nevada, that flourished from the mid-70s to mid-80s. They made S-100 # bus/Z80 hardware and a line of terminals called Ultimas. # # From: Erik Fair Sun Oct 27 07:21:05 1985 ims950-b|bare ims950 no init string:\ :is@:tc=ims950: # (ims950: removed obsolete ":ko@:" -- esr) ims950|ims televideo 950 emulation:\ :xn@:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb@:kd@:kh@:kl@:kr@:ku@:vb@:tc=tvi950: # (ims950-rv: removed obsolete ":ko@:" -- esr) ims950-rv|ims tvi950 rev video:\ :xn@:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb@:kd@:kh@:kl@:kr@:ku@:vb@:tc=tvi950-rv: ims-ansi|ultima2|ultimaII|IMS Ultima II:\ :am:bs:\ :co#80:it#8:li#24:\ :cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:cm=\E[%i%2;%2H:do=\ED:\ :if=/usr/share/tabset/vt100:\ :is=\E[m\E[>14l\E[?1;?5;20l\E>\E[1m\r:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:se=\E[m\E[1m:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m\E[1m:up=\EM:us=\E[4m: #### Intertec Data Systems # # I think this company is long dead as of 1995. They made an early CP/M # micro called the "Intertec Superbrain" that was moderately popular, # then sank out of sight. # superbrain|intertec superbrain:\ :am:bs:bw:\ :co#80:li#24:\ :bc=^U:bl=^G:cd=\E~k<10*>:ce=\E~K:cl=\014:cm=\EY%+ %+ :\ :cr=^M:do=^J:kd=^J:kl=^U:kr=^F:ku=^K:le=^H:nd=^F:sf=^J:ta=^I:\ :te=^L:ti=^L:up=^K: # (intertube: a Gould entry via BRL asserted smul=\E0@$<200/>, # rmul=\E0A$<200/>; my guess is the highlight letter is bit-coded like an ADM, # and the reverse is actually true. Try it. -- esr) intertube|intertec|Intertec InterTube:\ :am:bs:\ :co#80:li#25:\ :bl=^G:cl=^L:cm=\EY%+ %+ :cr=^M:do=^J:ho=^A:le=^H:nd=^F:\ :se=\E0@:sf=^J:so=\E0P:up=^Z: # The intertube 2 has the "full duplex" problem like the tek 4025: if you # are typing and a command comes in, the keystrokes you type get interspersed # with the command and it messes up intertube2|intertec data systems intertube 2:\ :bs:\ :ce=\EK:ch=\020%+^J:cm=\016%.\020%+^J:cv=\013%.:\ :ll=^K^X\r:\ :tc=intertube: #### Ithaca Intersystems # # This company made S100-bus personal computers long ago in the pre-IBM-PC # past. They used to be reachable at: # # Ithaca Intersystems # 1650 Hanshaw Road # Ithaca, New York 14850 # # However, the outfit went bankrupt years ago. # # The Graphos III was a color graphics terminal from Ithaca Intersystems. # These entries were written (originally in termcap syntax) by Brian Yandell # and Mike Meyer at the # University of Wisconsin. # (graphos: removed obsolete and syntactically incorrect :kn=4:, # removed :if=/usr/share/tabset/init.graphos: and # no such file & no :st: -- esr) graphos|graphos III:\ :am:mi:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:dm=\E[4h:do=\E[B:\ :ed=\E[4l:ei=\E[4l:ho=\E[H:im=\E[4h:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:me=\E[m:nd=\E[C:nw=^M\ED:rc=\E8:sc=\E7:\ :se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:up=\E[A:\ :ve=\Ez56;2;0;0z\Ez73z\Ez4;1;1z:\ :vs=\Ez4;2;1z\Ez56;2;80;24z: graphos-30|graphos III with 30 lines:\ :li#30:\ :vs=\Ez4;2;1z\Ez56;2;80;30z:tc=graphos: #### Modgraph # # These people used to be reachable at: # # Modgraph, Inc # 1393 Main Street, # Waltham, MA 02154 # Vox: (617)-890-5796. # # However, if you call that number today you'll get an insurance company. # I have mail from "Michael Berman, V.P. Sales, Modgraph" dated # 26 Feb 1997 that says: # # Modgraph GX-1000, replaced by GX-2000. Both are out of production, have been # for ~7 years. Modgraph still in business. Products are rugged laptop and # portable PC's and specialized CRT and LCD monitors (rugged, rack-mount # panel-mount etc). I can be emailed at sonfour@aol.com # modgraph|mod24|modgraph terminal emulating vt100:\ :xn@:\ :co#80:li#24:\ :is=\E\1369;0s\E\1367;1s\E[3g\E\13611;9s\E\13611;17s\E\13611;25s\E\13611;33s\E\13611;41s\E\13611;49s\E\13611;57s\E\13611;65s\E\13611;73s\E\13611;81s\E\13611;89s:\ :rf@:sr=5\EM\E[K:vs=\E\1369;0s\E\1367;1s:\ :tc=vt100: # The GX-1000 manual is dated 1984. This looks rather like a VT-52. modgraph2|modgraph gx-1000 80x24 with keypad not enabled:\ :am:da:db:\ :co#80:it#8:li#24:\ :cd=50\EJ:ce=3\EK:cl=50\EH\EJ:cm=5\EY%+ %+ :\ :is=\E<\E\1365;2s\E\1367;1s\E[3g\E\13611;9s\E\13611;17s\E\13611;25s\E\13611;33s\E\13611;41s\E\13611;49s\E\13611;57s\E\13611;65s\E\13611;73s\E\13611;81s\E\13611;89s\E\13612;0s\E\13614;2s\E\13615;9s\E\13625;1s\E\1369;1s\E\13627;1:\ :le=^H:nd=2\EC:sr=5\EI:ta=^I:up=2\EA: # # Modgraph from Nancy L. Cider # BUG NOTE from Barbara E. Ringers : # If we set TERM=vt100, and set the Modgraph screen to 24 lines, setting a # mark and using delete-to-killbuffer work correctly. However, we would # like normal mode of operation to be using a Modgraph with 48 line setting. # If we set TERM=mod (which is a valid entry in termcap with 48 lines) # the setting mark and delete-to-killbuffer results in the deletion of only # the line the mark is set on. # We've discovered that the delete-to-killbuffer works correctly # with TERM=mod and screen set to 80x48 but it's not obvious. Only # the first line disappears but a ctrl-l shows that it did work # correctly. modgraph48|mod|Modgraph w/48 lines:\ :am:bs:pt:xn:\ :co#80:it#8:li#48:vt#3:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:do=^J:ho=\E[H:\ :is=\E<\E[1;48r\E[0q\E[3;4q\E=\E[?1h:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:r1=\E=\E[0q\E>:rc=\E8:\ :sc=\E7:se=\E[m:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[0q\E[1;2q\E[?5l\E[0q\E[4;3q: #### Morrow Designs # # This was George Morrow's company. They started in the late 1970s making # S100-bus machines. They used to be reachable at: # # Morrow # 600 McCormick St. # San Leandro, CA 94577 # # but they're long gone now (1995). # # The mt70 terminal was shipped with the Morrow MD-3 microcomputer. # Jeff's specimen was dated June 1984. # From: Jeff Wieland 24 Feb 1995 mt70|mt-70|Morrow MD-70; native Morrow mode:\ :am:mi:ms:xo:\ :co#80:it#8:li#24:\ :%1=^AO\r:F1=^A`\r:F2=^Aa\r:F3=^Ab\r:F4=^Ac\r:F5=^Ad\r:\ :F6=^Ae\r:F7=^Af\r:F8=^Ag\r:F9=^Ah\r:FA=^Ai\r:\ :ac=+z\054{.yOi-x`|jGkFlEmDnHtLuKvNwMxIqJ:ae=\E%:\ :al=\EE:as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ei=:ho=^^:\ :i1=\E"2\EG0\E]:ic=\EQ:im=:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:\ :k;=^AI\r:kB=^A^Z\r:kC=^An\r:kD=\177:kb=^H:kd=^AK\r:\ :kh=^AN\r:kl=^AL\r:kr=^AM\r:ku=^AJ\r:le=^H:mh=\EG2:mk@:\ :nd=^L:nw=^_:sf=^J:ta=^I:te=:ti=\E"2\EG0\E]:up=^K:us=\EG1:\ :vb=\EK1\EK0:ve=\E"2:vi=\E"0:\ :tc=adm+sgr: #### Motorola # # Motorola EXORterm 155 from {decvax, ihnp4}!philabs!sbcs!megad!seth via BRL # (Seth H Zirin) ex155|Motorola Exorterm 155:\ :am:bs:bw:\ :co#80:kn#5:li#24:ug#1:\ :bt=\E[:cd=\ET:ce=\EU:cl=\EX:cm=\EE%+ %+ :do=\EB:ho=\E@:\ :kB=\E[:kC=\EX:kE=\EU:kS=\ET:kb=^H:kd=^J:kh=\E@:kl=^H:kr=^L:\ :ku=^K:nd=\ED:se=\Ec\ED:so=\Eb\ED:ta=\EZ:ue=\Eg\ED:\ :us=\Ef\ED: #### Omron # # This company is still around in 1995, manufacturing point-of-sale systems. omron|Omron 8025AG:\ :am:bs:da:db:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\ER:ce=\EK:cl=\EJ:cr=^M:dc=\EP:dl=\EM:do=^J:\ :ho=\EH:le=^H:nd=\EC:se=\E4:sf=\ES:so=\Ef:sr=\ET:up=\EA:\ :vs=\EN: #### Ramtek # # Ramtek was a vendor of high-end graphics terminals around 1979-1983; they # were competition for things like the Tektronics 4025. # # Ramtek 6221 from BRL, probably by Doug Gwyn # The following SET-UP modes are assumed for normal operation: # UNDERLINE_CURSOR ANSI_MODE AUTO_XON/XOFF_ON # NEWLINE_OFF 80_COLUMNS # Other SET-UP modes may be set for operator convenience or communication # requirements; I recommend # SMOOTH_SCROLL AUTO_REPEAT_ON 3_#_SHIFTED WRAP_AROUND_ON # Hardware tabs are assumed to be every 8 columns; they can be set up by the # "reset", "tset", or "tabs" utilities (use rt6221-w, 160 columns, for this). # Note that the Control-E key is useless on this brain-damaged terminal. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! rt6221|Ramtek 6221, 80x24:\ :bs:ms:pt:xo:\ :co#80:it#8:kn#4:li#24:vt#3:\ :DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ac=:ae=\E(B:as=\E(0:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[1;1H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^K:ho=\E[1;1H:is=:\ :k0=\EOP:k1=\EOQ:k2=\EOR:k3=\EOS:kb=^H:kd=\E[B:ke=\E>:\ :kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:l0=PF1:l1=PF2:l2=PF3:l3=PF4:\ :le=^H:ll=\E[24;1H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:nw=\EE:\ :r1=\E[1w\E[>37m\E[>39m\E[1v\E[20l\E[?3l\E[?6l\E[>5h\E[>6h\E[>7h\E[>8l\E[>9h\E[>10l\E[1;24r\E[m\E[q\E(B\017\E#5\E>:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\EM:us=\E[4m:ve=\E[>5h\E[>9h:vi=\E[>5l:\ :vs=\E[>7h\E[>9l: # [TO DO: Check out: short forms of ho/cl and ll; reset (\Ec)]. rt6221-w|Ramtek 6221, 160x48:\ :co#160:li#48:\ :ll=\E[48;1H:tc=rt6221: #### RCA # # RCA VP3301 or VP3501 rca|rca vp3301/vp3501:\ :bs:\ :co#40:li#24:\ :cl=^L:cm=\EY%+ %+ :ho=^Z:nd=^U:se=\E\ES0:so=\E\ES1:up=^K: #### Selanar # # Selanar HiREZ-100 from BRL, probably by Doug Gwyn # The following SET-UP modes are assumed for normal operation: # SET_DEFAULT_TABS 48_LINES 80_COLUMNS # ONLINE ANSI CURSOR_VISIBLE # VT102_AUTO_WRAP_ON VT102_NEWLINE_OFF VT102_MONITOR_MODE_OFF # LOCAL_ECHO_OFF US_CHAR_SET WPS_TERMINAL_DISABLED # CPU_AUTO_XON/XOFF_ENABLED PRINT_FULL_SCREEN # For use with graphics software, all graphics modes should be set to factory # default. Other SET-UP modes may be set for operator convenience or # communication requirements. No delays are specified; use "stty ixon -ixany" # to enable DC3/DC1 flow control! # I commented out the scrolling capabilities since they are too slow. hirez100|Selanar HiREZ-100:\ :bs:mi:ms:pt:xo:\ :co#80:it#8:kn#4:li#48:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ac=:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=^J:ho=\E[H:is=\E<:k0=\EOP:k1=\EOQ:\ :k2=\EOR:k3=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=PF1:l1=PF2:l2=PF3:l3=PF4:\ :le=^H:ll=\E[48H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:nw=\EE:pf=\E[4i\E[?4i:po=\E[?5i\E[5i:ps=\E[i:\ :r1=\030\E2\E<\E[4i\E[?4i\E[12h\E[2;4;20l\E[?0;7h\E[?1;3;6;19l\E[r\E[m\E(B\017\E>:\ :rc=\E8:sc=\E7:se=\E[m:so=\E[7m:st=\EH:ta=^I:ue=\E[m:up=\EM:\ :us=\E[4m: hirez100-w|Selanar HiREZ-100 in 132-column mode:\ :co#132:tc=hirez100: #### Signetics # # From University of Wisconsin vsc|Signetics Vsc Video driver by RMC:\ :am:ms:\ :co#80:it#8:li#26:\ :ce=\E[K:cl=50\E[;H\E[2J:cm=\E[%i%d;%dH:cr=^M:do=^J:\ :ho=\E[H:kb=^H:kd=^J:kl=^H:le=^H:me=^_\041:mr=^_ :nd=\E[C:\ :nw=^M^J:se=^_\041:sf=^J:so=^_ :ta=^I:ue=^_#:up=\E[A:us=^_": #### Soroc # # Alan Frisbie writes: # # As you may recall, the Soroc logo consisted of their name, # with the letter "S" superimposed over an odd design. This # consisted of a circle with a slightly smaller 15 degree (approx.) # wedge with rounded corners inside it. The color was sort of # a metallic gold/yellow. # # If I had been more of a beer drinker it might have been obvious # to me, but it took a clue from their service department to make # me exclaim, "Of course!" The circular object was the top of # a beer can (the old removable pop-top style) and "Soroc" was an # anagram for "Coors". # # I can just imagine the founders of the company sitting around # one evening, tossing back a few and trying to decide what to # call their new company and what to use for a logo. # # (soroc120: removed obsolete ":ma=^K^P^R^L^L :" -- esr) soroc120|iq120|soroc|soroc iq120:\ :cd=\EY:ce=\ET:cl=\E*:do=^J:kd=^J:kl=^H:kr=^L:ku=^K:tc=adm3a: soroc140|iq140|soroc iq140:\ :am:bs:mi:\ :co#80:li#24:\ :al=\Ee:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:dc=\Ew:dl=\Er:do=^J:ei=\E8:ho=^^:im=\E9:k0=^A0\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:kh=^^:kr=^L:ku=^K:le=^H:\ :ll=^^^K:nd=^L:se=\E\177:sf=^J:so=\E\177:ue=\E^A:up=^K:\ :us=\E^A: #### Southwest Technical Products # # These guys made an early personal micro called the M6800. # The ct82 was probably its console terminal. # # (swtp: removed obsolete ":bc=^D:" -- esr) swtp|ct82|southwest technical products ct82:\ :am:\ :co#82:li#20:\ :al=^^Y:bl=^G:cd=^V:ce=^F:cl=^L:cm=\013%r%.%.:cr=^M:dc=^^H:\ :dl=^Z:do=^J:ei=:ho=^P:ic=^^X:im=:\ :is=\034\022\036\023\036\004\035\027\011\023\036\035\036\017\035\027\022\011:\ :le=^D:ll=^C:nd=^S:se=^^^F:sf=^N:so=^^^V:sr=^O:up=^A: #### Synertek # # Bob Manson writes (28 Apr 1995): # # Synertek used to make ICs, various 6502-based single-board process # control and hobbyist computers, and assorted peripherals including a # series of small inexpensive terminals (I think they were one of the # first to have a "terminal-on-a-keyboard", where the terminal itself # was only slightly larger than the keyboard). # # They apparently had a KTM-1 model, which I've never seen. The KTM-2/40 # was a 40x24 terminal that could connect to a standard TV through a # video modulator. The KTM-2/80 was the 80-column version (the 2/40 # could be upgraded to the 2/80 by adding 2 2114 SRAMs and a new ROM). # I have a KTM-2/80 still in working order. The KTM-2s had fully # socketed parts, used 2 6507s, a 6532 as keyboard scanner, a program # ROM and 2 ROMs as character generators. They were incredibly simple, # and I've never had any problems with mine (witness the fact that mine # was made in 1981 and is still working great... I've blown the video # output transistor a couple of times, but it's a 2N2222 :-) # # The KTM-3 (which is what is listed in the terminfo file) was their # attempt at putting a KTM-2 in a box (and some models came with a # CRT). It wasn't much different from the KTM-2 hardware-wise, but the # control and escape sequences are very different. The KTM-3 was always # real broken, at least according to the folks I've talked to about it. # # The padding in the entry is probably off--these terminals were very # slow (it takes like 100ms for the KTM-2 to clear the screen...) And # anyone with any sanity replaced the ROMs with something that provided # a reasonable subset of VT100 functionality, since the usual ROMs were # obviously very primitive... oh, you could get an upgraded ROM from # Synertek for some incredible amount of money, but what hacker with an # EPROM burner would do that? :) # # Sorry I don't have any contact info; I believe they were located in # Sunnyvale, and I'm fairly sure they are still manufacturing ICs # (they've gone to ASICs and FPGAs), but I doubt they're in the computer # business these days. # # Tested, seems to work fine with vi. synertek|ktm|synertek380|synertek ktm 3/80 tubeless terminal:\ :am:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=^Z:cm=\E=%+ %+ :le=^H:nd=^L:up=^K: #### Tab Office Products # # TAB Products Co. - Palo Alto, California # Electronic Office Products, # 1451 California Avenue 94304 # # I think they're out of business. # # The tab 132 uses xon/xoff, so no padding needed. # :ks:/:ke: have nothing to do with arrow keys. # :is: sets 80 col mode, normal video, autowrap on (for :am:). # Seems to be no way to get rid of status line. # The manual for this puppy was dated June 1981. It claims to be VT52- # compatible but looks more vt100-like. tab132|tab|tab132-15|tab 132/15:\ :da:db:\ :co#80:dN@:li#24:lm#96:\ :al=\E[L:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:\ :im=\E[4h:is=\E[?7h\E[?3l\E[?5l:kd=\E[B:ke@:kl=\E[D:ks@:\ :ku=\E[A:\ :tc=vt100: tab132-w|tab132 in wide mode:\ :co#132:\ :is=\E[?7h\E[?3h\E[?5l:tc=tab132: tab132-rv|tab132 in reverse-video mode:\ :is=\E[?7h\E[?3l\E[?5h:tc=tab132: tab132-w-rv|tab132 in reverse-video/wide mode:\ :is=\E[?7h\E[?3h\E[?5h:tc=tab132-w: #### Teleray # # Research Incorporated # 6425 Flying Cloud Drive # Eden Prairie, MN 55344 # Vox: (612)-941-3300 # # The Teleray terminals were all discontinued in 1992-93. RI still services # and repairs these beasts, but no longer manufactures them. The Teleray # people believe that all the types listed below are very rare now (1995). # There was a newer line of Telerays (Model 7, Model 20, Model 30, and # Model 100) that were ANSI-compatible. # # Note two things called "teleray". Reorder should move the common one # to the front if you have either. A dumb teleray with the cursor stuck # on the bottom and no obvious model number is probably a 3700. # t3700|dumb teleray 3700:\ :bs:\ :co#80:li#24:\ :bl=^G:cl=^L:cr=^M:do=^J:le=^H:sf=^J: t3800|teleray 3800 series:\ :bs:\ :co#80:it#8:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:do=^J:ho=\EH:\ :le=^H:ll=\EY7 :nd=\EC:sf=^J:ta=^I:up=^K: t1061|teleray|teleray 1061:\ :am:bs:km:xs:xt:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\014:cm=\EY%+ %+ :cr=^M:\ :ct=\EG:dc=\EQ:dl=\EM:do=^J:ei=:ho=\EH:ic=\EP:im=:ip=:\ :is=\Ee\EU01^Z1\EV\EU02^Z2\EV\EU03^Z3\EV\EU04^Z4\EV\EU05^Z5\EV\EU06^Z6\EV\EU07^Z7\EV\EU08^Z8\EV\Ef:\ :k1=^Z1:k2=^Z2:k3=^Z3:k4=^Z4:k5=^Z5:k6=^Z6:k7=^Z7:k8=^Z8:\ :le=^H:nd=\EC:se=\ER@:sf=^J:so= \ERD:st=\EF:ta=^I:ue=\ER@:\ :up=\EA:us=\ERH: t1061f|teleray 1061 with fast PROMs:\ :al=\EL:dl=\EM:ip@:tc=t1061: # "Teleray Arpa Special", officially designated as # "Teleray Arpa network model 10" with "Special feature 720". # This is the new (1981) fast microcode updating the older "arpa" proms # (which gave meta-key and programmable-fxn keys). 720 is much much faster, # converts the keypad to programmable function keys, and has other goodies. # Standout mode is still broken (magic cookie, etc) so is suppressed as no # programs handle such lossage properly. # Note: this is NOT the old termcap's "t1061f with fast proms." # From: J. Lepreau Tue Feb 1 06:39:37 1983, Univ of Utah # (t10: removed overridden ":so@:se@:us@:ue@:" -- esr) t10|teleray 10 special:\ :bs:km:xs:xt:\ :co#80:it#8:li#24:sg#2:ug#2:\ :al=\EL:cd=\EJ:ce=\EK:cl=30\Ej:cm=\EY%+ %+ :dc=\EQ:dl=\EM:\ :ei=:ho=\EH:ic=\EP:im=:le=^H:nd=\EC:pc=\200:se=\ER@:sf=\Eq:\ :so=\ERD:sr=\Ep:ta=^I:ue=\ER@:up=\EA:us=\ERH: # teleray 16 - map the arrow keys for vi/rogue, shifted to up/down page, and # back/forth words. Put the function keys (f1-f10) where they can be # found, and turn off the other magic keys along the top row, except # for line/local. Do the magic appropriate to make the page shifts work. # Also toggle ^S/^Q for those of us who use Emacs. t16|teleray 16:\ :am:da:db:mi:xs:xt:\ :co#80:li#24:\ :al=\E[L:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:\ :cm=%i\E[%d;%df:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:\ :ho=\E[H:im=\E[4h:k1=^Z1:k2=^Z2:k3=^Z3:k4=^Z4:k5=^Z5:k6=^Z6:\ :k7=^Z7:k8=^Z8:k9=^Z9:k;=^Z0:le=^H:me=\E[m:nd=\E[C:se=\E[m:\ :sf=^J:so=\E[7m:sr=\E[T:ta=^I:te=\E[V\E[24;1f\E[?38h:\ :ti=\E[U\E[?38l:ue=\E[m:up=\E[A:us=\E[4m: #### Texas Instruments (ti) # # The Silent 700 was so called because it was built around a quiet thermal # printer. It was portable, equipped with an acoustic coupler, and pretty # neat for its day. ti700|ti733|ti735|ti745|ti800|ti silent 700/733/735/745 or omni 800:\ :bs:hc:os:\ :co#80:\ :bl=^G:cr=\r:do=^J:le=^H:sf=^J: # # Texas Instruments 916 VDT 7 bit control mode # ti916|ti916-220-7|Texas Instruments 916 VDT 8859/1 vt220 mode 7 bit CTRL:\ :da:db:in:ms:\ :%9=^X:@4=\E[29~:@8=^J:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:\ :DO=\E[%dB:F1=\E[29~:F2=\E[31~:IC=\E[%d@:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:as=\E(0:bt=\E[Z:cb=\E[1K:\ :cd=\E[J:ce=\E[0K:ch=\E[%+^AG:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:ct=\E[3g:cv=\E[%+^Ad:dc=\E[P:eA=\E(B:\ :ec=\E[%dX:ei=:ff=^L:im=:ip=:is=\E[1;24r\E[24;1H:k1=\E[17~:\ :k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:k6=\E[23~:\ :k7=\E[24~:k8=\E[25~:k9=\E[26~:k;=\E[28~:kD=\E[P:kI=\E[@:\ :kN=\E[S:kP=\E[T:kh=\E[H:mp=\E&:r2=\E[\041p:st=\E[0W:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h:\ :tc=vt220: # # Texas Instruments 916 VDT 8 bit control mode # ti916-8|ti916-220-8|Texas Instruments 916 VDT 8859/1 8 vt220 mode bit CTRL:\ :%9=^X:@4=\23329~:@8=^J:F1=\23329~:F2=\23331~:k1=\23317~:\ :k2=\23318~:k3=\23319~:k4=\23320~:k5=\23321~:k6=\23323~:\ :k7=\23324~:k8=\23325~:k9=\23326~:k;=\23328~:kD=\233P:\ :kI=\233@:kN=\233S:kP=\233T:kd=\233B:kh=\233H:kl=\233D:\ :kr=\233C:ku=\233A:\ :tc=ti916: # # Texas Instruments 916 VDT 8859/1 7 bit control 132 column mode # ti916-132|Texas Instruments 916 VDT vt220 132 column:\ :co#132:tc=ti916: # # Texas Instruments 916 VDT 8859/1 8 bit control 132 column mode # ti916-8-132|Texas Instruments 916 VDT vt220 132 column:\ :co#132:tc=ti916-8: ti924|Texas Instruments 924 VDT 8859/1 7 bit CTRL:\ :am:bs:xo:\ :co#80:it#8:li#24:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:\ :cm=%i\E[%d;%dH:cr=^M:cs=%i\E[%d;%dr:ct=\E[3g:dl=\E[M:\ :do=\E[B:ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[16~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kD=\E[P:kI=\E[@:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\E[?25h:vi=\E[?25l:vs=\E[?31h: ti924-8|Texas Instruments 924 VDT 8859/1 8 bit CTRL:\ :am:xo:\ :co#80:it#8:li#24:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:\ :cm=%i\E[%d;%dH:cr=^M:cs=%i\E[%d;%dr:ct=\E[3g:dl=\E[M:\ :do=\E[B:ho=\E[H:k1=P\217>:k2=Q\217>:k3=R\217>:k4=S\217>:\ :k5=~\23316>:k6=~\23317>:k7=~\23318>:k8=~\23319>:\ :k9=~\23320>:kD=P\233>:kI=@\233>:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[7m:\ :sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:\ :vi=\E[?25l:vs=\E[?31h: ti924w|Texas Instruments 924 VDT 7 bit - 132 column mode:\ :co#132:tc=ti924: ti924-8w|Texas Instruments 924 VDT 8 bit - 132 column mode:\ :co#132:tc=ti924-8: ti931|Texas Instruments 931 VDT:\ :am:bs:xo:\ :co#80:li#24:\ :al=\EN:bl=^G:cd=\EJ:ce=\EI:cl=\EL:cm=\EY%+ %+ :cr=^M:\ :dc=\EQ:dl=\EO:do=\EB:ei=:ho=\EH:ic=\ER\EP\EM:im=:\ :is=\EGB\E(@B@@\E):k1=\Ei1:k2=\Ei2:k3=\Ei3:k4=\Ei4:\ :k5=\Ei5:k6=\Ei6:k7=\Ei7:k8=\Ei8:k9=\Ei9:kA=\EN:kD=\EQ:\ :kI=\EP:kL=\EO:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=\ED:mb=\E4P:\ :me=\E4@:mk=\E4H:mr=\E4B:nd=\EC:se=\E4@:sf=\Ea:so=\E4A:\ :sr=\Eb:ue=\E4@:up=\EA:us=\E4D:ve=\E4@: ti926|Texas Instruments 926 VDT 8859/1 7 bit CTRL:\ :cs@:sf=\E[1S:sr=\E[1T:tc=ti924: # (ti926-8: I corrected this from the broken SCO entry -- esr) ti926-8|Texas Instruments 926 VDT 8859/1 8 bit CTRL:\ :cs@:sf=\2331S:sr=\2331T:\ :tc=ti924-8: ti_ansi|basic entry for ti928:\ :am:eo:ut:xn:xo:\ :Co#8:co#80:it#8:li#25:pa#64:\ :@7=\E[F:Sb=\E[4%dm:Sf=\E[3%dm:al=\E[L:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[@:im=:k0=\E[V:k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:\ :k5=\E[Q:k6=\E[R:k7=\E[S:k8=\E[T:k9=\E[U:kN=\E[G:kP=\E[I:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:nd=\E[C:op=\E[37;40m:se=\E[m:\ :sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # # 928 VDT 7 bit control mode # ti928|Texas Instruments 928 VDT 8859/1 7 bit CTRL:\ :%9=\E[35~:@7=\E_1\E\:@8=\E[8~:F1=\E[29~:F2=\E[31~:\ :F3=\E[32~:F5=\E[34~:k1=\E[17~:k2=\E[18~:k3=\E[19~:\ :k4=\E[20~:k5=\E[21~:k6=\E[23~:k7=\E[24~:k8=\E[25~:\ :k9=\E[26~:k;=\E[28~:kD=\E[P:kI=\E[@:kN=\E[S:kP=\E[T:\ :tc=ti_ansi: # # 928 VDT 8 bit control mode # ti928-8|Texas Instruments 928 VDT 8859/1 8 bit CTRL:\ :%9=\23335~:@7=\2371\234:@8=\2338~:F1=\23329~:F2=\23331~:\ :F3=\23332~:F5=\23334~:k1=\23317~:k2=\23318~:k3=\23319~:\ :k4=\23320~:k5=\23321~:k6=\23323~:k7=\23324~:k8=\23325~:\ :k9=\23326~:k;=\23328~:kD=\233P:kI=\233@:kN=\233S:\ :kP=\233T:kh=\233H:\ :tc=ti_ansi: #### Zentec (zen) # # (zen30: removed obsolete :ma=^L ^R^L^K^P:. This entry originally # had just :so:=\EG6 which I think means standout was supposed to be # dim-reverse using ADM12-style attributes. ADM12 :us:/:ue: and # might work-- esr) zen30|z30|zentec 30:\ :am:bs:mi:ul:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:le=^H:mh=\EG2:nd=^L:\ :sf=^J:so=\EG6:ue@:up=^K:us@:\ :tc=adm+sgr: # (zen50: this had extension capabilities # :BS=^U:CL=^V:CR=^B: # UK/DK/RK/LK/HM were someone's aliases for ku/kd/kl/kr/kh, # which were also in the original entry -- esr) # (zen50: removed obsolete ":ma=^Hh^Ll^Jj^Kk:" -- esr) zen50|z50|zentec zephyr:\ :am:bs:\ :co#80:li#24:sg#1:\ :al=\EE:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :dc=\EW:dl=\ER:ei=:\ :ic=\EQ:im=:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:mk@:ue@:up=^K:\ :us@:\ :tc=adm+sgr: # CCI 4574 (Office Power) from Will Martin via BRL cci|cci1|z8001|zen8001|CCI Custom Zentec 8001:\ :am:bs:bw:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cs=\ER%+ %+ :do=^J:\ :ho=\EH:is=\EM \EF\ET\EP\ER 7:kb=^H:kd=\EB:kh=\EH:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:mb=\EM":me=\EM :mh=\EM\041:mk=\EM(:\ :mr=\EM$:nd=\EC:pf=^T:po=^R:se=\EM :so=\EM$:sr=\EI:ue=\EM :\ :up=\EA:us=\EM0:ve=\EP:vs=\EF\EQ\EM \ER 7: ######## OBSOLETE UNIX CONSOLES # #### Apollo consoles # # Apollo got bought by Hewlett-Packard. The Apollo workstations are # labeled HP700s now. # # From: Gary Darland apollo|apollo console:\ :am:bs:mi:\ :co#88:li#53:\ :al=\EI:cd=\EJ:ce=\EK:ch=\EN%d:cl=^L:cm=\EM%+ %d):cv=\EO+ :\ :dc=\EP:dl=\EL:do=\EB:ei=\ER:im=\EQ:le=^H:nd=\EC:se=\ET:\ :sf=\EE:so=\ES:sr=\ED:te=\EX:ti=\EW:ue=\EV:up=\EA:us=\EU: # We don't know whether or not the apollo guys replicated DEC's firmware bug # in the VT132 that reversed :ei:/:im:. To be on the safe side, disable # both these capabilities. apollo_15P|apollo 15 inch display:\ :ei@:im@:tc=vt132: apollo_19L|apollo 19 inch display:\ :ei@:im@:tc=vt132: apollo_color|apollo color display:\ :ei@:im@:tc=vt132: #### Convergent Technology # # Burroughs bought Convergent shortly before it merged with Univac. # CTOS is (I believe) dead. Probably the aws is too (this entry dates # from 1991 or earlier). # # Convergent AWS workstation from Gould/SEL UTX/32 via BRL # (aws: removed unknown :dn=^K: -- esr) aws|Convergent Technologies AWS workstation under UTX,Xenix:\ :am:\ :co#80:li#28:sg#0:ug#0:\ :ac=:ae=\EAAF:al=\EIL:as=\EAAN:bc=^H:cd=\EEF:ce=\EEL:\ :ch=\EH%.:cl=^L:cm=\EC%r%.%.:cv=\EV%.:dc=\EDC:dl=\EDL:\ :do=^K:ei=:ic=\EIC:im=:kb=^H:kd=^K:kl=^N:kr=^R:ku=^A:\ :ma=\016h\013j\001k\022l\002m:nd=^R:nl=^J:se=\EARF:\ :sf=\ESU:so=\EARN:sr=\ESD:ue=\EAUF:up=^A:us=\EAUN: awsc|Convergent Technologies AWS workstation under CTOS:\ :am:\ :co#80:li#24:sg#0:ug#0:\ :ac=:ae=\EAAF:as=\EAAN:bc=^N:cd=\EEF:ce=\EEL:cl=^L:\ :cm=\EC%r%.%.:do=^K:kb=^H:kd=^K:kl=^N:kr=^R:ku=^A:\ :ma=\016h\013j\001k\022l\002m:nd=^R:se=\EAA:so=\EAE:\ :ue=\EAA:up=^A:us=\EAC: #### DEC consoles # # The MicroVax console. Tim Theisen writes: # The digital uVax II's had a graphic display called a qdss. It was # supposed to be a high performance graphic accelerator, but it was # late to market and barely appeared before faster dumb frame buffers # appeared. I have only used this display while running X11. However, # during bootup, it was in text mode, and probably had a terminal emulator # within it. And that is what your termcap entry is for. In graphics # mode the screen size is 1024x864 pixels. qdss|qdcons|qdss glass tty:\ :am:bs:\ :co#128:li#57:\ :cl=1\032:cm=\E=%.%.:do=^J:le=^H:nd=^L:up=^K: #### Fortune Systems consoles # # Fortune made a line of 68K-based UNIX boxes that were pretty nifty # in their day; I (esr) used one myself for a year or so around 1984. # They had no graphics, though, and couldn't compete against Suns and # the like. R.I.P. # # From: Robert Nathanson via tut Wed Oct 5, 1983 # (This had extension capabilities # :rv=\EH:re=\EI:rg=0:GG=0:\ # :CO=\E\\:WL=^Aa\r:WR=^Ab\r:CL=^Ac\r:CR=^Ad\r:DL=^Ae\r:RF=^Af\r:\ # :RC=^Ag\r:CW=^Ah\r:NU=^Aj\r:EN=^Ak\r:HM=^Al:PL=^Am\r:\ # :PU=^An\r:PD=^Ao\r:PR=^Ap\r:HP=^A@\r:RT=^Aq\r:TB=\r:CN=\177:MP=\E+F: # It had both ":bs:" and ":bs=^H:"; I removed the latter. Also, it had # ":sg=0:" and ":ug=0:"; evidently the composer was trying (unnecessarily) # to force both magic cookie glitches off. Once upon a time, I # used a Fortune myself, so I know the capabilities of the form ^A[a-z]\r are # function keys; thus the "Al" value for HM was certainly an error. I renamed # EN/PD/PU/CO/CF/RT according to the XENIX/TC mappings, but not HM/DL/RF/RC. # I think :rv: and :re: are start/end reverse video and :rg: is a nonexistent # "reverse-video-glitch" capability; I have put :rv: and :re: in with standard # names below. I've removed obsolete ":nl=5^J:" as there is a :do: -- esr) fos|fortune|Fortune system:\ :am:bs:bw:\ :co#80:li#25:\ :@7=^Ak\r:@8=^Aq:ac=l m"k(j*v%w#q&x-:ae=^O:al=\034E:\ :as=\Eo:bl=^G:cd=\034Y:ce=^\Z:cl=\014:cm=\034C%+ %+ :cr=^M:\ :dc=\034W:dl=\034R:do=\n:ei=:ho=\036:ic=\034Q:im=:is=^_..:\ :k1=^Aa\r:k2=^Ab\r:k3=^Ac\r:k4=^Ad\r:k5=^Ae\r:k6=^Af\r:\ :k7=^Ag\r:k8=^Ah\r:kN=^Ao\r:kP=^An\r:kb=^H:kd=^Ay\r:\ :kh=^A?\r:kl=^Aw\r:kr=^Az\r:ku=^Ax\r:le=^H:mb=\EN:me=\EI:\ :mr=\EH:nw=^M^J:se=^\I`:sf=^J:so=^\H`:ta=^Z:ue=^\IP:up=\013:\ :us=^\HP:ve=\E\:vi=\E]:vs=\E\072: #### Masscomp consoles # # Masscomp has gone out of business. Their product line was purchased by # comany in Georgia (US) called "XS International", parts and service may # still be available through them. # # (masscomp: ":MT:" changed to ":km:"; -- esr) masscomp|masscomp workstation console:\ :bs:km:mi:\ :co#80:it#8:li#24:\ :al=\E[L:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=\E[4l:im=\E[4h:is=\EGc\EGb\EGw:kb=^H:\ :kd=\EOB:kl=\EOD:kr=\EOC:ku=\EOA:le=^H:nd=\E[C:se=\E[m:\ :so=\E[7m:ta=^I:ue=\EGau:up=\E[A:us=\EGu: masscomp1|masscomp large screen version 1:\ :co#104:li#36:tc=masscomp: masscomp2|masscomp large screen version 2:\ :co#64:li#21:tc=masscomp: ######## OTHER OBSOLETE TYPES # # These terminals are *long* dead -- these entries are retained for # historical interest only. # #### Obsolete non-ANSI software emulations # # CTRM terminal emulator # 1. underlining is not allowed with colors: first, is is simulated by # black on white, second, it disables background color manipulations. # 2. BLINKING, REVERSE and BOLD are allowed with colors, # so we have to save their status in the static registers A, B and H # respectively, to be able to restore them when color changes # (because any color change turns off ALL attributes) # 3. :md: and :mr: sequences alternate modes, # rather then simply entering them. Thus we have to check the # static register B and H to determine the status, before sending the # escape sequence. # 4. :me: now must set the status of all 3 register (A,B,H) to zero # and then reset colors # 5. implementation of the protect mode would badly penalize the performance. # we would have to use \E&bn sequence to turn off colors (as well as all # other attributes), and keep the status of protect mode in yet another # static variable. If someone really needs this mode, they would have to # create another terminfo entry. # 6. original color-pair is white on black. # store the information about colors into static registers # 7. set foreground color. it performs the following steps. # 1) turn off all attributes # 2) turn on the background and video attributes that have been turned # on before (this information is stored in static registers X,Y,Z,A,B,H,D). # 3) turn on foreground attributes # 4) store information about foreground into U,V,W static registers # 8. turn on background: similar to turn on foreground above # (untranslatable capabilities removed to fit entry within 1023 bytes) ctrm|C terminal emulator:\ :am:ut:xo:\ :Co#8:NC#2:Nl#0:co#80:lh#0:li#24:lm#0:lw#0:pa#63:pb#19200:vt#6:\ :al=\EL:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:\ :cm=\E&a%r%dc%dY:cr=^M:ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:\ :do=^J:ei=\ER:im=\EQ:ip=:is=\E&jA\r:k1=\Ep\r:k2=\Eq\r:\ :k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:k7=\Ev\r:k8=\Ew\r:\ :kb=^H:kd=\Ew\r:ke=\E&jA:kh=\Ep\r:kl=\Eu\r:kr=\Ev\r:\ :ks=\E&jB:ku=\Et\r:le=^H:mb=\E&dA%{1}%PA:\ :md=%?%gH%{0}%=%t\E&dH%{1}%PH%;:\ :me=\E&d@%{0}%PA%{0}%PB%{0}%PH:\ :mr=%?%gB%{0}%=%t\E&dB%{1}%PB%;:nd=\EC:\ :op=\E&bn\E&bB\E&bG\E&bR\n%{0}%PX%{0}%PY%{0}%PZ\n%{1}%PW%{1}%PV%{1}%PU:\ :sf=^J:so=\E&dD:st=\E1:ta=\011:up=\EA:us=\E&dD: # gs6300 - can't use blue foreground, it clashes with underline; # it's simulated with cyan # Bug: The capability probably resets attributes. # (gs6300: commented out (no ) --esr) gs6300|emots|AT&T PC6300 with EMOTS terminal emulator:\ :am:ms:ut:xo:\ :Co#8:co#80:it#8:li#24:pa#63:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:Sb=\E[?;%dm:\ :..Sf=\E[?%?%p1%{0}%=%t0\n%e%p1%{1}%=%t2\n%e%p1%{1}%-%d%;m:\ :UP=\E[%dA:\ :ac=\054\054..--++``aaffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:\ :ei=:ho=\E[H:ic=\E[@:im=:is=\E[m:k1=\E[0s:k2=\E[24s:\ :k3=\E[1s:k4=\E[23s:k5=\E[2s:k6=\E[22s:k7=\E[3s:k8=\E[21s:\ :kB=^R^I:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m\E[10m:mr=\E[7m:nd=\E[C:\ :op=\E[?;m:pf=\E[4i:po=\E[5i:r1=\Ec:sf=^J:so=\E[1m:sr=\E[L:\ :ta=^I:up=\E[A:us=\E[4m: # From: 29 Oct 85 05:40:18 GMT # MS-Kermit with Heath-19 emulation mode enabled # (h19k: changed ":pt@:" to ":it@" h19k|h19kermit|heathkit emulation provided by Kermit (no auto margin):\ :am@:da:db:xt:\ :it@:\ :ta@:tc=h19-u: # Apple Macintosh with Versaterm, a terminal emulator distributed by Synergy # Software (formerly Peripherals Computers & Supplies, Inc) of # 2457 Perkiomen Ave., Reading, PA 19606, 1-800-876-8376. They can # also be reached at support@synergy.com. versaterm|versaterm vt100 emulator for the macintosh:\ :am:xn:\ :co#80:it#8:li#24:\ :al=9\E[1L:bl=^G:cd=50\E[J:ce=3\E[K:cl=50\E[;H\E[2J:\ :cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=7\E[1P:\ :dl=9\E[1M:do=^J:ei=:ho=\E[H:ic=7\E[1@:im=:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\EOB:ke=\E>\E[?1l:kl=\EOD:kr=\EOC:ks=\E=\E[?1h:\ :ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:me=2\E[m:mr=2\E[7m:\ :nd=2\E[C:nw=^M^J:r1=\E>:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=2\E[m:so=2\E[7m:\ :sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:us=2\E[4m: # From: Rick Thomas # (xtalk: I added / based on the init string. # I also removed :sg#1: and the trailing \s characters from the highlight # changers, I don't believe these on a VT100-emulating PC display -- esr) xtalk|IBM PC with xtalk communication program (versions up to 3.4):\ :am:mi:ms:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:dl=\E[M:do=^J:\ :eA=\E(B:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:me=\E[m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:up=\E[A: # The official PC terminal emulator program of the AT&T Product Centers. # Note - insert mode commented out - doesn't seem to work on AT&T PC. simterm|attpc running simterm:\ :am:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\E=%+ %+ :cr=^M:\ :dc=\ER:dl=\EM:do=\EB:ho=\EH:le=^H:me=\E&d@:nd=\EC:se=\E&d@:\ :sf=^J:so=\E&dB:te=\EVE:ti=\EVS:up=\EA: #### Daisy wheel printers # # This section collects Diablo, DTC, Xerox, Qume, and other daisy # wheel terminals. These are now largely obsolete. # # (diablo1620: removed :if=/usr/share/tabset/xerox1720:, no such file -- esr) diablo1620|diablo1720|diablo450|ipsi|diablo 1620:\ :bs:hc:os:\ :co#132:it#8:\ :ch=\E\011%i%.:ct=\E2:do=^J:hd=\ED:hu=\EU:kb=^H:le=^H:\ :st=\E1:ta=^I:up=\E^J: diablo1620-m8|diablo1640-m8|diablo 1620 w/8 column left margin:\ :co#124:\ :is=\r \E9:tc=diablo1620: # (diablo1640: removed :if=/usr/share/tabset/xerox1730:, no such file -- esr) diablo1640|diablo1730|diablo1740|diablo630|x1700|diablo|xerox|diablo 1640:\ :bl=^G:se=\E&:so=\EW:ue=\ER:us=\EE:\ :tc=diablo1620: # (diablo1640-lm: removed :if=/usr/share/tabset/xerox1730-lm:, no such # file -- esr) diablo1640-lm|diablo-lm|xerox-lm|diablo 1640 with indented left margin:\ :co#124:\ :se=\E&:so=\EW:ue=\ER:us=\EE:tc=diablo1620: diablo1740-lm|630-lm|1730-lm|x1700-lm|diablo 1740 printer:\ :tc=diablo1640-lm: # DTC 382 with VDU. Has no :cd: so we fake it with :ce:. Standout # :so=^P\s\002^PF: works but won't go away without dynamite :se=^P\s\200:. # The terminal has tabs, but I'm getting tired of fighting the braindamage. # If no tab is set or the terminal's in a bad mood, it glitches the screen # around all of memory. Note that return puts a blank ("a return character") # in the space the cursor was at, so we use ^P return (and thus ^P newline for # newline). Note also that if you turn off :pt: and let Unix expand tabs, # curses won't work (some old BSD versions) because it doesn't clear this bit, # and cursor addressing sends a tab for row/column 9. What a losing terminal! # I have been unable to get tabs set in all 96 lines - it always leaves at # least one line with no tabs in it, and once you tab through that line, # it completely weirds out. # (dtc382: change :te: to :ti: -- it just does a clear --esr) dtc382|DTC 382:\ :am:bs:da:db:xs:\ :co#80:li#24:lm#96:\ :al=^P^Z:bl=^G:cd=\020\025\020\023\020\023:ce=^P^U:\ :cl=\020\035:cm=\020\021%r%.%.:cr=^P^M:dc=^X:dl=^P^S:\ :ei=^Pi:ho=^P^R:im=^PI:le=^H:nd=^PR:pc=\177:sf=^J:te=:\ :ti=\020\035:ue=^P \200:up=^P^L:us=^P ^P:ve=^Pb:vs=^PB: dtc300s|DTC 300s:\ :bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:ct=\E3:do=^J:ff=^L:hd=\Eh:hu=\EH:kb=^H:le=^H:\ :sf=^J:st=\E1:ta=^I:up=^Z: gsi|mystery gsi terminal:\ :bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:hd=\Eh:hu=\EH:le=^H:sf=^J:ta=^I:up=^Z: aj830|aj832|aj|anderson jacobson:\ :bs:hc:os:\ :bl=^G:cr=^M:do=^J:hd=\E9:hu=\E8:le=^H:sf=^J:up=\E7: # From: Chris Torek Thu, 7 Nov 85 18:21:58 EST aj510|Anderson-Jacobson model 510:\ :am:bs:mi:\ :co#80:li#24:\ :al=2*\E&I:cd=\E'P:ce=\E'L:cl=^L:cm=\E#%+ %+ :dc=.1*\E'D:\ :dl=2*\E&D:ei=\E'J:ic=:im=\E'I:ip=.1*:kd=\EZ:kl=\EW:kr=\EX:\ :ku=\EY:le=^H:nd=\EX:pc=\177:se=\E"I:so=\E"I:te=\E"N:\ :ti=\E"N:ue=\E"U:up=\EY:us=\E"U: # From: Thu Aug 20 09:09:18 1981 # This is incomplete, but it's a start. nec5520|nec|spinwriter|nec 5520:\ :bs:hc:os:\ :co#132:it#8:\ :bl=^G:cr=^M:ct=\E3:do=^J:ff=^L:hd=\E]s\n\E]W:\ :hu=\E]s\E9\E]W:kb=^H:le=^H:sf=^J:st=\E1:ta=^I:up=\E9: qume5|qume|Qume Sprint 5:\ :bs:hc:os:\ :co#80:it#8:\ :bl=^G:cr=^M:ct=\E3:do=^J:ff=^L:hd=\Eh:hu=\EH:kb=^H:le=^H:\ :sf=^J:st=\E1:ta=^I:up=^Z: # I suspect the xerox 1720 is the same as the diablo 1620. xerox1720|x1720|x1750|xerox 1720:\ :bs:hc:os:\ :co#132:it#8:\ :bl=^G:cr=^M:ct=\E2:do=^J:ff=^L:le=^H:sf=^J:st=\E1:ta=^I: #### Miscellaneous obsolete terminals, manufacturers unknown # # If you have any information about these (like, a manufacturer's name, # and a date on the serial-number plate) please send it! cad68-3|cgc3|cad68 basic monitor transparent mode size 3 chars:\ :am:bs:\ :co#73:li#36:\ :cl=^Z:ho=^^:le=^H:nd=^L:up=^K: cad68-2|cgc2|cad68 basic monitor transparent mode size 2 chars:\ :am:bs:\ :co#85:li#39:\ :cl=^Z:ho=^^:k1=\E5:k2=\E6:k3=\E7:k4=\E8:kd=\E2:kl=\E3:\ :kr=\E4:ku=\E1:le=^H:nd=^L:se=\Em^C:so=\Em^L:up=^K: cops10|cops|cops-10|cops 10:\ :am:bw:\ :co#80:li#24:\ :bl=^G:cd=^W:ce=^V:cl=30\030:cm=\020%+ %+ :cr=^M:do=^J:\ :kb=^H:kd=^J:kh=^Y:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:sf=^J:up=^K: # (d132: removed duplicate :ic=\E5:, # merged in capabilities from a BRL entry -- esr) d132|datagraphix|datagraphix 132a:\ :da:db:in:\ :co#80:li#30:\ :al=\E3:bl=^G:cl=^L:cm=\E8%i%3%3:cr=^M:dc=\E6:do=^J:ei=:\ :ho=\ET:ic=\E5:im=:kb=^H:kd=^J:kl=^H:le=^H:nd=\EL:nw=^M^J:\ :sf=^J:sr=\Ew:ta=^I:up=\EK:ve=\Em\En:vs=\Ex: # The d800 was an early portable terminal from c.1984-85 that looked a lot # like the original Compaq `lunchbox' portable (but no handle). It had a vt220 # mode (which is what this entry looks like) and several other lesser-known # emulations. d800|Direct 800/A:\ :am:bs:da:db:ms:xs:\ :co#80:it#8:li#24:\ :ac=``a1fxgqh0jYk?lZm@nEooppqDrrsstCu4vAwBx3yyzz{{||}}~~:\ :ae=\E[m:as=\E[1m:bl=^G:cd=\E[J:ce=\E[K:cl=\E[1;1H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:do=^J:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOT:k6=\EOU:k7=\EOV:k8=\EOW:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[C:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[>12h:\ :vs=\E[>12l: digilog|digilog 333:\ :bs:\ :co#80:li#16:\ :bl=^G:ce=^X:cr=^M:do=^J:ho=^N:le=^H:nd=^I:sf=^J:up=^O: # The DWK was a terminal manufactured in the Soviet Union c.1986 dwk|dwk-vt|dwk terminal:\ :am:\ :co#80:it#8:li#24:\ :ac=lJmFkCjXtEuPv\wKqUxWnNo~s_`+a\072f'g#~_\\054Q+\136.M-Sh#I#0\177:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:dc=\EP:do=^J:ei=:ho=\EH:ic=\EQ:im=:k1=\Ef1:k2=\Ef2:\ :k3=\Ef3:k4=\Ef4:k5=\Ef5:k6=\Ef6:k7=\Ef7:k8=\Ef8:k9=\Ef9:\ :k;=\Ef0:kD=\Ee:kI=\Ed:kN=\Eh:kP=\Eg:kb=\177:kd=\EB:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:me=\EX:mr=\ET:nd=\EC:nw=^M^J:se=\EX:\ :sf=^J:so=\ET:sr=\ES:ta=^I:up=\EA: env230|envision230|envision 230 graphics terminal:\ :xn@:\ :pf=\E[4i:po=\E[5i:ps=\E[0i:\ :..sa=\E[%?%p1%t;1%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:tc=vt100: # These execuports were impact-printer ttys with a 30- or maybe 15-cps acoustic # coupler attached, the whole rig fitting in a suitcase and more or less # portable. Hot stuff for c.1977 :-) -- esr ep48|ep4080|execuport 4080:\ :am:bs:os:\ :co#80:\ :bl=^G:cr=^M:do=^J:hd=^\:hu=^^:le=^H:sf=^J: ep40|ep4000|execuport 4000:\ :co#136:tc=ep4080: # Adam Thompson tells us: # Informer series - these are all portable units, resembling older # automatic bread-baking machines. The terminal looks like a `clamshell' # design, but isn't. The structure is similar to the Direct terminals, # but only half the width. The entire unit is only about 10" wide. # It features an 8" screen (6" or 7" if you have color!), and an 9"x6" # keyboard. All the keys are crammed together, much like some laptop # PCs today, but perhaps less well organized...all these units have a # bewildering array of plugs on the back, including a built-in modem. # The 305 was a color version of the 304; the 306 and 307 were mono and # color terminals built for IBM bisync protocols. # From: Paul Leondis ifmr|Informer D304:\ :am:bs:\ :co#80:li#24:\ :cd=\E/:ce=\EQ:cl=\EZ:cm=\EY%r%+ %+ :dc=\E\:do=^J:ei=:\ :ho=\EH:ic=\E[:im=:le=^H:me=\EK:nd=\EC:se=\EK:so=\EJ:sr=\En:\ :up=\EA: # Entry largely based on wy60 and has the features of wy60ak. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) opus3n1+|Esprit Opus3n1+ in wy60 mode with ANSI arrow keys:\ :am:bw:hs:km:mi:ms:ul:xo:\ :co#80:li#24:ws#80:\ :ae=\EH^C:al=\EE:as=\EH^B:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E*:\ :cm=\Ea%i%dR%dC:cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\Ez(\r:\ :ei=\Er:fs=^M:ho=\036:if=/usr/share/tabset/std:im=\Eq:ip=:\ :is=\E`\072\Ee(\EO\Ee6\Ec41\E~4\Ec21\Ed/\Ezz&\E[A\177\Ezz'\E[B\177\Ezz(\E[D\177\Ezz)\E[C\177\Ezz<\E[Q\177\Ezz`\E[F\177\EA1*\EZH12:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:kN=\EK:kP=\EJ:\ :kb=^H:kd=\E[B:kh=^^:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:nd=^L:nw=\r\n:sf=^J:sr=\Ej:\ :st=\E1:ta=\011:te=:\ :ti=\Ezz&\E[A\177\Ezz'\E[B\177\Ezz(\E[D\177\Ezz)\E[C\177\Ezz<\E[Q\177:\ :ts=\Ez(:uc=\EG8%p1%c\EG0:up=^K:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: teletec|Teletec Datascreen:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=^^:le=^H:nd=^_:sf=^J:up=^K: # From: Mark Dornfeld # This termcap is for the LANPAR Technologies VISION 3220 # terminal. The function key definitions k0-k5 represent the # edit keypad: FIND, INSERT HERE, REMOVE, SELECT, PREV SCREEN, # NEXT SCREEN. The key definitions k6-k9 represent the PF1 to # PF4 keys. # (v3220: removed obsolete ":kn#10:", # I added / based on the init string -- esr) v3220|LANPAR Vision II model 3220/3221/3222:\ :am:bs:mi:xn:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:\ :is=\E>\E[?3l\E[?7h\E[?8h\E[p:k0=\E[1~:k1=\E[2~:\ :k2=\E[3~:k3=\E[4~:k4=\E[5~:k5=\E[6~:k6=\E[OP:k7=\E[OQ:\ :k8=\E[OR:k9=\E[OS:kd=\E[B:ke=\E>:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E=:ku=\E[A:le=^H:me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:\ :sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: ######## ICH/ICH1 VERSUS RMIR/SMIR # # Some non-curses applications get confused if both ich/ich1 and rmir/smir # are present; the symptom is doubled characters in an update using insert. # These applications are technically correct; in both 4.3BSD termcap and # terminfo, you're not actually supposed to specify both ich/ich1 and rmir/smir # unless the terminal needs both. This requirement is now rare; most ich # sequences do not require previous smir, and most smir insert modes do not # require ich1 before each character. # # For ncurses-based applications this is not a problem, as ncurses uses # one or the other as appropriate but never mixes the two. Therefore we # have not corrected entries like `linux' and `xterm' that specify both. # If you see doubled characters from these, use the linux-nic and xterm-nic # entries that suppress ich/ich1. And upgrade to ncurses! # ######## VT100/ANSI/ISO 6429/ECMA-48/PC-TERM TERMINAL STANDARDS # # ANSI X3.64 has been withdrawn and replaced by ECMA-48. The ISO 6429 and # ECMA-48 standards are said to be almost identical, but are not the same # as X3.64 (though for practical purposes they are close supersets of it). # # You can obtain ECMA-48 for free by sending email to helpdesk@ecma.ch # requesting the standard(s) you want (i.e. ECMA-48, "Control Functions for # Coded Character Sets"), include your snail-mail address, and you should # receive the document in due course. Don't expect an email acknowledgement. # # Related standards include "X3.4-1977: American National Standard Code for # Information Interchange" (the ASCII standard) and "X3.41.1974: # Code-Extension Techniques for Use with the 7-Bit Coded Character Set of # American National Standard for Information Interchange." I believe (but # am not certain) that these are effectively identical to ECMA-6 and ECMA-35 # respectively. # #### VT100/ANSI/ECMA-48 # # ANSI Standard (X3.64) Control Sequences for Video Terminals and Peripherals # and ECMA-48 Control Functions for Coded Character Sets. # # Much of the content of this comment is adapted from a table prepared by # Richard Shuford, based on a 1984 Byte article. Terminfo correspondences, # discussion of some terminfo-related issues, and updates to capture ECMA-48 # have been added. Control functions described in ECMA-48 only are tagged # with * after their names. # # The table is a complete list of the defined ANSI X3.64/ECMA-48 control # sequences. In the main table, \E stands for an escape (\033) character, # SPC for space. Pn stands for a single numeric parameter to be inserted # in decimal ASCII. Ps stands for a list of such parameters separated by # semicolons. Parameter meanings for most parametrized sequences are # decribed in the notes. # # Sequence Sequence Parameter or # Mnemonic Name Sequence Value Mode terminfo # ----------------------------------------------------------------------------- # APC Applicatn Program Command \E _ - Delim - # BEL Bell * ^G - - bel # BPH Break Permitted Here * \E B - * - # BS Backpace * ^H - EF - # CAN Cancel * ^X - - - (A) # CBT Cursor Backward Tab \E [ Pn Z 1 eF cbt # CCH Cancel Previous Character \E T - - - # CHA Cursor Horizntal Absolute \E [ Pn G 1 eF hpa (B) # CHT Cursor Horizontal Tab \E [ Pn I 1 eF tab (C) # CMD Coding Method Delimiter * \E # CNL Cursor Next Line \E [ Pn E 1 eF nel (D) # CPL Cursor Preceding Line \E [ Pn F 1 eF - # CPR Cursor Position Report \E [ Pn ; Pn R 1, 1 - - (E) # CSI Control Sequence Intro \E [ - Intro - # CTC Cursor Tabulation Control \E [ Ps W 0 eF - (F) # CUB Cursor Backward \E [ Pn D 1 eF cub # CUD Cursor Down \E [ Pn B 1 eF cud # CUF Cursor Forward \E [ Pn C 1 eF cuf # CUP Cursor Position \E [ Pn ; Pn H 1, 1 eF cup (G) # CUU Cursor Up \E [ Pn A 1 eF cuu # CVT Cursor Vertical Tab \E [ Pn Y - eF - (H) # DA Device Attributes \E [ Pn c 0 - - # DAQ Define Area Qualification \E [ Ps o 0 - - # DCH Delete Character \E [ Pn P 1 eF dch # DCS Device Control String \E P - Delim - # DL Delete Line \E [ Pn M 1 eF dl # DLE Data Link Escape * ^P - - - # DMI Disable Manual Input \E \ - Fs - # DSR Device Status Report \E [ Ps n 0 - - (I) # DTA Dimension Text Area * \E [ Pn ; Pn SPC T - PC - # EA Erase in Area \E [ Ps O 0 eF - (J) # ECH Erase Character \E [ Pn X 1 eF ech # ED Erase in Display \E [ Ps J 0 eF ed (J) # EF Erase in Field \E [ Ps N 0 eF - # EL Erase in Line \E [ Ps K 0 eF el (J) # EM End of Medium * ^Y - - - # EMI Enable Manual Input \E b Fs - # ENQ Enquire ^E - - - # EOT End Of Transmission ^D - * - # EPA End of Protected Area \E W - - - (K) # ESA End of Selected Area \E G - - - # ESC Escape ^[ - - - # ETB End Transmission Block ^W - - - # ETX End of Text ^C - - - # FF Form Feed ^L - - - # FNK Function Key * \E [ Pn SPC W - - - # GCC Graphic Char Combination* \E [ Pn ; Pn SPC B - - - # FNT Font Selection \E [ Pn ; Pn SPC D 0, 0 FE - # GSM Graphic Size Modify \E [ Pn ; Pn SPC B 100, 100 FE - (L) # GSS Graphic Size Selection \E [ Pn SPC C none FE - # HPA Horz Position Absolute \E [ Pn ` 1 FE - (B) # HPB Char Position Backward \E [ j 1 FE - # HPR Horz Position Relative \E [ Pn a 1 FE - (M) # HT Horizontal Tab * ^I - FE - (N) # HTJ Horz Tab w/Justification \E I - FE - # HTS Horizontal Tab Set \E H - FE hts # HVP Horz & Vertical Position \E [ Pn ; Pn f 1, 1 FE - (G) # ICH Insert Character \E [ Pn @ 1 eF ich # IDCS ID Device Control String \E [ SPC O - * - # IGS ID Graphic Subrepertoire \E [ SPC M - * - # IL Insert Line \E [ Pn L 1 eF il # IND Index \E D - FE - # INT Interrupt \E a - Fs - # JFY Justify \E [ Ps SPC F 0 FE - # IS1 Info Separator #1 * ^_ - * - # IS2 Info Separator #1 * ^^ - * - # IS3 Info Separator #1 * ^] - * - # IS4 Info Separator #1 * ^\ - * - # LF Line Feed ^J - - - # LS1R Locking Shift Right 1 * \E ~ - - - # LS2 Locking Shift 2 * \E n - - - # LS2R Locking Shift Right 2 * \E } - - - # LS3 Locking Shift 3 * \E o - - - # LS3R Locking Shift Right 3 * \E | - - - # MC Media Copy \E [ Ps i 0 - - (S) # MW Message Waiting \E U - - - # NAK Negative Acknowledge * ^U - * - # NBH No Break Here * \E C - - - # NEL Next Line \E E - FE nel (D) # NP Next Page \E [ Pn U 1 eF - # NUL Null * ^@ - - - # OSC Operating System Command \E ] - Delim - # PEC Pres. Expand/Contract * \E Pn SPC Z 0 - - # PFS Page Format Selection * \E Pn SPC J 0 - - # PLD Partial Line Down \E K - FE - (T) # PLU Partial Line Up \E L - FE - (U) # PM Privacy Message \E ^ - Delim - # PP Preceding Page \E [ Pn V 1 eF - # PPA Page Position Absolute * \E [ Pn SPC P 1 FE - # PPB Page Position Backward * \E [ Pn SPC R 1 FE - # PPR Page Position Forward * \E [ Pn SPC Q 1 FE - # PTX Parallel Texts * \E [ \ - - - # PU1 Private Use 1 \E Q - - - # PU2 Private Use 2 \E R - - - # QUAD Typographic Quadding \E [ Ps SPC H 0 FE - # REP Repeat Char or Control \E [ Pn b 1 - rep # RI Reverse Index \E M - FE - (V) # RIS Reset to Initial State \E c - Fs - # RM Reset Mode * \E [ Ps l - - - (W) # SACS Set Add. Char. Sep. * \E [ Pn SPC / 0 - - # SAPV Sel. Alt. Present. Var. * \E [ Ps SPC ] 0 - - (X) # SCI Single-Char Introducer \E Z - - - # SCO Sel. Char. Orientation * \E [ Pn ; Pn SPC k - - - # SCS Set Char. Spacing * \E [ Pn SPC g - - - # SD Scroll Down \E [ Pn T 1 eF rin # SDS Start Directed String * \E [ Pn ] 1 - - # SEE Select Editing Extent \E [ Ps Q 0 - - (Y) # SEF Sheet Eject & Feed * \E [ Ps ; Ps SPC Y 0,0 - - # SGR Select Graphic Rendition \E [ Ps m 0 FE sgr (O) # SHS Select Char. Spacing * \E [ Ps SPC K 0 - - # SI Shift In ^O - - - (P) # SIMD Sel. Imp. Move Direct. * \E [ Ps ^ - - - # SL Scroll Left \E [ Pn SPC @ 1 eF - # SLH Set Line Home * \E [ Pn SPC U - - - # SLL Set Line Limit * \E [ Pn SPC V - - - # SLS Set Line Spacing * \E [ Pn SPC h - - - # SM Select Mode \E [ Ps h none - - (W) # SO Shift Out ^N - - - (Q) # SOH Start Of Heading * ^A - - - # SOS Start of String * \E X - - - # SPA Start of Protected Area \E V - - - (Z) # SPD Select Pres. Direction * \E [ Ps ; Ps SPC S 0,0 - - # SPH Set Page Home * \E [ Ps SPC G - - - # SPI Spacing Increment \E [ Pn ; Pn SPC G none FE - # SPL Set Page Limit * \E [ Ps SPC j - - - # SPQR Set Pr. Qual. & Rapid. * \E [ Ps SPC X 0 - - # SR Scroll Right \E [ Pn SPC A 1 eF - # SRCS Set Reduced Char. Sep. * \E [ Pn SPC f 0 - - # SRS Start Reversed String * \E [ Ps [ 0 - - # SSA Start of Selected Area \E F - - - # SSU Select Size Unit * \E [ Pn SPC I 0 - - # SSW Set Space Width * \E [ Pn SPC [ none - - # SS2 Single Shift 2 (G2 set) \E N - Intro - # SS3 Single Shift 3 (G3 set) \E O - Intro - # ST String Terminator \E \ - Delim - # STAB Selective Tabulation * \E [ Pn SPC ^ - - - # STS Set Transmit State \E S - - - # STX Start pf Text * ^B - - - # SU Scroll Up \E [ Pn S 1 eF indn # SUB Substitute * ^Z - - - # SVS Select Line Spacing * \E [ Pn SPC \ 1 - - # SYN Synchronous Idle * ^F - - - # TAC Tabul. Aligned Centered * \E [ Pn SPC b - - - # TALE Tabul. Al. Leading Edge * \E [ Pn SPC a - - - # TATE Tabul. Al. Trailing Edge* \E [ Pn SPC ` - - - # TBC Tab Clear \E [ Ps g 0 FE tbc # TCC Tabul. Centered on Char * \E [ Pn SPC c - - - # TSR Tabulation Stop Remove * \E [ Pn SPC d - FE - # TSS Thin Space Specification \E [ Pn SC E none FE - # VPA Vert. Position Absolute \E [ Pn d 1 FE vpa # VPB Line Position Backward * \E [ Pn k 1 FE - # VPR Vert. Position Relative \E [ Pn e 1 FE - (R) # VT Vertical Tabulation * ^K - FE - # VTS Vertical Tabulation Set \E J - FE - # # --------------------------------------------------------------------------- # # Notes: # # Some control characters are listed in the ECMA-48 standard without # being assigned functions relevant to terminal control there (they # referred to other standards such as ISO 1745 or ECMA-35). They are listed # here anyway for completeness. # # (A) ECMA-48 calls this "CancelCharacter" but retains the CCH abbreviation. # # (B) There seems to be some confusion abroad between CHA and HPA. Most # `ANSI' terminals accept the CHA sequence, not the HPA. but terminfo calls # the capability (hpa). ECMA-48 calls this "Cursor Character Absolute" but # preserved the CHA abbreviation. # # (C) CHT corresponds to terminfo (tab). Usually it has the value ^I. # Occasionally (as on, for example, certain HP terminals) this has the HTJ # value. ECMA-48 calls this "Cursor Forward Tabulation" but preserved the # CHT abbreviation. # # (D) terminfo (nel) is usually \r\n rather than ANSI \EE. # # (E) ECMA-48 calls this "Active Position Report" but preserves the CPR # abbreviation. # # (F) CTC parameter values: 0 = set char tab, 1 = set line tab, 2 = clear # char tab, 3 = clear line tab, 4 = clear all char tabs on current line, # 5 = clear all char tabs, 6 = clear all line tabs. # # (G) CUP and HVP are identical in effect. Some ANSI.SYS versions accept # HVP, but always allow CUP as an alternate. ECMA-48 calls HVP "Character # Position Absolute" but retains the HVP abbreviation. # # (H) ECMA calls this "Cursor Line Tabulation" but preserves the CVT # abbreviation. # # (I) DSR parameter values: 0 = ready, 1 = busy, 2 = busy, will send DSR # later, 3 = malfunction, 4 = malfunction, will send DSR later, 5 = request # DSR, 6 = request CPR response. # # (J) ECMA calls ED "Erase In Page". EA/ED/EL parameters: 0 = clear to end, # 1 = clear from beginning, 2 = clear. # # (K) ECMA calls this "End of Guarded Area" but preserves the EPA abbreviation. # # (L) The GSM parameters are vertical and horizontal parameters to scale by. # # (M) Some ANSI.SYS versions accept HPR, but more commonly `ANSI' terminals # use CUF for this function and ignore HPR. ECMA-48 calls this "Character # Position Relative" but retains the HPR abbreviation. # # (N) ECMA-48 calls this "Character Tabulation" but retains the HT # abbreviation. # # (O) SGR parameter values: 0 = default mode (attributes off), 1 = bold, # 2 = dim, 3 = italicized, 4 = underlined, 5 = slow blink, 6 = fast blink, # 7 = reverse video, 8 = invisible, 9 = crossed-out (marked for deletion), # 10 = primary font, 10 + n (n in 1..9) = nth alternative font, 20 = Fraktur, # 21 = double underline, 22 = turn off 2, 23 = turn off 3, 24 = turn off 4, # 25 = turn off 5, 26 = proportional spacing, 27 = turn off 7, 28 = turn off # 8, 29 = turn off 9, 30 = black fg, 31 = red fg, 32 = green fg, 33 = yellow # fg, 34 = blue fg, 35 = magenta fg, 36 = cyan fg, 37 = white fg, 38 = set # fg color as in CCIT T.416, 39 = set default fg color, 40 = black bg # 41 = red bg, 42 = green bg, 43 = yellow bg, 44 = blue bg, 45 = magenta bg, # 46 = cyan bg, 47 = white bg, 48 = set bg color as in CCIT T.416, 39 = set # default bg color, 50 = turn off 26, 51 = framed, 52 = encircled, 53 = # overlined, 54 = turn off 51 & 52, 55 = not overlined, 56-59 = reserved, # 61-65 = variable highlights for ideograms. # # (P) SI is also called LSO, Locking Shift Zero. # # (Q) SI is also called LS1, Locking Shift One. # # (R) Some ANSI.SYS versions accept VPR, but more commonly `ANSI' terminals # use CUD for this function and ignore VPR. ECMA calls it `Line Position # Absolute' but retains the VPA abbreviation. # # (S) MC parameters: 0 = start xfer to primary aux device, 1 = start xfer from # primary aux device, 2 = start xfer to secondary aux device, 3 = start xfer # from secondary aux device, 4 = stop relay to primary aux device, 5 = # start relay to primary aux device, 6 = stop relay to secondary aux device, # 7 = start relay to secondary aux device. # # (T) ECMA-48 calls this "Partial Line Forward" but retains the PLD # abbreviation. # # (U) ECMA-48 calls this "Partial Line Backward" but retains the PLD # abbreviation. # # (V) ECMA-48 calls this "Reverse Line Feed" but retains the RI abbreviation. # # (W) RM/SM modes are as follows: 1 = Guarder Area Transfer Mode (GATM), # 2 = Keyboard Action Mode (KAM), 3 = Control Representation Mode (CRM), # 4 = Insertion Replacement Mode, 5 = Status Report Transfer Mode (SRTM), # 6 = Erasure Mode (ERM), 7 = Line Editing Mode (LEM), 8 = Bi-Directional # Support Mode (BDSM), 9 = Device Component Select Mode (DCSM), # 10 = Character Editing Mode (HEM), 11 = Positioning Unit Mode (PUM), # 12 = Send/Receive Mode, 13 = Format Effector Action Mode (FEAM), # 14 = Format Effector Transfer Mode (FETM), 15 = Multiple Area Transfer # Mode (MATM), 16 = Transfer Termination Mode, 17 = Selected Area Transfer # Mode, 18 = Tabulation Stop Mode, 19 = Editing Boundary Mode, 20 = Line Feed # New Line Mode (LF/NL), Graphic Rendition Combination Mode (GRCM), 22 = # Zero Default Mode (ZDM). The EBM and LF/NL modes have actually been removed # from ECMA-48's 5th edition but are listed here for reference. # # (X) Select Alternate Presentation Variants is used only for non-Latin # alphabets. # # (Y) "Select Editing Extent" (SEE) was ANSI "Select Edit Extent Mode" (SEM). # # (Z) ECMA-48 calls this "Start of Guarded Area" but retains the SPA # abbreviation. # # --------------------------------------------------------------------------- # # Abbreviations: # # Intro an Introducer of some kind of defined sequence; the normal 7-bit # X3.64 Control Sequence Introducer is the two characters "Escape [" # # Delim a Delimiter # # x/y identifies a character by position in the ASCII table (column/row) # # eF editor function (see explanation) # # FE format effector (see explanation) # # F is a Final character in # an Escape sequence (F from 3/0 to 7/14 in the ASCII table) # a control sequence (F from 4/0 to 7/14) # # Gs is a graphic character appearing in strings (Gs ranges from # 2/0 to 7/14) in the ASCII table # # Ce is a control represented as a single bit combination in the C1 set # of controls in an 8-bit character set # # C0 the familiar set of 7-bit ASCII control characters # # C1 roughly, the set of control chars available only in 8-bit systems. # This is too complicated to explain fully here, so read Jim Fleming's # article in the February 1983 BYTE, especially pages 214 through 224. # # Fe is a Final character of a 2-character Escape sequence that has an # equivalent representation in an 8-bit environment as a Ce-type # (Fe ranges from 4/0 to 5/15) # # Fs is a Final character of a 2-character Escape sequence that is # standardized internationally with identical representation in 7-bit # and 8-bit environments and is independent of the currently # designated C0 and C1 control sets (Fs ranges from 6/0 to 7/14) # # I is an Intermediate character from 2/0 to 2/15 (inclusive) in the # ASCII table # # P is a parameter character from 3/0 to 3/15 (inclusive) in the ASCII # table # # Pn is a numeric parameter in a control sequence, a string of zero or # more characters ranging from 3/0 to 3/9 in the ASCII table # # Ps is a variable number of selective parameters in a control sequence # with each selective parameter separated from the other by the code # 3/11 (which usually represents a semicolon); Ps ranges from # 3/0 to 3/9 and includes 3/11 # # * Not relevant to terminal control, listed for completeness only. # # Format Effectors versus Editor Functions # # A format effector specifies how following output is to be displayed. # An editor function allows you to modify the display. Informally # format effectors may be destructive; format effectors should not be. # # For instance, a format effector that moves the "active position" (the # cursor or equivalent) one space to the left would be useful when you want to # create an overstrike, a compound character made of two standard characters # overlaid. Control-H, the Backspace character, is actually supposed to be a # format effector, so you can do this. But many systems use it in a # nonstandard fashion, as an editor function, deleting the character to the # left of the cursor and moving the cursor left. When Control-H is assumed to # be an editor function, you cannot predict whether its use will create an # overstrike unless you also know whether the output device is in an "insert # mode" or an "overwrite mode". When Control-H is used as a format effector, # its effect can always be predicted. The familiar characters carriage # return, linefeed, formfeed, etc., are defined as format effectors. # # NOTES ON THE DEC VT100 IMPLEMENTATION # # Control sequences implemented in the VT100 are as follows: # # CPR, CUB, CUD, CUF, CUP, CUU, DA, DSR, ED, EL, HTS, HVP, IND, # LNM, NEL, RI, RIS, RM, SGR, SM, TBC # # plus several private DEC commands. # # Erasing parts of the display (EL and ED) in the VT100 is performed thus: # # Erase from cursor to end of line Esc [ 0 K or Esc [ K # Erase from beginning of line to cursor Esc [ 1 K # Erase line containing cursor Esc [ 2 K # Erase from cursor to end of screen Esc [ 0 J or Esc [ J # Erase from beginning of screen to cursor Esc [ 1 J # Erase entire screen Esc [ 2 J # # Some brain-damaged terminal/emulators respond to Esc [ J as if it were # Esc [ 2 J, but this is wrong; the default is 0. # # The VT100 responds to receiving the DA (Device Attributes) control # # Esc [ c (or Esc [ 0 c) # # by transmitting the sequence # # Esc [ ? l ; Ps c # # where Ps is a character that describes installed options. # # The VT100's cursor location can be read with the DSR (Device Status # Report) control # # Esc [ 6 n # # The VT100 reports by transmitting the CPR sequence # # Esc [ Pl ; Pc R # # where Pl is the line number and Pc is the column number (in decimal). # # The specification for the DEC VT100 is document EK-VT100-UG-003. #### ANSI.SYS # # Here is a description of the color and attribute controls supported in the # the ANSI.SYS driver under MS-DOS. Most console drivers and ANSI # terminal emulators for Intel boxes obey these. They are a proper subset # of the ECMA-48 escapes. # # 0 all attributes off # 1 foreground bright # 4 underscore on # 5 blink on/background bright (not reliable with brown) # 7 reverse-video # 8 set blank (non-display) # 10 set primary font # 11 set first alternate font (on PCs, display ROM characters 1-31) # 12 set second alternate font (on PCs, display IBM high-half chars) # # Color attribute sets # 3n set foreground color / 0=black, 1=red, 2=green, 3=brown, # 4n set background color \ 4=blue, 5=magenta, 6=cyan, 7=white # Bright black becomes gray. Bright brown becomes yellow, # These coincide with the prescriptions of the ISO 6429/ECMA-48 standard. # # * If the 5 attribute is on and you set a background color (40-47) it is # supposed to enable bright background. # # * Many VGA cards (such as the Paradise and compatibles) do the wrong thing # when you try to set a "bright brown" (yellow) background with attribute # 5 (you get a blinking yellow foreground instead). A few displays # (including the System V console) support an attribute 6 that undoes this # braindamage (this is required by iBCS2). # # * Some older versions of ANSI.SYS have a bug that causes thems to require # ESC [ Pn k as EL rather than the ANSI ESC [ Pn K. (This is not ECMA-48 # compatible.) #### Intel Binary Compatibility Standard # # For comparison, here are the capabilities implied by the Intel Binary # Compatibility Standard for UNIX systems (Intel order number 468366-001). # These recommendations are optional. IBCS2 allows the leading escape to # be either the 7-bit \E[ or 8-bit \0233 introducer, in accordance with # the ANSI X.364/ISO 6429/ECMA-48 standard. Here are the iBCS2 capabilities # (as described in figure 9-3 of the standard). Those expressed in the ibcs2 # terminfo entry are followed with the corresponding capability in parens: # # CSI k disable (n=0) or enable (n=1) keyclick # CSI 2h lock keyboard # CSI 2i send screen as input # CSI 2l unlock keyboard # CSI 6m enable background color intensity # CSI <0-2>c reserved # CSI <0-59>m select graphic rendition # CSI ;H (cup) cursor to line n and column m # CSI ;f cursor to line n and column m # CSI @ (ich) insert characters # CSI A (cuu) cursor up n lines # CSI B (cud) cursor down n lines # CSI C (cuu) cursor right n characters # CSI D (cud) cursor left n characters # CSI E cursor down n lines and in first column # CSI F cursor up n lines and in first column # CSI G (hpa) position cursor at column n-1 # CSI J (ed) erase in display # CSI K (el) erase in line # CSI L (il) insert line(s) # CSI P (dch) delete characters # CSI S (indn) scroll up n lines # CSI T (rin) scroll down n lines # CSI X (ech) erase characters # CSI Z (cbt) back up n tab stops # CSI ` cursor to column n on line # CSI a (cuu) cursor right n characters # CSI d (vpa) cursor to line n # CSI e cursor down n lines and in first column # CSI g (cbt) clear all tabs # CSI z make virtual terminal n active # CSI ?7h (smam) turn automargin on # CSI ?7l (rmam) turn automargin off # CSI s save cursor position # CSI u restore cursor position to saved value # CSI =A set overscan color # CSI =F set normal foreground color # CSI =G set normal background color # CSI =H set reverse foreground color # CSI =I set reverse foreground color # CSI =J set graphic foreground color # CSI =K set graphic foreground color # CSI =g (dispc) display n from alternate graphics character set # CSI =

;B set bell parameters # CSI =;C set cursor parameters # CSI =D enable/disable intensity of background color # CSI =E set/clear blink vs. bold background # CSI 7 (sc) (sc) save cursor position # CSI 8 (rc) (rc) restore cursor position to saved value # CSI H (hts) (hts) set tab stop # CSI Q define function key string # (string must begin and end with delimiter char) # CSI c (clear) clear screen # # The lack of any specification for attributes in SGR (among other things) # makes this a wretchedly weak standard. The table above is literally # everything iBSC2 has to say about terminal escape sequences; there is # no further discussion of their meaning or how to set the parameters # in these sequences at all. # ######## NONSTANDARD CAPABILITY TRANSLATIONS USED IN THIS FILE # # The historical termcap file entries were written primarily in 4.4BSD termcap. # The 4.4BSD termcap set was substantially larger than the original 4.1BSD set, # with the extension names chosen for compatibility with the termcap names # assigned in System V terminfo. There are some variant extension sets out # there. We try to describe them here. # # XENIX extensions: # # The XENIX extensions include a set of function-key capabilities as follows: # # code XENIX variable name terminfo name name clashes? # ---- ------------------- ------------- ----------------------- # CL key_char_left # CR key_char_right # CW key_change_window create_window # EN key_end kend # HM key_home khome # HP ?? # LD key_delete_line kdl1 # LF key_linefeed label_off # NU key_next_unlocked_cell # PD key_page_down knp # PL ?? # PN start_print mc5 # PR ?? # PS stop_print mc4 # PU key_page_up kpp pulse # RC key_recalc remove_clock # RF key_toggle_ref req_for_input # RT key_return kent # UP key_up_arrow kcuu1 parm_up_cursor # WL key_word_left # WR key_word_right # # The XENIX extensions also include the following character-set and highlight # capabilities: # # XENIX terminfo function # ----- -------- ------------------------------ # GS smacs start alternate character set # GE rmacs end alternate character set # GG :as:/:ae: glitch (analogous to :sg:/:ug:) # bo blink begin blink (not used in /etc/termcap) # be end blink (not used in /etc/termcap) # bb blink glitch (not used in /etc/termcap) # it dim begin dim (not used in /etc/termcap) # ie end dim (not used in /etc/termcap) # ig dim glitch (not used in /etc/termcap) # # Finally, XENIX also used the following forms-drawing capabilities: # # single double type ASCII approximation # ------ ------ ------------- ------------------- # GV Gv vertical line | # GH Gv horizontal line - _ # G1 G5 top right corner _ | # G2 G6 top left corner | # G3 G7 bottom left corner |_ # G4 G8 bottom right corner _| # GD Gd down-tick character T # GL Gl left-tick character -| # GR Gr right-tick character |- # GC Gc middle intersection -|- # GU Gu up-tick character _|_ # # These were invented to take advantage of the IBM PC ROM character set. One # can compose an acsc string from the single-width characters as follows # "j{G4}k{G1}l{G2}m{G3}q{GH}x{GV}t{GR}u{GL}v{GU}w{GD}n{GC}" # When translating a termcap file, ncurses tic will do this automatically. # The double forms characters don't fit the SVr4 terminfo model. # # AT&T Extensions: # # The old AT&T 5410, 5420, 5425, pc6300plus, 610, and s4 entries used a set of # nonstandard capabilities. Its signature is the KM capability, used to name # some sort of keymap file. EE, BO, CI, CV, XS, DS, FL and FE are in this # set. Comments in the original, and a little cross-checking with other AT&T # documentation, seem to establish that BO=:mr: (start reverse video), DS=:mh: # (start dim), XS=:mk: (secure/invisible mode), EE=:me: (end highlights), # FL=:LO: (enable soft labels), FE=:LF: (disable soft labels), CI=:vi: (make # cursor invisible), and CV=:ve: (make cursor normal). # # HP Extensions # # The HP library (as of mid-1995, their term.h file version 70.1) appears to # have the System V capabilities up to SVr1 level. After that, it supports # two nonstandard caps meml and memu corresponding to the old termcap :ml:, # :mu: capabilities. After that, it supports caps plab_norm, label_on, # label_off, and key_f11..key_f63 capabilities like SVr4's. This makes the # HP binary format incompatible with SVr4's. # # IBM Extensions # # There is a set of nonstandard terminfos used by IBM's AIX operating system. # The AIX terminfo library diverged from SVr1 terminfo, and replaces all # capabilities following prtr_non with the following special capabilties: # box[12], batt[12], colb[0123456789], colf[0123456789], f[01234567], kbtab, # kdo, kcmd, kcpn, kend, khlp, knl, knpn, kppn, kppn, kquit, ksel, kscl, kscr, # ktab, kmpf[123456789], apstr, ksf1..ksf10, kf11...kf63, kact, topl, btml, # rvert, lvert. Some of these are identical to XPG4/SVr4 equivalents: # kcmd, kend, khlp, and kf11...kf63. Two others (kbtab and ksel) can be # renamed (to kcbt and kslt). The places in the box[12] capabilities # correspond to acsc chars, here is the mapping: # # box1[0] = ACS_ULCORNER # box1[1] = ACS_HLINE # box1[2] = ACS_URCORNER # box1[3] = ACS_VLINE # box1[4] = ACS_LRCORNER # box1[5] = ACS_LLCORNER # box1[6] = ACS_TTEE # box1[7] = ACS_RTEE # box1[8] = ACS_BTEE # box1[9] = ACS_LTEE # box1[10] = ACS_PLUS # # The box2 characters are the double-line versions of these forms graphics. # The AIX binary terminfo format is incompatible with SVr4's. # # Iris console extensions: # # HS is half-intensity start; HE is half-intensity end # CT is color terminal type (for Curses & rogue) # CP is color change escape sequence # CZ are color names (for Curses & rogue) # # The ncurses tic utility recognizes HS as an alias for mh . # # TC Extensions: # # There is a set of extended termcaps associated with something # called the "Terminal Control" or TC package created by MainStream Systems, # Winfield Kansas. This one also uses GS/GE for as/ae, and also uses # CF for civis and CO for cvvis. Finally, they define a boolean :ct: # that flags color terminals. # ######## CHANGE HISTORY # # The last /etc/termcap version maintained by John Kunze was 8.3, dated 8/5/94. # Releases 9 and up are maintained by Eric S. Raymond as part of the ncurses # project. # # This file contains all the capability information present in John Kunze's # last version of the termcap master file, except as noted in the change # comments at end of file. Some information about very ancient obsolete # capabilities has been moved to comments. Some all-numeric names of older # terminals have been retired. # # I changed :MT: to :km: (the 4.4BSD name) everywhere. I commented out some # capabilities (EP, dF, dT, dV, kn, ma, ml, mu, xr, xx) that are no longer # used by BSD curses. # # The 9.1.0 version of this file was translated from my lightly-edited copy of # 8.3, then mechanically checked against 8.3 using Emacs Lisp code written for # the purpose. Unless the ncurses tic implementation and the Lisp code were # making perfectly synchronized mistakes which I then failed to catch by # eyeball, the translation was correct and perfectly information-preserving. # # Major version number bumps correspond to major version changes in ncurses. # # Here is a log of the changes since then: # # 9.1.0 (Wed Feb 1 04:50:32 EST 1995): # * First terminfo master translated from 8.3. # 9.2.0 (Wed Feb 1 12:21:45 EST 1995): # * Replaced Wyse entries with updated entries supplied by vendor. # # 9.3.0 (Mon Feb 6 19:14:40 EST 1995): # * Added contact & status info from G. Clark Brown . # 9.3.1 (Tue Feb 7 12:00:24 EST 1995): # * Better XENIX keycap translation. Describe TC termcaps. # * Contact and history info supplied by Qume. # 9.3.2 (Sat Feb 11 23:40:02 EST 1995): # * Raided the Shuford FTP site for recent termcaps/terminfos. # * Added information on X3.64 and VT100 standard escape sequences. # 9.3.3 (Mon Feb 13 12:26:15 EST 1995): # * Added a correct X11R6 xterm entry. # * Fixed terminfo translations of padding. # 9.3.4 (Wed Feb 22 19:27:34 EST 1995): # * Added correct acsc/smacs/rmacs strings for vt100 and xterm. # * Added u6/u7/u8/u9 capabilities. # * Added PCVT entry. # 9.3.5 (Thu Feb 23 09:37:12 EST 1995): # * Emacs uses :so:, not :mr:, for its mode line. Fix linux entry # to use reverse-video standout so Emacs will look right. # * Added el1 capability to ansi. # * Added smacs/rmacs to ansi.sys. # # 9.4.0 (Sat Feb 25 16:43:25 EST 1995): # * New mt70 entry. # * Added COPYRIGHTS AND OTHER DELUSIONS. # * Added AT&T 23xx & 500/513, vt220 and vt420, opus3n1+, netronics # smartvid & smarterm, ampex 175 & 219 & 232, # env230, falco ts100, fluke, intertube, superbrain, ncr7901, vic20, # ozzie, trs200, tr600, Tandy & Texas Instruments VDTs, intext2, # screwpoint, fviewpoint, Contel Business Systems, Datamedia Colorscan, # adm36, mime314, ergo4000, ca22851. Replaced att7300, esprit, dd5500. # * Replaced the Perkin-Elmer entries with vendor's official ones. # * Restored the old minimal-ansi entry, luna needs it. # * Fixed some incorrect ip and proportional-padding translations. # 9.4.1 (Mon Feb 27 14:18:33 EST 1995): # * Fix linux & AT386 sgr strings to do A_ALTCHARSET turnoff correctly. # * Make the xterm entry 65 lines again; create xterm25 and xterm24 # to force a particular height. # * Added beehive4 and reorganized other Harris entries. # 9.4.2 (Thu Mar 9 01:45:44 EST 1995): # * Merged in DEC's official entries for its terminals. The only old # entry I kept was Doug Gwyn's alternate vt100 (as vt100-avo). # * Replaced the translated BBN Bitgraph entries with purpose-built # ones from AT&T's SVr3. # * Replaced the AT&T entries with AT&T's official terminfos. # * Added teleray 16, vc415, cops10. # * Merged in many individual capabilities from SCO terminfo files. # 9.4.3 (Mon Mar 13 02:37:53 EST 1995): # * Typo fixes. # * Change linux entry so A_PROTECT enables IBM-PC ROM characters. # 9.4.4 (Mon Mar 27 12:32:35 EST 1995): # * Added tty35, Ann Arbor Guru series. vi300 and 550, cg7900, tvi803, # pt210, ibm3164, IBM System 1, ctrm, Tymshare scanset, dt200, adm21, # simterm, citoh and variants. # * Replaced sol entry with sol1 and sol2. # * Replaced Qume QVT and Freedom-series entries with purpose-built # terminfo entries. # * Enhanced vt220, tvi910, tvi924, hpterm, hp2645, adm42, tek # and dg200 entries using caps from from SCO. # * Added the usual set of function-key mappings to ANSI entry. # * Corrected xterm's function-key capabilities. # 9.4.5 (Tue Mar 28 14:27:49 EST 1995): # * Fix in xterm entry, cub and cud are not reliable under X11R6. # 9.4.6 (Thu Mar 30 14:52:15 EST 1995): # * Fix in xterm entry, get the arrow keys right. # * Change some \0 escapes to \200. # 9.4.7 (Tue Apr 4 11:27:11 EDT 1995) # * Added apple (Videx card), adm1a, oadm31. # * Fixed malformed ampex csr. # * Fixed act4, cyb110; they had old-style prefix padding left in. # * Changed mandatory to advisory padding in many entries. # * Replaced HP entries up to hpsub with purpose-built ones. # * Blank rmir/smir/rmdc/smdc capabilities removed. # * Small fixes merged in from SCO entries for lpr, fos, tvi910+, tvi924. # 9.4.8 (Fri Apr 7 09:36:34 EDT 199): # * Replaced the Ann Arbor entries with SCO's, the init strings are # more efficient (but the entries otherwise identical). # * Added dg211 from Shuford archive. # * Added synertek, apple-soroc, ibmpc, pc-venix, pc-coherent, xtalk, # adm42-nl, pc52, gs6300, xerox820, uts30. # * Pull SCO's padding into vi200 entry. # * Improved capabilities for tvi4107 and other Televideo and Viewpoint # entries merged in from SCO's descriptions. # * Fixed old-style prefix padding on zen50, h1500. # * Moved old superbee entry to superbee-xsb, pulled in new superbee # entry from SCO's description. # * Reorganized the special entries. # * Added lm#0 to cbunix and virtual entries. # # 9.5.0 (Mon Apr 10 11:30:00 EDT 1995): # * Restored cdc456tst. # * Fixed sb1 entry, SCO erroneously left out the xsb glitch. # * Added megatek, beacon, microkit. # * Freeze for ncurses-1.9 release. # 9.5.1 (Fri Apr 21 12:46:42 EDT 1995): # * Added historical data for TAB. # * Comment fixes from David MacKenzie. # * Added the new BSDI pc3 entry. # 9.5.2 (Tue Apr 25 17:27:52 EDT 1995) # * A change in the tic -C logic now ensures that all entries in # the termcap translation will fit in < 1024 bytes. # * Added `bobcat' and `gator' HP consoles and the Nu machine entries # from GNU termcap file. This merges in all their local information. # 9.5.3 (Tue Apr 25 22:28:13 EDT 1995) # * Changed tic -C logic to dump all capabilities used by GNU termcap. # * Added warnings about entries with long translations (restoring # all the GNU termcaps pushes a few over the edge). # 9.5.4 (Wed Apr 26 15:35:09 EDT 1995) # * Yet another tic change, and a couple of entry tweaks, to reduce the # number of long (> 1024) termcap translations back to 0. # # 9.6.0 (Mon May 1 10:35:54 EDT 1995) # * Added kf13-kf20 to Linux entry. # * Regularize Prime terminal names. # * Historical data on Synertek. # * Freeze for ncurses-1.9.1. # 9.6.1 (Sat May 6 02:00:52 EDT 1995): # * Added true xterm-color entry, renamed djm's pseudo-color entry. # * Eliminate whitespace in short name fields, this tanks some scripts. # * Name field changes to shorten some long entries. # * Termcap translation now automatically generates empty rmir/smir # when ich1/ich is present (copes with an ancient vi bug). # * Added `screen' entries from FSF's screen-3.6.2. # * Added linux-nic and xterm-nic entries. # 9.6.2 (Sat May 6 17:00:55 EDT 1995): # * Change linux entry to use smacs=\E[11m and have an explicit acsc, # eliminating some special-case code in ncurses. # # 9.7.0 (Tue May 9 18:03:12 EDT 1995): # * Added vt320-k3, rsvidtx from the Emacs termcap.dat file. I think # that captures everything unique from it. # * Added reorder script generator. # * Freeze for ncurses 1.9.2 release. # 9.7.1 (Thu Jun 29 09:35:22 EDT 1995): # * Added Sean Farley's kspd, flash, rs1 capabilities for linux. # * Added Olaf Siebert's corrections for adm12. # * ansi-pc-color now includes the colors and pairs caps, so that # entries which use it will inherit them automatically. # * The linux entry can now recognize the center (keypad 5) key. # * Removed some junk that found its way into Linux acsc. # # 9.8.0 (Fri Jul 7 04:46:57 EDT 1995): # * Add 50% cut mark as a desperate hack to reduce tic's core usage. # * xterm doesn't try to use application keypad mode any more. # * Freeze for ncurses-1.9.3 release. # 9.8.1 (Thu Jul 19 17:02:12 EDT 1995): # * Added corrected sun entry from vendor. # * Added csr capability to linux entry. # * Peter Wemm says the at386 hpa should be \E[%i%p1%dG, not \E[%p1%dG. # * Added vt102-nsgr to cope with stupid IBM PC `VT100' emulators. # * Some commented-out caps in long entries come back in, my code # for computing string-table lengths had a bug in it. # * pcansi series modified to fit comm-program reality better. # 9.8.2 (Sat Sep 9 23:35:00 EDT 1995): # * BSD/OS actually ships the ibmpc3 bold entry as its console. # * Correct some bad aliases in the pcansi series # * Added entry for QNX console. # * Clean up duplicate long names for use with 4.4 library. # * Change vt100 standout to be normal reverse vide, not bright reverse; # this makes the Emacs status line look better. # 9.8.3 (Sun Sep 10 13:07:34 EDT 1995): # * Added Adam Thompson's VT320 entries, also his dtx-sas and z340. # * Minor surgery, mostly on name strings, to shorten termcap version. # # 9.9.0 (Sat Sep 16 23:03:48 EDT 1995): # * Added dec-vt100 for use with the EWAN emulator. # * Added kmous to xterm for use with xterm's mouse-tracking facility. # * Freeze for 1.9.5 alpha release. # 9.9.1 (Wed Sep 20 13:46:09 EDT 1995): # * Changed xterm lines to 24, the X11R6 default. # 9.9.2 (Sat Sep 23 21:29:21 EDT 1995): # * Added 7 newly discovered, undocumented acsc characters to linux # entry (the pryz{|} characters). # * ncurses no longer steals A_PROTECT. Simplify linux sgr accordingly. # * Correct two typos in the xterm entries introduced in 9.9.1. # * I finally figured out how to translate ko capabilities. Done. # * Added tvi921 entries from Tim Theisen. # * Cleanup: dgd211 -> dg211, adm42-nl -> adm42-nsl. # * Removed mystery tec entry, it was neither interesting nor useful. # * shortened altos3, qvt203, tvi910+, tvi92D, tvi921-g, tvi955, vi200-f, # vi300-ss, att505-24, contel301, dm3045, f200vi, pe7000c, vc303a, # trs200, wind26, wind40, wind50, cdc456tst, dku7003, f110, dg211, # by making them relative to use capabilities # * Added cuf1=^L to tvi925 from deleted variant tvi925a. # * fixed cup in adm22 entry and parametrized strings in vt320-k3. # * added it#8 to entries that used to have :pt: -- tvi912, vi200, # ampex80, # * Translate all home=\E[;H capabilities to home=\E[H, they're # equivalent. # * Translate \E[0m -> \E[m in [rs]mso, [rs]mul, and init strings of # vt100 and ANSI-like terminals. # 9.9.3 (Tue Sep 26 20:11:15 EDT 1995): # * Added it#8 and ht=\t to *all* entries with :pt:; the ncurses tic # does this now, too. # * fviewpoint is gone, it duplicated screwpoint. # * Added hp2627, graphos, graphos-30, hpex, ibmega, ibm8514, ibm8514-c, # ibmvga, ibmvga-c, minix, mm340, mt4520-rv, screen2, screen3, # versaterm, vi500, vsc, vt131, vt340, vt400 entries from UW. # The UW vi50 replaces the old one, which becomes vi50adm, # * No more embedded commas in name fields. # # 9.10.0 (Wed Oct 4 15:39:37 EDT 1995): # * XENIX forms characters in fos, trs16, scoansi become acsc strings, # * Introduced klone+* entries for describing Intel-console behavior. # * Linux kbs is default-mapped to delete for some brain-dead reason. # * -nsl -> -ns. The -pp syntax is obsolete. # * Eliminate [A-Z]* primaries in accordance with SVr4 terminfo docs. # * Make xterm entry do application-keypad mode again. I got complaints # that it was messing up someone's 3270 emulator. # * Added some longname fields in order to avoid warning messages from # older tic implementations. # * According to ctrlseqs.ms, xterm has a full vt100 graphics set. Use # it! (This gives us pi, greater than, less than, and a few more.) # * Freeze for ncurses-1.9.6 release. # 9.10.1 (Sat Oct 21 22:18:09 EDT 1995): # * Add xon to a number of console entries, they're memory-mapped and # don't need padding. # * Correct the use dependencies in the ansi series. # * Hand-translate more XENIX capabilities. # * Added hpterm entry for HP's X terminal emulator. # * Added aixterm entries. # * Shortened four names so everything fits in 14 chars. # # 9.11.0 (Thu Nov 2 17:29:35 EST 1995): # * Added ibcs2 entry and info on iBCS2 standard. # * Corrected hpa/vpa in linux entry. They still fail the worm test. # * We can handle the HP meml/memu capability now. # * Added smacs to klone entries, just as documentation. # * Carrected ansi.sys and cit-500 entries. # * Added z39, vt320-k311, v220c, and avatar entries. # * Make pcansi use the ansi.sys invis capability. # * Added DIP switch descriptions for vt100, adm31, tvi910, tvi920c, # tvi925, tvi950, dt80, ncr7900i, h19. # * X3.64 has been withdrawn, change some references. # * Removed function keys from ansi-m entry. # * Corrected ansi.sys entry. # * Freeze for ncurses-1.9.7 release. # 9.11.1 (Tue Nov 6 18:18:38 EST 1995): # * Added rmam/smam capabilities to many entries based on init strings. # * Added correct hpa/vpa to linux. # * Reduced several entries relative to vt52. # 9.11.2 (Tue Nov 7 00:21:06 EST 1995): # * Exiled some utterly unidentifiable custom and homebrew types to the # UFO file; also, obsolete small-screen hardware; also, entries which # look flat-out incorrect, garbled, or redundant. These include the # following entries: carlock, cdc456tst, microkit, qdss, ramtek, tec, # tec400, tec500, ubell, wind, wind16, wind40, wind50, plasma, agile, # apple, bch, daleblit, nucterm, ttywilliams, nuterminal, nu24, bnu, # fnu, nunix-30, nunix-61, exidy, ex3000, sexidy, pc52, sanyo55, # yterm10, yterm11, yterm10nat, aed, aed-ucb, compucolor, compucolor2, # vic20, dg1, act5s, netx, smartvid, smarterm, sol, sol2, dt200, # trs80, trs100, trs200, trs600, xitex, rsvidtx, vid, att2300-x40, # att2350-x40, att4410-nfk, att5410-ns, otty5410, att5425-nl-w, # tty5425-fk, tty5425-w-fk, cita, c108-na, c108-rv-na, c100-rv-na, # c108-na-acs, c108-rv-na-acs, ims950-ns, infotonKAS, ncr7900i-na, # regent60na, scanset-n, tvi921-g, tvi925n, tvi925vbn, tvi925vb, # vc404-na, vc404-s-na, vt420nam, vt420f-nam, vt420pc-nam, vt510nam, # vt510pc-nam, vt520nam, vt525nam, xterm25, xterm50, xterm65, xterms. # * Corrected pcvt25h as suggested by Brian C. Grayson # . # 9.11.3 (Thu Nov 9 12:14:40 EST 1995): # * Added kspd=\E[P, kcbt=\E[Z, to linux entry, changed kbs back to ^H. # * Added kent=\EOM to xterm entry. # # 9.11.4 (Fri Nov 10 08:31:35 EST 1995): # * Corrected gigi entry. # * Restored cuf/cud1 to xterm, their apparent bugginess was due to # bad hpa/vpa capabilities. # * Corrected flash strings to have a uniform delay of .2 sec. No # more speed-dependent NUL-padding! # * terminfo capabilities in comments bracketed with <>. # 9.11.5 (Fri Nov 10 15:35:02 EST 1995): # * Replaced pcvt with the 3.31 pcvt entries. # * Freeze for 1.9.7a. # 9.11.6 (Mon Nov 13 10:20:24 EST 1995): # * Added emu entry from the X11R6 contrib tape sources. # # 9.12.0 (Wed Nov 29 04:22:25 EST 1995): # * Improved iris-ansi and sun entries. # * More flash string improvements. # * Corrected wy160 & wy160 as suggested by Robert Dunn # * Added dim to at386. # * Reconciled pc3 and ibmpc3 with the BSDI termcap file. Keith says # he's ready to start using the termcap generated from this one. # * Added vt102-w, vt220-w, xterm-bold, wyse-vp, wy75ap, att4424m, # ln03, lno3-w, h19-g, z29a*, qdss. Made vt200 an alias of vt220. # * Improved hpterm, apollo consoles, fos, qvt101, tvi924. tvi925, # att610, att620, att630, # * Changed hazeltine name prefix from h to hz. # * Sent t500 to the UFI file. # * I think we've sucked all the juice out of BSDI's termcap file now. # * Freeze for ncurses 1.9.8 release # 9.12.1 (Thu Nov 30 03:14:06 EST 1995) # * Unfreeze, linux kbs needed to be fixed. # * Tim Theisen pinned down a bug in the DMD firmware. # 9.12.2 (Thu Nov 30 19:08:55 EST 1995): # * Fixes to ansi and klone capabilities (thank you, Aaron Ucko). # (The broken ones had been shadowed by sgr.) # 9.12.3 (Thu Dec 7 17:47:22 EST 1995): # * Added documentation on ECMA-48 standard. # * New Amiga entry. # 9.12.4 (Thu Dec 14 04:16:39 EST 1995): # * More ECMA-48 stuff # * Corrected typo in minix entry, added pc-minix. # * Corrected khome/kend in xterm (thank you again, Aaron Ucko). # * Added rxvt entry. # * Added 1.3.x color-change capabilities to linux entry. # 9.12.5 (Tue Dec 19 00:22:10 EST 1995): # * Corrected rxvt entry khome/kend. # * Corrected linux color change capabilities. # * NeXT entries from Dave Wetzel. # * Cleaned up if and rf file names (all in /usr/share now). # * Changed linux op capability to avoid screwing up a background color # pair set by setterm. # 9.12.6 (Wed Feb 7 16:14:35 EST 1996): # * Added xterm-sun. # 9.12.7 (Fri Feb 9 13:27:35 EST 1996): # * Added visa50. # # 9.13.0 (Sun Mar 10 00:13:08 EST 1996): # * Another sweep through the Shuford archive looking for new info. # * Added dg100 alias to dg6053 based on a comp.terminals posting. # * Added st52 from Per Persson. # * Added eterm from the GNU Emacs 19.30 distribution. # * Freeze for 1.9.9. # 9.13.1 (Fri Mar 29 14:06:46 EST 1996): # * FreeBSD console entries from Andrew Chernov. # * Removed duplicate Atari st52 name. # 9.13.2 (Tue May 7 16:10:06 EDT 1996) # * xterm doesn't actually have ACS_BLOCK. # * Change klone+color setf/setb to simpler forms that can be # translated into termcap. # * Added xterm1. # * Removed mechanically-generated junk capabilities from cons* entries. # * Added color support to bsdos. # 9.13.3 (Thu May 9 10:35:51 EDT 1996): # * Added Wyse 520 entries from Wm. Randolph Franklin . # * Created ecma+color, linux can use it. Also added ech to linux. # * Teach xterm about more keys. Add Thomas Dickey's 3.1.2E updates. # * Add descriptions to FreeBSD console entries. Also shorten # some aliases to <= 14 chars for portability. # * Added x68k console # * Added OTbs to several VT-series entries. # 9.13.4 (Wed May 22 10:54:09 EDT 1996): # * screen entry update for 3.7.1 from Michael Alan Dorfman. # 9.13.5 (Wed Jun 5 11:22:41 EDT 1996): # * kterm correction due to Kenji Rikitake. # * ACS correction in vt320-kll due to Phillippe De Muyter. # 9.13.6 (Sun Jun 16 15:01:07 EDT 1996): # * Sun console entry correction from J.T. Conklin. # * Changed all DEC VT300 and up terminals to use VT300 tab set # 9.13.7 (Mon Jul 8 20:14:32 EDT 1996): # * Added smul to linux entry (we never noticed it was missing # because of sgr!). # * Added rmln to hp+labels (deduced from other HP entries). # * Added vt100 acsc capability to vt220, vt340, vt400, d800, dt80-sas, # pro350, att7300, 5420_2, att4418, att4424, att4426, att505, vt320-k3. # * Corrected vt220 acsc. # * The klone+sgr and klone+sgr-dumb entries now use klone+acs; # this corresponds to reality and helps prevent some tic warnings. # * Added sgr0 to c101, pcix, vt100-nav, screen2, oldsun, next, altos2, # hpgeneric, hpansi, hpsub, hp236, hp700-wy, bobcat, dku7003, adm11, # adm12, adm20, adm21, adm22, adm31, adm36, adm42, pt100, pt200, # qvt101, tvi910, tvi921, tvi92B, tvi925, tvi950, tvi970, wy30-mc, # wy50-mc, wy100, wyse-vp, ampex232, regent100, viewpoint, vp90, # adds980, cit101, cit500, contel300, cs10, dm80, falco, falco-p, # f1720a, go140, sb1, superbeeic, microb, ibm8512, kt7, ergo4000, # owl, uts30, dmterm, dt100, dt100, dt110, appleII, apple-videx, # lisa, trsII, atari, st52, pc-coherent, basis, m2-man, bg2.0, bg1.25, # dw3, ln03, ims-ansi, graphos, t16, zen30, xtalk, simterm, d800, # ifmr, v3220, wy100q, tandem653, ibmaed. # * Added DWK terminal description. # 9.13.8 (Wed Jul 10 11:45:21 EDT 1996): # * Many entries now have highlights inherited from adm+sgr. # * xterm entry now corresponds to XFree86 3.1.2E, with color. # * xtitle and xtitle-twm enable access to the X status line. # * Added linux-1.3.6 color palette caps in conventional format. # * Added adm1178 terminal. # * Move fos and apollo terminals to obsolete category. # * Aha! The BRL terminals file told us what the Iris extensions mean. # * Added, from the BRL termcap file: rt6221, rt6221-w, northstar, # commodore, cdc721-esc, excel62, osexec. Replaced from the BRL file: # cit500, adm11. # 9.13.9 (Mon Jul 15 00:32:51 EDT 1996): # * Added, from the BRL termcap file: cdc721, cdc721l, cdc752, cdc756, # aws, awsc, zentec8001, modgraph48, rca vp3301/vp3501, ex155. # * Corrected, from BRL termcap file: vi50. # * Better rxvt entry & corrected xterm entries from Thomas Dickey. # 9.13.10 (Mon Jul 15 12:20:13 EDT 1996): # * Added from BRL: cit101e & variants, hmod1, vi200, ansi77, att5620-1, # att5620-s, att5620-s, dg210, aas1901, hz1520, hp9845, osborne # (old osborne moved to osborne-w), tvi970-vb, tvi970-2p, tvi925-hi, # tek4105brl, tek4106brl, tek4107brl,tek4109brl, hazel, aepro, # apple40p, apple80p, appleIIgs, apple2e, apple2e-p, apple-ae. # * Paired-attribute fixes to various terminals. # * Sun entry corrections from A. Lukyanov & Gert-Jan Vons. # * xterm entry corrections from Thomas Dickey. # 9.13.11 (Tue Jul 30 16:42:58 EDT 1996): # * Added t916 entry, translated from a termcap in SCO's support area. # * New qnx entry from Michael Hunter. # 9.13.12 (Mon Aug 5 14:31:11 EDT 1996): # * Added hpex2 from Ville Sulko. # * Fixed a bug that ran the qnx and pcvtXX together. # 9.13.13 (Fri Aug 9 01:16:17 EDT 1996): # * Added dtterm entry from Solaris CDE. # 9.13.14 (Tue Sep 10 15:31:56 EDT 1996): # * corrected pairs#8 typo in dtterm entry. # * added tvi9065. # 9.13.15 (Sun Sep 15 02:47:05 EDT 1996): # * updated xterm entry to cover 3.1.2E's new features. # 9.13.16 (Tue Sep 24 12:47:43 EDT 1996): # * Added new minix entry # * Removed aliases of the form ^[0-9]* for obsolete terminals. # * Commented out linux-old, nobody's using pre-1.2 kernels now. # 9.13.17 (Fri Sep 27 13:25:38 EDT 1996): # * Added Prism entries and kt7ix. # * Caution notes about EWAN and tabset files. # * Changed /usr/lib/tabset -> /usr/share/tabset. # * Added acsc/rmacs/smacs to vt52. # 9.13.18 (Mon Oct 28 13:24:59 EST 1996): # * Merged in Thomas Dickey's reorganization of the xterm entries; # added technical corrections to avoid warning messages. # 9.13.19 (Sat Nov 16 16:05:49 EST 1996): # * Added rmso=\E[27m in Linux entry. # * Added koi8-r support for Linux console. # * Replace xterm entries with canonical ones from XFree86 3.2. # 9.13.20 (Sun Nov 17 23:02:51 EST 1996): # * Added color_xterm from Jacob Mandelson # 9.13.21 (Mon Nov 18 12:43:42 EST 1996): # * Back off the xterm entry to use r6 as a base. # 9.13.22 (Sat Nov 30 11:51:31 EST 1996): # * Added dec-vt220 at Adrian Garside's request. # 9.13.23 (Fri Feb 21 16:36:06 EST 1997): # * Replaced minitel-2 entry. # * Added MGR, ansi-nt. # * Minor corrections to xterm entries. # * Replaced EWAN telnet entry. # * Dropped the reorder script generator. It was a fossil. # 9.13.24 (Sun Feb 23 20:55:23 EST 1997): # * Thorsten Lockert added termcap `bs' to a lot of types, working from # the 4.4BSD Lite2 file. # 9.13.25 (Fri Jun 20 12:33:36 EDT 1997): # * Added Datapoint 8242, pilot, ansi_psx, rbcomm, vt220js. # * Updated iris-ansi; corrected vt102-w. # * Switch base xterm entry to 3.3 level. # # The following sets edit modes for GNU EMACS # Local Variables: # fill-prefix:"\t" # fill-column:75 # End: ######## SHANTIH! SHANTIH! SHANTIH! lH@& sH mH iH eHaH{H YH MH SH MH IH EH AH =H 9H 5H  H H  H  H H  H H H H H H H H ޡH 1H H !H "H #H $H %H &ݡH '١H (աH )ѡH *͡H +ɡH ,šH -H .H /H 0H 1H 2H 3H 4H 5H 6H 7H 8H 9H :H ;H <H =H >}H ?yH @uH AqH BmH CiH DeH EaH F]H GYH HUH IQH JMH KIH LEH MAH N=H O9H P5H Q1H R-H S)H T%H U!H VH WH XH YH Z H [ H \H ]H ^H _H `H aH bH cH dH eH fݡH g١H hաH iѡH j͡H kɡH lšH mH nH oH pH qH rH sH tH uH vH wH xH yH zH {H |H }H ~}H yHH qH mH iH eH aH ]H YHHH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H H H H }H yH uH qH mH iH eH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H  H  H  H  H  H  H  H  H  ݡH  ١H  աH  ѡH  ͡H  ɡH  šH  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  }H  yH&  H  mH  iH  eHaH{H  YH  MH  H  MH  IH  EH  AH  =H  9H  5H   H H  H   H H   H  H  H  H  H  H  H  H  ޡH bH  H ! H " H # H $ H % H & ݡH ' ١H ( աH ) ѡH * ͡H + ɡH , šH - H . H / H 0 H 1 H 2 H 3 H 4 H 5 H 6 H 7 H 8 H 9 H : H ; H < H = H > }H ? yH @ uH A qH B mH C iH D eH E aH F ]H G YH H UH I QH J MH K IH L EH M AH N =H O 9H P 5H Q 1H R -H S )H T %H U !H V H W H X H Y H Z H [ H \ H ] H ^ H _ H ` H a H b H c H d H e H f ݡH g ١H h աH i ѡH j ͡H k ɡH l šH m H n H o H p H q H r H s H t H u H v H w H x H y H z H { H | H } H ~ }H  yH H  qH  mH  iH  eH  aH  ]H  YH H H  MH  IH  EH  AH  =H  9H  5H  1H  -H  )H  %H  !H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  ݡH  ١H  աH  ѡH  ͡H  ɡH  šH  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  }H  yH  uH  qH  mH  iH  eH  aH  ]H  YH  UH  QH  MH  IH  EH  AH  =H  9H  5H  1H  -H  )H  %H  !H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  ݡH  ١H  աH  ѡH  ͡H  ɡH  šH  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  }H  yH &  H  mH  iH  eH aH {H  YH  MH H  MH  IH  EH  AH  =H  9H  5H  H  H  H  H  H  H  H  H  H  H  ߡH  ۡH  סH  ӡH  H H !H "H #H $H %H &ݡH '١H (աH )ѡH *͡H +`H ,šH -H .H /H 0H 1H 2H 3H 4H 5H 6H 7H 8H 9H :H ;H <H =H >}H ?yH @uH AqH BmH CiH DeH EaH F]H GYH HUH IQH JMH KIH LEH MAH N=H O9H P5H Q1H R-H S)H T%H U!H VH WH XH YH Z H [ H \H ]H ^H _H `H aH bH cH dH eH fݡH g١H hաH iѡH j͡H kɡH lšH mH nH oH pH qH rH sH tH uH vH wH xH yH zH {H |H }H ~}H yHH qH mH iH eH aH ]H YHHH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H H H H }H yH uH qH mH iH eH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H H H H }H yH <4;;;;; ;(;0;8H )@`  <4! !7 <0$0+0;"+,+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; <4 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/< P-<4 %)<0 L %"+/< -<4+cP<!8`"!8#t@<#(;x ;"`;" @?o@;Ҋ@@2 @ 0P -@ @ @"P/< P-<4 %)<0 L %"+/< -<4+cP<!8`"!8#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @?$t x ``-`Ձ @? tx ́ )<!L@!TP -@ @ @"P/< P-<4 %)<0 L %"+/< -<4+cP<!8`"!8#t@;x;;<!T!X ;`#h#l;;;;@s``htx ;`#h#l;;;;@r3``htxk )<*!(@)<*! P -@ @ @"P/< P-<4 %)<0 L %"+/< -<4+cP ;`@;h#t;x;;;;;`@o;`htx% /< -<4+cPۜP -@ @ @"P/< P-<4 %)<0 L %"+/< -<4+cP ;`@;h#t;x;;;`;;@tP;`htxށ -?P -@-P -@ @ @"/< /< /< 6PP-<4 %)<0 L %"/< /< /< P;x<!@`"!@@;,/,;@ ;`,)<0 ;h %)<"D #p "`@ x  -<-@- %0P -@ @ @"/< /< /< 6PP-<4 %)<0 L %"/< /< /< P;x<!@`"!@@;,/,;@ ;`,)<0 ;h %)<"D #p "`@  <0 2/@,`x+ P -@ @ @"/< /< /< 6PP-<4 %)<0 L %"/< /< /< P<!@`"!@?P * * ;`@;h09P -@ @ @"/< /< /< 6PP-<4 %)<0 L %"/< /< /< P<!@`"!@?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@=`h ?P `*  P -@ @ @"/< /< /< 6PP-<4 %)<0 L %"/< /< /< P<!@`"!@-<<P  2<P?p " % ;`@;h`h ?p " d @/<  @̀-<4 $)<0 L %-<4+cP-<0l MP @ H ,@`#<a4$` (08 @̀=)<0 $0+0;"+2+0 `# @ 05-" % >&p 8 >0-@0=`"-@-@0 `# @ 05-"T  -<4%- +cP ;`@;h #t;x;`;;;;@mL;`htx -<4& 0! H,@` !`hpx (08@HPX @̀H,@`%<4 $ (08 @̀@ @̀  H ,@`#<a4$` (08@̀2>?@ @̀='<0$0/0?"/2/0 `# @ 05-"$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#<a4 $` (08@̀ -<0l  @yP-<4"/<4А  ! H,@` ! (08@HPX @̀<0L `?* `"" * `@"<0k  * `@&* *  ֊@* "``/A`   0`0 0  c mt@ <   <  @@   <  @@ #<%< ;  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D<%b@<0" <0"  *<0" !`<0" $H(  /  <( =;</PH <0" (<"<;c@"@!<*$"H``<$"cH  !<%#!<( $ $ <%# 2< " < " < "!< "!(<#""<#""<#"#L<#"#t<$""<$""0<$""<$""<*""<*""0<*"#x<@Ւa<( !<$!4<  !<$!(@@pH(  / <0 (=;<S!PH <S@2x!H,/ d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx!'P   d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx P   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P   < *<$ <'@ lcopyinstr<@ * < <'@ copyoutstr!4<'a#  J@*@`  ?"@ 2"#   J*@`4  ?"@ 2"< * < <@ *< 4<'!@" <4" <4"   <44``6 < ` <  !4!`<' @D< `" <!D`"!D < <<! `2$j0<'@~"<'@{"<'@x"switch rqswitch wchanswitch SRUN< <4: H< " (o! `j<"2J "2 J    "2 J  J " <bx+  @ #@"   *@ * hH- <""$ `! "H"j <#0`"#0j ` *@ #( !4` (08 2㿠@A<0`` Ъ@@<€"Т@: H"  h`<   <4<(" " " ?" ?< <4<(" " < <4<(" " < <4<(" " < ؀ <4<(" "" < <4<(" 2" < <4<(" 2" < <4<(" *" <4<(a" `2 `2`2" <4<(a" `2*`22`2"" @<(a" Њ@" @<(a" " " @""@" "`""@ 6 :@ 6 `6:  6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*<a4<*` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  <*?Ѐ @ 3 <0!$ c@  Њb@&""""  <Sah@ @: " longjmp botch@" `&"`㿠<+@ (6 0audioaudioamdispleenmainbusiommuobiovmeiexdcxdxycxyauxregclockoclocktimereeprompowercpumemregeccmemctlzsfdcfdsbusxboxdmaledmalebufferespqecbeqeaudiocsmagmamttymbpptlphynsphyqsphyinphyexphylxtphyicsphysqphyukphyzsttykbdmsscsibuscdchsdstssukbwtwocgtwocgthreecgfourcgsixcgeighttcxcgfourteensiswbuschannelconsoledriveluntargetphyvecpriaddrlevelirqfunctionsocketcontrolleroffsetslotslavemdvnd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" 㿘 , N 0  . m. h. k  & & . j@. l !*@ *` E*@*`*` C*` *`㿘 4 2    t& 4€& 8 㿘 x@& 4?    @" mulaw  <, " 2"""  㿘 j<+#*`  < , 04  l* 4& k* *  *  2   ?<,!*` 4$4"* <,a4"4$ m  -  ,-H /*% i,@ ,,` c,@ p  f,@ p& d,@ p" e,@ p$ j,@ -,`H p@  0 !*@ *`" 8  0 !*@ *`" 8 㿘<6`@e 0  states->%s%sGOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status->Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating?0x%x?Port DiscoveryWaiting Port Discovery ACKPort LoginWait Port Login ACKProcess LoginWait Process Login ACKLogged InPort UnavailableProcess LogoutWait Process Logout ACKPort LogoutWait Port Logout ACK21001080%s: LVD Mode %s: Differential Mode %s: Single-Ended Mode %s: Illegal Mode 0x%x %s: unknown chip rev. 0x%x- assuming a 1020 10201020A10401040A1040B%s: Ultra Mode Capable chip reset timed out%s: MBOX_BUSY never cleared on reset NOP test failedMailbox Register test didn't completeRegister Test Failed%s: F/W download failed at word %d ram checksum failure%s: skipping f/w download failed to set CLOCKRATE%s: setting input clock to %d ABOUT FIRMWARE command failed%s: Board Revision %s, %s F/W Revision %d.%d loadedresident%s: in 64-Bit PCI slot %s: Last F/W revision was %d.%d 㿈 *  h 2`.  &   `@  7@6 * @6   &  -`@ ` <- Ħ#` 2D   d4  <-Ȓ`v * 2 i"d*#<.@*@ $<-#@ Ē   @ $<-#@   @@ $<-#@   <. 2@     ?` *`</  €<. (@   . <. (`X . <. (`` . <. < `h . <. <`p . <. <`x4` `v€!" @<-#@ d @ $@ *@$@ ` € * 2  <. @ H @@ <$@ 4`!(@ =   @@*@$@  ,"  `@: 4`  `" @  +    X d  `"   `B    C d  `    `@   ` c    & d? [<.    %    @  d 2  `* @€ * 2 `  #  ` € *  2 `  # €`@ * 2  `@  `.  `0 @   `" @        c  d? <. * 2  7@<.@ǒ`0 >7b /)!?777777@ΐ耢<.@`07"@<./"@<.?#@<.!@<.)!@<.@a0 `$ "    "2 `$ - 6  #7`&, 7`  @7耢<.  `$&7  7`&7@q<.@KaP0 2  <.!h@ В   7`& "7@S ""     47 7@D<.a@   2  <. !@   7@+<.@a0?<.!   <. "@`03 @  0/<." @ {     <."(@ l*  @* 6 <."@2@ [ @ ``. %s: can't setup dma mailboxes failed to set initiator idfailed to set retry count and delayfailed to set async data setup timefailed to set active neg statefailed to set tag age limitfailed to set selection timeout%s: failed even to set defaults for target %d %s: failed to set device queue parameters for target %d, lun %d set of response queue failedset of request queue failed%s: unable enable FW features 㿈@ @ <1!@ Ԓ 0_ " @y0W@2     `. 07@2` `7@D@<1@a08 27 ` 7 ` @27耤<1@ a0' 67@2 7@!耤@<1@b0 57@22 ` * 7@ 耤<1@b80 37 ` 7@耤@<1@ْbX0 17`7@耢<1@ʒbx0 ```` 651  6@  8-777 2 * @7@Œ#777 2 * 7@耢<1" @ P (77@@ =5"Ȗ @ 652  *@ * $/ 5  6    6 9377`72 @k7耢<1 /# $ `   w $ $ 777777@H<1@"c0<$!$ 7777. 77@1耤<1@ c00&.   .   6@ J7耢 7 7ꀢ  @耢<1#P@ y   . %s: bad frame length (%d) from NVRAM- using %d %s: too many retries to get going- giving up INIT FIRMWARE failed㿀  "h@  8'@' /`!C0`!C7``* 2 '@ 7`<3`!( @ 4$`7`` 7`` /` `  q/` 7``/`@* 2`@ 2 /`@* 2` 2 /`@2`*  2 /`@ /`@2  /`@2  /` @`2  #/` @  *2*2*2222     /`/`/`/`/`/` /` /`! 7`$7`&$ 7`($l7`*$ 7`0$   @` 7`2 -  `77@7 77777'@ G'䀢@ @ @ <3@@ <3 '@#'䀤   <3!X@ 0@a0  Ɛ `) ) ) ) ``) @(`   h70V*0%s: DMA error getting port database %s: Comand Param Error on Get Port Database %s: error 0x%x getting port database for ID %d 㿈 .` d 77"l7 777@ Ɛ  @<4@ *<4 @*<4 h @  V   !H 2   <4!p @ ?0 !2@?%s: Firmware State %s -> %s %s: GET LOOP ID failed %s: Loop ID %d, ALPA 0x%x 㿈  z @p j<4"耢( <4#* €Ӹ <-"H<-"X<-"p<-"<-"<-"<- "<- "!<"<-b@  '<5 \* €|ԈԔԠԬԸ<-"H<-"X<-"p<-"<-"<-"<- "<- "!<"<-b@Ő@{  "  dd 2? 7@ @ <4,, # @X  <4@R#?%s: adapter not ready %s: unsupported cdb length (%d) %s: Request Queue Overflow %s: Request Queue Overflow+ %s: out of xflist pointers %s(%d.%d): START%d cmd 0x%x datalen %d 㿈 & 4 2    <5!@  & 4A  `  $4<5  <5!@  & 4-  ` ) "*  *     -ƒc  & 4 @7"@   "   "@  " @ +@€`, `/ $ *  @  / 2  U<5Q! $ # $`$`+   ,` ,` `, `  ` 2  3<5/"$* @/ @  @ ,@  ,`,`,`  `, ,` *`** 2  <5"8@Z  & 4 $$` "    & 0  @   4` `"*  * @`" 4`   " 4`   @    ",`   #,`  &4` #,`  `@ $ 2  <5  `#"X `" `  ` ,@ #\ @#* `4`   4` " `  4`  @ "& 4$ `,    2  *  `@4  ,  %s: isp_control unknown control op %x isp_control SCSI bus reset failed%s: driver initiated bus reset Target Reset Failed%s: Target %d Reset Succeeded %s: isp_control- cannot find command to abort in active list %s: isp_control MBOX_ABORT failure (code %x) %s: command for target %d lun %d was aborted 㿈 <7!<* €\`4D<6k#    ,  7 `7  7@ <6@ cc?<7 @D ]   .777@ Ȓ<7@ `8J?<7 P@*   , 0?  * *2<7 p@ ,? 7 " #*` :777@ <7 @ ?<7 # "@   @ Ð -Ɛc%s: isp_intr isr=%x %s: isp_intr sees 0x%x why intr? isr %x iptr %x optr %x %s: not RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) %s: rqs_flags=%x%s: internal queues full %s: bad header %s: bad request packet %s: bad request handle %d %s: NULL xs in xflist (handle %x) %s: unknown return %x %s: cnt %d rsd %d %s: ARQ failure for target %d lun %d %s(%d.%d): FIN%d dl%d resid%d STS %x Skey: %x BUT NOT SET XS_ERR=0x%x 㽈    `` * 4` 0* 4` 2 "  2  <7#`@B   N  "* 2  *<7#x2@%    3 2`@   %?+  @"@ ,$ 0 , `    2  $ ,   2`*`  6 ,"    `@ ) /@€  @2  2  <7#4`@Ζ       [ /<8  $ `, / ` @u "P ` 2L <7# @   ` # 2> <8  @ `  <8 @ `  <8 8@~ ` <8 H@v` * <8 `@l     2" <8 @[ @   `   .  $ 4 ` , ` *` @ ` $ <`$$ @`($ D`,$ H`0$ L`4$ P`8$ T`<$ 4$ X` ", 4  .   "* @ *`  " ` 2 4 $ 4` $ <`$$ @`($ D`,$ H`0$ L`4$ P`8$ T`<$ X`  4`  4 2 ` ` 2 ` $ 4 `<8 4 2 ` @  $ 4 @ޒ  42  $ 4 "``$ 0(" ,`$ 0 2  <8 , `@  , " `  ` ` 2  4  2   <8 # "@  $ 4 2  4   $ 4    #  "%<8 ` , 0#\ `@#``  <8 >@!( 4<8@y!8 4@vH 2      2`*`  6 ,"     `€.  . @ ,` "` `$ @g`@,` %s: Internal FW Error @ RISC Addr 0x%x %s: Request Queue Transfer Error %s: Response Queue Transfer Error %s: timeout initiated SCSI bus reset %s: device reset %s: extended message underrun %s: SCAM interrupt %s: stalled SCSI Bus after DATA Overrun %s: SCSI Bus reset after DATA Overrun %s: Transition to LVD mode %s: Transition to Differential mode %s: Transition to Single Ended mode %s: Transition to unknown mode 0x%x %s: fast post completion of %u %s: CTIO done %s: LIP occurred %s: Loop RESET %s: Port Database Changed %s: unknown async code 0x%x 㿘   <   <:   f 8<;3 ` b  n<:(<; }    e  i<; ` r<:  o<: <;    "i e<:    <; ` "     <; ` "   !"<;<; @ה  . Ӱ `* <: "@2@ ʐð?"0"X `<:"@  .  <:`. """<:"#(`€* 2  h" <:d.<:A#@=<:<:#P@Β   @*# * "  ,"#p@   @ " * # * "<:#@   @*@"  # *@ "#@   . F` ` * 2 , 2  0<:# )!  <;`.   .   @  <;`.   0 `. <; @@R  ` @L%s: other response type %x %s: Request Queue Overflow other response 㿘`<<? @,!а %s: Selection Timeout for target %d %s: command incomplete for target %d lun %d, state 0x%x %s: DMA error for command on target %d, lun %d %s: transport error %s: bus reset destroyed command for target %d lun %d %s: command aborted for target %d lun %d %s: command timed out for target %d lun %d %s: command overrun for command on target %d, lun %d %s: status overrun for command on target %d, lun %d %s: message not COMMAND COMPLETE after status on target %d, lun %d %s: No MESSAGE OUT phase after selection on target %d, lun %d %s: EXTENDED IDENTIFY failed on target %d, lun %d %s: target %d lun %d rejected INITIATOR DETECTED ERROR message %s: target %d lun %d rejected ABORT message %s: target %d lun %d rejected MESSAGE REJECT message %s: target %d lun %d rejected NOP message %s: target %d lun %d rejected MESSAGE PARITY ERROR message %s: target %d lun %d rejected BUS DEVICE RESET message %s: target %d lun %d rejected IDENTIFY message %s: target %d lun %d had an unexpected bus free %s: HBA attempted queued transaction with disconnect not set for target %d lun %d %s: HBA attempted queued transaction to target routine %d on target %d %s: HBA attempted queued transaction for target %d lun %d when queueing disabled %s: invalid IOCB entry type detected %s: internal queues full for target %d lun %d status 0x%x %s: SCSI phase skipped (e.g., COMMAND COMPLETE w/o STATUS phase) for target %d lun %d %s: Auto Request Sense failed for target %d lun %d %s: Wide Negotiation failed for target %d lun %d %s: SDTR Message failed for target %d lun %d %s: Bad LVD Bus condition while talking to target %d lun %d %s: Port Unavailable for target %d %s: port logout for target %d %s: port changed for target %d %s: port busy for target %d %s: comp status %x `  `+#<>!*` €40h(<PdxPP<PxPPPPPP,` "2 2  << `""P@   +  `#<< `""x @3 ߐ << #"<<"@ <-a0@6x` a x1<-<-!@H@,` b 1<-x<-X!@@"` dx<-h!@@` hx<-x!@@` @x<-ሒ!@@` @x<-ᘒ!@@` @<-xᨒ!@@<-!!@x@x<-@` <-xВ@۔` <-x@Ҕ` <-x@ɔ` <-x@` <-x@` <-x@` @<-x(@` <-x8@x@1  2  << ## "@D    .  &4<< ##8 "@7    . &4 2  << ##h "@%    `&0<< #Ő#<< ##<= # <= # P<= # <= # <= #!<= #!8<= #!p<= #!<= #!<= #"<= #"H "&4`$&0<= #|"<= ""w #<= #q# <=#x@  <= ## " @``` &4<= #X#<> # 8 "@  &4<> # p "@  "v&4 ?Ȑ .  "*`  *  *@ 2  "*` * @ "<> # "@t  Q  ?Đ .  "*`  *  *@ 2  "*` * @ 7"<> # "@P /  2  <> `"!@C " <> `"!@@;  &4<> `"!` <> `"!@,   &4*<>! 2@" &4%s: fast posting handle 0x%x not found 㿘`*  " <@"@ 0 ,$ 0  , `   `$ @%s: bad command %x %s: no parameters for %x %s: isp_mboxcmd could not get command started %s: isp_mboxcmd timeout #2 %s: isp_mboxcmd timeout #3 %s: isp_mboxcmd timeout #4 %s: mbox cmd %x failed with INVALID_COMMAND %s: mbox cmd %x failed with HOST_INTERFACE_ERROR %s: mbox cmd %x failed with TEST_FAILED %s: mbox cmd %x failed with COMMAND_ERROR %s: mbox cmd %x failed with COMMAND_PARAM_ERROR %s: mbox cmd %x failed with error %x 㿘@  76@ 7 " s<@#8<6 @ `2`  `2 <@#P   @釐 d `/   E'{ d  &  * 2`    @ ϒ0@" <      @  @  ?  ?@ ` 2  6`?`^<A#*` €d$  ``6`  ` ` 6`  2 @ `2 6`   ` ` 6`  2 @ `2 6`  ``6`  ``6`  ``6`  ``6` @6@ @           %0 @P!蜐 d <@ @P荐 d    <@   *2``  <@0"    @ O d `F<B"ܓ*` €    l P 4   `€6` ` €6`  ` €6`  `€6` `€6` `€6` `€6` 6@ @   @  @<<A  @") " @)<A @& `F @    @J @ `7 @%  @< `-2  5<A  0<A h  @v0(d&j)!<A @j 00<@#p###@\ 0* 2**<A! @N2couldn't GET FIRMWARE STATUS%s: %d commands on completion queue couldn't GET DEVICE QUEUE STATUS%s: lost command for target %d lun %d, %d active of %d, Queue State: %x lost command㿀 7@<C.aꀢ<C!@ `&`" 7 " #* 7耢<Cb`<C #"8 " #\@<Cb@K%s: %s biu_conf1=%x biu_csr=%x biu_icr=%x biu_isr=%x biu_sema=%x risc_hccr=%x cdma_conf=%x cdma_sts=%x cdma_fifostat=%x ddma_conf=%x ddma_sts=%x ddma_fifostat=%x sxp_int=%x sxp_gross=%x sxp(scsi_ctrl)=%x mbox regs: %x %x %x %x %x 㿘<C#@  !<C # !<C#€ * @x2` %<CȐ  * 4`  * 4  * @]2 !<C'#€@* @Q2` g@  %<D `  *  4``$ *  4 `&* @*2 %<D 0`@ *  4``D *  4 `F* @ 2 %<D`` * 4`` * 4 `r* @2 @   )<D  * 4` * 4` * 4`` * 4 `* @3` `@%s: active requests Active Handle %d: tgt %d lun %d dlen %d 㿘   +<E,` '<E`8 @  P  " `# ,@```,`GET FIRMWARE STATE failed㿈 -   i7@   @    @  @<E ِ ߠ <E`0,` %s: failed to %cet SCSI parameters for target %d %s: tgt %d flags 0x%x period %d off %d 㿀  `. `˜  ' +<E*` *  ` 2`  8* *7 ?7  2`*` 7 *  (*@ 22"2`  (* @*`7 `*"` *7r <E!   s g@l䀤   . d )??+  * 2` `  ,   2  ( 2   2b @,`   +  *@ * *`2  *`#+ @ *` `  2"`  @ 6䀢  * *   *@  " * *   @ "  '䀢`F %s: already have dparms could not GET ACT NEG STATE 㿈 $" $2  <F!p@D 0&  `@2 @n  ! $    2 2 * * :*  %7  2  <F@!@   $@ @2`* *` $@2  * * @$@?ò# 5??7?````` $-55@ `( `?* 2  : ` 0  $   $   $ - @2? (,77O235@5-2   @ * $`d  -2` `*`  $`?* 2  :(  8   0   $,    `  @@@ *@*  $@ x*H*0 $@     <4`4`,` #,` ,` `,`  @ @   "@` %s: isp_restart cannot restart ISP 㻘  , " "  2` ``Q 2` ``  .  2   <G!@  ,     `  2``    2*  6  # 4 ,`# 0# @! ߓ, %s: invalid NVRAM header %s: invalid NVRAM checksum %s: version %d NVRAM not understood truefalse%s: NVRAM values: Fifo Threshold = 0x%x  Bus Reset Delay = %d Retry Count = %d Retry Delay = %d Tag Age Limit = %d Selection Timeout = %d Max Queue Depth = %d Async Data Setup = 0x%x  REQ/ACK Active Negation = %s Data Line Active Negation = %s Data DMA Burst Enable = %s Cmd DMA Burst Enable = %s Fast MTTR = %s %s: not supporting QFRZ option for target %d %s: not disabling ARQ option for target %d  Target %d: Enabled %d Throttle %d Offset %d Period %d Flags 0x%x %s: Adapter WWN 0x%08x%08x %s: BOOT DEVICE WWN 0x%08x%08x Max IOCB Allocation = %d  Max Frame Length = %d  Execution Throttle = %d  Retry Count = %d  Retry Delay = %d  Hard Loop ID = %d  Options = 0x%x HBA Options = 0x%x %s: NVRAM is valid 㾈'D !    D@ !S@D P"  `!t?<G# =6  D@j    @ ` D<G#@@`P?<G#`@`G?D` v`2   ` * * %2`* *` %?- #-  -  * %`` 2    H   0 %72` *` %2  * * %2` `* *` %2 * * @%- *@ * 5 *` 5  * D%`2` ``i<G#@ `<G2`#@ `<G @#<H @ <H @ (<H @ P<H @ x<H @ <H2`  @ `<H <6 <6 @ې <H2!<6 <6 @ΐ <H2!@<6 <6 @ <H2!h<6 <6 @ <H2!<6 <6 @ ?â #      ;<H2  @ * @% @<c @*@ % @ * @% /D`   /2`   @02`   @  %4@  !4@ D<H!`@Y $4   D<H!`@L   (4    4    4  @  4 2     4 D4 `2`   b  2 2 #\2 @`    r`D       * *`5-    +` D6. @ `  @ -6`. @.@'.` @ D @  @ `<H'"`@ɒ8@@CA D B*`  E *6`.   @+` F 7`/   @.`6./`G.      <H"@* @0`* 0` (` (` (`(` 0`D`2`  .<G@n#<H`@i"<H`@d"<H` @_"<H` @Z#<H` @U# <H`@P#@<H`@K#`<H>@G#D`2`  D<H#@<` 㿘    o    g  `` `f`?a `&&6* 2 <    ` I  `` A  ` 9 <<6 *`6   )     6     ``$     `* 2`@6states->%s%sGOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status->Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating?0x%x?Port DiscoveryWaiting Port Discovery ACKPort LoginWait Port Login ACKProcess LoginWait Process Login ACKLogged InPort UnavailableProcess LogoutWait Process Logout ACKPort LogoutWait Port Logout ACK㿘 <M <L<6c ? l& p& t. & H& 8& @& D&  &  ``  ` ꃔ  }   6 R6 T. -  . -6 R 6 T @2  . P -  . -  . , c  <0a <N + " &  P*@<ܒ ,@ 㿘 0?#@@& 0@㿘 H /* %  6 2 "* @ *`@ '` `?Ȗ*`2 ?ΐ+2  "*` * @ @ 2   "* * @ @ "  , 2   4?    䈐 2` ``      ` H 0 & 4  , `        "     & 4H 0[ & &  "@$ H 0M    `       `  2  H 0%@$      2 ?*  `@4   4  & 4H 0 㿘" \`` #贆 %s: isp_watch failed to abort command 㿘H /* % ??Ţ )<N"Фa , @"  "  " "4    "   (@} 7<0 , <0a <N*"  P*@5 & H 0㿘H /* %     <N P@I & H 0%s: botched command restart (0x%x) %s: requeued %d commands 㿘 H /* % D  ; +<N` "`&  " `   `       `a@  4$   $ 4@ ʤ<N"@H 0, 16 bit wide , Tagged Queueing Enabled , 16 bit wide, Tagged Queueing Enabled %s: Target %d at %dMHz Max Offset %d%s%s: Target %d Async Mode%s%s: SCSI bus reset detected %s: Loop DOWN %s: Loop UP Target/InitiatorInitiatorTargetNo%s: Loop ID %d, %s role Node Address 0x%x WWN 0x%02x%02x%02x%02x%02x%02x%02x%02x Hard Address 0x%x WWN 0x%02x%02x%02x%02x%02x%02x%02x%02x Master State=%s, Slave State=%s Master State=%s Slave State=%s %s: Name Server Database Changed 㿈H /* %`ۤ <O".` €> ????E@ ,  * @ @     " @2   " (  *0  ! *@#  @  " <N ( <L  x <L  x#<N#<N# *`@ `<N# @ 0|<O  @ݖ 0u<Op 0 <O& k P<N"4& @ <Ob ` [.,   @`N<62`В `  <O`P @촒 ` <O` *`` + @ @ ` ````#\`#``#d`@#h@<O``*``+ @ @ `!` ` ``#\`#``#d`@#h`N 0 "` 0 "`0<O` 8!H<P!<* €AlAxAAAAAAAAAA<L*!<L'!<L$!<L!!<L!<L!<L"<L"<L"0<L"@<L "X<L "h!<#<La@}` 7<P"<* €BlBxBBBBBBBBBB<L*!<L'!<L$!<L!!<L!<L!<L"<L"<L"0<L"@<L "X<L "h!<#<La@=@0<O 8!p<P#P* €CCCCCCCCCCCD<L*!<L'!<L$!<L!!<L!<L!<L"<L"<L"0<L"@<L "X<L "h!<#<La@H<O 8!<Q \* €DDDDDDDDDDEE<L*!<L'!<L$!<L!!<L!<L!<L"<L"<L"0<L"@<L "X<L "h!<#<La@뵐<O! @hH 0 㿘<Q",<Sa&!&!@!P &!l*!T` * &!p   &!h!t*" !P &!T  !x*" !T &h \! 77!4 2 ؐ 7 О!| ؘ  ,.!| .!} .!~  .! .! .!  +` +  *    77@7!H&!X!l&!d !P27&!`@&!\?!H* !p@ !T27@7?*  7!h@ !P 6!T :!t,@,!H/Җ 2!l/7  77֐П !P &!t!T 0!x,@,!H/ʖ 2!p/7  77ΐȟ !T &!x%s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled 㿐!  !B 6!B @ *!2   | & |( t & t<R @2!00  <R @*!H t@& tͰ  <R @!` |@& | @ J&!8:!X @  ` <R p@ `<R @  t & t   <R @  t & t!t,  @Δ  :/77@ !P  " !l,     &!X"n !d b!\#<R!p, @   `U`@ \ ;96 \ <R <R @顒 0!`&!8@<R @鎒   &  a@  &  | & |``  " x  &  x & x!T " !d? &!d&!\@ ,!d`"6 Z missing buffer, no_td = %d, last_td = %d 㿐 0 $@ @Ua`.)<S "ax@嬒ax,@ 0  6 ./77`@ a  HaT " ad  $ad 0$%6 0ap,@`@  ! 06 0ad@a`    & & $  ?& 2 ($a`lance_config: weird memory size: address %s %s: %d receive buffers, %d transmit buffers lance_config: can't establish shutdownhook㿘@<V?b " <V   #H & !6 \<V<V& @& D& H& L& & ̖& ,@ !(  !,6!0!(,   @ !,  &!(!0  ! @  !@ ,@襐!|@ T @岖 !L @"  @ @" !<S@ @@@" <S@" <S        &!P&!T@浐#8!<S#X@@J<S!P#h!T@D <W!@ȏ &!<<S@析#!P * @ !T&!t* @ &!x㿘H o*@f@H p@㿘!  %s: controller failed to initialize 㿘!  > d!`"!@!!@ !!H!h  , !2!4    d!  a! € !! ?€ !! !B \6 Z @ ;!6 \@ ,!<T"@縒 !`@㿘 <( )<('< 2=aH /* 'V*` ?4  ! 0@ 4"`440"0" @l ($@ ,&( ?6@#H C@H /* 'V*` ?4  ! 0@ 4"`440"0" @⾐l ($@,&( ?6@⪐#H 2 ; <a" <㿘%Ȕ H /*'+<(c@᷒ H p@ H /* '<(`2H 0   4$4$$@V   ,$$ d<( 0H /* '<al @u &@x @m &H 0 ( &6&(& &$&4&0 S( ` ??" $ $8 & !$6@H /*'c@2 H p@ H /* ' `5 H 0  2"""2@    l& @ 7 2 p t ,& t & p T  @Ⲓ \ @ !|!|@`"@  " `@ " @*``@ 0@"Ē  ,@&%s: device timeout 㿘<V b@䐐  P& P㿘! ` @㿘 0  &`8` &`$ 㿘 H /* & !2  !1c !  !"C 0m 0!5c0 !6_ 0b 0 6 0 `   B0?@)S0Q 2        6 6 %6  * * * * *  * @  2 0m 0 "6 0  @ q0@ ,@ﰒ ,`4 = @ H 0㿘>d;n &0vAkkQMaXPq< D֣ad°Ԡ x㿘0@0`0`0`0@.   &  ()<W? @`(@6``(@6`6`6`. @` (0@ 2  2 0 300?300@0`0`0`㿐!D'@ݐ㿐!D'@Ӓ@㿐!D' @cMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUT㿘 @  *@C @><6 ! `   ? . ` 2  (<6 *` *`  * `ː  @ ? `  *  `4 ` *&㿘  @C  @><6 ! ` Ҡ  ? 2.& 2  '<6 .   `*@ `}  @ ? `  * 2&4 &㿘  !" ? " "?    . -6 T6 R. ,&#&  * *@ * *@   *@ Ā`@㿘  *1! *@ *  * a %"㿘 ܀    Ȁ`@@ ܀  @| ܠ  @㿘 Ȁ`" ܟ@ ܐ  & # 2   ``* # &#@W Ā`@ncr5380_cmd_timeout: no scsipi_xfer %s: cmd timeout, targ=%d, lun=%d 㿘H /* %  <Y@ぐ h0  `<Y   @x   &  2   ܔ" * *`@"  ܀ @$H 0ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finish㿘  `2`d<Y@ᅐ!H /* % `   <Y  !@  D ܀  <Y@g!  +` ```+`+ $ `"4`#   #?# # ( # , # # #   $ 2$" ܀ @   <Y@1"H 0ncr5380_done: sense asked for sense %s: target %d, bad status=%d 㿘   @ ܀ `4  $`4`4 23&  "  % <Z!  # !$`4   <Y@←# $`4$ & &  " *`*  #"  $`4<Z  @p  $`4&  " **` <Y"  @_$ & ``$`@}~& ܁%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... 㿘 Ȩ ` @"      "  +     "@ - , `2 `&"    Ā`@0& ܐ@ `  p<Z!@  # & f&#- , ""&    &  `&#&#& &#&$``"  $42 $4<Z!@ؒ $4" &#& & &#&#&$  $ ܐ & 1&# ." !(&#"   `"   ؀& @ "   `" @   <0@ @#<Y @\ @= ܀`"Z"%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d 㿐 )<6 @!`<[t  @ Ȁ @2k   @ ` <[    *2 `$* ` <[!@ 0!8@     *  !`<[;  @  * *@ <6 a '  ? <[!`@ܒ U 2  <[ !x * @ /<[! @Œ > ܖ *, " 0<[ &  &   &   & 耊&#&#&#&$ *   $*@   `" @  !0* Ȕ@ 0#!@  ܔ  &  *@ο    &#&#@  *@ *   *@ ܔ & ܁㿘# `"  * *@ *H o*@ g   *  *  ΄  ? @ @ |  @   *@t  @ " *@ *H p@T * *@H 0` *@  *  *@N    *@H   @@'!??  @ @?  `  *@2  @ @ `  * *@ * *@   *@  ` *@ Ԁ    $*@ %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT 㿘   *@  # ` $;" ܐ ?& ܐ$&$  @<6 ! ` ѐ  ? 2 2   +<6 @ " #`2   ``*Ͳ # ܒ` &#&  ܀ =`$ #`2   ``*͚ # ܒ` &#'& ܢ`$` *@` &$$ `  (5 ``22 ``$ ` )` $`2  $ @ `  *a d  @ ? 2   *"y  `` ><]"̓*` €vww`wtwLwww4x0vO#` $ ``*2 #@@$ -= ` 6 %  1%  &  ,& $  <\#<\#@ϒ #`` ``* #` # ` &  ``* #`&#  *  a   @ ? 2   *$%s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP 㿘   *@    *#`2#$ $@{"## &##&## *  &#&#` S&$<^"*` €{ zz{,z{,{,{,z{,{,{,{,{,{,{,z{,{,{,{,{,{,{,{,{,{,{,{,{,{,{,z 2 <^   :     2  .$       .$  <^ @  .$ <^! $J&$ @M<6 ! `   ? = 2   28  !<6# 2 $   *@ $ &$  *@  *!   @ ? 2   * `4 # R`  *`"㿐   *@ /  #*`/////   $   $@` $ 4 # ` &  ``*ˠ #`&# %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding 㿘 ` @`<_<! *@<  j  ܀  <_`<6*` !@ \ 2   @<_! 耢4` `   =  @2  ; <_!@ % ܀ "   ؀&  @) *`2         @ " $ $ # ` $  ``* #`$# ncr5380_status: none? 㿐   *  < <_& @ܧ# ncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... 㿘   ܀ r @ <6<`@H ` % 4\` ` !'<`?  ܀ I 4r d ? 2   $<`"h,  €̐ܒ-)Y%!T<` @ #  &  ``*3 # &#<`@ `&#`"(    @ "  ܐ &  @  " #    ``* # &# ` <`!@ۺ #    ``* # &#`[`` <``& ! @۞ ``` 耢 `<` !H@ۍ &  % 0א`4<6 `a@ɼ  @ @" ? <`!h@o w * *@  * *@   *@`  &#&$& & & & &#&#en_k2szen_b2szen_sz2b%s: ATM midway v%d, board IDs %d.%d, %s%s%s, %ldKB on-board RAM sabre controller, SUNIUtopia (pipelined)%s: passed 64 byte DMA test %s: FAILED DMA TEST: burst=%d, alburst=%d %s: maximum DMA burst length = %d bytes%s (must align)%s: EN_NTX/EN_TXSZ too big %s: EN_NTX/EN_TXSZ/EN_RXSZ too big %s: %d %dKB receive buffers, %d %dKB transmit buffers allocated x  ,`'@' " c  "c:     ( ??` ! @' 䀢`@ "@    " @ *  @ <a0'2 <a"<a"(@<a"0<a"8#\` 2<a<a"@"(#`  2` #d@m'Y  U `@U"X `2 <a@W"P bX <a"p"XbU <a <a"<a"(  @9'  ! D # ! Lc<e<@<h! H! @! ,c", (  0`0 ` `x `| ?(3(*( ?@# <a@"0! a, a(!@     `` ` +     `(&@&%%$"@""#%#@$$@$ @`@ @`@ @ @@@`@@#2`*`#  c:` !<a@ٱ#0##! O      c/$#c4#H        ;?    `` `` 9 " -@%##@ $%$@?$@$ @%2 " g*`&@ @ & c  DDD`DD DD`D DD`D ֖D cb! '!3!a!a!0! ,)!"(5!$!b !"D! @+!b<;7!8!b4!b#! bL9/!!bH!!"-!!b %!1!!<a!#(  @ @@S%s: WARNING: WMAYBE DMA test failed %d time(s) 㽘-X`8.``?2` 8"  ?2 @˖  @@Ö @&  ?X . bU!. ' <a0<a0 @<a0  <a0         @!bUbVW. .    <a0 @ <a0        @ؐ!bU"T/."Y`&<6@Q  "X@@E  <c" @D<6!6<6"aX%s: unexpected timeout in tx DMA test %s: unexpected status in tx DMA test: 0x%x %s: unexpected timeout in rx DMA test %s: unexpected status in rx DMA test: 0x%x 㿘 'P` @ "  `@ "  " ` "  "  `/@`C`  "  $*`@ & , *`@ &     "  #  C*? 6*P"U<62`!X,  8 ` ` ` ` <a0 `@ <a0      @! Y`,`   "@  , @  " ` " ? 2( " # ,?  2 @3  +<dŦ ?2 ܒ @ab@2` ` #@& &  @ <d @C"(s"@Y ? ,`   "@  , @  " ` "   2`  " # $?  2 @+  '<dM ?2 ܒ @X8@2` a  #@& &  @ <d @""@P@@ 2-`@ 㿘 H /* & !@.  ! @"0/ 0!|@ '0!{@$   @- 20 ` @@<a &("8@@0 H 0en_rxctl: left over mbufs on enable㿘``* ` `@#|g, ?c 2ư  #  c/  @ # `D# *  *  c  2 # 5 5 0*@  .*@ c/ *@,2@ ` #4  ` <f #H `<f@{ #c* *@( & @j #, ?# ,* 9 #/ @ U H /* & ,  ܔ  # @ ` "   # c" c"@ @(+   "   *#4+@`  #H` @   * #/ `*  ,@#,4@5H 0 㿘 䀢`@ "  c?# @"A,*  c4- ` ` $""`?"`@S *  cH` ` $""`?"`@; * / ``*  * 5@`a, !  `,@`` $@%"``?$``@ @!@` ` $""`?"`"@ % @ @Ѣ`@㿘 \ 2 i \ 6 \ @`6 \@ "  @ #! @p( !&  $@!+  #2 & #@ a& ( @U( &  ,* "4  (& # ` &  !a$*  + )?'?%   @& `H D6(6(&(   #@ "  "@@ 2 #@ " `@   " bP * " 㿘.` ܠ0* "£ c.` @?#@  "   "@ +`  +    "  c  (@  " %s: output vpi=%d, vci=%d out of card range, dropping... 㿐 0 @@    &@&`$ `?&` ڦ ' #bY `<6!``  @` "@  @`?@ * 2  ' "@    *    * ? <h! @ג @ @@  @? ` /@ 0( * "`5/7`"  `'`" !` ` ? $ $   +?+` +`  +` ,*  -# #?`@`  @ " "    @" @ `, * @ @  `@ C% 3@"@ @$    2" " @  " "  @Ӑ@㿘b @ % "  $  @z$H /*'<(#@ђ H p@  H /* '<(`2H 0   6 & && 6 @ 0  "2H /* '<al @͛ & @  @͓ & H 0  (  & 6 & (& & $& 4& 0  2  @ mb   7% @  & &&@ Z&@ $ " ??@ 2 , , `$  "?" ?? %s: tx%d: packet larger than xmit buffer (%d > %d) en dequeueen dequeue dropp<6! `?.'ܶ 3a@ /'   *`@' * '쀊@/ '  '耤Q'"YbW  '耤  :'  3    "  $bX` "U "U"@ `$"U @Z@`$  ``2 2   '@ ''@ 0* , '@ے 0    '<j Ȓ @ٔ@#a b   & ܀ 2    $  a & & @a@  ! " "`$`?"`耢"<j@!"( x`&`@& x, c&  @ ,*  @@+ ''Ԁ`@ b0 'ؐ & @HДa @!,"@"@" `#@"`!,@@ ` "`"`a@@  @  "@ "$?"耢<j@Ϧ!@ %a @" "@%s: tx%d: bogus trasmit needs (%d) 㿈'H.`'+a$$a  4`   @'@ 0  '<kH"  @ $`@2 "  $ "  $`m+`H` (-`-?(-`@``   24쀈2쀋2쀌 2 ? " @ "  $6$@")@+bY $2`*  2`*   "@  & "@+` +`c& p& ?&@ 2+$"+``  ` @ ``( " 6  +@ ? @ + +bY `! $$@?  +2  @* ' `( @8(_   " ``&          $ $@?  +2  * @'+bY  + @8@@ @  "  +   "@  & "@+` +`c& p& ?& @2` " "X`d"W _]+bU" @ 2`   <6!X3`+   ;@   $ $@?  +2  * @'+bY  + @8@@ @  "  +   "@  & "@+` +`c& p& ?& @2` " +bUR"V8 + bT   $ $@?  +2  * @'+bY  + @8@@ @  "  +   "@  & "@+` +`c& p& ?& @2` "X Q<6!X3` ` ;@ $ $@?  +2  * @'+bY  + @8@@ @  "  +   "@  & "@+` +`c& p& ?& @2` " Vb $ &      $@?  +2  * @'+bY  + @8@@ @  "  +   "@  & "@+` +`c& p& ?& @2` "+@'삒 2`]9"Yb `?  &  $H`+ -`@ + `@ @ " ` `&  "   & &  ?& $ @ 4 ?" *?$??2 @  "  $`쀥@F+ ?H@-` 2`*`(" "Y$  2`*` -`@ ` "  2`*   # "@  `&  "     & 0&  ?  ?2`(&  " +a$"%s: unexpected interrupt=0x%b, resetting card T7T6T5T4 T3 T2 T1 T0 DMAOVRIDLERRDMAERRRXDMATXDMASERVSUNISTATenintr: dtqsync%s: lost mbuf in slot %d! enintr: drqsync㿐 ܐ ?   <n<n #@͑ "* !a$   D   ? ,"  ܗ,  -` @@ %@ %@#@    ,`P3` ! ܒ`,?  2&  8!(,` -<o &  3 +`!,$   " "` `?"`2@ @˅  "@$@ @ 82-` `& !@  , `  ,`;a  ܒ`$? 2 !c,?`&!, o?" 2   +`+` * ! #4@  @  "@  ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx" ?"2  <o 0 @̸ <o@ P * / @ *! ) @#4#,`5@  #H`2/( ܒ@  2' @ 2# ,@#4@ (2  #. @@ p @c& p @2 //// ,@F42! -`@ a &&  Z ܐ *`@  耢P #c!? #"4b8 ܒ @& & (@+`(@ " +  + ( @ "  #/&  2   &  `*(* 2(`*`2 #6(|6(( &( 2 ܀ !?@Nb  &   @! a#5  &  &  en_service rx slot/vci syncen_service: id mismatch %s: %s, dropping frame CRC errorinvalid AAL5 PDU length%s: got %d cells (%d bytes), AAL5 len is %d bytes (pdu=0x%x) `'( Q (*  *@ *  c, '#'*` '쀢 <p@#xc/  # c$#(  (` '@ '  ܐ c2` @ *`@(`*`2 #6(|6(*  #/ * (&(`@'"@?"@ #0*` *( 'Z' c.*  '''?  "<p@ɉ# b    & 7'䀠`  80'ܑ,*  @ +??@c @  '܀<p# <p#<p# @c<p# @ @?'ܮ$@̕* cH @  "'b<   & b@  &     " "`$`?"`'Ъ'H /*'7<(@V H p@` H /* '<(`2H 0  ` 4`$`4`$@$`@    , @@[  d$`$` $`'<(  5`БH /*'@  H p@` H /* '``6`H 0  `4`$`$@$`4`@m   l$` `(1` H /* '<al @Ԓ $`@א @̒ $`H 0` (` $`4`$`($` $`$$`4$`0` ($` ` @$` 'Y%@ ```  & "X` "W  U"@ @ $ U @@$ 2@` ^'@ bL ܐ '&  ܘa @ 1! &bD  L& "@* "cH$   2" " H̓*`@#H@ `"` "`  (& ܞ ?# @ 'ܖ쀠) a!) (`@? ''+?<6` a ` ?  "p#    %+ "Y  %2`*  2`đ*   "@  & "@a `#& p& ?&bY `" #%  ` `2 * '@ `, @;`đ,  "X`d"W ` bU" 4   <6!X0+   0  #%$  ` 2 * '@"Y + @;`@@ @  "  đ+    "@  & "@a `#& p& `? & @2` ` "` "UT"V< + bT  #%$  `2 * '@bY + @;`@@ @  "  đ+    "@  & "@ ! `c& p& `? & @2`  "` S<6!X4 +   <  #%  `2 * '@bY + @;`@@ @  "  đ+    "@  & "@ ! `c& p& `? & @2`  "`X@`܀`܀L (`% ? 2 a *  "@Y  %2`*` ) @  `2`*`(`@ `# "  `&  "   #@& & ?!   ?2` &  " +耠` 䀡    ""@$ $$ؔ4$@* @   2" "@ ؔ4@*   " `" @ c(*`" dumping device %s at level 0x%b SWSLDRQDTQRXTXMREGSSTATS en_stats: %d mfix (%d failed); %d/%d head/tail byte DMAs, %d flushes %d rx dma overflow interrupts %d times we ran out of TX space and stalled %d times we ran out of DTQs %d times we launched a packet %d times we launched without on-board header %d times we launched without on-board tail %d times we pulled the hw service list  %d times we pushed a vci on the sw service list %d times RX pulled an mbuf from Q that wasn't ours %d times RX pulled a good mbuf from Q %d times we ran out of mbufs *and* DRQs %d times we ran out of DRQs %d trasmit packets dropped due to mbsize %d cells trashed due to turned off rxvc %d cells trashed due to totally full buffer %d cells trashed due almost full buffer %d rx mbuf allocation failures mregs: resid = 0x%x interrupt status = 0x%b interrupt enable = 0x%b mcsr = 0x%b LCKDMAONTXONRXONW1MSW500USserv_write = [chip=%d] [us=%d] dma addr = 0x%x DRQ: chip[rd=0x%x,wr=0x%x], sc[chip=0x%x,us=0x%x] DTQ: chip[rd=0x%x,wr=0x%x], sc[chip=0x%x,us=0x%x] unusal txspeeds:  vci%d=0x%x rxvc slot mappings: %d->%dtx: tx%d: start/stop/cur=0x%x/0x%x/0x%x [%d] mbsize=%d, bfree=%d txhw: base_address=0x%lx, size=%d, read=%d, descstart=%d recv slots: rx%d: vci=%d: start/stop/cur=0x%x/0x%x/0x%x mode=0x%x, atm_flags=0x%x, oth_flags=0x%x RXHW: mode=0x%x, DST_RP=0x%x, WP_ST_CNT=0x%x dtq [need_dtqs=%d,dtq_free=%d]: 0x%x=[cnt=%d, chan=%d, end=%d, type=%d @ 0x%x] drq [need_drqs=%d,drq_free=%d]: swslist [size=%d]: 0x%x x<0' 'D@ X'H) @`"I <0D@C <0 <u<uH !@a`@ H<u0!`````''HH `@'}'<u@I"@ @ b @ <u@"@7@@<u@1"X @ <u@+"$@ <u@%"(@ <u@",@ <u@#0@ <u@#@4@ <u@ #p8@ <u@#<@ <u@#@@ <v@ D@ <v@ @H@ <v@ p@ <v@ @ <v@ @ <v@ݐ @ <v@א!0L<v@ @ѐ!` <v@ː!` <v@Ő!` <n#<v!@Ļ`  <nc<v!@ı` <v<v!@Ĩ`?` <v"@ĝ2` <v@Ė"8` $  ! @a*`*@ <v"P@ā@` ,@(@  @*`*@<v "@n@ <v@k"c@  '<v+<v)<v " "@] #$ @W@Ubc?@ # )<v, " #@F #, @@耥A<v@:#a! $!@ @@ @ @  ;<v9<v7<v531,@ # 3`@c #P@`ܛ,@@ `D @ H@ (  2 @h$ޡ, C<v@#5 @ ;   #,c $@ @ @ 9<v7<v/<w #(@#@@ .  @c/ @̠ D`ܙ+  @  @ @ @@  DئD쀠`5@ <w@ @î H  @ @ $?#c%<w`?2 *  h0 00#\   @Íp 80`@ 2`耡 6@ <w@ @w + a@ @ %!@?c#'<w`?  2 * 000#\  @Tp 80a@ 2`䀠` <0<wh@C hh'<v)<w`,  @8   $ <h" , @* <0 `@ ' invalid unit number: %d invalid addr/len number: %d, %d dumping %d words starting at offset 0x%x mem[0x%x] = 0x%x 㿘  <0  <y. @ <y@"x0'#@ .@ #@<y<y<y"@Ք0"@Д 1<y ܒ@Ɛ"` AM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d 㿘& 2&  @l &&& 2&  @c &&& <z& 2&<z@r X0i <z h@j 0a<6d* <z& @`&& @S  `.  . &*"@ *`"  *  , @B*  . . & .&@ &ǐ?   & `. h. E<& X& P6 l& \6 j. D D@m &Ș? ! €     €         %s: unknown revision code, assuming ESP100 㿘  @!<6!`!<z"@   .&`  !`" <z"@ے  .&`  !&Ȁ`+<z#Г*` €p@    &̐` &&      <z"@             &Ȁ    %s: resetting SCSI bus 㿘 @<{!@n <6`!<z"@f   .&`  [NCR_INIT(%d)] 㿘%<6` <{!@N& 2! Đ & & &  & &  & & Ġ Ȑ @Ĕ$ $ $  "@&  4% @ 0  .&  "4@#    "4@ 2 !&&&& %%%&Ѐ    : @? ` : `!`*&Ӕ++@` ` .&`!<z"@   .&`  0 .&@1regs[intr=%02x,stat=%02x,step=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x)] 㿐`  `",`"* % `#+<6a`  <{`#Ȓ@ .&``2 <0`!< @!@#@lb `  + &@t @ ,`"* &@x* &`&̀`   2 &Ȁ  &Ȁ  `"?`&̮  ` `  `   <6ሀ ON ??.``$`  &&&&`'&&   `    @ @  a`!<z"@   .&`  a`<z"@    .&`    @0<       a`!<z"@ C C .&`  C`$ ` @  `a`!<z"@̒ B B .&`  B㿘H /* % &`  &@ " &  & &`@ @J H 0especb㿘H /* %  ` #<}  `@Ȗ  ` ` "`$  " & H 0[ncr53c9x_scsi_cmd] [0x%x, %d]->%d 㿘 !<6!` `<}@S!X!` <} !p `"@I $  2$ H  b$  $ $ $  $ ,  @! $ $$ $ ($ ( ,$ ,, 0H /* % $$ "@$ @qH 0`2  @" " @ @  @ [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] 㿘!<6!` <}@#"" #<} @ @ $` "&  !` @Őc0@#贆2  [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)%d:%d busy 㿘#<6a` "&<~@ &`" <~@ '%<~   `"*" `#* %:@ `a`` "`&  "@& Đ0  @tH 2 requesting sense 㿘`` "* "*<6!`` <~@W!@.`, , , , ,  .` # *`, , `   < #&` &`$&`(&`,&`` $`` `  #`*@* 4` Ā@` &` j0@ &@ " & &  &`&`p[ncr53c9x_done(error:%x)] resid=%d sense=0x%02x error=%d 㿘`  "* "@*`e#<6a`  <~ 4@"<!@i 4`0, `` @  $ 4 $ 4`0 > 2`,`,$ 0j0<$ 0 a` $ `"`  0`" 4<~@" 4`2<~<~ <"ؐ"@`   #*@* 4 Ā@ &  & Ē .&0@  ڒ@X$` @` " `@ ` ? "` ` " @` %s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d with no nexus; sending ABORT %s: reselect: target %d, lun %d: should be busy ncr53c9x_sched_msgout %d 㿘fĐ  f* *@@ < ! @/`!<6@ `?`    "@ 2 # 22 <!` @ `!<6`"`$`" + "@ *`e@ ,f$`: 2 <! `@ *4  + ` f@ @Ւ . "* f@͑* & f̀`   2 fȀ `fȀ  ``"?`f̨  ``` `` `   !<6!` !<!@ !`!"`<z"@ ` ,f`   f f@  @!` !<!@z !`!<z"@s ` ,f`   f f@ ,f,f( $f,=$f!` !<!@W !`!"`<z"@O ` ,f`   f f@ !` !<!@: !`!<z"@3 ` ,f`   f f@ ,f,f [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available gotmsg(%x)cmdcomplete got %ld extra bytes msg reject (msgout=%x) noop disconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMb/s unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: reselect without IDENTIFY; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET 㿘-<6` <&@"p   2&<"@z 0 " &&& .&  `` <"@e&&* &`!<z"@X   .&`  <&"&@J 0q& " ` !<!@= `!<z"@6   .&`  &&@ .&.&&.&  &&& `  (,``2)`&`& ` `& `  @``!<z"@   .&`  0`"< @"&  <    "&*"@ *`e `y <#+` €  h   x xX `"<@#& 6   @d`&<#@ && ! & % , " 0 .&`"<&@#(&  @`& .&  `,&̀   `       ``"<@w#@``"<@o#H  $&`}.& !y% `"<@]#X&% (&n% ,`"<@R#p (&& ,c&&`"<@F#&  2 `"<  @9#&  ` ,&   `,,&Ѐ "    `| @c`<@#&` , ,H`d @  !@~-`*&*"  @@~ ,`$* &@~* 6$`,`$* &@~* , @cH`<#Ȓ@&2/  &Ѐ@6 &,   ,  ,` !<!@Œ @`!<z"@   .&`  &&@ @.&.& ,& .& `+ &@ @~ ,`"* &@~* &`&̀`   2 &Ȁ  &Ȁ  `"?`&̨  ` `  `   {`@b`< #`"<@Y  @b < @R` !<!@J `!" <z"@B   .&`  &&@I &  < H@` @& ` !<!@ `!" <z"@   .&`  &&@ ` !<!@ `!<z"@   .&`  &&@ .&.&`!<z"@   .&`  & .&&&[ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus 㿐)<6!` <&#@&& @& "=&!`!<z"@   .&`  Ր .&(&& !<!` !<&@!!`!<z"@   .&`  &&@&.& .&#Ȓ @m$&`2&& & @?*@.&.&&& ?.&<!+  €p0 Ě      `"&**&" *`&* %* &*` &* &`&&  , + &@ @| ,`"* &@|ۑ* &`&̀`   2 &Ȁ  &Ȁ  `"?`&̪  ` `  `   =&& <# @%  ` #& ,*& & .&*  ` "*" * %  ``,& *@&   &  *@& *@&  &.&*@&&&&&Ԁ 8   '&&   `    @ @  !`!<z"@J   .&`  !`" <z"@:   .&`    @[ncr53c9x_intr] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>ECB_NEXUS while in state %x backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=0x%2x %s: identify failed ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: STATUS_PHASE: msg %d %s: invalid state: %dMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting 㿈)<6!` <@"H @ 2    .   . @  . $`" @ 2! &&` <{ # @v  8  .& 8   !`!" <z"@a   .&`   & < @P"`5  Ā V <"x@ & 0@Y  @(   !`!" <z"@-   .&`  b &  2<  "44 @"-&&  .&* <&"& &@& €  !`!" <z"@   .&`  ) ϐ& ` .& € "C  @?2  <"@Ӓ {   @ 2  2* & "& &`2&& <& " #\   2 < #@  ,?#\@ A<#@ &` !<!@ !`!" <z"@   .&`  &&@  !<!@p !`!<z"@i   .&`  &&@ .&.& ` ` < #@P    !`!" <z"@A   .&`  v `!<z"@0 D  D.&`  D&?`V<"|*` €"3"#3 "`4&`"<@]o`<@ # "*&"@ *`e .& ` ,`&`2<#@  <@ Ґ<@ (<!@_{  "`4 $ " & &  $& &` <#*` €$L$L$*,,,$< @ @հ & <  p<@ & .&.&.& .& "  @\`<&@   & 2&`#<  <@ Ȑa@_ $ " & & $& Ĥ & `.&< T p     $ &Ȁ " &<    #\@W < .&` <!0@H ` "!<6&`.&!`!<z"@9   .&`  &! " &&Ȁ 2&& .&& 2 <!@@ ð 05 2< Ā2<@q!X  `"*"@ *` e <#* €''X)P( )`!<z"@   .&`   ` 2&<!p <! &Ӕ ,`,`&`.&` !<!@˒ @!`!<z"@Ē   .&`  &&@ @.&q.&!<6! " &   b    `#< `"!  #`#\@ `<z"@   .&`  ` !<!@ !`!<z"@x   .&`  &&@ .&^.&`!<z"@b   .&`  !<6! " & <  ! `" `# #\#`@F    $ `#!`*@  4`&&( &&, &&.& "0 @- `a" <z"@%   .&`  Z & f  `.&< " @         ??   ??2   ,0  ``@< 0"@ܔ < ! & $," 0 .&"@Ȓ `!" <z"@   .&`  &<" @ <2&<@ !X `  " @h @  <`!  < < @<@#ϐx&& @" <@}#  &&&!`!<z"@r   .&`  & .&`!" <z"@_   .&`  h&<&`  `< #8 @G & `.&S& #x @: K&!<6< #@1$   !`!" <z"@"   .&`  W ! I$ &&&&`'&&   `    @ @  `!<z"@   .&`  `" <z"@ے   .&`    @" $    @   $ ``!<z"@   .&`   && @!<&@#!`!<z"@   .&`  &&Ԁ 8  '`&& @(&&<@#&Ȁ 2&!`!<z"@v  .&`  &&Ԁ 8  '`&&  &&  ~$      @  `!<z"@@   .&`  ` <z`"  @,`   .&`     @6  @<@#&`.&!`!" <z"@   .&`  &&ߐ   .&L &@t 2* @ 2G  ncr53c9x_abort: not NEXUS 㿘` 'Д @&`&`  Ā@4& !!<!<6!` !<!@Ò !`!<z"@   .&`  &&@ .&.&!<!@[<0`@{ @t#@[g02 &`@X`<@#p> & DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)],  AGAIN sync negotiation disabled p  `"*"@ `*`e@X     @ < < &<#\ Đ #`#d& #h&#l&#p &#t &#x #| ,@# 0H(  @  <@!h 0!<@!p $41 Ā   & @X^<@!x `"  `*  $ H 0㿘   .   . @  . $`" @ 2! &&<6!``<{ # @  address %s, type %s 㿘  D$` <$` <$` <$` ?& D ܄Lal "<<$`|$`$`4`0,X@{   ,   @  ,   ! @s  !@!<@@ @֐@n`( @ %s: device timeout 㿘< aX@ڐ  P& P@~ i82586_cmd_wait: timo(%ssync): scb status: 0x%x a㿘 %n ,!D ` 0`"  @ !(@*  " c  $ ,!<`!<!<!!(* @ 2 㿘! " !D 2L &!!D.` !,2 , ` 0  `"  @ !@  &!, g!%# !h , ` 0  `"  @ !(@* 2 2  `!g@$ , v%s: rx error (frame# %d): %s COMPLTBUSYOK CRC ALGN RNR OVRSHORTNOEOF!<< (: Hx@   @  %s: i82586_intr: %d spurious interrupts %s: cna; status=0x%x 㿘!€  , !D` 0  `"  @ !(@<  <$@`Ә .@耠@ ,'\ `    @  @  @   @      @  $@   @ $@ ?% H /*'3<(c@c H p@ H /* '<(`2H 0   4$4$$@   d$$s<( 0 H /* '<al @" $`@% @ $`H 0` (` $`4`$`($` $`$$`4$`0` j( 8$ 6$` H /*'c@ H p@ H /* ' `5 H 0  2"""2@P  0 l$@ Т $!` "@".X`  @%@ @p" ݪ @͐ fTd2  *%  !<#`@8`@Β\  l't'p'h@3h\@ᢐ  @ %%s: xmit buffer %d iexmit: CU not active %s: iexmit: start xmit command timed out i82586_start: no header mbuf%s: fill buffer %d %s: tbuf overflow 㿘 0 d@ @9a 2 2da a & & $ ?& # /?<@ǐ  ( "a@͒a <a @U`%- < @M`- @* "* "a* @  a$    @*@  - *a,2a, @*"*"a* a0   " $aH /* & a``a @a< 0`@a,a|,@*a,`2a|a,@ a[,az, a|@*a,`2a|@a,`axa,@ azax@*a,`22 ?"* ax, a,@ a~ax@*a,`2`, `0`aD  `"  @ a(@"2= <@ H@u6 a|@a,`a|(@a,`a~aD`*a,2`, ``0  `"  @ !  Y  < `@Z` a4`r`$aH 0`2  0$6 0㿘!<` 0* , ` 0  `"  @ !@ 0 *@ , ` 0  `"  @ !€ !@U d ,  0`!@  `"  @  0 , @`?` `"   @ !(@!D* 2 <    %s: reset %s: abort commands timed out 㿘H /* &` <#`@ʒ  t6 r {6 t$@   <#p@ `!€  d , ` 0  `"   @ !(@!D* 2 <     t`  @  `H 0㿘!, ?@ .`!,6`!,?!D.!,`6%s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x 㿘 `!, !  23@!( 2!(3@€* 2  , ` 0  `"   @ !(@!D* 2 <     @ %@@<!p@<!@ 0@<! g@<!ؒ g<" @ie: bogus buffer calc %s: %d frames %d bufs %s: reserved %d bytes 㿘!H#< ?&!x &!| &!&!!H ?!L$ " @i &!l<@#Й* + &!P+   * &!T+ &!X  <# &!p@!l @67!p)??@ `,`!P, !,@ !P@!,`#,!R*!P @*!,`2!P` 0!,!l@ѐ?!p @69 ?@ `,`!T, !,@ ,!V*!T @*!,`2!T,`!X@!0`!T` !!!,!p@͐?  !x!,@ !x@!,` !z!x@*!,`2`` !p<!l!H&!h$ &!` &!&!&!&!\@&!d%s: configure command timed out; status %x %s: configure command failed; status %x 㿘K `0 *`0 @*``0 @*`0 .@*` `0* `0 `@*` `0* `0 @*` `0.@ *`0* `0@*``0 * `, ``0  `"  @ ! ~ a(€*  2 <#`2`,<#@q`  ``0  `"   @ a(aD@ * 2 <   M %s: individual address command timed out; status %x %s: individual address command failed; status %x 㿘`D   ```a$@  !  a(€*  2 <!2`,<!@ `  ``0  `"   @ a(aD@ * 2 <    %s: multicast setup command timed out; status %x %s: multicast setup command failed; status %x 㿘a O  Ka+  a$*a@`a+  **a,2`!  a(€*  2 <#@2`,<#x@`  ``0  `"   @ a(aD@ * 2 <   w 㿘!H D!&! :  : 2 ,+  ` 0  `"   @ !(@!D* 2 <   @ !`"`0@`0`@ {@4`0 %s: CU/RU stop command timed out %s: CU/RU command timed out %s: RU command timed out 㿘!d!\*` +`!V* !P + @ *!,`2!\+  !R* !D*!,`2!*#0   <" @ !2 " * !z+  !D*!,`2!  Θ < "H   Ę <"h@Œ %s: iestop: disable commands timed out 㿘#0   <#@ 㿘 H /* & !2  !1r !  !"E 0| 0!5r0 !6n 0q 0 6 0 `   B0*@0` 2        6 6 6  * * * * *  * А0:@ #$! 0 @ @ 2 0 0 6 0` `@ `x 0` $!$!@ D@` D`4 @ @R H 0㿘  &! "!% !  `  @h    t D6 tB 0622!!@ !@ml 6 6@l &!&!  4 !*  * * * * *! &!22! &!㿘!4` @㿘!8€RBD at %08x: status %04x, next %04x, buffer %lx length/EOL %04x 㿘.`!T, )<!( €!T* @!(4`€!T* @!(4`€`* 3`@h 㿘! @!< 0 @\!,!|,@*!,`2!|!,@ ![,!z, !|@*!,`2!|@!,`!x!,@ !z!x@*!,`22 ?"* !x, !,@ !~!x@*!,`2 ,  0`!D  `"  @ !(@"2> <@ HՐ7 !|?@!,`!|(@!,`!~!D`*!,2 , ` 0  `"  @ !    < `@  6 r  *@  *@ *` @  *  @ * `* 㿘` @. T. T 8 T㿘# c 4€ 2  8 ? 4 4 8  a 4€ "  T ? 4 4 T 8   4  c `   dc ?  T 8   4  c T 8   4  f ? 4 T: %sh<6! %a T,` `  8  8   8 T  4  "`? 4 8``$ T ` 4 T 8   8  <6ᘢ ,` "` T `  8  8   8 T  4  ? 4 8``ޑ,`@<6cDcD''' ''''''''' @N <6b@( @<6 @ @ ` @@ @  . Z@ @ < \@u"p㿘)<6.`"@ T   8  4  `2 @ `S  T 8   80  T  8   8 $" V `"`2@ `S  T @  8  8   T   8  8  " 1  T  8  4    T  8  8 0 V ` T   8  8  㿘.`* @!<6* A.`"@ @i" @b͒ @ T   8  4  `  *     T 8   8  % @i" @b  T  8 @  4     T @   8@  8   *` @* A * L*@ M *`㿘@, L` , M@@bg  8 T  4   8@ T  8 `@bM  T 8  4  T  8@  8 㿘 ` `   `   `   `   `   㿘N@ 6 8 . U 8 T  4   8  T  8. U T  4   8 T  8 ߟ  J U *@*`*@*`  6      Invalid kind 㿐  U  `N < <*` €P0 B@ <6*"  `6  + VJ  @ %& !   ђ0   @Ր& <@e#؁㿐  ^  `W <!*` €8t K`I <6.`"  `?K5 1`V   *@&  "f Z  @&<@#؁mulawalawslinear_leulinearslinear_beslinearulinear_leulinear_beadpcm t<(@dD< # e< #  _+ <   #  # 3  # + R# <0 # 0 G# <8 8#  # 3  # + # ``?6# <H H#   # # # )# <P # P<` # ` #  3  # + # # `<  p # p 3 # # #  㿘 ` ``" 4` ". +<"%  #`  `<#  <"  2` <<<ct#8 "Ԓ `<"*` €     "        ? 8 @E 2 &' ,m  $h ,n$d㿘`` `  2 `  24 `21  @ 8 T  4  ? 8@ T  8  T 8  4  T ? 8@  8 & P  P 㿘 T 8   4  T  8    8  㿘 T 8   4  T  8   8  ad1848_commit: Auto calibration timed out 㿘 n uH /* %     m l* h `   T 8  8  `*a 4€  4 a 4€ ? 4 4 T 8  8  4  4€ a" 4€  4? € 2<@!p[ g H . n 㿘 T 8   4  T  8   8  `  8   8   8  ad1848: Can't find speed??? 㿘!<6@"|"|? `p8   |*@@   ( @"@ #  "|<@y 0 "|*  . n. l &@ 㿘 T 8   4  T  8   8   㿘 T 8   4  T  8   8   㿘 T` 8@   4 㿘 T` 8@   8 %s: unknown channel %s: dma map create failed : rev 0esc11+2unknown (0x%x) 㿐 @ "<  <"<"<<!b& h & d!l& h<"@& d@ޒ <a L 0& `#\@     <<"@ʒ 0:@ǐ" 4<@ @ & 8 `<@"<!<$@<(@"<<@"<@"<<@"<@" <@"< 8@"<@"%s: line %d: CSR = 0x%lx /work/tmp/mrg/src/sys/dev/ic/lsi64854.cR_PEND㿘 4$ 耊d ! ?    4$2?  <<` @Y <@V! 4 < " 4@"@  4@ "@  4  8 @ @ (@ <` *`   <`  "& H%s: cannot allocate DVMA address㿘 4$耊d ! ?  <  4$2?  << `@!<@O! < "& X& \@?@*@"@ 8 & T' T#  X@ 0& P`  @ L  " 0<"@)  `  L P  T @ L 4 "` 8@2 4 X<0@ T$  ?!<0 @\ @c  4"  4@" >! "@ %s: error: csr=%s bINTbERRfDRAININGbIENbSLVERRbRSTbWRITEb ENDMAb ENCNTbTCDSBL_CSR_DRNbDSBL_SCSI_DRNfBURSTbTWOCYCLEbFASTERbTCIDISbENNXTbDMAONbALOADEDbNALOADEDdmaintr: DMA wasn't activeDRAININGX`4B`D!<<  @И @`@? ``4"?`H <@!x$"`8耊d ! ?  d `4$2? 2 `8<< `@!d<@w! 2` `@"`4 " 耊`  ! ?  9 `4 2? 2 << `@!d<@L!"$`H`T Z 2    ঀ 2,`T   ࡠ * `@   *  2 `T`T@@2`T ࡀ @" `T, `L` $`\`0 ` `P  @`L`0 €`\ ""`X@"bINTbERRfDRAININGbIENbSLVERRbRSTbWRITEb DRAINb DSBL_WR_DRNb DSBL_RD_DRNbILACCbDSBL_BUF_WRbDSBL_WR_INVALbLOOPTESTbTPX 4`B!<< ؐ @ @ @O }`` 4" `@<6 " <6"`d"  4` " lu  ? l@ p㿘 4$耊d ! ?  [  4$2?  << `@ !<@n! < "& X& \@?@*@"@ 8 & T' T&  X@ 0& P`  @ L  " 0<"@H  `  L P  T @ L 4 "` 4 T" 4@ "@ bINTbERRfDRAININGbIENbSLVERRbRSTbWRITEb ENDMAb ENCNTbTCDIAGbTCIDISbENNXTbDMAONbALOADEDbNALOADEDX 4 `B!<< Ȑ @' @ @ }`` 4"~  H O `$" 8耊d ! ?    4$2? 2  8<< `@o"E<@А! 2` `@" 4 耊`  ! ?    4 2?  << `@D"E<@! }"& H T , \" " X@ " L` $ l 0 ` a P T  @ L 0 € l@ p@   @*@`  @*@`  ` @**@`   ` @ **@`   ` @*@*` @ * @*@*`  @(`cdlinemicheadphonesspeaker`?: full duplex : half duplex audio: could not allocate play buffer audio: could not allocate record buffer recordmonitorsourceoutputmaster`\@ < X< h@p`&`4&`0&`, @T@ <&`0@b x0`\ @G@  @j<&`0@R 0<6DD&` &`  &` ?&` ?&` +<&`D)<&` &a &a &a &a  .`@&a@ @@@P&a$&a,.a0&a4&ah&ap.at&ax&a'  @[x`Ѐ "  Ȑ@[n ؀ "Ȑ 'H€Ȁ <6<6#c$'Ȱ/<-<+<)<"!< #\a$@8#\ah`@0 䀠 Ȑ@[= ؀ &aȐ 'H€ h '@[(  Ȑ ' 0H , ̰?㿘\@[  &`@[ } > &@`5 ( 6+```$, @Z 2(`@ * %`*$ ``4*" &``  &`( ``@ Ф =.` ;&@`5 ( 6+```$, @Z 2(`@ * %`*$ q``4*" &``  &`( ``@ Ф㿈<''T'@X 㿘 , 0" T L`  @ &`  @^ݔ &` `  &@ 㿘 0 P  ,` &` ` @_r &` 㿘    0    @@ |㿘    0   0 @ @  㿘  0  0@M 㿘  0  0@ 㿘 ``` 0 `  @@ S㿘  0 @ 㿘 ?0?@?㿘  $ @]l` @]e   ?& & @]&  . ;& & & & (& 0. 8. 9. :㿘 0ؐ \  9   h l ," Đ &  "  9 "     ,"  `` ("`8"``""``"`|``  "`audio?2 <0 !` p !*@`j`0f c `8 _ €`, X`$`L$`T$`X,`$`,`,`$a$a$a  `8  ,`8` `8  ,`8p<6DD$`$a$a $a$a $aD$`$`$` $`$`$` @X `'a'a'a'`'p`'|`'t`''x$``@ $` " @`,$a ,`8,`9㿘H /* % 0 4  ! " , 9  ,€ H 0㿘H /* %   0&!`4 ,€ H 0aud_dr㿘M Ӏ   4 T 2*`0`` `@V$`" @` :` H /* %` @$`$`@H p@ *`0H /* %3</<0 X-<   b*`" * % X@u! % X`0 " H 0㿘<0 !. @ 0H /* %`  " !  0 ,@". @ ,.  `&  ဢ " N Ѐ 2 0t 2  0 `" 0@ , 0`,€ ,.  @ ,`` 8 9 `. 8. 9" &!  8 9 `. 8. 9&! & LH 0 aud_hraud_rd㿘<0! . @\L; ۰  l 9 i` H /* %"@  #</aЀT<# $T ! @uV )$T"@ 쀎H 0`*@6$`  0H 0 #H 00H 00{H 0t #H 00l` i g H /* %  !< @ р֔!؀T<# $T! @t $T $ ,9H 0 %@ "&`* ,@o@@ %@ H /* % $$,9H 0`` 㿘H /* %   T  T@u & T 0`0€ ,.  ဢ  X  X@u & X 0`,€ ,. H 0㿘 Ԁ  0`    \<6@@[@Zh#@[` @[``@Z2 ` € ,$ ` ?) <(@HPP  U`       ` *@`0`*@`4*@ x `  @ 8  8x@nD&@`  aud_wr㿘<0! . @ L;  ` !  %!!  9   ` B>`&`Ұ *!`% 8 `<` B#&`>`!"%!` 0H 0 #H 00 H /* %$ !< ` X<# % X ! @s{ % X$퀎 ,9H 0 $ "@  "@S@S@&`*@m ` $@  , @Y@ : H /* %%  L:$`$ @Rې$ %@ @RԐ  @Sx" ,:,9 ဢ  L8 @`H 0 "` `  _㿘<0! . @! 0@ .0!@"`  "~@ 0 "}@"K  !@" !@0"!@İ 0!@< 0!"@"`\!@"!  !@"d  !@"` ڰ !!@y  ! @UͰ !@"!@ 0À "$ L L "$ L   H o*@ e + " 9H 00  ဢ  ` @:  9   @ H 00~&|&H /* %  &   `@X8" & h  p$ "@ &H 00^H /* %    "   @@ :  &   @X" & $ &H 00: x8&@3@. )``%@ ,!`8€ ,&`\@ ,  `<  ,€ " $! 02 0@ ,&㿘<0 !. @ H /* %`A 9 "  x !@8  ` |@$` ` 9 2  @   @J D`@E  @@ :  $  $@ ($  ܀  ؐ@ @  #@@@  @  ( `@ " @* & & & ܐ   ` 2 9 $< , ,@ " 9 9 "! L 8 2!    4!  X  X@q & X@ < L "! @g  !  T  @q T& T@ D L @f 㿘 8 \ [ 0    #  #  (K ;`# (d H( < ,㬟@0? K 8` #  4" @# 4 $ &dK 9 2 d 0" @# 0# # d 2 T( < ,㬟@ " T% T  T@q  & T@ D L @f ` `  "`   `<  "`   "`   "` !<؇(@@((((@@HHHHHH``"`  `   㿘  &`&`.` .`  0@ , 2  :  &`.`  0@€ , 㿀    @U &  :  @@Uؐ" & : @2` `2'c W *' 0 ' D€ , O` F `$`4. 耢@2@ ?' Ѐ 01 .-  0 ' D€ , ' `耦 `$`4. "` ? 'o " `. "` @b㿘 &` 0`D ,€  ` &` &&` 0D , ` && p@ '؀'`?x ?Җq` .' 0 ' D€ , c`   ['`$`4,  耢@2 @ ?'؀ G؀ , A 0 ' D€ , 7`  '''܀@ " , `$ 耊 " `4 '|Ѐ ܢ`Ж `?ؠ  , ` @Mے'ܐ @M֒'؀  &.*`*@M&.&@MÒ  @"@.㿀  2O K  '" 0A  '䀢 7  *@% *-    '䀢 '  $* @   '耢 * 耢 2  0  $ 0' 0@ , @Q㿀@"7 ` '    0' D€ , ( ` `! ``$*@ @"  *0 ``$*@ @  *H`0`8 ^ ` ` '` '`'`'`'`'a'a'a'a 'a@'' `? `' `8?"` 'Ȥ ` ?"` '` ?"`'̤`?"`'`?"`'Ф`?"`'`?'ԤhȰ  aఒ    i  ''ܠ   ]  '' `? 2`P`   ,`9 ,`9 `9` a  `,`9\\@`, 2 `9  ?''' '2 `9?'''' `9 `,@Ȱ Ȁ  ''' ' ''''$`$a$a$a$a $a$`$`$`$`$`$````" `  ` ͐`aah Y ` `Ra$ J `?ah` 9`?a$` (`3 ah`3  `3 a${ `3ѐ `p?"`0a `0`s '''/@€`, `0 ` "$ `0,``0 2 `0 `ဢ 2 `0 `9 " `0H /* % H p@  `0 ` "$`t,` `0 2`t ` 2`t `9 "`tH /* % yH p@ `t?   `t   2 /  ,`€`,$`$``,``?" `9  ( `9 "` @`, m "@`xH /* % ) )`@``" `9H `9   `ဢ  5  `9    ` H 0 .`x? ` ` ( @QӐ $``|  `?`@QƐ $``x?2``|?  ```" 4$` 㿀0 `8w $&@&`8&`$&`$&` C$ h$>&`4$x&``HB`k`=`3 0 '''D€, 2&`p&`p&`p &`x$" &`("@ $(&`,$, .`0 ,0Ȁ @ .`1 @ ,1,2.`2 82  .`6 8 `,6 .`7 ,7&` \$ &`t@JK&`x@JG&`| 9&`<0a 6 a(20   㿘 P  P`2 @ &@Q 0 2㿘 P   @a:  2 㿘<0 !. ֒ 㿘<0! . @0!@1 0 0 "}@0!@  06!@ !@ 0-   @PÔ  P" "$ P `8`H`D€ ,`@€ ,  `` @ , midioplmpuaudioprint: unknown type %d%s at %s㿘`#`<``<0 ` <0 < #  < < @ (< H@ WARNING: no memory for concatenated disks ccd%dccdlk㿘 3. @*` @PL )<ڀ  %#<<@` #< "@P 0<6"cp@Kݒ  -< +<#< (@ $ 8!\ a( @L ခ` `*` 'H*  @P `  $` $` @ o 'L;<=p 'H3<=`" @K$H- @ $ne  j  @O  $ @La'pL't$'|'a H*` €p Lܖa$  @`h'P'd'T%H% %'ha H*` €P 3 (*``@Ny& +`:$ $ ` ` $` ``  &!: @6@ @P= `@P: ;  @P5 `@P2 03 @P. `@P+ , @ *` *  $ `  * `* @ *$  @Og$`@" ('' ' `@N(' @ `$@㿘  *@OH & @J  "   @     @O2 $ $$$  "@`` @ @ g$    =@H)%%  +`  *      @ +`# *` *  *  *   ,`: "  ` +` *    $ @N$@ @NI   * @Nٔ % *`  *   @(   "  @:    *  2 $㿘? @2 ` <6#p:@ F <ڑ,`c<* !\ @Ks 8,`$   * D `@` "  @6 ,` ` " <  @ @$ @$ < @ < $ D @K: 㿘?2  <6#p: <. . #<@*` !\ @K ".  $@"  <  < @ * *@$ @ * *@$ < < @  $ D@J  㿘 8? @2 `  : <ړ*#<@ *` `  $ (& (& $0% 0 "*#`  ``@ߦ  0& 4H /*%@H  $(@;㿈 0@v `8? @2 `  : * "@``H *`@`@ ''`0 0`<@M 2"  '' @}K2`$ (&`$&`(@v  0-"'0$ : @ Ԥ !<> ''$@2#XP`d "`d#X''P#X H*` €2㿘`  `  @       6& @G@Fj`` 4 2$@  @@F * @@FH@M5,`*@ `@{ / `$< @c,& $& L` @&  & H& 8& <& P` " "  : 2`*  *` ?  2 @ 8& 0  & 0& x& |& 㿘`$("`0`0&`4`0 0`4@uI" @8%s: error %d on component %d ccdiodone: count㿘 x |H /* % $( `$($`$ (" $`(< "@ג( 0@|O`4"$`4<@/#H 0㿘?2   <6#p: * <<* ` << ! ( @N 㿘?2   <6#p: * <<* ` << ! ( @N  ccdpl㿈? @ `2 <6#p:   <c<- # E* `g@  E f@  m@  "@ !\ 0"@!\!\z  @H s `h@""E r@"E e  m@`h@ "@"  `g@  E f@ `h`hF `h@"?E r@8E e@" 4   m@""- `g@  E f@ "@? 0"@    `   $  $  $@K*  * @K je* <! .` @9 " @+.`  @ @`@.``@i  @.`  @ @`@.`@L @L @L @L &  0@s=& #h< a #\#`#d  @y @ @2  : * "@ *@ D 2  < "  @ "   @6     `@@   @KԴ @ &      @Kǒ  `  @K  @K  @yQ$@s& 0N@H !I @2   &: * " *  @9&@$  @$ 2@2#? @ @ 2` @ : *  * @  < a@G  ?$   $ $@Ò @G 㿘?2    <6#p: 68?<ڑ*c< * `*# `D*@  `<a   ,`?,` ` ? ( @J2` 2 <a   ?  @'''''ܐ @ ^T 4 <>'8'<'@ H*` 8`@@ H `<=@H' '(','$'0 H*`  <>' '$'( H*`  `@@ 0#H <>' '$'( H*`  & ' '$'( H*`  `@@n  ccdfictitious㿘  @E! &`< &`( &`, &`0 @I&`4&`8<b`@D  <6`b`@D . 6`J6`H&`X&`  aW &`6`&`.`&@@p 6`WARNING: %s: total sector size in disklabel (%d) != the size of ccd (%lu) WARNING: %s: end of partition `%c' exceeds the size of ccd (%lu) 㿘)?2   : <ڑ, <* @ @E4" ? , `*`  `<@^a쀢 "<@'0 <#h@}( )<@ #(@}y a `  default label㿘  , <a0 @DO @p^4 WARNING: no memory for vnode disks 㿘 . @*`@*`"@*` @I-  <@}B!x0@Dǒ <<6"|"#x㿘? 2  <6#x:@ E ,`@*`@*`<!|"@*` @ 6,`$   *@ `@`  "  @6 ,` ` " "  $ $    $ @㿘?2  <6#x: . - @*`@*`<!|"@*` @ ".  $@"      * *@$  * *@$    @ @$ ` 8)? @2 ` : , * * <"a|* 2 0 $   =@G6`( ,  $ (& (& $00H /* %  %`@w ` $  @  0& 4`( H@G4  8 2` @  : * "@`*`@` @H5  $D@`H'  `B@'Ԑ@A a ''''''a  H* @ <>''' H*@  ؀?"  t@A 5<&@Ԓ@Gϐ &H /* % @v H p@$ 0$ $ؓ<  , $ ,$ H$ ($ < $ $ L$ P$ \$ ` X 2 0$ T$ X T""@$ T 0 X"" 8$ X h 2 0$ d$ h d""@$ d 0 h"" 8$ h H$ x$ 4H /* %`` `@%`@n2@2H p@TH /* % ` ` ?`%` `` $& ((& $@v֒@܏H 00@܆㿐  ,  H  $& #<> 0  & 0& H@o[  $@2cX P`d "`dcX'' PcX H*` € H & 0  ?& 㿘 x?`8 2` @:`* *  * <" a|* H o*@ e 0  4`4"@ " @o>$`4 $  ( 2$  P @n@vd "`4`$($`$ $`( 2H  2 H 2H@vJ@H|$HH p@㿘?2   <6#x: * *  <* |" * @` <<  P ( @H 㿘?2   <6#x: * *  <* |" * @` <<  P ( @H  vnd%dvndxplvndbpl?  2  : @N[!: <6#x 6° ,* <a|* " E* g@  E f@  m@  "@   `h0"@   `h@""`E r@"`E e  m@`h@ "@" ` g@  E f@ `h``hr `h@"?E r@cE e@  0`  m@M 0Zg@  E f@ "@ΰ 0M0"@I ` E @ @H'H @'l'p'L't @  }<= X'0'4$?'<'@ H*` 0 X<>'0'4'8 H*` 0 W<>'0'4'8 H*` 0X$` * 2`  2 $` ( $a $a$a$a    X. @Ed @Eba a@E_2` `   X '"@ḛ 2  $a$a$a* $a $` @    X@ @L0` @``* &`   $`<a(@y<`$`@l` <ša0#\#`#d#ha   @r <#ha8#\#`#daԒ   @r @0'@ ~? 2  : * "@ *@`  `  ` @e @@s&a@s$a@l`@Y `@Aܔ!S 2 ` &: * "`*  @C&@ ?`$`` @` 2`@2`#?  2` @ : *  * @  <``P@`` @$` " 0 ` $` $`@  X@M$`" T@Dt `*` 'Ж"` Д   ''`'''?@ V'` <=l''`$?'l' H*`  2 ` <!  `  `@ ` <>''' H*` @D T<`H܀  "   " 㿘%<6x#<*` *  * a|" *   x@x"* @*`@*`"@a|*` * vndioctl: null vp㿘 < ?a & <@vj"  @ Q @L* & & & 㿘?2    <6#x: 6<?* *  <* a|" *  `*#@  *@   <a   ,`?,` ` ? ( @C2` 2 <a   ? vndfictitious㿘! @?-!! @B2` &`<!&`( &`, &`0 @C&`4&`8<Œ`8`@>{  <6``@`@>t . 6`J6`H&`X`"`< &`*  aW6`&`&@@js6`%s: %s default label㿘+?2   : ,`* * <a|"*  "@>ސ ? ,``*`  `<`P@ <Ő!(@w;     @ * <#@ # *@`<Œa0 @> @j4 vndlck㿘  !<Œ`& !"x@\S "   &  㿘  `&  & @]`` ` ` ` (#` \8 @ "8 "" P '@<=`' '  ` '  `?``''''''` H*` € 3  D 8`@? & @ m  @4  944<>''' H*` @  &Ā" @ G @ Ā  <>  <>''' H*`  `@Ӱ @Ā  <>''' H*` @    P'` `'N@ =`?''` `( `\  $`,'$`, :!<>!'?'''!H*@ ఒ |<cp`  '"``\'`,Ȁ'2܀  @ԍ`, :<>''<>?''H* @ఒ N <  `,*s vs `  `! k7P > `2` ``?@VN@ . 7 M`! @wM`! t<`,@`!  ` @=`H* `,&'21`,#`, ` `0@)H* $`0@o`2  @= ]̮ `,$`,`,Ȁb,`,$`0Ѐ "J:@8@܀ !<>@Д!':`?'''!H*@ ఒ `<%$`,`($`,'Ȅ %'̀ "`@ӻ`@@w  @$`0̀ <cp` "` `,$`(-<>'''H*` `0@ D@ @ ԰@{܀ @ `0IĀ9 6@   2@c0:`0`  @^4`44$  D@ @ |԰@N܀ !Ā<> 2<>'''H*`  `@@ 㿐` `@94 ?@Ѧ "`@`"@ ` < @#` "@cd9660nopl㿈<0a4<ږ⤒ 9@Tt <##(<:<:a4\<ژ :<<"@#`#d#h a#\   @m 㿘6` '<%<⤒ @(*` " @ @2 2  `@뒐 0 2  㿘 < 2 ⤒@ <#( @ *`  " && "  4 @<     cd9660_inactive: pushing active㿈 << c8   V 4 "$ <Ȑ#`@k$ <>''' H*`  |`@֒  cd9660_reclaim: pushing active㿘 <<c8   V 4 <ɐ @?@ " @t$  <@o &  x  '  6`| 6``@   <>`.  :`!'?'''!`H*@ ܀< < 26  @`|!6`| @2 `| @6`|   `| 6`|   `| 6`|   @`| 6`|  @2 `| 6`|  * @&`  * &` `|&`!m6`|&`܀ @x'܀  `@  <>`*  :`!'?'''!`H*@ ܀' < 2! `d =@  @  @`t  `d`h&`t&`x @|`l  `t`x&`l&`p  ܐ @`t`t`x&`l&`p&`d&`h܀ @r㿘 l g    &`&@@ ē*@ *`"@ *`"@  @7 @* @,`:`& ?@7 d * @,`, * * ":`$@@7 ?, * * "@*`@*`" * 0d,"* * "@&@&`   (( І㿐 ?/  /  /  / ޒ / ڒ  //   (  *  * `(㿘   . @0| .  (@.&`  . ``(@.&  .@6`&` RRIP without PX field? 㿘<@q#@` ..RRIP with incorrect flags?㿘  `(@`$l`0` <`,@6  /,` H ` H <ʐ#*` €,,,t,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,`,# `,  $`, `$  `@8ڐ`,<< |b `,   `,<@q~#P`,@@ @:d   `(&`$2@&`0   0`( &`0&` `$" &`$2`  ?&`RRIP with incorrect NM flags? 㿘N <ʢ#H` 7 <ː!*` €...x..............................  << | b   ?<@q!`,``(@2*``,2`@   ``( &``$""@&`$2`$@9`$&`$ `  ?&`㿘< H`$H* * *N !    !  ``( @`$0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  '  2 @`l @" p" l  @Ԓ`d @ l p" d" h  ,@ƒ`t-` 2  @`l @" p" l  @ `d @ l p" d" h  @`t`@ l p" t" x` ?&` 㿘@3 㿘   ( ``. `.` (. ( 5?3c6 .  5?6 3c. . @&`` ` 㿘 `? @`@&`!W㿘 . ((&`` / ``..> >`  .  (.&`$IEEE_1282IEEE_P1282RRIP_1991A㿘  2,   `  2% ` 2  <̒c @7e 2   2` <̒c@7X  <̐c@7Q  `" =&`㿐 `!`'`L! 2`  *` * + `  H "X`!T@ @    @ 2&`?#   "`LJ@2L J@ ` "  (` @: ` ,`) ``! :` B8 2  + ?@W ` <`   @ͽ 2 €  2 ` '<6''ܔX`6 !  x<6'7'''IJ 'IJ` 'Đ<`$  7<7'6'''Ĕp'* SP`<΢  "&aX@6a     1&aX@6X  2?"'<7'ܐ"?  F,T J ;( J ;F ?  Є 5+  (В   ( (Ж)# `  @   $ .;   ? ;?  `+  =* %`   (8@Z *  (8. ; 2*(8;*`@ & 2cd9660cd9660_mountroot: can't setup rootvproot_device<!<@ < <b!<@䳒!Ȁ <@lH"<<ΐ"ؒc@ǔ| )!'|@  | @@"@|@:] 0|<<#D""#D@ 2##D"|#D"`@ @|@ᓰ XE t  8`@ @  @ @M| @&(&&$&&,@ qh "l@ah  #< @(2`@ & @SZ `$`@I <=  'h'p't'l'x H*` h<> 'h'l'p H*@ h 18@@2  @.  @ d YWd Z$@ @4 W} Yd @4$@  @CD001Xl `8'` '' @͐ "@> <!Ȁ    @H   <= ?H ''*''' @ఒ <=H!0"!'c"'̕*'''@ @ 2'  )<@8@(?@ " < @4g  2   @^``c   ? * ~@ @2 !\ 9@8v  @4!\$ P  P* @ * @*@ $$@5j "  *  *` * $H ` * ` `*` * $L$ $ `* $$ `"$@<ΐ"'&a@@&```8@ &`d&`8&`<$$$ l` "`p`' ` `?H@ +@ @n 'r< $Tp p ?&p$ `"$@p' `$`  $P $P$   " @ʶ    <= ?H ''''Е*' @@8y 9&a@ 㿀6` @ݒ "<=a@ `l ? ?" ''''' H*` €@ @8O 9`8*$`8$a@㿘!@!$v!P `?@ -㿘!@ @6@ @ &`&` &`&` &`&` &``L @4 Z` @4{ Z `<@2r &`,  㿐 ` ` & |` &@ & F㿘!@@(`  `0`4&& 㿘 @/ isonodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] p!@ &+ <` @߷ܠ <& @e  @2 <є4  @3N ܐ#`$$$ 2F'6@ @❰ F<!@`!  @⑰ F<ѐ!@jے0 , ?@ؠ  @⁰@ɂ<ѐ"@jɒ0 < @ @@p؀ " @m <і "0@j@ ð F$ $ `4 #2`4ؑ6@$`@T <>؄  '''?' H*` ࠒ @;0 <   * *   *` $X ` `* *` `  * $\ ܒ@ $`#`hP / "' <>*  :!'?'''!`H*@ 'ԐԐ*Ԁ " @ؒB؀ "|@|< @ <<"Г2`  ܀`,"h<Ґ"|*` €K K K JJK K JK <#"`H<#(" H@ <` $ "`H@"`@$$'XH@`0 "`0ܰ &  2@ "``"` -㿘    h   2|  h| o@`   $`$`| /$`T$`$` $`d$`,h$`0l$`4p$`8t$`<x$`@$`L\ :`<` \ p  h 2m$`D<)H /* '  $ T@5q "H 0'  $  '  ''''''?'''@o耢 <Д$   <` <<0#$`$ : <)*`hH /* '<0S  . *`  @5ْ T0<)!ȓ+ @ @ "@ "$"H 0 $`D$`H$`(\ :<`P h$@ 㿀   1` 6 @ː 0 % y`w @-͒    $@ \ :@b   2^ ` Y  ; <0     (' \* ) :`#\  @̋?"`<  \*  ?'#\#`@, ?@%`<`4$@@8 `<@H/@N " 㿘``*@ `  ? 6`#0@* &#@#D`#H 4:@&#@?#H`?#0&#D&#H@H  2>#8 㿘"" N" =`?  " !!? 2!@0 ""!  # ! 2!.!   # ". "   ? 6"#("># !#(>#"@1 ..p`'` h'Ԫ    %<)H /* '  #P T@3 @$H 0,a,`,b,a,`$c0` s$cD`2 / %  <)I"H<)F"h@<)A"<)>" <)7"<)4"耢1<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    T@3f @"H 0$cD$cH $c@`ܐ!'?'''!H*` ఒ 3<<0#$`$@ : <)*`hH /* '<0S  , *`  @3Ӓ T0<)!ȓ+ @ @ "@ "$@"H 00. \>`c(  @ ܀ !<>@c(ܐ!'?'''!H*` ఒ ܦ  < @ @ >c( 8 @ @ C j D''D' H*`  @ΰ 㿈 <> D''D' H*`  @ܻ 㿘  @- 4㿘  `@- 4cd9660_strategy: spec㿀` P`h? `<@cE#( H D@$<> ' H'' '''`H*` ఒ "  H $h$ $@$ (0  <@,F 0 H$ 4<> `l` $ 8#X`H*` € 0@ tag VT_ISOFS, isofs vnode 㿘<@d X 㿘 `@, 4 4<؄ԇ(aaaa a8aDaPa\aahat  !P`   % $  "           x @ F `?2V -`?2R -`?2N -`(?2J -`L?2F -`T?2B -`D?2> -`H?2: -` ?26 -`?22 -`,?2. -`4?2* -`?2& -` ?2h`$?" ` h   "`  -` <> b b'?''''H*` ذ㿘` `, @?2@" "!0"! @ @ @@}  @`㿘`&`( &`,  &`0  @ &`4 &`D `2`   ` R 6`"` e  0`" 0`` *@Đ``*@ `<&`*`#"   "`("` " ` `4 2`4 ""`` *@``*` &`* " "`0"` `" ` `4 2`4  ""`` *@``*@ `<&`*`!<"   " `0 """ @"㿘`&`( &`, c  2 * &`0  @&`4 `&`D` *@N``*@ `<&`*` L"   "`("` " ` `4 2`4  ""`` *@,``*` &`* " "`0"` `" ` `4 2`4   ""`0<0 ` @?@.-@.ɒ`4@ $@``` *@``* `<&`*a<"  " " " " " @s㿘`&`(&`, &`0 @ &`4`&`D`@ *`@ΐ``*``` <&`*L#   #``(#`` #` ` `4 2`4  #`#``0)<0 @?@-̒@.h`4@ $@`$``@ *`@``*` ``<&`*a<"  " " " " " `4 ?@@-@.@, &`4@㿘8<&`8&`<  4`&`@` *@f``* `<&`*!<"@ `@@ `<`8" " "``8"`"`"` "``` *@I``*` &`* "@`@@"``@ `<" "`"`"` "` X@Ȑ 5 X`# '` &`'`  ''<0`   ''''`  ''''@ '@.q T$ X&@&``&@ Lt 2  ELF㿘<ڒc@)x  2    2  `  㿘?"  ? &    " &   @&"@@2   '@`'@ 2`'@%< '"@ :  G@    @ *@  <& *`#"  # `# # `4 6`4# @#  "E  *@u *  <& * L"  "@# `# # `4 6`4@# @ #   *@R *@  <& *`#"  # `# # `4 6`4# @#     :`   *@& *  <& *a<"  &" " " " @" 'x  #\#`#d#h #l@E 2`  㾈\ D ''''''@#  h  <=@''$?''H*`  <><=@''H$?''H*@  n<>D 8 i "`$` 3"`'''H*`   4 Z`  T`< T, @,N ,z D`<+ `' '8< <( @@ ''` '<`@ ۠ @, T@$ <>'''H*` `@, T@㻀`  ` 3'B  2ٰ ` R 6`"`,Ұ  T*@+ ` `  ?&`0&`,&`(&`4/`,  2 #`  <8   <8!?<8&`Tb'   ,  @   `, = ,  ??'''耢. <ݐ t* €tu u u vua ` `ۚ` @  `0&`(? &`,&`0&`4&`0&`4`, ș, ? O<`0@*@ 'O "  T@+G #\``D @+ T$ `*$ `,$ `$'&`X`&`D@+Ғ T` 0@v"0@+ƒ T@` NetBSD㿘,,  T@+  ` 5 B ,*`6+< +*`@ ('*` T@* ` @ !    2   b8 @&   0 @+z T, *`  Т`   @+l T@+i T㿘 <8!&`T?' 㿘8<&`8&`<  4`&`@` *@ݐ``* `<&`*!<"@ `@@ `<`8" " "``8"`"`"` "``` *@``*` &`* "@`@@"``@ `<" "`"`"` "` #!㿀`H $``  <ޒ`@%w   `  @ 8  @   J@ "*@`@ *J@@ *L }    J@ "` "` M@ # @   `J@`  @"`*@`J@  @ "`" ` `J@  *@` "@`" `H`&`H%<)H /* 'H    ?@) $HH 0`4'   @<)GHE"h<)<)@">" <)<)6"4"<)!<)0#-#( <)<)#H#h<)<)## @<)<) # #耢<*<*  (!<)H /* '    ?@) $$"H 0@$r &   @<)FHD"h<)<)?"=" <)<)5"3"<)/#-#( <)<)#H#h<)<)## @<)<) # #耢<*<*  (H /* '    ?@) $@$@"H 0@@$p`H /* '#  $ ?@( $@$@$#H 0@@$GU `$@`&` ` 4@^ 2S``H  &`H`@Ɛ<= ' '''' `H*` @ԉ<<0#$`$ : <)*`hH /* 'S <0  *@ *@  @)M 0<)!ȓ+ @ @ "@ "$"H 0`H` &`L&`Hư " 4`H`` &`H `P&`H@ ```@k<= ' '''' `H*` @.`+< 4)<0c$-<) # :@*`hH /* 'R %<0  * *`   @( 0<)!ȓ*@ @ "@ "` 4"@`4"H 0f 7c$@c$ #@ :*hH /* 'S   * *`   @( ?0<)!ȓ+ @ @ "@ "@"@"H 0`@ 2@c$ $ :*hH /* 'S   * *`  @( ?0<)!ȓ+ @ @ "@ "$"H 0@`㿘, &* * h'``  `<)K"H<)H"h`@<)C"<)@"b a<)9"<)6"耢d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '   * *  ?@'P @"H 0:, *@$G<)<#$<0 #@ :@*` hH /* 'R <0  *@ *@   @'͒ ?0<)!ȓ+ @ @ "@ " " "H 0& 㿘 H   :&    @  `&& <)<#$<0 #@ :@*` hH /* 'R <0  *@ *@   @' ?0<)!ȓ+ @ @ "@ " " "H 0㿘` %< `@ 2! ` "`  @9  2` Ac@  ``@`  `€ 0 㿀`*< ` c* &` ` *   @? 2%  #`#\@`#d`  `#h`#l@ 2`2`   ` @  ;` @M @ 㿘`<A`c*@&```  *   @]?  %sswappercannot mount root, error = %d cannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reaper㿈@#< (<@_"a <<8!@Z!b(@ @n@@@M@@I@_@)v<*`&``"` "&` <b&a</ "b" " `<"bؐ`"b&`@&`<<< !! `L `  ` `<8 `<* ` ``0 ` L" "   .a &`(.`-.a&`.a.a.a .a .a .a .a&`@-# `'<"`@@ 2 ؐ @ v&`<(?`&` +`: ``:@<0!8 :` @<` @<0!08 ;` <`P<`x P!<   +@ 8 ;`<`p<`h <`X@  :  !<"ؚ:$`<<  @ <``a@ <0`&` edb &`&a$&`$ @)X @@@ɐ@j@@)@w$@n@j<5#H` #H @  2H /*'@Y\@H 0@=ؐ #<(%<@= @_}@p@9@= @Y,c<"<a $c? 2   : *`"  @:K @9!<<<cD8 "8cD @# @cD €#h "#h<@W^!<>$ 4  24' ''H*@ @.$ <* <  <"b@b@" b@ X <`c ""c " # X#`#`&`@1&`!<  @-"쀢 ""<@W&!<a@<<# @ "<<@W"<#Ė( @ <@W "0@@@H/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d P< p @ '''''@ `@W0 <<@Xt 0@Xq /sbin/init.bak/sbin/oinit/sbin/initinit: couldn't allocate argument spaceexec %s: error %d init: not found no initp-<<"@ ' cԖ @A?  <@V!h<8#0#0 /<(V"`㜐 -/` ؐ  s/ِڤ  * " $@  B@\ $@ B ?Cܒ ?CՒ@ / " ?@ ?C'''@  " <!@Wޒ <@W֐!<@V7!㿘@(㿘@@`a:@+ I@ $ '''''ܐ@͔ :<>''' H*` h   `@@ # %<` <!<# < @ ` !<#`@@В $#$`@  @$`(< `2! !/! /! /! /! /! /!/!/!//ٔ@. @7@ 7 'H /* * <* `Ж"'` `" 'Вb@ ?H 0 @e 7Д̒b?' '?/a ?<0@" <0$@ " 7``` @ 7`0 `,@9  7' (  '! ` "? l?' <>!;#/ '''''#H*`    #`#\#d#l#hИ  @4 (㿘@" a .     6 `  (.` 6 `.` @.`6 Accounting resumed Accounting suspended 㾘#<c`"!<`h 2 `D  ?@ז G$c  <;@"f@r d -c<<"`$c%`h ``.`h 2 `D  ?@賖 #$ `  <;@"B@N d 4 <; `<$c$ ``@Tː <;`<0 !<@". @  weird hz㿘 <<" @l"`<# `<!<0! | !<0"| @! <#"`@"<*`<<0%d<0 <*耢<0<0<* "a`<* "a`  "a` "a`<* "a`@TT!㿘<#h`  ` ? "`  @`2` <! )< @` !<0` " `!$@E&` 2`@1 ` !<0`  <!$@E` <@1Ԓ <# `!<0@a<b<b4 !$"b<#P" #b4 <@В@ ?@"?/!@"@`"@<;'<;?Ȥ   :`+   #@ #:+ " @ !<* ? "@ ܄?/!@"<;R <; #<;`` "$ Ѐ 9<!+  €$\h<;   '$`% #$`T@ܒa <; В  ?T @Вa <; В  $  $` $`<; `0"$`<;<; ` <;` ;4<*a` ?* $ ` <;` ;4<*a`" ?+ $$<*<; Ā  a`a` Ȕ" : "@$Ȓ Ȓ"@;  $<!<0a` *@ Ȁ `  $ d <% 0<#+ 076 : : " :`:`@ *" : : @ $ 6: : :  ":6: : :  " :6: : :  ": $Ȁ / <0H 0!@0 <* *Y Bc 0B< 㿘Ho o<#h  #< `  $h#$`H p@Ho oh 2 H 0timeout table full㿘$ Ho o<`2<<@R!""#h#h#`  4& 2 "  "" #"H 0H<#h #h< 2 2`  $"` "` "" 2H 㿘H /* * <*``Р"(b<0`<0" *"@ *`"  * ` " * !$@ ! 1#@#@H 0㿘 ( $<! `& (`"!<# `H /*.<`<<<|"`@j"ఓH p@㿘 ( "<! ߒ& (`"!<# H /*. <<" "`@jn H p@㿘 @#<<!  (`  @X < ? R#  !`B < <a` 1"`<a ,"a ? ;#  <<  a < `B < <a`  "`  < `B < "<a` "`< #  `<`  $ `<`  "`@:㿘<; ^<; @? + <; <;  <*<;`̀ <*<* <;#`<*```##`̀`,<;@*  <; Ē :`" "  ĕ; @ " Ād<;@  <; <;Ē *:@ "  " <;ē*`;  "<;<; Ā@4"Đ @&"ā㿀<0<0$<0! <<'a('!|' `'' @=[ 㿐 @ @.`   @= @dup2: fdalloc㿐 ``@@ .`@   ` 2) ` (% <0!8 @  & @ 2<@Py!Ȑ@d@K`@@ @,`@ "8 `` 3<#(*` €P$8``   ` <0!8  @İ  Đ@  @ &`  @  @ ?*@ T  ?&  34 ` %   ̒@ 4  `'~    b} @' 2 ˰   4 ~'0T 2   `<&`w@ &T `  "`<   &`@! 2!  &`  `v` PT  `  ;ܒ |W W @ B ?W`*<>`` 0i  0f  c (  2([ <>'''̒`$( &&'`H*` €H'''̐ @&&&`H*` 8T 4  `;  ,W W @ B ?W    <>'''̠  @$?$?$?`H*` Ȱ `;h  @*`@*#@` *  3 `4 `" 㿘 .` `2   ?*# *@&"@  .` ""@Ӑ 㿘 @`@ђ fstat0@`*@@ 2R  ``"   < @` @` @N!`: hfpathconf㿈 @`*@@ 2R ! ` `<`  "&  <>`'''' H*` @N!㿘 <0 a8@  @     &  .  2  @  $ @ $$ &ΰ &Ȱ `1 2-<+`,h'``  `<)K"H<)H"h`@<)C"<)@"b a<)9"<)6"耢d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '   '@i @"H 0@ *@a$@@   @X$@  4<#$<0<)#@ :@*` hH /* 'R <0  *@ *@   @ג '0<)!ȓ+ @ @ "@ """H 0$ %$ $  <08 " $"@`4 +   " ?,  2?`퐂? filepl㿈<:<:a4\ &<<#`#d#h!8c#\ (  @Hy file㿐 Ô <G<0la8<@M'#h= "l<!8@Iw   ;; ; ; ;  @`" <@ #@" "@ # cc #c" "c#   `@* "3  @#  2&@& 㿘"  " "@@" <l<"l!8@I㿘 <)H /* 'Ȁ    '@M "ȑH 0 @ `& 4 24` `& `4 2`4@<8   p " 2 2 ""  "` 2㿘  `@@& 㿘@ސ& 㿘 #<)H /* 'bȀ    '@ $bȑH 0&& &  & & & & & 4 24 `" `4 2`4  ` 6   p&&   P  c *` 4 :  c , h&``  `<)I"H<)F"h`@<)A"<)>"ba9b<)6"耢d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '   '@Q &&"H 0@& & @H@D    `?`  2` 㿘 ?* `~4`  "$@{ &  4!<#$#<0'<)`# :@*`hH /* 'R 1<0  * *`   @ '0<)!ȓ*@ @ "@ """H 0@'<) !< #<01<0@#$`$ :*hH /* 'S   * *`  @h '0<)!ȓ+ @ @ "@ "$"H 0closef: count < 0h ,`"$ `( "  T 2  <> 7!Є  '7??''Д  @""!"`H*` € ?* :``4 3 6 <@J#/*  @2  <> 7!Є  '7??''Д  ""!"`H*` €   € ːh ``@@.`@@`2V` F C -`   7?? 7`?А*<>6`!'''̔"  27$ 7`  6`<>!'''̔   0<>!'''̔  ""!"`H*` €Ȱ?  0 "X 㿘@.`` +` 9  25W`"!- `.` 7` `@4" `! !`.@ `(`@4 ``& ``  .@ " ` 㿘  ` ` `" `  $```(D$($$@ 0&` `h  <=@'''''`H*` ఒ <=`$'''''`H*` ఒ `D 8 ̰ 2`$(("`$` 3"`<= '''''`H*` ఒ <>'''`H*` #\#`@`#d#h`#l   @ݔ J`)<8ܠ !" &`  <8! , @!€  2`H`H !  耦 `D<@8 `,@  ` `4 `$   ﾐ``@߷<=  ''''' `H*` @z<)<#$<04#@ :@*` hH /* 'R <0 , *`   @> 0<)!ȓ*@ @ "@ "4"4"H 006@E<)<#$<04#@ :@*` hH /* 'R <0  *@ *@   @ 0<)!ȓ+ @ @ "@ "4"4"H 0X%< @<8! @ 6@<8! ,`@ "` #@8 `@ ,`@'t''x'T'P'|h4( `b`  `@`<)<)G"HE"h<)<)@">" da<)<)6"4"<)<)/#-#(@@ @<)<)#H#h@<)<)##@ @@<)<) # #耢@<*<*  (H /* '   ?@ ''"H 0<8"P''''''''' <<@\`{ /<)+< )<0A5<0J@,@`J@`  @`c$ #@ :*hH /* 'S   * *`   @ ?0<)!ȓ+ @ @ "@ """H 0  ìc$ #@ :*hH /* 'S   * *`   @ڒ ?0<)!ȓ+ @ @ "@ """H 0 '`/<) +<)<05<0  2 ?@ ' '3    3h  ? @`  ?@ ' '3   3K  ?"v 0t @` `` ,* 0 ?"  ᐐ@ " ؐ ? 'X '@L<0  $ $  2 $$̐ 2 $ؒ@ 2@ $$@  2 @`€@@    ''<`$" ؐ #;c3'   c,"@$3"@ ǐ@!  $ '@U?, :cĐ 4:@7 4 24(@ $(`$Ē D@.$(쀋(`  $'` ""(@"@଀ ਀ @ސ쀊("쀊$"(!( >$(<# @@#`c$ #@ :*hH /* 'S   * *`   @ 0<)!ȓ+ @ @ "@ """H 0@ܲ`<= ''''' H*` @v`((@#ڒ $c$ # :@*`hH /* 'R  ,@ * @  @0 ?0<)!ȓ*@ @ "@ """H 0 @`A?@`;?Y 'Ð@J`<= ''''' H*` @c$ # :@*`hH /* 'R  , *   @֒ 0<)!ȓ*`@ @ "@ """H 0<@(<#$<0<)#@ :@*` hH /* 'R <0  *@ *@   @ ?0<)!ȓ+ @ @ "@ """H 00 @%<`/c$ #@ :*hH /* 'S   * *`   @h T0<)!ȓ+ @ @ "@ """H 0c$ #@ :*hH /* 'S   * *`   @9 0<)!ȓ+ @ @ "@ """H 0@j`<= ''''' H*` @.<‒@vc$ # :@*`hH /* 'R  , *   @ ?0<)!ȓ*`@ @ "@ """H 0@{ @x? 㿈`'` '0Ք  2U  T,  **` ` '&@'0  -0z쀢 6  @ ?' '0  ? &`0   0W쀢  ?  '0   㿘@@ *` init died (signal %d, exit %d)㿈 0 'H<6`#`@D&  ( <.K<.#@@h  ( &!<`& (  D@,Q& (?& & & & <+"& & & & . Y ` ` @c7@_``2! @$)<!` `.` "(&`` `2``|  @! ` @j `  <= ''' H*` ` "&`@7&`&`!@  ?; ڐ@ ` "`   " . - 4` 8"`8 4 8" P`<@+b쀦`?##<`H@Zb`(h" @&`(@!C `2`HJ H!<6!8@ !< @Ŕ` !<@r`H D (  <@5 P<@+<"!  `"< @@o @ܐ㿘< &  "` "& @+ reaper㿘#<%<bb x  @*b "  "   "@@< $  " "$  (@ @  D@+T Dbwait㿐@ 2`!` &@`?" Pʰ   @" L - 0  ! @ 2 HL - ~ 0&`` !8'/  2` `"  (!</ H 2 ((< D 0 T "<@ <"@ (F* $ ( D$ T@ w  D@* 0~!  $\ \@ 8 "\4!8 !<@ H<.!<@?#@| ` "`   " H` L"`L H L" @? ?  " @J@< @?#8 Ā "<@<ܐ" @?<;а ?:"Ѐ 2  H (@ 2 Hh@ ` " H@  0$ (&`` !8*'.  2R@2` 2 &<@! @) "= P  D  H L L H L `P" H`P H L"`P`P" L" D㿘 @ 㿘 @ 㿘 @ procppwait㿘 <0`'<;!0А@ <@ <@A p #@q  :   p  <R t 8@`?k #<R8@ <ܐ@T?_ " @> %< )<;$!/@ d%` `Ԓ d`Ԁ@H< !0`H `Ԉ`H "; <!<; 0ค  @  #฀ !   @ ฀ Ԁ $ `฀@ Ԁ $ ! `  $  Ԁ 4 `  2 0  2 $$`0<* $``"` "$`  ,`-$`$@<*`0<"b @ *` $`4 `4"`8"`0b @ *`" `0 * $`8`T @ b `Ԓ @ Ĕ L ( $`( $` (` </<#8@=u $`  "" "  " " " `"`  2 Ā`$``4 2`4$` ` "$`@: $`` "`! ` ` ( `( $`(``( $`( < $`< <`<"`@& < <$`@$`D P`$`H P`H"`L& P P$`L$`P @"  \$` $`@+ \$`\ ̐  &  ( 6`@А6`$a$ @zH *<* К ` "  "4a:,`-@VH p@ < & ` "`` "``` "`2&`(  !<  x@'W `(  `0&&㿘Ho o< "!  a @'7 H 0 %:㿘<; 'P'L'T'X  L5<H? ? <5<P?<#X㿐<'T'X (  ! " (b " (!@BT@& WARNING: thread `%s' (%d) exits with status %d 㿘  < <`0 ha@A< . unable to allocate kthread_q㿘  T@ ]  2"<@?֐ """""<;``""`㿘<;  $$` @ @  T 2㿘  @  & @ & &    0 404㿘<! <)H /* '   , T@  "H 06 @[^ `0a&  @  㿘<!  @ % ΐ h(`b`  `@`<)<)H"HF"h<)<)A"?" da<)<)7"5"<)<)0#.#( @@ @<)<)#H#h@<)<)##@ @@<)<) # #耤@<*<*  (H /* '   T@ y "H 0$6 $    *" $$(@X5<)3<c$1<0 $ :@*`hH /* 'R %<0  * *`  @  T0<)!ȓ*@ @ "@ "$"H 0c$ $ :*hH /* 'S   * *`  @  T0<)!ȓ+ @ @ "@ "$"H 0 *@% 㿈<! ` @ $`7'' $ ($@<)<#$<0`$ : *`hH /* 'S <0   *@ *@ @ t T0<)!ȓ*@ @ "@ "$"H 0`*@$`㿘<! ` @ $`@$$ (@<)<#$<0`$ : *`hH /* 'S <0   *@ *@ @ , T0<)!ȓ*@ @ "@ "$"H 0`*@$`㿘`@&`O @$$ (@S<)<#$<0`$ : *`hH /* 'S <0   *@ *@ @  T0<)!ȓ*@ @ "@ "$"H 0`*@&`㿘<! ` @%  h(``  `<)K"H<)H"h`@<)C"<)@"b a<)9"<)6"耧d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '   T@  "H 0$$   @4)J  $$$(@5<$3<0`$ :@1<)*` hH /* 'R '<0  * *`  @  T0<)!ȓ*@ @ "@ "$"H 0$`$ :* hH /* 'S   * *`  @  T0<)!ȓ+ @ @ "@ "$"H 0 *@% x<! ` @ $`.`'' >`'''''ؔ $ ($@<)<#$<0`$ : *`hH /* 'S <0   *@ *@ @  T0<)!ȓ*@ @ "@ "$"H 0`*@$`㿐<! ` @ $`'' $ ($@<)<#$<0`$ : *`hH /* 'S <0   *@ *@ @ O T0<)!ȓ*@ @ "@ "$"H 0`*@$`㿘  @`  @*@"q  2`k  ` @  *% <* `"W `2 `@ " &```2`C `2` =  !@  "5  `/ ` @ @ʘ`<`` @  `  @@ "  *@% @` ` @  *&   + @ @'''''ܐ @# 2 <>''' H*`  h`   @? +& i <* `U `2 ` ?@Y " ``2`B 2` =  !@ c  "5  `/`` @r@@1@`<```@ . `  @V@`"    @ז *@& 㿘@’ 1 2``" `%&`&`1`&` @ 2`  &`?* &` ` @` ``а 㿘  P`  H " Dktrace write failed, errno %d, tracing stopped P`^  ,Ȅ  '''?''''̀ '(, '''' @ ```؟@ #`@ϐ <=''ᘔؐ $?$?`H'*` <>`'``H'*' @ <bH@:M <*ࠀ   2 x  2  `22 2 2`   lkmopn㿘?2   0 !<; 耊 #<`  & !`@ – 2 耊 `   $ 㿘%<;쀢 !<!x  `" ax<R8@S!x" ax" $,`" $<R8@E0!x",$㿘1<; 耊 < !x   J     @!&  x # @  #@<;#@<;y  #@c 0r0#@<;0# @<;f 0 #@0# @"[ <;"x`4V < ȶ J@ `<r."*  "" #<R&!<a8"$!x@ !x0 " "@ & `"!x"0a8"8@ !x"4", & !x@"`4"`0"`,& <; "`<;"x`  #<;`? 30 !<!x``" ` %4@ !x    $`# ^#<;`쀤  ݰ 3<ax`4`0" (`,Ӱ %@ ax 4 0 *$`# 4"x`4 " "x` 3<;`쀢  !<!x`` " `  @Ԓ !x "`$    &`!x*`!x *`&`"x`4 2  ؔ $} }< ȴ (   L " @@y  <`<?."<* `Ȓ J`!<A$!x `$   <;Q  " !xK* ؔ $p < Ȣ (   L " @@>  <`<.& "@<*` Ȅ@H<"x  &(   &$(&( &,2 &0(&4( &8($/ 㿘@-㿘@@+ 㿘< Ȩ (   L@ "  (@   `<< < 㿘 (`5 <`: " 3 )<8<#D`\ (@ *)(*<8 <8 @(  $ ` $ "  #` $  <8 c@("@  " 㿘 (` 4`2   @ @  㿘 (` 倦`v " ܰ   "L հ  <a(  << "P`x  a( a( ( M<!( 6 (#<bP+ @  $ $ $  $ $$ ($ , $ 0#@ "" " """$ <`<  << !,`x  `< (`< (q < < (i @<,+` @$ $ $  $ $$ ($ ,$ 0$ 4 $ 8$ $ < "" " """" " $"$9$    (0 ( "<bP* "@  "  "  $"  ("  ,"  0"  <a,* "@  "  "  $"  ("  ,"  0"  4"  8"  <" $㿘 (`? H`F " ? <8!  <8! +`! +! <8% <8! <8 a+@  $ < $ @ "@ `  $  <8 a+"@  <" "㿘(`" <#*` €$( P      p "" " " " " ?" " 2 " " " " " "P  2 lockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myselflockmgr: unknown locktype request %d㿘<!  ? 0 ` @  p @<",* €Hl *` '  '  &   *` @V:` ?& ` 2 M ' o  & 0j  &  <  <@5V  ? *`:` & 6 6   ;& &  ` !  ?& 0D <  <@53  `?&   !21   +  !2  !&  ` &   *` @:` ?& ` 2 M    >&  $& &  ` <@4!   @%  ``@  @ݠ <@4Ґ!(  @ 6   6 0ˀ`  'Š    &  &   *` @:` ?& ` 2 M &  "&  ` &   *` @j:` ?&  ` 2  M   !  =& | $& &  `j <@4i!   @< !H@4]  @"6  ?6  ` ? ;& & 0   ?&  H@~0D `<@46! '8   4 0    &   *` @:` 6` 25 M '     & &  @6 26 0<!@3  (" '2  2  2    w& @$ lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pending㿘 < @5Z!   $< !(V @5O  `<@5I!XRAIDframefilecore nodefilecore mountcodaPoolUSB deviceUSBIP flowDMA maptempUVM aobjUVM amapVM page bucketVM pageVM swapEXT2FS nodeNFS bigfhNFS diroffNFS srvdescadosfs bitmapafsIP queue entadosfs anodeadosfs nodeadosfs mountmiscfs nodemiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostNQNFS HostNQNFS LeaseMFS nodeFFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pgdataVM pagerVM pvmapVM pmapVM objhashVM objectVM mapentVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqfhandlemountiovsessionpgrpcredmapmemioctlopsgprofnameisonamesooptsifaddrzombiefragtblhosttblroutetblpcbsocketdevbufmbuffreemalloc: out of space in kmem_mapmalloc: allocation too large㿘(   5 3  @0 . "!) ' $$ "      @     <)aȗ,  H /* ' X +<0` ,` $?@@ *<0 $)<0  <;:@ <!,@ @S <<@2"8H 03 c$<) &` : h* + @  2@?#@<@1"`6@s "$"@"@ "@ "$$H 0㿘<c$<0<)&`h:* R<)+ aȖ * @H /* '<0` *  <;`*@>H 0@ 2#@"& H 0㿘 `-<& c$<0<)$@`h:* <0S ` * *` *@ @0 minbucket too small/struct freelist too big㿐)<0 @@ђ@ݒ'<R8,@ <)"h !<#<#$`@8<a#\  @Ԛ <; 㿀@   H /**@M <;`<; ''''H 0@D  <;` @@2 `a   b"`l<; &<; &P@ D | a:`@q sH /* *  )<;% Ā )<;'<;$฀ '<;%<;$ %<;#<;`?c  $`$` #<;1<;& 1<;]<; 6: : '<;`<; ''' ' '`''đH 0@ D ` @@2 `a   b"`l<; &<; &㿀H /**@LK<;`<; ''''H 0 @Ә physbufphysio㿘<`!  ` `  ` @,@ @  @߶ @ ̤`&@`? @ $`&`$%&`8H /* %`$  # !< `$&`$ #x@ܖ `$ `$ &`$H p@&`8&`(&` ` ~@, "s` &`$`3` +  ; &`H&`0&`<`0  $( 2`<@ې`<@e@@H o*@e`$b #<  c@ `$b`$ &`$H p@@`<@G̖$`$("`0`( " `0`4" #@&&`8` B#?` '`  `&@H /* %`$?# @ &`$@20 `$ @`$ * &`$@H 0㿘 x T  @` x!P?!$ \$ $ `putphysbuf: private buf B_WANTED㿘 P @B $ @"< @/#G T 0@4" 0 procplpgrpplpcredplplimitplrusgepl㿈<  H`  H"`2!<0!0 & <*: − )@ !0<܀"b:<㘒 )@ !0</"`:< )@ <"ap )!<:#<:!4a\#h<< " `X#\;`!@  @)  #h<< !``#\;`   @)ޘ  *<< #8`h#\;`#h   @)ј << #h `p#\;`   @)Ř  <.< #h;`#`#\ H  @) chgproccnt: procs < 0chgproccnt: lost user㿘<!<p *`   2F  m 6< @.X"h`"`"<)<c$<0  : *`hH /* 'S <0   *@ *@ c )0<)!ȓ*@ @ "@ " "H 0. <)< ( @."H /* 'H    ) "HH 0` " $   < "   02 D 2 0 <*<܆ b( "   0  4 2 0 <</ `( "     2  㿘 2`! 0<!@) Ȑ w 2<)H /* '   $  "H 0 0 # ## # # ! # # # #  ( ?& ($` ! $` `"$`$`<</ @* `$@"  @* @"@$`$`@"% @ !@  <` @"`@ < @"! `2&!@#&!` & <` <"`@`$`& @ 㿘 <` @"`@ < @"! `2&!@&! 㿘  `"`|""`|` "` " `5"<#$<0 <)#@ :@*` hH /* 'R <0  *@ *@     0<)!ȓ+ @ @ "@ " " "H 0<!@)ݒ㿘 D!@` ` 2 P` &`? &`@$ P !@" H` 2 HN - " H` "`? "`@  H 2!㿘  N - 2 <`@ ; @ 8  < 0 2N - 0" D0 " D0 "! "㿘@` z 2! !  ` &㿘@` g 2! ! `& ""  `" ""  `"㿘@`  R` &R @6`   @.  2& 㿘! 0 @ " . " 0 <  0 &㿘` 6@A ` 0@"! "5  2!. !  @ 2(  (@" ! !  @" `` 0&`@"` "  ` !  ` 㿘`@ @ @+a:  ? @ $" $ $ `(!$`(㿘`@ @"  @@a:  @y $" `(a$`(㿘`@  @`@  @!: 26 @`@ @  @Ԓ!: @A$"   ? $ $ "  (!& ( 㿘`@ @@a:  @ $" $ $ `(!$`(㿘`@ @"  @@a:  @ $" `(a$`(㿘`@  @`@  @j!: 2/ @`@ @  @U!: @$" $ `$ "  (!& ( 㿘`a:@2 2@  @&``,  22` `( !$`(R` `(@ :    *   ` @2@㿘<)H /* '   P Д "H 0 @e P 6㿘H /* ' ?* `26<<0#$`& : <)*`hH /* 'S <0  *@ *@  ? 0<)!ȓ+ @ @ "@ "&"H 0H 0㿘  @t P 6㿘@g P 6㿘`(! &` ! @ 㿘 !:Z   !  @` ?" 㿘@  )  "`M "'`I    2:!9 )` ! . )  * )!& < 2! ) <* `&`<*  )` `2 !&  2  ) )?&  㿘@    "`R "-`N  i A`@D; ` !m 1`  -``@. < `"` <* `&`<* ` `` 2  `@`  2 `` 㿘    `` 4 &?a6 .a p!:  .a@0 㿈@`  @㿘`( `   .`  4 @ @  @ @ 4   2  @(  !:. "Ѱ@4 2   @( > ` `  `"@ & `+<R`` <R`b<0 !(2  (!( > !(2 (!(  !,2  (!, > !,2 < <!, >< *   >@  W@  < " <" "  " "   @ @惘 C!8:  4!8 !8 !8 :>!8:  4(!82* %!8! <0!0:  4!0 !0 !0 :>!0:  4!02  !0 :> << 㿘@  *  `  㿐'HH /* .   H 0 @EB2 <H @ `$`w$&@t&`!    @Cw<`X`X" "@  <4`, @,`b2*@ *@ b 2`* *`@C3`+  > +` @@켒@쏖 Ж@@쉪 $ Ж@@x$@즒@y Ж@@s H Ж@ @@aH` `@쌒@_ Ж@@Y &@ Ж@@H&`㿘@ `   \ `  H`@ H Д"b?  "?/"" "   " ?/""  &"   @"` 㿘< @# @L  $ $ 㿘`? "`<@#ʐ AD 0 㿘 $ "* (&&& & &&` ` <ȇ* @ H*@ (#`&``&`` &` `&``&`1< (. (&` .&` /&`  /@ &` ` (! (` "  ( 0 ( ((! (` (2 .`  ( (2 .   (. @2  (2 (  @(> &@   (   (@> &@@  H h`   2` @`  *  ``     㿘$7<*9<5<&' (&    (& & & <&`&`&` `ȶ  `(`$` `  . 6`. `*@$6`. @`*@#@@6`. `*@# 6`. `*@" @!#" $@  `  ˲`(""(""" 'c 'c'c㿘`$<`` ȶ   ( $     0(,.@ `"(  @!&#"'@    ` ޺``("`"`("`"`"a '# '#'#  " " " " a H`"``"00"%0- Ԅ#  ؆#  ܄ #   &#  Ԅ(#  ؐ(#  ܄(#   (#  +  # # #  +  # H <`( Ԓ`((# ` ؆(# ` ܐ(# `  (# H / x`   2` @`  |  ``      "@ "` "` "`  Ԅ*"@ ؆*"` ܄+"` +@"` 㿈@ pause㿘`1 $ $#$ $#( #4$#, `$#0$#4H @ & `& `& ` . & <(+ (& *& +@ &  (& H 1<!(#p@   㿈@  3   @   $#"#"# "`" `2 "`# " @ 8@ "#`"#`"#  x@   2@  `  Đ  ``    㿘``  B @/ 27  "`     "` "`` 2  !!`   `` @,       @㿘 ; <* x0 $-("2)"& `    `   `2!`  2 `@20D " !P 2 =  60 $.<("2*< `    `   `2<!`  2 <` N- "<@<20  㿘   @ 㿘    ( " <@u < 㿘 ((c $2*   * @X 2U$< < `"< 2  Б.`*   У.`@ , Ho o  Ԑ &   ؒ@ &   ܐ &   @ & ``* %<!ȓ.`  @"@@* $H o@0$<$8@㿘<!ȓ.` (  &0*  @  *   @    @   !  .! ! ` <* * &  * &  * &   * & < * &  * &  * &   * & 0*    *@# ` . oN - kHo oN -  (<J!  ( S(O`"5 `C`2B! E0*`  * *#  D6!8`(  i @02 (h/` &`` *# "! h  . -`" h *# `@ 0  <  "c! 2 2.!@ H 0issignal 㿈<*  (<* * '+  +@ *'''@耢   ?,  3`+  @ ` ** $@   @ " ( ((ΐ ( h(+. @@ 4!8 D 0(@g@ @2i  ((!8 ?3`*  @ ` * @ * $@ .  $* <aȑ. @) 23` 0  ((! `2 D~ D4!8`(   @@ _pn 3`j ((2f<@"d"a*@   `*@$@ , 㿘 (*   D. -@& (㿘<! ?5 *    $* *# .  *`   @ c4 Ԁ  c$  2c4@x0U  ?$c4c$   <`" <c8 c<$c8$c< А`  @H/ /+`@  Ԑ $   ؒ@ $   ܐ $   @ $ ` `5 *    *@ *  " <!ȓ.   @  "@ * $@H o@pid %d was killed: %s sorry, pid %d was killed: %s 㿘< 0c@ 7 < 0#@!Ғ 㿘<!:!ȕ.` ` 6!: $@"c8 "`ϒcore%s.coreh( a#3<0``` *   @: @    D 80 D   8 @<; "|`<`@!00<`0@!0 @ '''''ܐ"@i! h  <=''H%?''H*`  2 P<  <>?h`  ?H?P?X(?`0?p8?x@?H?P?X???'?h''' %?H*` €<=!@''%?''!@H*` :`'4:@ٔ $<'8'<'' `*'$`*'(``+@@ +@ @|', H<> - 2`' `  #\( #`#d#h#l @% .<>( < `` *@ `" *,#`#\#d#h#l @ʖ <> #`#\#d#h#l   @<>'''H*` @ʒ  "㿘  N㿘 `I E` `?&&8  "@ 2@@  ܔ  2@@ F @`"$`$@ B#&>&@ureadc: non-positive residureadc: non-positive iovcnt㿘` 2`<@l"x``4@<@e"  2` &`&@  "    6 *  ?$ $```B >`&`hashinit: bad cnt㿘 <@.# , &, 륑,  @*``@&?&㿘  듔  2"   " <*`""`"" 㿘"  " "@! 㿘 !<*`"`"@  2㿘  Z  2"   " <hh`""`"h" 㿘"  " "@ 㿘 !<"""@ ؒ #h2㿘<#h`<`2@` @ 0`2`setroot: no name to bdev major mapnfsroot device (default %s%c): dump device (default %sb)nonegenericfile system (default %s): haltuse one of: generic %s halt unknown device major 0x%x %s%ddevice %s (0x%x) not configured root on %s%ccan't determine root device dumps on %s%c ?'H'p'l   <"` <@"H<<"b@"p ,< 4" (<< $<* <*!p` `0  ```2`0` `/<(㜐 %!<$""< /<(㜐 %㜀 %<9<1< +<Hxt@2 :@jx<"@d!<H<"@[a@Y"@W"x@  @垒@唐`єxJ@ *2H  *@ t@   #;< <b@划  p@ߚ  2-<@b@@"x@_ ߀`t?  ?2` @  : *  * @  @'p  <<tp&"L %b<" 4 " D   D 2 4 2<<""bئx1<7-< `@,# ` @5  x@"؀ <@x "< 4`<<@#<<L %<#< 4 " D@c  D 2 4@(<""<@@ À`t< !<* @ g H*`@*` * ?  ` 1<W&"0  <@̐     < %< ?c 2 @  x<@K#0㜔%㜐 @̔ ? 2 <cP @|20  x@䓒  "  x 2 <#X@!x㜖%""<`"!`<!<<b?  <2  c !<:*"  @a 'l@#㜒`{%" "<@SbЀ c㜀 `g+<Lb" 1+<bT# @2 @y Lx @[ b? 2 <cP !<*@ 2#0  x@"  "  x +b? %<`b* * ?? @   +<%bb? 2` @<` :*"@  @a0 l<?"b<@#㿘`2?  "? @@㻐@o `@ `?`2@ @ "    use one of: %s[a-%c] none㿘@2 *< @3!<*c0 `5< 3< ` @$ h`2   2 c @   2`"<< @!<@ #(parsedisk㿘`P `2 <c@^ 2 @3;   ,`: ?.5'<*#0 0#%<    @< 2T 6 @2ȓ*`* * ? @ @ @' 2  @  ѐ?  2- 㿘@  '<@ "&  @     @"   #  @@,@Ȑ 0 <! 0?@~0פ@z0<! <<!@q 80ʐ"@m,Ĥ㿘<0a  <<"c!<!!X"@R  㿘<`<**@ <*` _+<; - p?` $ p t $ t d@#bp t2 `G$ dH /* . <!|`d(  ` `* *  @j* @ \$ d$ `@@b$ \@Ԑ !1<! " !L - 2 ! ( 2 !2 @" !@/q !@/O,!0 !,!H 0  2 -@-<0a <!!Ƭ 㿘< *` t*`@  \& \?& t( t?  & t @沐@ 2 t& \@㿘<0 <a a<( `" H <bH 0 H p@ '@ @  ܨ H <>  c $ l,!$ h$ t@ @ "@ ""$<""<  (L  `$ (c   h  @ݐ , - 2     , -@ @="@ !<*cH 0 ( d$ ( { $ ( @ @; #  J 5 #<""*! 2  L    @ @.   + .  $@*`    ? @ @     㿘H/` / hN - @Y (@f ($& (H 0㿘<! H <0` <<( `<bH 0 H p@07> < #`,!$ h$ l$ t  " ""  , -$@`"@ @  @  ۰ @  @2 !  ۥ !<*cH 0Hh8<  @@ 2@"@ """hH 㿘H > < c @ 1)< '< h2&$ h"`"$`L - 2 t ( (U ( , -`$ t@- (`<ː(֔"#%" 2 hH 0㿐<a @3e'<X "@ X"  А"@ А"??/!`$$<` (2   #<0     <0  @4  <0  @<0`B <<0! @<` <   <0 `@r,<d`"d@2X<x *    setrunnable㿘Ho oN -` *`<$  €PH<$@  ((!8` 2`*    `*  # .  ( `. -@,H 0 t`( (v ( & t< (0 <! #  <<"c" ! ( \  8  *!<@ << ""㿘 \ $ @8& \!`1!.!X`    ': `  @*Ȱ ~Ȓ?`$<$# *` €<d|pX<%`   <&"< !,<t  <"<S!PV -` i  M` $@Ż !<B "( b( $ ے  b( $   %b(`@ű````#\̟Ā`` !<@Ũ"(` $"( 0"`  ` `" 㿐` \  ?i ?`%c<%!L*` €,D<(@\p|$p$8L<h<pÐ"<ٖ!<0!4@r!4!4@ $!4 <0!0<0!8@\!<;"x'@L  "x@6$"x`0  $"x <ܐ"@r! ذ <" |< @b! Ȱ <."#!<(#'@$#>< @ @ @@a  | w r !<0!@Ș!!`ki$!!<0@!!?$!?쀢`X V$!<0a,K<a@F<(  <*#$`a " "7 .) $   !<;"|@p"|"|`$"|  $@ -㿘`"Q ?` L<&#*` €,\D<S <S<ڐ@) <<0bܐ+ <<"<0a " * <`@+ -㿘  @     `&@;  , 㿘'P` @     `&@P 㿘@ܽ   @      &@  /㿘@ܕ   @     &@Ւ㿘  @ ` `&@ 㿘` @   ` &@㿘@  <#l ` *` *  (&@`!<"&@#  #&&@   `'l (   (&&@ (  ` `2p  < j <  H H@`"R N`- "J`?`/<( *` €,`0 @a  `( ".`a ` "(` l  @` ` `   2`@)!@ a@!p bP``2N`-  2@ $@& p& 㿘&@!` `  P&` @&``&` `&`` &``&``&` @N -  2 &a&a&a  &a@d&a &a &a  &a D "&a  0&a ! `&a$ &a`!`6a( ( ? `"&a,`l&a,`| " !1&a0`&a4&a, l`a8@ڔ `6aD&a@6aH6aF`@ &aL! `2`&aL`aP`@Ĕ 㿐H /* * <* А   "@ " ' 'Вb@ ?  6 <;"x`$<  #  "H 0!<# # b?`##  #`?/a  ## #`< X X`# X #`?/a  # X#`@`UH p@@, 㿈@  @-*`" * *'`' 㿈 !:Q @  `  #@;''l  㿐@   `  <0 沐"@"''`Ŕ nanosleepx@  {#@ ''@O o H /* * #<*``Д b?' '?/a ? " H 0<<)"8h#! ?"  #" ` 8H /* *`а ''ܑH 0"@ " '؀ 'Вb@ ?؀`''ؒ '* "**'`B  㿈@   @,@0   ``''% pid %d attempted to set the (obsolete) kernel time zone 㿈 !:i 2'@   2`   2@ " ` "`  <* 0`@ǐ  㿐 !:: Z@Ҕ  S`   @$ H <;*"@ *`" *  * " <0!(*@ *`!(@״ @@ & H /* *<b4<"b4"PH 0 ``!@"@'@׌"@'`  㿈@R H /* *2   ' x' |''쀢0<*`Ѐ` &'0`Ѐ''`А` "@ " ' 'Вb@ ' ' *''''H 0 `, 㿀@`8r `   2h`` ''  Z V@ 2Q @ J H /* *`. <+bK耢`<*쀢 <* А И@  b? ''?/a  ?b& x& |&  &  ,` """"H 0 㿘1  x <* | ?/& B& ?/ !#<+H /* *   b? |&  & & &    Ѐ@  0Ѐ@ bH 0 H 0 x}x@8  Є?`  2  " <0$&"   6  "@ @" "  " "  "  " " "  `" Є@@" "   !:j @"  x`  @  @' < <*#0"#0 <0 0" mapply: no match function for '%s' device 㿘2  @ 2 `<,@!Ȓ  @& & 㿀<2  ''耢`''''  V "`V <2 *`: * "@*`` @ 2 ’ V `@ ߠ 㿀<5RcD'' '''cD<2 V* "* @? 2V  unsupported not configured 㿘 @"  !<;"ƀ * @ root device %s not configured 㿘  <-@ X  @W 㿘?` .@# 0?.@r ` `0?.config_attachconfig_attach: device name too longconfig_attach: memory allocation for device softc failed%s (root)%s at %sconfig_attach: %sing dev arrayexpandcreatconfig_attach: duplicate %s㿈@@ +`<-@ !0V` ` V``6` 6` @m`?$  (@<-@ w!@   2@<-@ n!h@֐ & <*#0  & "@" `& &&  `@ @ & (& $<-!@  <-!@  ` +` .`$, $` ,  ڱ   $<-`!<-!<-!@ " .`*@B `@@ע@B $@ @*  <2<-!@ "  ` ` `2`R @2`R 2 `` 2@ @K`@config_detach: forced detach of %s failed (%d)%s detached 㿘  @  `@  € - `<.Z !@  <2 ` !``2 R  R @2 2   R @2   `"  "`<*"#4  "@ @*`" <.!H@  ښ `   *@`  *  @چ $` $@ 㿘`  ``(  -   $`(€ 2$`(㿘`  ``(  -  ?$`(€  2$`(config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structure㿘 $ 2 <.@ #   2"</@  0" "<!  ""@" 㿘<! !   $@` $`$ " €  `2 㿘&@Թ&<0&"@""   < 4   "`B" `44# 7 446 4.2`H H&("` 2 4!"` 2 4"`  442`H H&"` 2 4"`" (   @*`2 %s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)㿘 8? @2 `  : ,`"@ a<;@ Jb<;T<<",  $: </c</#0</#8  H 0</#@` </#H H 0</#P: @ `' ` 0`(@ `, !</ `8#X@Ґ`8@+!</`,@Ġ#p`,@"< <"!t㿘 <!t`<" "   @Ӽ  2  disk_attach: can't allocate storage for disklabel㿘! " & `"   ``& d 2 <0@ ! @Ӵ! d @Ӱ"H * <"@"@& @ & DH 0 &<& "@"<t "tdisk_detach: disk_count < 0㿘<at? "at<0@ X"`"  "`<"" " `w  dt $"$H( <@@"H"LH %s: dk_busy < 0 disk_unbusy㿈 $?? & $ <0@ #<0@ #H /* *<b@b@`''H 0  H L# "'耢'Вb@ ?? P T? & P & T?/a  & P& T`& H & L 8>` (@ CB> (> 8H(   : (: 8H( <@@" @" DH " P" TH extent㿈<1!#\#`#d    @ <"bH㿘@ \`@Ү ?& $ (& 2&   `?  "@ " '  "`#& Ho o!<"H`"HH 0`   ג 2&  & & && & & `&  &   & 㿘  " ""@@]   Q 㿘      @ 8"@'` '`  '@ "  & :'`  + `2@'  @ "" ' `""`"@ @0 @'` '` '@" ''`extnt㿘 @  @7 @ 2 0 `& `#`     &  <2!hy " @Ò # `2`f 㿐`'H\@\ H԰  ?      @°     2    " J?*7 2`"?' @ " ` ? (  ` "@8  @U@ T  o" l:   "@?  < ? 31` @ " ` ? (  `? @  @@    " ," )      &  !<2h @H@  #d extent_free: start 0x%lx, end 0x%lx extent_free: region not found㿘 @   @f 2 _  B *;@:@ 2  2 """@@ 4 2!@  (@  "&" @ ( : & & "  &" "& 2 @Ԑ<3"@ђ<3@2"( "@\ ` & d 㿘  $   `` "` ="`   $ ` <2! hݖ " ( H/` /!<"H``I  `H 0 "H@**`H p@  & 㿘 `:` #` &`  &@ " &  &`" Ho o<H@ǒH   &`  &@ " &  &` ` & Ր 0Ho o<H@H extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx 㿘 2<4@a"<4 " @    !<4 "@  2 㿘`%#<*`a"c$ 2   6     @S `a& & <<("a"<<*$ 0< @a @" <(  << ȁ klog㿘<*#$ Ho o  #%<'<5 ȑH 0G #$Ȓ!p "  H 005 @『H 0<bȐ ?"b``$     " 8  `$  @&`$ ` 2 㿘 Ho o`A <*#$@ <@&b̑H 0㿘<!`#!<۠"@-? ?`  ✒  !<׎ !<$ !<"Ȁ <*$"Ȓ $"ȁ }@/  @w@5?07 ~@2 v@'?0-H/ /<*$"@H `6" @"<Ȅ Ȅ < <" 㿈 Ē YҌ  \#\#``d#d#h@*  @ @ pool_init: page size invalid (%lx) pool_init: must specify alloc and release togetherphpool㿈\`@d#<` <6 @Ò   <:<: a <6@ "` `(  & & & h` ?:`?& X& \& P& T& 4& ,& & $& (& d& `& & & 0@?4 & 8& L& D& H& & & &  @& d & &   "?@к&& @е $@@O@& <$@@H@<bX& & & & & & & & & & h` <;<6 a0#\#`#d#h (  r <;&" &  "" 㿘 d 2TN  2 D ?&  D <" & D@``"`& `@"@ T` 0 X ,  d & ,`@& ``<`"```"H` X@H  2  `" & ` 2& @`2`&  `2``"  "`<;"" "@< d" Ypool_get: must have NOWAIT%s pool_get: urgentpool_get: %s: page empty㿈<! ``" H<7@!P H L@2< `2V ` /` H /* *<b@b@`''H 0   # "'耢'Вb@ ?? @ <7ap$  $ @ `" <7@k!x 2,  P 0 X 2   2 H` `<7@V!x 2 `   [$ $ ` \ &  H$ @{ H 2<7 \@7!` "`#  "@ D H$ D$ H  2  ?$    `# ` "`$  "# #  "$   " $   2$  2 $   D  $ @pool_put: %s: page header missing㿘 4 d @@   82 *  l`  `  ``2` `2`<8 \@Ȑ &@`" $` $``&``$`  D H ?& & D`& H&  `  ?& ```  & 0``2 <  , ( L& ` "&  D <" & D@``"`& `@"@ T` 0 X ,  d & ,`@& ```"```"H` <"XzH  [ `"W& ` 2S& @`2`M& @``"`& `@"$@ $` "& H o*@ j<"@"@$`  $`$H 0  `"&& ` 2"& @`2`& ?@@``"`& `@" $@ " & &  $`& 㿘  <@ܒ@x@ؒ $" ? d  0@ P  0 X` @ $& $ ? $&  (@ `& ( 㿘 d  @  1@Ho o<"X H p@ 86@ *  l` #  8 6@ *  l"` 86@ * " l 86@ `*``l #   # " & &  # #  # # # # # $     & @ & & `$@ < D  & D&@ &` "@#  @  "&  ,   & ,& WARNING: static pool `%s' dropped below low water mark 㿘 d    \<9@Ԑ#H   D @: P  0 X ` D * P㿘` &  <@ @Θ <@ <& $& $͐㿘`  <@ @Ά <@ <& (& (㿘& & & L& ` &  <@Ր @q <@ <& (& (㿘<;`<6`@K 㿘<;@[㿘<Ra8<.6`P@: 㿘<R8@J㿈 d H /* *<b@b@`''H 0  `v , $@q@` 2j` <;" '`$" `'А"@@''耢 &T D < " P` "  ?& " & D@``"`& `@"@ T` 0 X ,  d & ,`@& ``<`"```"H` XfH  2 `" & ` 2& @`2`& `2 ,㿘H /* '<  <;"`"Z"H 0%s: table is full 㿘<;`8@# panic: 㿘<(`'H'L'P'T'X !!"`<;H@ p@<;@ x@ɒ 㿘'L'P'T'XH` @1L   @$<a   @ H 0?㿘H` @ H p@%d㿀 < @B <;aؔ@O  >L @4  L   > @+ 㿘'H'L'P'T'XHo oH   @˘<a   @ H 0㿘<( `<"!`  `<! ````@-  ` `<a""a`+ ) ' %<(  !<*#$`a "# * ``" @&"   ""  <!` <;b€㿘'H'L'P'T'X<!  (` !  `   @@H ("  ! `" @"@! 㿘 7? 2&<<0#$`& : <)*`hH /* 'S <0  *@ *@   0<)!ȓ+ @ @ "@ "&"H 0㿘'L'P'T'X      @(`   Ho oې  @ϘLH p@㿘'L'P'T'X  @L㿘'H'L'P'T'XH` 1<;" &"  @HH p@<( `2&"&"㿘H` 1<;" &" @ H p@<( `2&"&"㿘'L'P'T'X  @hL.㿘 @^ .㿐'P'T'X` ' @LP+@?㿐` ' @9+@?%qx%qd%qo㿀@  ?N N     <=!<=!<=!O   ?,J`݀ ۀ - ,0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad base㾀'L`'耦'   '* :  `  L耦"F .`L`&@`% `1` ''? N@``XP<>"*` €t||||||||| X` <`"@ ? ?L_ @ ? ?L`: <= a` `<=a<=aҖO ` L耦"  .LLuL 뀧`"K@LE  * :   @ 5` L耦"p  < ,*@ < ,LIL`  L耦"U .L6L   L  *`: "@`  L耦"0  >.L >" N@  ?' '  +N@* ` ?&ަ?N@Ѐ   ,* ?ФN@Ѐ` `&ͦ?̒Ǩ  ,* ?ФN@Ѐ` `' @N@ l2 `  ?/   ?     @?* : ?:   ` -  ?> z:  @ ?s" ?n2   ?``     @?? ]  ?<>!p '    xQ ?`<>!  @) " @ã   ?00     @?? " <>!<>!p'쀍  ?     @??  2  ' ? "N' ",  3, ?<> , 4` `4 0 -@`402 0/-@  @`0  @-@ ` `0-@, 4` ` 4   -@'!@ '?ժ/  .`  2  '  ` LL耦" . <` `-LL耦" .% "` LL耦"  0. 0n` LL耦"| .^䀠  0` LL耦"b . 0D * 0` LL耦"I . 0+2M@L耦"5  @.`L`쀧` "@  `LL耦2. . @`L2 㿘` @@`"   H /*.`"` " @# `0"H p@ O 㿘-  `@ '&@`   @q 2`*  2 `   @U? *`}:`? $`$` ( @< & ("㿐 ( ,* ` @ $&@    @= * 2`@ 2   `@   7  rminit %s㿘 `/ <B!& & &  & "*"rmalloc %s㿘`<B "`     `" $  `" @ $    * `2 ` "@ "@"#@#`rmfree %srmfree: map '%s' loses space (%ld) 㿘` <B L"@$q$  "@$?f$d$ @ <B ?: @$L  HE$   $ @P"5"  ` `" @ $     ǚ`?? 2$@ <B #`@!" " #u    N - 㿐 @`@ +`@@"     #\ ``#`@hВ ?'''''쀧 '4  #` 2''\@   耢 ?  #2   `  &  `  ȘӚ `"㿐 @`@ +`@@"     #\ ``#`@8/  t $t('   <)K"H<)H"h @<)C"<)@"" !<)9"<)6"耤$<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '   d @"H 0 '  ''''' 逤' ` '  װ  7 2u('   <)K"H<)H"h @<)C"<)@"" !<)9"<)6"耤$<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '   Tǔ #H 0@”\@   耢 ?  #2    <$@ :`  t <)<#$<0`$ : *hH /* 'S <0   *@ *@ " T0<)!ȓ*@ @ "@ "$"H 0`"1<<0#$`$ : <)*`hH /* 'S <0  *@ *@   0<)!ȓ+ @ @ "@ "$"H 0㿐 @`@ +`@@"     #\ ``#`@h '''''''쀧 ':  #` 2''\@  耢 ?  #  2   `  &  `  Ș `"㿐 @`@ +`@@"     #\ ``#`@8/  t $t('   <)K"H<)H"h @<)C"<)@"" !<)9"<)6"耤$<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '   < @"H 0 .   '''''Ӕ ' ` '  ݰ  7 2u('   <)K"H<)H"h @<)C"<)@"" !<)9"<)6"耤$<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '   T #H 0@\@  耢 ?  #  2 Ѱ   <$@ :`  E <)<#$<0`$ : *hH /* 'S <0   *@ *@  T0<)!ȓ*@ @ "@ "$"H 0`"1<<0#$`$ : <)*`hH /* 'S <0  *@ *@   0<)!ȓ+ @ @ "@ "$"H 0`@ *@ Ӱ   2`Ͱ " "<0 @ ?*@  @  *@  ,2`     ǔ x `n  0  @R   `$@ "|"9@"{"ST e  b}"@ b~2[ @ 't    ?4  b~t[ 't  @  ?4  b}tIT 't  A" <`  't 2!5  't  `vt) 2   `<!$@`w@@ $@`  `ޔ ˒ select@`  @4&@@ 2 * * *   T 8`  ޭ 2(` @`  ޞ 2(`  @`  , ގ 2(` @u` 50~  2(   H /* * <* А  ?04@  '0 '4?/a ?0 " H 0+< +<( @%(a @@} 2I( 2E(Ho o`<*0  4@(Ѐ & (H 0$((`@a H 0(%(<<H 8ج!H p@ "((? ?%(,   #" `` ``,   ` `, ֔*   T㿘    @6+ <;"@ `@ @*`  * ,  - `  `@ܐ ?&` @ܴ  $Ӣ ' 㾐`` 8&``* a Tʔ @w 2(`?= @̒#`' @q#* "@*`@*`' } H /* * <* А  ?@  ' '?/a ?֐ " H 0%<%<(`@$(`@c 2I( 2E(Ho o`<*  @(Ѐ & (H 0$((`@ H 0($(<<H 8ז!H p@ "((? ?$(  #" a@ؔaŒ T㿘  $ ` *6@*@ 6@ `*`:`* `6@ ``@&  `E㿘@ 0 "&@€ " &@ h<ݐ 8@2&@` 6`㿘 4  < `<"6 ~ 8^ "&Ho oh<ݐ 82 (J- . 0< 0 @ ?"(H 0p@  1` 2@S @`#5<K *` €. --1@--1@----1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@---- 00@   ((    2!<[:  <"쀤 <;"x4 @Z 2&  (h@@  DL - @2&0&@`# <K"8*` €...1..1/X0t0/X111111111111111111111001,1( ( ( D$ (0$ T `2` ` :Ж  ?@ '''''''' @P`   ̐  $  ( 2`@R``" @  . ̐?$ @` 2L - D 0 T "  (H <" (*@$ ($ TL - 2` `4!8X `U ǐQ ?N$ ̐ &`  ( D($ (`0@$ T &`  @  P`Ѐ @ '?''Ԅ  '?'' @D! @0 2` !Ѐ @ '?''Ԅ  '?'' @ؖ  㿘      㿘      㿘#  E "9#?2C  "~" "}26  ##2/   ?3 >    d! ` d > 3 3 3 d*  D $# < <  "  2  " i r   @+    `    @"H 㿘  H /* !`A  D T@:   2  T 2 2  8 ` ` ` l h t" p"    x 2  `"  2 8 ``  @ 2   @  `v \ d4 d`n  4 H 0㿘  :0":::: :(:0:8:@:H:P:X:`  `   㿘  @/$ 㿘 `  `@= @@9 7 @ @@2 `2!2$ #`     `     2 2  `2 2 `   msginfo.msgssz not a small power of 2msginfo.msgseg > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULL㿘%<0  @*`c@<M,#( #<M$#P#<*c<  <M#h @c<<0!?`422``@#<* <b<"!p2<M#x  @6!<b `##@" `@`    !<b<!h"c<Mڐ# @ !h   "2 `@TTmsghdr->msg_spot out of rangemsghdr->msg_spot != -1㿘  "*V <0<*<<<NV `!`@c<h*` 2  p6   `0㤀  p`"6 6   2V V ?"<<N손!#"#&msg_cbytes is screwed upmsg_qnum is screwed up@ ?@c ``'<0  6 * * <ې ah*  `" V@ @2y "4 0o] 0l f `" `  " $ $ y@`2`  " <N&" <N "^$ B | >H T 8 @ ` .  `'`?4 4 <*   4 $  $ <J!   T  "&㿘`  @`/<0  @ 6 <!h  ` ` @  @ ᄢ``T`T@ T @ ` &Q    C0IF <0  @ <!h  `` @  @"" ᄢ``T`T@ T`@2$ $  4<*4   4  `4 4 4 $ $ $ $ `$ $$ $ ($ ,$ 4 $ < ?# @*`@& msgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segments㿘?@c` ``5<0  * * <ې ah* ` ` V@` @ F   @Ð??`  <` ` @   < p@4  " ` <O 4`  !ѐ ` 4` ư ` π  R/?<O꜐#(p@$ <Oꕐ#H <Oꏐ#h2<Oꉐ#4`? 4 `)4<<*p P<Ox#<Or#<Om#  <<Oe#* ? 2 0 p`4 ֋  T   ` @4`҇c ' -<)+<P  +`: 43`@<P- @p@[ $<*#<.` ߨ+`: ?"`<P 8` 4`VK' R` 2`$` #H` @4`90"$``<*"` ` `$`$`0$`$ %$`,'msg_first/last screwed up #1msg_first/last screwed up #2msg_first/last screwed up #3next too low #3next out of range #3㿘)?@#` ```9<0!  Ȱ * * <ې ah* ` `V@` @  ! /<O` A @" `")$` 1$`<Qy!` * <Q   @4 @  "`  "$`Y  $`2 $`<QR!@ 2  -! # ^ ` #V@` R R <*``" $`$`0$`($`4 @8 \    08 SbW02 )7<)5<Q/<Q! @  * : 4 `@p@p1 <*#<.`    2''@ sema is NULLsemu is NULL㿘!<* 2<*<RҐ <* ܀`<0<Rʐ!<0a\` 6a\    "2@ `88a\   <<* ܒ`"@ `d<""4㿘<;b䀢   "䀢"X "䀢"semconfig: unknown flag parameter value (%d) - ignored 㿘ݐ@  <; @<; ""bа"b&<R"@ &semu_alloc - second attempt failed㿘 <0<!\  <* ܆  <`` b4"@2"(#b4  `ddd<R4 `4R` 2 @"`" `2R`  "耠ǔ!\ 㿘@ 2 <"4   "&@ 2  2  L  2&@E   *`:  @-    2`R2` 222R &  *`: @3 *    @۔ Ñ. :   * `3  32" <4 5S   +   2 "R (8 3 ( #@ @2  (8``۔ 2S X @@``` ?c p-<0\  6p <*,`"* `b"f V@` @2`  X <S#L.  €OtPQpQRRXRS,S|S F<*#T<;`"@*` *  *  *  b4@` # : #b@ 4`.`*   @   `@* @*` `#@ `` ` @  \ @<*  ``""``( ``*` * ""``@8 84`F     8 ?4`Ɩ4`<*`  4` $` $! ǐ   8!  & `6 , `* @`!  & `6 , `* @`!  & `6 , `* ~@ה! zң  t`m  `.`@ Қ  c``@ ] ! X &V `6R , `* @H`  D B `>f  7, *`2 $ (Q  "`  .`` @B  ``@ ?P@   "&㿘 @@`M` :<0!\  @ 6 <*  `` ""`@!\``8@ 8!\ @  #<*.``$*@) !  p` @i  &&Z`c ""_  <0\<;U " 4O  @ \<* `@"\`@ `8\ @ #<*8 .``$* " ?3 !2 <* 2  *+`2T <*22 2"`Й+ ,  @#" "*@ `$*  ?c@ * & semwaitsemop - can't undo undosp'@`9?#  <0!l  <*.`"* bV@ @    - `*Hذ  0   @; ܚچج@*` * S@ `@ % * `2  2 2 @ ` 2   2 @2 ``@͆@B 6ؚژ  * @*`   " 2 ( #U <U  4  4@!˃ '"#V@ "Us R 2 ?4 ?4N @]` @"A`R "<` Z "2` , * #<U@R  ԐC "?VcH? -ؚژ  * @*`   " 2 0@  @``*` * 0$@`"'@f'@ semexit: undo vector disappearedsemexit - semid not allocatedsemexit - semnum out of range㿘#<b4  b4 +<; 2 +<;b䀢 # g  "˩ "䀢"b4  b4   2  2 T <WҐ BT  $; @67-<*  ,` @ *" * @`TU<W㴐 (`<W㭐 H * `*   *2 ` * @2ِ T `@  Ѧ$ $䀢%bɐ <0P @ 6?<  "`2` 0@ 0??@ <0P6 * <( 2  :`   㿘 <0 ? , @@ m <0$<0 <<  4 a""# 6 #a& ,㿘`?# <,`@*`  <0  @ @T  ?&` <*`Д*$ $  4  $ <+"`H 㿘 `<0H  6H?"@@H H    㿐 ``<0aH  * J    ?`"`  " N@ 2`e @!!  Z<0H  6 H`?H `H E <0 ?`;`   ``"   @ '@ 2*  '< @*@ ',@. @@  @  <*$@@ $`0$А 4$ &h @@ 2`U `8R <X#*` €dhcccpcp! 2@`e 0 9 7 20`O 0 2)?6 Ζ6 <*   6  & (f 2 & V $` 6 @?# @<+"H shmget㿘<.* @   4 <YВ!$ȴ  #1 ``"` @ ` && ? #*`@'  shmseg free count inconsistent㿘 <0H`` 'PH/< ` <0   7<0 $5<0-<@  : ` <+k H`? @  <  @"H`@ `0H @ <Yc!"H <, @,` ,5 @?* 5 %   ϔ  ?c , @ $% , 5 4 a   (5 5 5 `<*%  0$% 5  % % $% @ `Е:  @ P%% % (  ?Ē* 5 V 㿘`@` !@   #`" J㿘 <0(&`!H  , c  @i&`  <?#c`?"  * @*` ` 2` `㿘 `<0!H  6 `?"   ` Ԓ & 㿘!<0<0!H!H@! ` $!H<#`"` 22@ `00<+<<" H"a" 㿘H /* &`  p `P @ `H 0< 3$ p p 2  t *  @& t<; $ t !@F  t $ t p H 0 H 00H 0 H(`p@"`l@"`p"`x"`"`ąH 㿘<a""a@3  & p6 & |&  㿘`(6`@a@a < `D`"  &`D<!`$`"!&`$<"?`` ""9`?@ . 223  @ `|  ( `/@$2  `!@!@!@    <  `!@w@t!`p`@"`p@`p @ 2?h2`*@&`p!d=` 2  ``  ^@Ӓ @В`p@ `p &`p ` ! @`*@&`@w @ k``("`@ "`&``6 2  ` 2 `@S @ G  `| 2   `@; @ /`| F V`p* 2 " `p2 `l# @2`*` <&`p*@  J 2 0E 27`  2&`p2  `2`@2 `(2` "` 2  " ` " `p@`@ `p/d +`V``@` `"`p@ː`@ ђ``p@ ` @ ``"6`@.`6``p>*@&`pd"b` 2@  < b`@ @  ?"`p@ @?  <;#(  @ @2@ @y?  `@"`p 2  " @ `p2` ` `|i @2w`p@ s`p``( # V``H 6e`p @|``p@: \`p`@ T  @ T@ !L`p   2`ڀd  6`@I`(@ 7 `p`ڒ`*`:  6``6``p* &`p /@9V`ؐ@  2`p `"`pV`ؐ" 8  $ `p @!?  `p" 2`   ` `p* &`&`p@q 㿘` 2 <D `d ``"D &`d`H@d ? 5  2 `(. `ؐ   "  H /*&<]"@`H<D`d& @"D&`dH 0`ؐ6`؀ h?f  2a?  <D `d ``"D &`d @`H <I      < DV`؀ "8?<D `d ``"D &`d@`H '<;#(  `?`V`<^ |*` €xxxxxxx4 6`` B" 6`  ?6`ذ?x' e@M  {@  z@C ^@?/ n  @9#<* ]& r  @/    @)#<*  }@ R  @  @J    g@#<*  u@ = h  @6  @ 3#<*!<; , Ԁ '  Ô `!#@ z <! a `( | !  ( "  h@"H n@- @1  @ @ɒ ^@ a@v @" h  o@F"@s s@"nH c@ސ w@Ő  @<< "}@9   @ ] r@ "~@  @Tw  v@C   b@Pe@Pg  g@M ^!  @Z  @ W0őH /* &` p p ?$pH 0E @@&H /* &p d$pH 0. ` ` @ɐ%  !<!  "   p H H2   !:    $!<a""a @c " 0&&&& &&&&& &$&(6666! ٰ  ( | " !1! ǰ  (  H /* &@ $H 0 H /* &p {$pH 0 H /* &c@ ` @   H 00@2@  ) ̀€ " H 00f$$$($(`     @5 @"<  ! 4  $@ -@( '''' ''('$,$(0$ 4$$8$,@$<$ $$0$4$8$<$@* $$$ ( 7&  @  $$$$$ $H 0 ! l  h  H /* &<<`(*   .   h* H 0,hH 0 H /* &p  @  * $$p@H 0   `  `" h!   ( 2 h0~<<* <v H /* &p l# @2`*` <$p*@  H 0S ! `M ` " C  $!$|! "  ( 7' (!` @/  ( +2 '  $ !$|@Y @   4 44|4  @ 㿘c 2`*` <*D @ H /* &`A @- 4``T  H $`  p    @"   `Qܒ `ג H 0㿘 @a@R a  (    " 㿘 H /* & H 2   @ Ȁ`@ p<;`& p  H!@   H  p ည H 0 㿘Ȑ @ 㿘H /* &`  (`" @h ( `" p@b  p>*@& p6 6 @ ` l# @2` p*` <!@& p*  H`@A H HQ H 0<;" " " " " 㿘  ($   p & p!1 p - !"  ( % $"  "  @? H 2  p`@*& p @ Ѐ €   p & p㿘H o*@f p @ " pH p@㿘 Ȁ`@ 㿘`L 0> 㿘` p` `@ & p  @2  "   "Ē +   `2 `& p@I 㿘` p & p  ?@ & p        x   p*@ & & p  ' ' ' ' ' ''& & & @ ؀  p *@& p㿈<! 'L  ' H /* &@  H 0 (($| 䀊 L Ԁ HE A   <*<;`!@c "01H /* &aW `  &Sp0+` *  *  *  *  B `<*쀢`Ш ``' s` <*`Ш `` ''`И`"*"@ *`" *   * "  #@ U'<0 @Д?А @b@( E(p  @  L@ H 0  H 0 #<;#<;#@Δ!H p@   #   #"0H 05<*9<;E 2  d$2 |  `:#!@ 2 2 '  !`      d  @ I 6 H /* &p`)  %$" " @ 2H 2p $p@Ѐ € p ?$pH 0ttckoutq㿘V ޑH /* &  H`Ȁ@'@% H)<#'<d` <0H 0 a !|q p& p! "  HH 0 0` V ަ  H /* & p*   @%@ H 0  <;H 0 # !@ H p@ڀH 0<a   2`("` |& @"2{` 2v`Ԁ 2r`   r  Ȕ <*<;`!@} c [` @2&` H`` d 8  耤`?+ )</<; (@Ж ?@6  6: H 6 H2`06 @  H ؠ$"D d@6 %"D& d $@  H`4 ` 2 `4 `>&` H?H o*@ f H  H 00" pH 0` @@&` #<; & p  H!@ H p@2`0 ttyrub: would panic c = %d, val = %d 㿐` h '? @`~&`V`ڀ -`ڐ> <;#(  `?i<f!* €@v p`` @"l`ڐ@m g`ڑ*`:  @u0_H /* &`p ` @  V`آ``&`p&`6`ؐ@  @@ N ``p * &`&`pH 0V``ؠ$  6`ؠ ?,"`ڐ ? `<f!`ڀ`  `p@2 @&`p \`@Z`ڐ?6`ځ㿘`   `㿐 @< H * (@  @)@ ݔ  @  @@ ͔  p*& pH p@ 6 6 ځ㿘`p@2`` *@&`` (  ( @      ^   ^#  @ ?㿘c  p`  |  @2``@?㿘 @' 2  :`a!`  6  g h (  3@d 4* @*`@*`6 ށload: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %dk 㿈 <`!<g* *  * $2 "@’ d@h dԵ 2 |<g b`2`<gb  <gcԡ~6 ڐ@} 2 < L-<g0# ` l  <g#8<g#@ Ԃ= #Иb? '?/!`''!<g) #H@j#a '?/!`''!<g#X@S#Jd!<g+  * " *  * $2 #h@? d7L-  2  @$@<0@  2 <gcp$6 ځ [  - `-?(  (  *  "H   4*8 *`\\+8 1`08+ 8@?`?  "(   # `t"`0`tt8 (`( 2`0 `004  㿘H /* &`p H H  H 0? 2 |H p@ 㿘  "V , : @ ?ttypl㿈<!"!"`<<:<:4a\ ><<i###`#d#h `#\     "<a`" ` "`<"<㨄 "   <   㿘<   @ؔ  $@Ԕ  ($@Д  H$@̔ 㿘@  @ (@ H< β?㿘? <<2   @ ^ *`" <* a@  $@ p p @ $" ` 0@Ԑ#  c %$ $ $ $ $ $  Ȁ ` p $ p2 h p 2 h#<; t$ t !c8  t $ t p " t h<<*`( @ 㿘? 2 * "<*a << h,* €@ 㿘? 2 * "@<*`<@ @ !    "c a  23 (`("/ ('<*%<; |(`䀊 2^ `Ԁ 2Z   R   !Ƙ Fa  2 (`(2 | (``5 #<; (! " 0)   `@ (5  (`4```@r ( (`0  << h* 0@_ 㿘?2  * "<*a  Ȁ  << h*`4   㿘 l? @ `2  * "< p*aȀ  `  *"@& 㿘 l? @ `2  * "<*aȀ`    ?" `*`*``@㿘 l? @ `2  * "<*aȀ` ͐ X P`Ɛ Q 㿘?<<2   ) *" <* a  ?& Ƞ Ȁ   h<j"<<$ Ȓ`D*@    $ ,$,㿘? 2 * "<*a << h D*   p$ Ȕ $ p 0? 2 * "<*a   %<;`n l # P! d p`@`` ` " S ` @  ,`@8 ,`E " H ` "  H  :,`7 Àb€` `` 2T  H d 8 @f  `` " dT  H   p` $ p H 0?2  * "<*a     `p`@w`  "9``( o`` "(`(`(#  d@8#"  88 l`p @Q @{`(` ݠ `( @ВB1U R  d@8  D`p @) << <``( # ``!2 `h ``p `h* ?  ` Π  ` 2`<; `! "{`p`&`&` # 㿘? 2 * "<*a   H /* !`A p`@`H b"  ``  2  ``  ` ``p @`  "( `( #``!`` p "   `Qؒ `Ӓ H 0?  0 ("@<*`ȁ@㿘? 2  * "<*a   ` @$` "`  " ` @, ے `(h w   @, ̒ ` w$` #2 * <a,*@ <k H2 `h  i@"Y w@"/  _@"^w `h  @R  f@"7l `h  @   @C  p@"] `h  @W  @*T `h3`H<#@2`|`| 2`|  `&       ?     ?$    ?$   `H@`H `h`  `  `|  `@{ `h<<*`8 @ a 6` !@  `H,   T  `(0 -  @   @  @!  }  u@"   @" `  @   @* ` @, ؒ  `"  @ " @`  ``  @  `ߒ`$ ,  㿘h( `b`  `@`<)<)G"HE"h<)<)@">" da<)<)6"4"<)<)/#-#(@@ @<)<)#H#h@<)<)##@ @@<)<) # #耦@<*<*  (H /* '   > & & "H 0   Ͱ?@`:  h4( `b`  `@`<)<)G"HE"h<)<)@">" da<)<)6"4"<)<)/#-#(@@ @<)<)#H#h@<)<)##@ @@<)<) # #耢@<*<*  (H /* '   `:   >v & & "H 0 `7<#$<0 <)#@ :@*` hH /* 'R <0  *@ *@    >0<)!ȓ+ @ @ "@ " " "H 0? &` :  @͒  &  & & && &  㿘 `3<<0#$`#@ : <)*`hH /* 'S <0  *@ *@    >0<)!ȓ+ @ @ "@ " " "H 0 `3<<0#$`#@ : <)*`hH /* 'S <0  *@ *@   t >0<)!ȓ+ @ @ "@ " " "H 0& & ?H(#    "` `8("@82 "  " "" " H  㿘H /* &     @ "  " 4@e& "  &@&  &  & & H 0$@㿘 H(@F`2 `` `  =`: a`#  2@.`8( &> !` @ꀦ `  @HH(@`""     4  ""@ ""`耠"" H putc: required clalloc 㿘H /* & @`@`2` ` 2&`<pˬ#А$1  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**/+@` `8@ + "@8*  "  ( @ ( *+@   @ * +@ @ *   +@ +@  &+@b_to_q: required clalloc 㿘`S H /* & @?`;` 25&<q"X$  /(&@(  " " 4 @ה  }"  @@ &&@& & `4H 0  << (<(` (  `@"  @" "  "@  8("8" < (  "@ "    8 ("8!"@ ?H(&  2 "  "   ` `8 ("@82" " H  㿘0zs?㿀(   `  @_`<=?''''' H*` <> '''  H*@ 0 㿀``(  a `  @^Ւ`<=l?'''''l H*` <> '''  H*@ 0 㿀``(  a `  @^`<=ᘔ?''''' H*` <> '''  H*@ 0 x ( ! ` %  a@  q@2 <=! ` ' ( Ĕ?''''''' H*` ذ㿈(   ` <='''' H*` 0]㿘<c<<!<E#c# <F<#c"<K<H"pb#c" #c" "``#c` "``` : `  4` * ``2`<'c<. "c <.  d "@ <<"#"<t! tܔ <t!\ tה <" "2 : " 4  4*   < "* "   2   : R   2  42  42 4" 4 *R  㿘`-  ' <#"" *" 2 *@: *0P؀4`  4 *㿘<#```:` " 4 ` 4* ``2`㿘<!<``"!`` : ` (  4` * (``2`<0a <t2 !\:t  㿘<+ (<``" (`` : ` $  4` * $``2`<0a !<t!@ s mbplmclplWARNING: mclpool limit reached; increase NMBCLUSTERS㿈<(<t#b#\#`#d#h    <t<t#|c!<!l;`<tb#\#h(  y <t!L <㿘<b<6`@z 㿘<@z㿘@H o*@g@?<(#m `H p@ "#<(H /* '<(.` `2 H 0 6  & && 6  <(`` "``` "`㿘@AH o*@g@?<(#, `H p@ "$<(H /* '<(.` `2 H 0 6   & 6 &&  <(`` "``` "`㿘H /* '<#` `` : ` ,  4` * ,``2`<*!p   `" @  2 H 0<(`` "`㿘H /*'@?<(# `H p@ H /* '<(.` `2 H 0 6  & && 6 㿘H /*'@?<(#w `H p@ H /* '<(.` `2 H 0 6   & 6 && 㿘H /*'@?<(#> `H p@ H /* '<(.` `2 H 0 6  & && 6    @ l0 㿘H /* 'T <(*`@ ?2@   "  0@  4"`4 4 0"0< !l    ( $  , $ ( ?4 <(#H 㿘 A<( )<('<H /* 'V *` ?4   !  0@  4"`4 4 0"0"  sl    ( $ } , & ( ?6 _#H  㿘H /*'@?<(#y `H p@ "T`H /* 'T`<(* `2 H 0 ` 6 & && 6 ֐ 2` `& `& `  6 & ` 4``c& d " ?@& & m_copym㿐` <wՐ!`  2 `<w 2 Ɛ! $ 􀦠'<( @?/<( 沐"<wí!H /*' H p@`"V H /* 'V *  5 H p@  `4`$`$@$`4`N `$`! $` c$` ` 4`" $`"$`$`  "8$`   "-  $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4H /* ' ` `  4` 0$`4$`0& 0`0" 4H p@ "`@@"` &n   <b <b "b㿘H /*'@?+<( `QcH p@"V H /* 'V <(* `2 H 0  4$$$4 $` $` ` 4`$` $`   "+  $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4H /* '  4` 0$`4$`0& 0`0" 4H p@ @)  p<(@? H /*'cْ H p@ "V H /* 'V *  4 H p@   3 # ## 3 8 <$ #   ,  #  #  #  $# $ (# ( ,# , 0# 0 4# 4H /* '   `  3  0# 4# 0& 0 0" 4H p@  @   <b  "bm_copydata㿘``<y <y 2   @ &@ `#<y 2 `" @@& 㿘 2`  2&   `  @  &@\``  @  & 2  S `&`$ 4" "@ " " `8"  4"     "  !  "  , 2 " 6" "2  2㿘` `d``  `d@` `d` &@L H /*'<(# H p@ "T`H /* 'T`<(* `2 H 0 ` 6 & && 6   J& ` `& `& `  6 & ` 4`   ?&'<.)` @   ` 8 ` @ &@& ` $" $` `$`$`ڀ`` &X<`  "`㿘 ` `@`$`װ ` `Y"H /*'@?<(# `H p@ "TH /* 'T<(* `2 H 0   6 & 6 &&  " & "& $` Y d `d&  &$} ? d u@H /*'@?<(# `H p@ "T`H /* 'T`<(* `2 H 0 ` 6 & && 6   l " ?@& ` ",``& ` & `$& $`(& (`,& ,`0& 0`4& 4H /* '`  @6 `0& 4& 0$`0 0" 4H p@ `&  @{@& @$` &$@㿐'  H /*')<(# H p@` H /* '<(`2H 0  ` 4`$`4`$@$`    d # 0$`$` `$`<(  5%H /*'#ؒ H p@` H /* '`4H 0  `4`$`$@$`4`9   l$` %8 (5` H /* '<al  $`  $`H 0` (` $`4`$`($` $`$$`4$`0` (8$` 6  2 $` <'# @ 4$` ` $`$` `%@`@%@&@`k㿘 I  @;@  &@T`  2`l8 l" $@` @4@$"` @a& @ 2T`X   l l" $@4`    && unixsockpl㿈 <<|#h#La#\#`#d   ͘ 㿘<! E  "Z +  2T +O )H /* ! <#L  @ $  $ $  $ $4<~<!Ԓb$ $ `$ ``$        @k4 H p@0`<#@  4 H 0&@ 㿘<a H o*@a    H p@㿘H /* !       "  H 00 `  4 &  84 4H 0 㿘      @ W  @ ) h@<#Lsoclose: NOFDREF㿘H /* !    @ 3 @^  2 @ ) @T   ";   ' 2 @ǐ 2!   "   "   " %<&H /* 'V *` ?4  "#<(0@ 4"`440"0<!l ($,&( ?6c& XH  X ' V   "&V'  쀠   ?6  @ "8 "4`"H 0H o*@a'& "e 2" Do  L" & D& L``("& L'@& XA'@H /* 'V<(*`  ?0  "#<(0@ 4"`440"0<E!l ($N,&( ?6c& X/H  X2& @`@ $ '@ "&&  D"@& D @ 2 "  & @  @D6 B?$@ 1  -@ D " X d ? 6 d ?6 d  dH 0y 2     ``" 8   "V   2@ D2"& X "       耠2XX   d ? 6 d ?6 d dH 0F dX" d  d ? 6 d ?6 d dH 0㿘`  ``@ (        p D   @ 4 @0 4 H /* ' @ː `4 4 M  ? $ ' '' $  ' ' ''$ $ $ $ $ $ $ H 0` ` ` `@ @9Ё㿘?#'P@  "ȶ * `  @Pð *":"? 98 *"4@/ *+ *  '  1"y *u *4q *I"~  2z  6 "t  (p ` W6 *T6 "c  (_ `) " l 0@ &> D h@ 6D 7@8.& x H@8(& T"7  81 <0@  <0$@|Đ @c@  ! 06 6 f   ` @P G㿘?#  " * `@ }  Q&` 4 "MV @"HV "CV 0e"@V 0b"=V  "8V 0Z*"3V 0U "7 T "0 l""V 0D % "" x0; "` "V00 &`  ` "V `+"`V ` &"@ 8"@"6 8 H`" 2V fV <0!  &` @|`"@|<0@$`" *& 㿘 <   0      \ 2 㿘   =  6 @ǒ @  d <@' Dv 60s 6 d `<`@ D < @ h㿘  6 8\6  `<`@ h d < @ D㿘  6 0E6  `<`@ h d < @ D㿘T 4*` T 22 T 0 @  : M <cL, 4 @} 6  6  6  `6  &  66 6 <& < &  &  &  l@ H@&       @0Ð ` d < @ Dݐ 6 @6  " 0 2 0 2 2 2""( (",   `   2 0 20  "2 22 ("  , , ,  , ( " "  㿘 `6  < @> h㿘 ` 6  d < @1 D㿘 !  @6  <" <)<)6"4"<)<)/#-#( <)<)#H#h<)<)## @<)<) # #耦<*<*  (H /* '   TzX @#H 0@wSԚ `  П̰ 耢 ?  #   h `$';  < n <<0#$`$@ : <)*`hH /* 'S <0  *@ *@  z T0<)!ȓ+ @ @ "@ "$@"H 0Ѐ p`   "`0'``  `'`'''`@''Ԙ'@ٔ؁8`o  䀢v ư (*'  <)K"H<)H"h@<)C"<)@" <)9"<)6"耢<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '  +  yN "H 0* ` * '@'@@  `'ܔ 1<<0#$`$ : <)*`hH /* 'S <0  *@ *@  y 0<)!ȓ+ @ @ "@ "$"H 0h''̒@԰     '쀦''''?' ` '  l    @`wܡ* (4( "  @ <)<)G"HE"h<)<)@">" $!<)<)6"4"<)<)/#-#( <)<)#H#h<)<)## @<)<) # #耤<*<*  (H /* '   TxV @#H 0@uQԚ   'Ș     Ȁ@ ?  #` `=  <Ȕ # ଖl <<0#$`$@ : <)*`hH /* 'S <0  *@ *@  x T0<)!ȓ+ @ @ "@ "$@"H 0 Ȓ"@'"1 'Ѐ2' @"  `2@ $'~Ȱ ]Ȁ&s   @Nа  H̀ @?#@2;& " 5& ?""  '̀ 2%'`"` 6`Ȑ &`5@`  ?ȶ" 'Ȕ  &'&Ѐ "à [㿐 @d@ ` 㿐 @@V ` l `  H `  ` "`0 $ ` ``㿈 '@@. 8`  `Ȕ  0,' `` 2` `"쀢 ' ` 쀢 㿀   @  깖 7\  .<;"& " 2 2 "[䰒 2 "" 2@?&  \5*`" \/*`" [Y㿐 @@ ,`@  %        ` (`'`)` `# f㿐 @o@ 2`   " * 9`  # ˒      ` (`'`` ` ,㿘1  /lT <<!*@ v $  $  T  ?4 *`$ ($ $ $@ $ ,$ 4$ 0 $  㹐0$ *  @*`2P   &" 㿘 ` <<" 0 @ D5 2 dА   < ( 㿘 ` <<" l&` V`<<!*  u &``&` ` ?V`6`&`(*`&` &`$ &`,&`4&`0` @r`㿘 "<< ` <<" l&` V`<<!*  uu &``&` ` ?V`6`&`(*`&` &`$ &`,&`4&`0` @ri`uipc 1uipc 2uipc 3uipc 4piusrreq㿘``   - ``2 ` .`<! €MPNNN0QON\NpOPQPM\QtQQNH  8@1@   @4ް@ٰ0@0T@  2"<<|! `L $`t" @&`t`L$ $ `D`l"@  &`l`D$ ` < O h0]! @P T@ % `<`   8@  ⿐0  9ה@f0| `2`0<'!( @ ?"`0@  `D 2  ⓐ m `L$`t" "@$`t `L"$ `D `l" "@$`l `D" `d < C0?!0@a 5@07`l&HT@  ? "?`D@&H?& `2 (<`$  "` ( &, ,&& &0&$&( &CA  -00<!8㿘`  1   *2 *"  "   `0 &`0 ?&`0Ȑ 02  *  ' " `0 `"unp_attach㿐 l "V H  4V << <0 <<<<<<t U"" 4# sϔ  " 7$& $$ $ $ $ $ $ $ $ $ $$ ($ ,$ 0@* *`" *  * $ ,$ (㿘  " " l@ &  " @V  @ 6  "`  "<t9 <!` t/ @"t+   `  sp ` ͒ `  H H'p- ?H'l't@ڐ 2yX \<> D'8'<l$ D`H* @8\@=0@@8[ 0< !  ` ?   ? ? (? 0? 8? @? H? P? X8????''@<>\' '$'(', $? H*` € <=\ 8' '$Xl$?$?$? 8`H*` € X<>$ l&&&' '$'( H*`   s 8`   rٔ ` 6 `  D ,'''''@B K`h C &<=@'' $?''`H*` € 0`l`", =TV@@' )  `` # 2` =`   ` r &`@o``&`0&0@@Hs% unp_connect2㿘V@V@  )`" V  <""  "  ѐ unp_disconnect㿘 '& R`` 2  $ < 2 !H@2  $ & ` ?2`$ 㿘R`   D㿘4 8 ` $   "r r unp_externalize㿐<! `   ` ?2  @ ?T  `h 2 `   @ " `@&  ?V   @ `$@k@ "' (0%@,-<1<  4 %U " `@*"@%@`, %&`  㿘 `  ``?#@2 @  2  ` @@`*`  v &@ , #@ @  ( "  B@@ ?&;Y H /* '<al   &    & H 0  (  & 6 & (& & $& 4& 0  * 7 @n!@  @` @ $@@ & <@ * @  ἐ `22  ἰ 㿘  @R  * lL< \?2X 6& \<>X'' PX H*` €  , # ,' $"2 @㿐<! \ < ( @ݘ `$b!``$ $`$ <>`\?2X 4$`\<>X''`PX H*` €  , # ,` ?"'<>@ 4, <! < ( @ $b!$  "$ X\?X 4"\X''PX H*` € , # ,@ΐ  ƶ`$" @㿐\#`'P'T#\PTy 㿐<! < ( $2    P  D   8 @@F=  $? $! @ $ $H /* %  P@q P `0 "`0 Pd "dH p@ $@  P<>$ $X'X' H*`   @@Y㿘 㿘<!  8< (# @2 ` *`" <* bh@@&0" $  $ & $0`"0H /*% P@H  $ }& $@㿐 $<> & $ P'' H*@ 㿘<c0 c0"c0  $ @  $?# @& $ܐH /* % $   $ 7& $ $"@ $ & $ $@" , $*@& $ $` A , $ P $@  P @ $ , =& $`<<#" &  "` ""&  $@< " $ <"<"&  & "@" $?ߒc & $H 㿘@l  <0< ah*  "  D2  P2 $  2 D getblk㿘@k <0< ah* @ F< D2> P2:H /* % $`  $ @& $pH p@ ٰ 0E $@ $& $ H p@ H 0 2 D $@˒ "@@ &@" $@& & D& HH /* % @H @+㿘 @   $ & $<tt`&t" "t& @allocbuf: buffer larger than MAXBSIZE requested㿘<0 @d@kے@ ( ,<N"؀"h& 03 '<@h   $ $ $tt`$t" $t$  , ,$ @ 8  < < @ @" ,& , , 0"@$ ,$ 0n ,*Ӑ (3& 0H /* %<#   H 0& 0H $`$ $H 0 < , <@{" ,"$ ,& , $@ $ $7$ 0& 0getnewbuf㿘#<H /* %b     <0 "#0<#0H 0U  $@ $*& $ $`& $H 00 $ & $ $`" PH 0 $`& $՞ @H 0 \? & $& 8& D& H& L& (& 4& 0& X& T& h& ds= & \ `?"s6& `` "` "biowait㿘H /* % $"  1< "/  $"H 0 $d $  ;$ $0  $(  ( " biodone already㿘 $"<(# $"& $ $@ @ $ @  $  L& $€4 $ ^0 $ * & $F<耠  㿘<<"`2*@&  <b` "` * &<<* @ؐ  ؑ*   2  @@2L (2 @f )   2  2 <b`  "`%< 2& @ $`&<b` "` `< "`   "$  $ ""[ <b` #"` $ <b`  "` b "b `< "`   "$  $ "" ?4&@ `< "`  "   "@` "` "$  `   ""@"   "@$  $  "`  "`"$  㿘<<"`=<!<. @Ȓ *` .<" 2&$ 2" "" @@2  " J(& )&@ "@f&&@  2 <b`$ "`$&@?㿘<<"`#<<0!4c@ %<<ڐ!(  @d Hc%<*$c  ` "` "  "@ `"   ""@"  "@$  ` `  ""@"   "@$ `$ `@ $ $$  @ )$ , (*@f#:$ ` $ `""`<*< @aؐ  ص* @@ $@" "@$ $ `/$ @,`h (L (  ( `L ) .`L * . <`L ) .<<.`@#Ȓ @ *` $  "`"$ ncachepl㿈<!"!"`#<*!<0<!4ؒ } !4`$`ؒ`:`< | <."c<:<:!4\ <<#`#d#h!ȚcX#\ H  K <bx"bx"@<<* ؇(*bx" $ 2 $:bx"@"bx<a`B `":`D""` 4`"```  # ` ` `" `@" `@ "`` `" `` "`ḆḀ"`a` ` ""` 2`cluster_read: DONE bph\  $ $" 5  f@    $<% $ ` , ",   <` `& & `? >`@_ɔҺ@̀̀ -<> H ؐ '''*''' @઒  ܀?؀3 @4    : * &  < `*` 8 ؐ ؒ&  '؀ #d#`ܒ#\d@f`ܒ ;`@_i% H8s @n ْ i  H ؐ '''*''' @઒ W ܀?R؀"7 @4    : * &  < `*` 8 ؐ ؒ&  '؀#d#`ܒ#\ @b   $ܒ@$ $$ H   <a , ",   $"<><!АX'' PX H*` € ` $" <> $?# @$ $Ð X'' PX H*` € "   0@_ D& 㿘`\  d; <@^ @  .  $& H@& $0 !  $"& H $<0 @& $@_@f< 0o]0l i@ے a  `$b ,@`," "4 <`< @ @l" ,"& ,`,$`, ,@@ʀ`! $<b4@,& L& $  +fJ `&`&@&`&`  @&` ,& @ <`<@D@  0  ,& 0& ,`$$`H`,@ "@$`,$`$` `*"@&` @cluster_callback: too little memory㿘 $(  ( @& @ @f  <??$  *` @ < ,$ 0 $ , $$ (($ $? ,$"@& , ??$  ," & 06 <<Z"" 0@ߐ& 0& Lf~ + $0 $ * & $h D P $`t$`x$`$`|` "`D`t 2 `D 0`|;`  H "`x`D@@^H`?['`t<<`x"$` 0   ; @]l;`2  0@2  0 2 04 0'@v <>T'T''`H*`*  耢  1 *f + 0`x @v 0 ̠ (e +F$`t 0  ; @]< <>@"̔ H̐! '?'''! `H*` Ѐ  H? ߐ$` H$`t$`|$`x $`$`xӐ$`t$`x    @) $`x$`$`t H$`|Clustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocks㿘  ?-  ` 0 ? $`w0 0 $`20z?Ӑ,@`?ʐ?/   +d 0$,$$$ @<$$4<  @$$$L@$@g-<֒ ``[`  `$`2 5I   $ ,H: `H@ !?D<o"`Hk`D<̐"`<@R0!,@$0$,`$ $`$`,`$"@$`,$`$H /*%`P@`Pd "dH p@-  " @  $ $$$@$Ld +ΐ?"3㿘x +t "  *  c x & &  ,  `0G? ` , "  & ..㾠'D 'P <=@h'('0'4','8H*` ( "(" 'D'@'H@<= <'X#` @'T'L'('4'P'\'`','0` H*` ( P@pD u&@ @@D l c "" Tc (خ   +<= ?''''''''c''' '''' c'`H*`   `   &` $$ `   ` " @ `P&@ @`@`H&  @  "  @)D cْ T㿈r  ?2@$-&@@<>@''' H*` #@` 2&@ 2 &@@ 2&@@Ɛ&@`@+ ?@$x\'D ''؀`  `2`4<#h`4-D 6`44 24@+ɒ D'D@+<=؀c'ؒ /_*] [ @DW'D U`h `(` @D'''''` H*` €ఒ >D 8 `D @`'DD`Ր `42`4@+ D`0 쀢@DܤؐS?  ؀'ؒ /*ܸ?'D@'܀&܀ "D@$D @@G㿐#\  "[ `?㿘  ` `?` 㿈`4 % " Tb 2  ,`4  '#\;  "   $@&@b T -operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operation㿘 <<1<2 <<# "M" * #@ `2vfs_opv_init: operation vector without default routine.㿘!<<#*` 2<<(#x<!h  c* " 㿘 '%<h * a h*@]' @`"@@ h     2㿘  b  "@ 2<>< "ah h  "hmultiple `%s' file systemsvfsinit㿘@j<<"<@ ʐ <5c@  #<%<@ " a3 㿘W`   "@ @ B&  2 `  7`ް `` @2`??<) DB?<)H /* '   8 (`Ք "H 0< < $ $ `$ 4 $ $ $$ (\ C4   <r<0o<@@ <)<#$<0`$ : *`hH /* 'S <0   *@ *@ a= (0<)!ȓ*@ @ "@ "$"H 00f@Y<)<#$<0`$ : *`hH /* 'S <0   *@ *@ a (0<)!ȓ*@ @ "@ "$"H 001<0#$`$ : <)*`hH /* 'S <0  *@ *@  `ؒ (0<)!ȓ+ @ @ "@ "$"H 0 㿐V  $   ()<) 3 @<#$<0`& : * hH /* 'S <0   *@ *@ ` (0<)!ȓ+ @ @ "@ "&"H 00 #$%<<@ @  `" @   @ @"` @2`h`i ( `h`l@<<?*  @ , 6 @ 6 & & ,`(& 0`("@$`(Ȓx    ,` 0"`0"( 0 ,"@`1 (ܰ@ 2u'@  @  `< *` €x "& V    R 22@  2<)<#$<0`& : *`hH /* 'S <0   *@ *@ _ޒ (0<)!ȓ+ @ @ "@ "&"H 0u V R@ _ (j  @   @  " B& :`@PV  R 2$@V  ` 0"`0"( 0 ,"@# , ( ,# 0 ("& ( $ 2 ,   "'`  &  "@_s (M  '& #   B@; > "&  B: @ 㿐  2v'0}o @?`v< @*` €T0t "@<)<#$<0#@ :@*` hH /* 'R <0  *@ *@   _ (0<)!ȓ+ @ @ "@ """H 004     @ @V $"  ( "^   B : ' `B  : @R  㿘@) #  6`6` >@ ?2   ?2   >` @ b `B >` @?  0&`&`6` 㿐  ' R` 2`    @ 2V  lf_findoverlap: default㿘 '۰ `` `@= "  `@5    ? 4 @2 "#   4 2  ( 2     4   8  & '       "      2o    ?c  @@  ? @ 4 2J   D    @ 25  @  ? )   <   4 @    < ?<  <z# . 㿘 `@2   ` @2 ``B > I&` `@<) `@ ` B?> 8&` H /* '   8 (\Ŕ "H 0; ;  ;  ;  ;  (; ( 0; 0``B ; # $ $# (` B?> # &` & 㿘 $`0"`0& (0,"@" wK  $2,H,$ @$0``d <)H /* '  $ \j $`$`"H 0 $`z$`zÖ  "  "$ `\ $`  @`2 P` $ <#h$ `J`/" `D`8<=``  '''''`H*`  a< +<><)H /* '  $ [ "H 0`` Ф$ `  '''''''?'''''``H*@ € 7 <<0#$`$ : <)*`hH /* 'S <0  *@ *@  \\ 0<)!ȓ+ @ @ "@ "$"H 0<2Ȱ  #İ ?(9`@X<)<#$<0`#@ :@*` hH /* 'R <0  - *`  \ 0<)!ȓ*@ @ "@ "`"`"H 0$`*@@$`J@ / @A  4 24`$`$@ː 5<#$<0`<)#@ :@*` hH /* 'R <0  *@ *@   [Β 0<)!ȓ+ @ @ "@ "`"`"H 00`@@> @7d<#$<0`<)#@ :@*` hH /* 'R <0  *@ *@   [ 0<)!ȓ+ @ @ "@ "`"`"H 0U $`R   @@2 <>''' H*`   `$  ><#$<0`<)#@ :@*` hH /* 'R <0  *@ *@   [A 0<)!ȓ+ @ @ "@ "`"`"H 0@t@G$㿀$`$   `"$ $`@* $`- $@#R`J /! J /"" " $$`h`n J 2` 2$`c $`   $`$` $`J  /" ``$`J` `"`$`E ?$" $J`/2`J /"""@$$` $`*@$` J 2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@$<=  '` @444@" <#h 2 0$$4 44` <=`!"D$$ '' ''H*` 谒 , ?0 ?D`8 ?'` @\444@"<=`@ ` @ $`4 2`4` "" $` "@ $$` J`2`  $` @2 2h @H 2_`@$h l `a"` @@ @"$$` @ R$`@5  @ `$`@``"@? # `@`$4 242`@` & <>'''H*`  `   @@ <>''' H*` @@$relookup: null namerelookup: lookup on dot-dot㿈 @*&` @!J 2<3#0@<=<+#H<=  '''' H*` 谒 ?EC @A  4 =4 4@?  @`4 4`42@t % <>''' H*`     @@ <> `H '*`'' €@P@#&@vnodepl㿈<:<:a4\<*<<<*<.< "##<#`#d (#h"$a@#\    vfs_busy: unexpected lock failure㿘 8@`  & 8rX   @ T   <!㿘  Tה vfslock㿘<<#L`8!D@@S  ``D`2@`*!D W  @S!D<   TH    $ 8$ $ $ `@ |@$`@@RҔ  /,   Yvg &  <<DD@" `` 2 @`d 2@ @ 2`` 㿐@4<!(<@ *`8 & ` & d 08 `+ ?* 2` @ << D  D ''c8 `'6c8 & `J   *J8*` @ ???" L: P" `"" " " " " " : " (" <" 4" ," @" 8" 0" D" Hvnodefree vnode isn't㿘<<<<` ! <0!4%<*`  <.%<<0!4@ <."$  @Rǔ /$ 2T 4<!h&4  " L<!p`" P P"`P<" `P`L"@z`h$`P$`p @O$`l$`0$`<$`$`$`t$`|$`x$`$ hV$ $ H@ & 4 4$$   D ` T X X T X ` " D`" T` T X`"`" Xvwakeup: neg numoutput㿘 $@ P*@& $d? "d<.#p0d  {"0qedvinvalbuf: dirty bufsvinvalbufvinvalbuf: flush failed㿀`<="t  H"t''''*' @ 2 ` "U`<#P`''P H*` €E \  #<`D &7H /* %$  $ @"$ ` oH p@ " \J$"$H p@$ <>$@"$ Ā` \  ` ``D ```2`D`` `` ` ``D ```2`D``2   ` < y vflushbuf: not dirtyvflushbufvflushbuf: dirty㿘H /* % `& <$ $ Q"$@ "$H 0P@` 0ݐ 0Ֆ``2  dH 00 #< 0 d& 0 bo  d 2 0H 0 ``<"@K0bgetvp: not free㿘`P " 8< P & 8&`P h`? l &`8&`8 \ &` \`"`  \& \&` brelvp: NULL㿘 P2 <ې  P !P#!@  ` "`   "&  P& P8?"8reassignbuf: NULL㿘`2 <U!p0!P#!@  ` "`   "&  $ `\`` &  "` "& 㿘@  㿘@ 㿐?<&@c  Ŗ &@$ h@  '@&@ 㿈 h<` ! } @6 @6` ?<* c @ %<)@ l @2 h h@2 V 4 @` ꀦ 0 2 l  <)  h "4<>H /* 'h    T $ l$ l"hH 0 l"`  l "@ l" l"` l" $@ 0$ 0 0h@O& 0 ''' H*` @  H& H & $ hvget㿘 0a b& 0< m # V 4  4 L`" P P"`P<<"#@ P L"@ 4`` 6 4@@ @7 "@2 㿈 4<?a * 6 4<> '  H'*`' €0<<& Lc<` L& P`""`<>p'p H'+ ' @㿈 4<?a * 6 4<<c<& L` L& P`""`@@`  <> p' p H'*`' €㿘<!    : D/ T 0 2)" T 4T 6 "" h 2T 4  " h? @  @'<$ H̒  2 D`  vclean: deadlockvclean: cannot reclaimvclean: lock not drainedpV 4  4 6 4 0!"!< & 0<>`@ ` H''*' @@g`` ? Ԛ `<=  H?" 'И "*''@ @<> p'Ԑ p H'Г*` '<> 'Ԑ  H'Г*`' €<> 'ؐ  H'Г*`' €Ѐ  <  4?* ` 6 4<<& Lc<` L& P`""`ꁐ `> `@<< 8@ǒ <<0#$`#@ : <)*`hH /* 'S <0  *@ *@   S 0<)!ȓ+ @ @ "@ " " "H 0&  0<"ؔ & H& 0& & 0m㿘V 4  @ 㿘< @vgonemissing bdevmissing alias㿘 0a b<& 0 k 0  D  h? 8}V 4 l`x @@ `"@ "``"2l2 0<# 0) l@ ` l 2  h h@2    2l<Ӑ#0 7 0 0 l& 0<<0#$`#@ : <)*`hH /* 'S <0  *@ *@   Rܒ 0<)!ȓ+ @ @ "@ " l" l"H 0& lV 4 $  Pz"ۀ@<<< < L """ P P L"<<& L#< L"`P L"`"<<& P & h3  ?<( l 2 h@2" 2l㿀@". # @ !<=#?.` ` Ԕ䀢 "`"'''" H* @`@.` 㿘 0(2 l!T 4  0@ ` l` `h h@2  R4  2lVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %d, writecount %d, refcount %ld,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBWAIT|VALIASED flags (%s) P <^ `h<<P* <V`4 V`6S`8`0 /<a@L`0 <a@L`0 <a@L`0!<a @L`0"<a(@L`0$<a0@L`0(<a8@LO <!H` <<!X0 !`<>aL'aL`H'* @h`(d #<"t 6\ -X<<#x* "S -@Q "N -`0 I\#\`0 ?    `7 -<bto?/<+ "t  6& -"<<#x* " -@ '@@K  '`@''`4''o ( -kinfo: vp changed 㿐 <  ` *` * K&@$@&@G /<<@DD =5<) 7l . ''+<`D <<#t`e```Tn  2`n `''Dɐ$@&@  l`   0" @" ` l` 2 `h h2``2 `2l 㿘\   8" $04@L P 44 8 "$ 8`$€@Hd 1 Oٔ @Ky Xn\ v \@$d_,d" \`nq c d@$ g, `,  2 <#` @2`` ```2@ 2 = 7 "*    20& 0@! 8 @<@R@VD@K6     $04@Lh P 44 P 1㿘`   O 1㿘  %<4`   (O &` 㿘@a 8@   @)  8*& 8ؐ 8 |& 8a!@ @ 2 8& 8  " 8!& 8 㿐 A'<#<b Ӕb$`$b<<0#$`#@ : <)*`hH /* 'S <0  *@ *@   O T0<)!ȓ+ @ @ "@ "b $"@ $"H 0b"`$∀ `  <"""$ $ $ $ $ $ `?$`d$` | D (  0r4 \h`f<)H /* 'Ȁ  ! TN| $`$$`$"ȑH 0h  $lݖ   $/Ғ`J@  @ 7 $<c$<0 #@ : <)*`hH /* 'S <0  *@ *@   N T0<)!ȓ+ @ @ "@ " $"@ $"H 00− " $∰ 㿘 8! `* @` `€  2  8"2㿘`    `I0 .     * ! 2 @` Uݐ  2  2 2   @2  2  2 @  vfs_unmountall: no context, aborting unmount of %s failed with error %d WARNING: some file systems would not unmount 㿘<! )<<<%##D  +<  e 2@ " c #D2 <#syncing disks... %d giving up done 㿘<y ȓH o@< ( @ɔ '-<+<)<@  b* "@*`   <"`$ "   "< Joߢ@ <<> 0 ; <(` {vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNETvfs_mountroot: rootdev not set for DV_DISK%s: inappropriate for root file system root file system type: %s no file system for %s (dev 0x%x)㿘#<a`2@<Q"0  <!<"?"<<D"X!<"? <<<""Ւ`5 " " <<-Ȑ" #L  4 " D < D 2 4  a<"`a <<"#<!X O㿘<<#L  @G  D 2㿘'<<L   @G 2 D  2 < ,@LL & DL D"`H$L& H& @㿘 @ << #L" 2 D D` H"`H D H"􀢀"  <ɰ filecorecodaext2fsadosfsunioncd9660afsprocfskernfsumapnullportalfdesclfsmsdosmfsnfsffsufsvfslock㾰` @'`'8'\'<'dq8 g H`@`@R<;0 2DU  8  `<;I -<;"x`@ @`@ @$ 8 @ h` SҒ!: - ` `aF``&``&`  :#<>`'(','0`H*` (`"x`   <=@''''' H*`     " S!:  `" `7ݰ &`D`8&`   ǚ h ð @ i "@`<<#x*` `@F@ <bx@FR  <bp@F3  2l  !D  K  @F!D<   G{   $ @ $@$  @ $ h` " 8 8 $ 8&ߒc $ 8`  ~ @  $ 8` 8` 8@@ Ԑ 8 $ 8@* $ 8$ 8ǐ0@1 22$l$l<<D$$ D #<>"D"D"`@2`'''`H*@   @  0 @$@K< Zmount: lost mount㿐V 4 : l € "<*<| ` `!<` 2  b`4 2`4$  2 `W`4 2`4$ ``2`!<#h G`4$#h 2`4P@ D''''' - D`h   RC: "`80`8@ 0     `@ unmount: dangling vnode㿘 8@@& 8 %<)@`Fʔl 8@    8 & 8v 8`2   @ " @    @ 8* & 8@`Fl 8"4d}0 "D<< "` D@ "@ ` "`l  @" @ @<|"``Fml 8dQJ<  㿘%<<D @)'<) Zl "`8` 2` ?$`8 @@a`  @ "``8 @$`8`]D@ܐ P@ @'''''ΐ  D D `` `@`P@ @'''''촐 * D  @`  :4``gܔ!㿐 @7@ `  D  @  :4 `g!㿘+<<`cDcD2 @@ 3 -<) ͔l $@6@`   `@` @`:4 g! @cD@Ӑ $&&0& x@@ ϐ \ ` 4@4 4 h+ <=' '''' H*` ` e  `ذ{  I؀ " l <>@0''' H*` ` `  2`T `O $`x`a:`Pb G@@ cܰ A `@7`h `<=' ''''`H*` <>'''`H*`  `4`6`4 ˒ 2    `4`6`4$  "$ $  P@ D '''''@; ` &`P !: O 2&@ D'''''ܐ@ "   $     `4`6`4$  㿀6 '  h  `<= ' ?''  H*`  <>j0 ''' H*` ` ` l,h  @`'@* h': $Xl '''Đ@   ,  ?X h/ ?h d&?" h* \"@<<$X#Ȓ `ϔ 6`&`6` `0C&`   7?` ? 77`  0<>''' H*` <>#?a'p #?''t'xa H*` p V``@ z,h*`" `@`6`<>'p't'x H*` ph &Ф:O  @'l 'H'p'L't[H X <A ` `<` ? ? ? ? ? (? 0? 8? @? H? P? X?? `:` ` o ' '   8 2  '' '  I\<>c'0'8'<'4H &?c H*` €0`"<>\0'0'4@ &0l& H*` 0  \<>D'0'4&D H*` €0/\0/<=\ d'0'4Xl&?&?&? d`H*` €0<>Dl'0'8D'4 H*` 0\4  +@H  'H'l'p'L't顐 2iX \<> D'8'<l$? D`H* @8X@ XՐ X 0J<    `?  ? ? ? (? 0? 8? @? H? P? X? <>??'`8: ` /  @'c\' '(','$ $?c H*` € <=\ d' '$Xl$?$?$? d`H*` € (@ @''''') \ ` ''''' M <> D''$? D`H* @@ Q y 0/ !<>#'''' $# H*` € ''''$#`H*` €<='''' H*` H<)H /* '  $ E< @"H 0@$c 2v<`H  'H'l'p'L't蚐 h<X \<> D'8'<l$? D`H* @8X@ Xΐ X I<<` `<>`8? ? ? ? ? (? 0? 8? @? H? P? X??`: !'@ \' '$'(',$? H*` € <=\#' '$Xl$?$?$?'4#`H*`  <<0#$`$@ : <)*`hH /* 'S <0  *@ *@  EG 0<)!ȓ+ @ @ "@ "$@"H 0(@ 'آ '''' U @2`<> D''$? D`H* @@P !  2 F<>''''' H*` <>0''&0& H*`   <>D''&D H*` €ā(@ 'ئ ''''玐 M`0 <> D''$? D`H* @Ā00 @[Ր !<>@#''''$# H*` € ''''$#`H*` €<=Ԑ"'?'"`H*`   @@*@ 2T G  `h 2`>  " `  ! 04<=1  @ C'x'|"?''`H*` x `  B` <='X?`'p'\?h`H*` X 2< > h @`@ ,`@@ ".   2T (  h 2  <= `'??''?H* @€؀ 2 ``#`#\~аh @`@ ,`@@ ".   2T (  h 2  <= `'??''?H* @€؀ 2 ``#`#\~-аh @`@ ,`@@ ".   2T (  h 2  <= `'??''?H* @€؀ 2 ``#`#\аh @`@ ,`@@ ".   2T (  h 2  <= `'??''?H* @€؀ 2 ``#`#\а8 D $   $ @'''''ܰ 2%$ ``` ```2``<=@ <='''''`H*` $ $ @ D'p'H'l'L't巐H X@ QX `` h@ 'p'H'l'L't噐H X@ 3X ``ǔ h@@ D'''''| <>`'''' H*` @' ''''[ B h 8  D 8@ <=`@'p't$'|' H*` p !`` `  '''''?'''@<>'p'x'|'t H*` pm`"@&@ @H'p'H'l'L't  G<>#X'0'<'4'8 $#`H*` €0`@ o!<  H<=? ` ?? `' ? ? ? (? 0? 8? @? P? X?@?@'0'4$'<'@@`H*` €0t@Z@ Q<>tc`  ''x'|'$c`H*` €x`@ !<  H<=? ` ?? `' ? ? ? (? 0? 8? @? P? X?@?@'x'|$''@`H*` €x<> 'x'|' `H*@ xP@ @'''''[ `@*㿐 @@  @`P@'''''8 `@<>#@#'x'|'' H $?*@ x@ `<o`??? ?(?0?8?@?H?P?X???'<=a@'x'|$?''a@ H* x<>` H`'|'x*' @xP@ @'''''ѐ  ` @m`BP@ @'''''㹐  ` @U`*㿐 @G@ `  `@B`㿐 @7@ `  `@2`P@'''''ゐ  ` @`P@'''''k  ` @`<>#@#'x''|'`H $?*@ x`@Ð<='x'|$?`H*`'' €x I<>   G 2 3 2 72 ;"?<` <=`? ? `? ? ? (? 0? 8? @? H? P? X??'''@@'x'|"'`H@'*` €x<> `H 'x*`'|' €xP@ @'''''א `@*J㿐 @g@  @`P@'''''ⴐ `@'<`  ` ``? ? ? (? 0? 8? @? H? P? X??? ?]  " 0L@r`'''<>cc'h't'l'pH $?*@ €h`@ߐ<=**"@ " *`@ *  * *`''''a@a@'h'l$?H*`'t'x h<>`H`'h*'l'p @h@ @H'p'H'l'L't( `<>`X'0'<'4'8 $ H*` 0`@ hF @ A<=`@'0'4$'<'@ H*` 0 0<` <=? ``?? `? ? ? (? 0? 8? @? H? P? X?`@?@'0'4$'<'@@ H*` €0t@_@ _t` 2` Y <>#'x''|' $# H*` €x`@ h5 @| 1<><` <=? ``?? `? ? ? (? 0? 8? @? H? P? Xt??`@'x'|$''@ H*` €x<>'x'|' H*` xx@@` # `@ː<="t' ''''"t H*` <> '''  H*@ x@@` # `@<="t' ''''"t H*` <> '''  H*@ 㿘`@@  㿘`@@   ''''' < `,h'''h'l'ې <>D'X'\$?DX H*@ #<)D7<B5<03<0x`| h``h `#  `h  " 2?Ā @8 ?N|%<>'L'@'D'HX &? H*` €@Ā`'@'L'D'H&?H*` €@`<=@TӐ@'@'H'L'D&?`H*` €@<=Đc8'@x'H|'D`"'P'T"c8H*` €@,#<>`D'@'H'D`D H*` €@谐`聐`|ĔԐ`D'@'H'D`D H*` @藐p#<)7<5<0$# :@*``hH /* 'R 3<0`  * *`   =- 0<)!ȓ*@ @ "@ """H 0 $\$#@ :*`hH /* 'S  ` * *`   < 0<)!ȓ+ @ @ "@ """H 0 @H  'H'l'p'L'tߞ jX \<> D'8'<l$ D`H* @8\0N <    `?  ? ? ? (? 0? 8? @? H? P? X?<>??'`8: ` ! @'c\' '(','$$?c H*` € <=\#d' '$Xl$?$?$?#d`H*` € X8@  '''''% W`h   2`0  2  0<> !<>#'''' $# H*` € ''''$#`H*` €<=Ԑ#'?'#`H*` D''D' H*` ĀN0 㿈 @f@ `  ``#\#` @&   "`2@ @H'p'H'l'L'tޚ 5<= X'0'4$'<'@`H*` 0    @ "V`4C!: V`4 <=`0(  '0'8'4`H*` 0 @*` " R "   h" "  ,b`z  $(h$$ L$(7  2J<   `? ? ? ? ? (? 0? 8? @? H? P? X??'' '<>'x'|'' $? H*` €x<=$ 8'x'''|$? 8`H*` €x ɲ{*<>D$'x'D'| H*` x@Q "  $  } D$($$Đ h b -1d`<= 'x''|''H*` x ddh { @} v<= 'x''|''H*` x fdN<>'x'|'H*` x<>'x'|'' $?H*`   €x`@< <=?`?@??(?0?8?@?H?P?X???'x?'|$?''@H*` x <='x'''|'H*` x ` 6 66t㿘 0 " @Q   㿀` 6?4 6`@<= H''''*' @JX` h`@j '\l''?'' '''<=al'al<=a'a'"`H''ȕ* @$耢  "  <> ' `H'*`' €\`  h   ''Ԓ`''''''@<=#?''"?D''#'' H*` '<><''' H*`  mQ<!D H@ L@5 <=H''''' H*` `䣐 `-<= '''''`H*`  䌐02'''`H*`   $ <  { h% 0 % D`8  `    4`4 4$ <c h%'㿀 <>' '''' H* @ *`:  *   $`@c@<=>l'''l'' H*`   $@@ @ C >@<>''' H*` 㿀 `h    2   2  2 $`D ".  8 ".  $ & <> '''''`H*` `@ @<=>'''''`H*`   " >@$@ @ C >@<>'''`H*` <=@'x'|"? H*`'' €x "Q&@&` h`$<А#*` €CCCCCCC  ( 0% *2 @ 2 >`@&`>`8&` &`&`&`&`P&`&` &`$&`(&`,&`0&`H&`L `  h?`0<ѐ ē*` €DDEpEpEhEhEp"@2<='x'|"?'' H*` €x 5` " 0&!@ + ) <=T`'X'd'h'l'\'`'p H*` X  a@`   "` ` "` 4 4 4㿈 <='''' H*` vn_lock㿈?#'@#<>%< 0a b$ 0 XPW   H@`Ȑ`''*' @谒  @@2 0㿘  DV defaultvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_revokevop_mmapvop_fsyncvop_seekvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_islockedvop_pathconfvop_advlockvop_blkatoffvop_vallocvop_reallocblksvop_vfreevop_truncatevop_updatevop_leasevop_whiteoutvop_strategyvop_bwrite    dead_read: lock㿘@  " <h"`0   dead_write: lock㿘@  <h~"X 㿘@v   <= a H* @  㿐  P " @\    $h"$) 0 <>cX''PcX H*` €㿘 @@*@& @;   <> ` H* @ 㿀@)  <>    ' '  '''' H*`  tag VT_NON, dead vnode 㿘<i @ 㿘 0a   b& 0O  0abfdesc㿐8@@M -  @ E<)H /* 'H    5S "HH 0`0  "`0"`h"8#<`$8$@ݓ YS Z"@ @0ϒ  @0˔ Z` 4 4 4 㿘!@6`T 4`` , 2 K!@5 &!@ 㿘!@` 44 4&@  -㿘`  `   @*`"  * ""  @&`&` &`&`@ &`&`&`6@ ``L&`  d &`$@1ʔ Z` @1Ɣ Z `<@/    - - - - -㿘< < <<r !,b(   (*# @<"<*l  HҔ <##㿘<*!l<@ *` @ %< 2 `D2     R& 2 %<H`H`$HN @<`#$H  /H<)H /* 'h    T4: "hH 0"`?$ $ $ $ $ @ $@" $@$ HH `$H $HNӐ fdttystdinfd/0stdoutfd/1stderrfd/2..㿐  `   `  ``N .2 %@444` "` `ð 2`<Ԓb@@/  2`D  O %@"hc` 2%`<ԒbH@/  2` ( " ! ` 2D   *  %@"h=`  `0$<ԐbP@/b  `<Ԣ"X <Ԓb`@/V  <<Ԣ"h  bp@/K  `<Ԣ"x `; D R " %@`" h[ 0J2<Ԓb@/)  2 DV 79   *`* :` ?Ѐ А , N  ,   `2D     "` %@`%@㿘   `<Ր"\*` €VVVpVV   "`X<b    fdesc attr`6] @. @ 2R U ``" L< <='x'''|' H*` x =@ 9` ?5&`w| 0_ &@&`&`&` &`&`>` &`,&`4&`&`8&`<&`@&`0&`D&`H&`(&`L @*t >`Pe"fdesc_getattr㿘  ` `r <֐ *` €XXZXX<  < <  <  <  <  (< ( 0< 0 8< 8 @< @ H< H P< P X< X `< `` $ `   !m!m  $ $$ $ L`@-` < <"!   $ $$ L$  <  "$ $ < $$ L$ $ `D" `<$ $ (   $ <$ ,$ 0$ 4$ 8$ @$ D$ H < P % <d H$`hfdesc setattr㿀    `- +  `*@@ 2R  ``<0 <= @ ''''@' H*`  dP"`%d㾐  `    2`  ``  `     ` ?7 ???`2   ` ΀z<?#"@ 8 ,h'``  `<)K"H<)H"h`@<)C"<)@"b a<)9"<)6"耢d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '  , T14 @"H 0 "@ ",<?`* cx <?# 6     2 ?``( "/`a `2 ?'`? :"`+ @"` ?' @-/ / D ɀ`"`: <@``   <?z  8 ,h'``  `<)K"H<)H"h`@<)C"<)@"b a<)9"<)6"耢d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '  , T0i @"H 0 "@ "6< 3<)<` 34  '/b@-L , /,@"' d#P// Cٔ `< <@` ͠   =;< <0$<)#@ :@*` hH /* 'R <0  *@ *@   0 T0<)!ȓ+ @ @ "@ " "@ "H 0 "@ "<=`㿘 `h "` `   -`@+. Cr㿘 `  -<b 㿘 `  -<b 㿘  `   -<b     㿘  ` <b % 0@㿈 <>''' H*` $ h 㿘  `"`"<)<c$<0  #@ : * hH /* 'R <0   *@ *@  / T0<)!ȓ*@ @ "@ " " "H 0&  ` &<ل(f(f8fDf|f|fPfhf|f\fh` `   `   ` "`  `     tag VT_NON, fdesc vnode 㿘<c" 㿈 <> D''D' H*`  گ 㿈 <> D''D' H*`  ڜ    hl I<)H /* 'H    . "HH 0$l ̔  ̐ $Ȕ {  ̐ $   IG̐/2 $l$ $ ̒` 2 2      $    2  $I&  "    $ ` ?2`  $I  % 2$ 2 #<>`)<@'''`H* @ !! G `, 24  "'`)`  5 $  0 #<>`)<@'''`H* @ !! Gl ` 2    "'  <='''''H*` Ё㿈  l8  <>  4  '''H*`       `2   ?4   `#  ?4   l` " 㿈 l `   4  <>'''H*`        `   ?4 p  "~@"#    l 'qS  "   "  `l ' qA  p    l@'  qР    l`'  qР㿈 <>''' H*`   "    "     2" 㿘    `l ? $ /   " T`4 ? $ 1T`4 =  <)<#$<0`$ : *`hH /* 'S <0   *@ *@ - 0<)!ȓ*@ @ "@ "$"H 0$`ltag VT_NON 㿘<`ΐ#@ <۰ `Ȑ#, fifo with %ld readers and %ld writers㿘 l< #` " "    "    "      E㿀   `֊ 2  <>''''' H*`    㿘  $6<$<0#@ <):@*` hH /* 'R <0  *@ *@   ,ޒ 0<)!ȓ+ @ @ "@ "  "@ "H 0 genfs: bad op㿘<^"0   -  vop_revokeall㿘 < 0h3! a <ܒb& 0x EM 0*a(!& 0 l" 0l  2h h@2  "  02l 0(2 l 0 >& 0  㿘   (  㿘   (,x   #\ '#`#d?@  kernfs_get_rrootdev: no raw root device 㿘<@, -<┐ (",)< < '<@# #?,  2` @ *`   `  @o|$(   < ?<$(_s 8kernfs㿐8@@Q -<bp  H<)H /* 'H    @+4 "HH 0`0  "`0"`h"8#<a0$8$@t YI Z"@ @&  @& Za0 4 4 4 w, 㿘!@6`T 4``   2 )!@+ @&!@ 㿘!@` 44 4&@  -㿘"  @&`&` @ &`&`&`&`&`6@ ``L&`  d &`$@'Ĕ Z` @' Z `<@%    - - - - -versiontimerrootdevrootdevphysmempagesizemsgbufloadavghzhostnamecopyrightboottime...%ld %ld %d %d %d %d %ld 㿐 "%  5  " g O< Y /7 0^ 0[@xƐ<`^0G<`^0A@&<(   <*#$`a " # < @ 9  6" "@"@ 8  +&< |<܀ b" @'& * * ( <`(^j@%n&& 㿘 / J?` "!<ܠ"@&<"|, 㿀   %?  <>'''H*` `+<@M . b%444`v b<@ !`?b@%~ b  ``W U  ` G<`?  ` ץ䀢 `@  %!䀢 27 bp D<䰒 m`0*<)H /* ' H`   T)c "" @"HH 0" `  "hF` %㿘 0 !m`h   ? 㾈    << < < < < (< 0< 8< @< H< P< X< `$ $ `D"``  $ $ (@w<   $ ,*`" *  * $ 4$ 8$ 0$ D$ H$ L< P`0   !m "< $ $ $'$ `<@a$@ *` *  *  ` *  $ `:   $ $ $  'k! 2> <   㾐 `h   -`@' Q! ''' H*` $ h 㿘  `4<<0#$`#@ : <)*`hH /* 'S <0  *@ *@   ' T0<)!ȓ+ @ @ "@ " " "H 0&  ` &<0(Xht` `   `   ` "`  `     tag VT_KERNFS, kernfs vnode 㿘<[" 㿈 <> D''D' H*`  Ң 㿈 <> D''D' H*`  ҏ 㿘<  ; <#"null_node_find: vget failed. 㿘<b<6` ⬑* @@` !<`2@`  D2 @-  Z#@`2` 㿐<# > `h"`h%<)H /* 'h    T&e $hH 0 h? $H /* 'h     &E "l# l$hH 0`l ` l" # $ $ $  v'<)&3<c$1<0 $ :@*`hH /* 'R %<0  * *`  & T0<)!ȓ*@ @ "@ "$"H 0 h? 3c$ l #@ :*hH /* 'S   * *`   & 0<)!ȓ+ @ @ "@ " l"@l"H 0<"ؒ # hѲ" HY @ h? :< l c2 ?*  @  l l  2 h h@2 V 4 ܐ,  l 2 l l"@l"`l"$@0h"0 0o& 0&<"6``4< @ "*` 6`4 $ " # $  㿐   'є  E`  "`  7` &nullx8@@d -C  ^ T&(&&,&$&ȝ S&  %  D$@  % 09<>''' H*` `0 "`0$`` D8@ <8 $8$@aBܐ YCRܢ Z$@ @ } CF Yܒ @ r$@   㿘!@6` T 4`` ْ 2 Я!@%_ &!@ 㿘!@ ` 44 4&@ 㿘!@  @㾘 @ 3!!@   "' @6@6`@ &`&`&` &`&`&`&` ``L&`  d &`$@!r Z` @!n Z `<@e   㿘!@   - - - -null_bypass: %s <A ``<XT!h < ,  ?"x#@   ""  H@"" `" `@ "`4 2`4  ܣ<`x H*` €  , @ ?" "  x@ `"@ @  <`?ab <=`  D {@ p   @  D`8 ? B ~2  @"   D`8"    2    $#<>ax''ax H*` €Ѐ  ''Ր؀ ''ax H*` Ѐ  ''㿘 H?  ?2D?2D,?2 D4?2D?" D 8`2)  ?2h$?h?`<!P*` €|ltt|tt   D 8` 㿘   D  `"`㿘   `h    `D 8` ѐ㿘  h` D 8` 㿘6   @* &  㿘' @* & 㿘 2 㿈 <>''' H*`  㿘  "`"`"<)<c$<0  #@ : * hH /* 'R <0   *@ *@  #H T0<)!ȓ*@ @ "@ " " "H 0& z tag VT_NULLFS, vp=%p, lowervp=%p 㿘 <` V 㿐 <> PcX`$ P'' PcXH*` €$ P㿐 <> Pc`$ P'' PcH*` €$ Pportal㿀 8@@w -@  2q > 2j `  <` ,`D ݖ耢 <)VH /* ' H`   T" "" @"HH 0  !  0"h`"0"# Z"`""  <3  8&!@& 87a  Y@G @s$@  @< Y @h$@   㿘!@6`V 4`` Β 2ͤ!@   !@  !@"J $!@㿘!@` 44 4&@  -㿘"   @&`&` &`@ &`&`&`&`6@ ``L&`  d &`$@~ Z` @z Z `<@q    - - - - -portal_closefd: error = %d 㿈'蒒 <Ue!㿐 '  `%@? c `  <L .2 `D%`4  U2`4`D  D H "h<)H o*@gH 2 "  T! ""HH 0L ` `J@ ``*" $`$`  T  $@$<A@ $ "@% 㿘`"% =VV@@"` ) U 2` =`   `   $``@``$`Cportalconportal_open: %d extra fds `'t0'l `  X  D @t s l@tbP  l t lH /* !t  8 '< R `<0a 6*  9t 8 " H 08 t2f`d2``@ @2`2`d` ` 'x   '|  @' @>7x P''`'@ Pt '''''''?  ؖ   gl '耢 ( '`t @'h 'p ؖplh Pp l   'p @ll `" 6`耢`8l`@?2 2` . =`<#S 6  @} ` ,@ `S   l   =H 0l% X l "tt ݒ ct㿐    << < < < < (< 0< 8< @< H< P< X/< `$ $  D " `"$ < $ (@m  $ ,*`" *  * $ 4$ 8$ 0$ D$ H$ L< P 0  !$ $ $ $  !$ $ $  $   0   㿈 <>''' H*`  㿘   `<  T$  < <0$<)#@ :@*` hH /* 'R <0  *@ *@   Ȓ T0<)!ȓ+ @ @ "@ "  "@ "H 0 "` ` &<(44 4 ` `   `   ` "`  `     tag VT_PORTAL, portal vnode 㿘<R#@ 㿈 <> D''D' H*`  ʀ 㿈 <> D''D' H*`  m waitrunstepdetachattachusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfs_control㿘"2`("`07`()`(4h 0@2`( (2 `   2! <&>!: 2<"쀦@ '<;"x"z h@@"t `Dn h@@"h `D2d N`- 2` @"<0Q8<0L`(B `D&`(0&`T. 2N`-`D 0`T " `("x <"`(F*@&`(&`TN`- 6a89I  - `-? 1<! !87  2 `-?  P!!@㿀 3 - '@̔䰒 )<A"@  -` <A"@ `(("``D2 `` !- 㾐@ 8! $ @ `̐  &``(  @  @n 0 2` 2 `N`-  @nv`̘  ?&`> (2   0x%lx 0x%lx %c%c%c %c%c%c %s %s %d %d %d COWNCOWNCNNCp `  - @ 0|r <!    ˔  e , - (@a<` 2Y`<`"` ` - r` w#\#\`  x#`#``  r#d#d`  w#h#h`  x#l#l` <"0<"8#p` "<<"@"H#t`$ #x`(#|`4#Q!@  0E < `<! `   [  (2   㿘 ( @* #`(2 `  `4`   &`̀2` @` "@ ` `̰` @&`́ ĝ㿘 `  2`(! <$U!: "<"쀦@  <;"x `?H    @'@Y  -Hǒ 9   P$ @ `̐  &``(  @  @m  / 2` 2 `N`-  @l`̘  ?&`> (2    %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld -1,-1 %ld,%ld %ld,%ld %snochan %d,%d 㾈  -`D `0 0a a @ . @<c@O`(  l? 2 <cP2<cP??O<쀢` #X< Oƒc`<ha `2 J< Ocp<hJ ,<Ocx`(  `<  Oc<Oc& <cO`h<c`l<#O`!<#`Oy`OtV`  %<`, @ OhV`   <O_cа & " @   .(%s)X  -)<  Tޔ N`-``( < aOG `  `4`0r   &`̀2` @N`  ` "` Ȕ ;` '?'''''''@S 2e`  '` '?''ܒ'''@@'䰒 2R`̐    @`1*@  -  '` ?'''''''@Ȱ /<  ` L " `` Ԡ 2?`` @&` $`  ,-`` @ &`̐ Tprocfs_allocvp㿘'<X#< 2 D2 ŵ X&@ 2 #<c\`c\`$c\4D X<ۖ`#d$c\ ¼ i\@<)H /* 'h    T "hH 0$ "" """*  /"<#p. €!m"  $ 0$ h!m" $ h!m" $ h! !$" $ h<L!X X@@ 2@"@\\ `$\ $c\4G 㿘<#X#X `  2"   <<0#$`#@ : <)*`hH /* 'S <0  *@ *@    T0<)!ȓ+ @ @ "@ " " "H 0&  㿘    `< (2 b  ` `<"쀢  <;"xM `H<"X*` €$||@ ֖4 - & K 7 Ζ V   -㿘  @""   (,d   > .@@ J?` 2&?.@& 㿘 @f    procfs: invalid directory entry sizeprocfs㿐8@@$ -@#<`$8$@̒6ݔ Z Z"@ @  @ Z` 4 4 4 ,㿘6` l  㿘   㿘< <0<;!0&`А  #@  @&`&` &`@ &`&`&`6@ ``L&`  d &`$@, Z` @( Z `<@   -  -    -cmdlinemapnotepgnotestatusctlfpregsregsmemfile...㿘    < (`2 "  2   (2    z "    ($   `  `"`  "    "     2" 㿈 <>'''H*`  "<&  ( Ŀ  㿘 ` &<($\\0H\<H` `   `   ` "`  `     tag VT_PROCFS, type %d, pid %d, mode %x, flags %lx 㿘 <`!h` `` KK`㿈 <> D''D' H*`   㿈 <> D''D' H*`  װ %ldprocfs_getattr㿀  `   "< (`< <`<<``< ` < `< ` < `(< (`0< 0`8< 8`@< @`H< H`P< P`X< X``< `  h$$ $ $ H@e0$ ($ <*`" *  * $ ,$ 0$ @$ 4$ 8` ``   $ `(!   >$  $ `@$ `@$ ` V*`< H €|ȠL\pppppp " < P$ $ $ ><  $ $ $ <! <0bhJϐ%:  $ ` " $ ` < P$ !<  -` <0ࠔ *  :  P< P !< P <   < P< <H"p  <=!'x'| " !''`H*` €x   #curproc㿘    %?   2 `N@ .2`%`4  5`4  . 0 @| 2 < "@  2 `D c @a1 _ "<{ (U`DM  @" `DL "<b (<5<B<B @ 6 8   ? @x  `" @  `@   2`DA 44 4ށ`%   V   㿘'@ 㾐   `       ?7??? `̫2 `2  "< (`  y<B "@8 -`h'``  `<)K"H<)H"h`@<)C"<)@"b a<)9"<)6"耢d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '  * Tڔ "H 0 "@<B 8,@``<B 6  `" @ "$ `8 ` *  ' /@ @/ (M ۀ": <   `ͦ<B    r-`'  <)K"H<)H"h@<)C"<)@" <)9"<)6"耢<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    T  "H 0 "@<  H@`K7<5< E!0 '/@ -@  /<"   '/?/``$ `0`*``'`0H:h //` '  `< <`   B>8< <0$<)#@ :@*` hH /* 'R <0  *@ *@   J T0<)!ȓ+ @ @ "@ " "@ "H 0 "@ ""<=㿈  `2 <! 0<bhGʐ ' 0 Є  * ((Ї8 12    㿀`lc `D 2`8  `h`<!*` €   t    < <   ?"/< *<;x  , <* aP@m x <@W?  䀢  R`4 ϐ V@Vِ Q <, a,*  $@<>`0 $`0'''`H*` ۾`0-<!( ) <;"x` ?  , "<* bh@ ˆ , "@<P*`  spec_read typeh    `h $ <<>'''`H*` `l c 2`*` <4*  \`0 6`l ` #<(2 ('؀ ("* "@<*`"\ ` `h@   `  ` " ``"@5' ( 2@ :>`K I@ Аؤ*@> @  &@8`<Ԓ?'#\#`ܘ ?M԰%`<4"@8 <%Ԁ "0DX 0 spec_write typex   h % <<>'''H*` l c 2`*` <8*  ڝ`02 6l ` #< (2 ( ("* "@<*`"\ `  `h@   `  ` " ``"@r ( 2@ w?>`= P`N@ *@@ Ò %8   'ܐ?ܰ '`4%@8`<$ڐ @ `$(2`( "0C#8܁spec_ioctl㿘 lc  h 2` ,<*@ <*`< * @ **" <*bh@  @ "@ <*`\  @CM"X㿘 `h "`lL0 c 2`*` <H*   㿘 h   Ò ` 㿘  8 @ 2`*`" <*X @ 㿈 <>''' H*`   "    "     2" spec_close: not special㿘  l h`. `K<   ! ` M a "  0! # @2 * <*a0@ $     2  0! # @2 * "<*bT@ B   tag VT_NON, dev %d, %d 㿘  lc ? 2 < "8D2` ` &<ć(@@,@ ,` `   `   ` "`  `     㿐   l   #\  㿘<D  $ <#" 6?*@  * ?*  6?`   ?(@㿘<aD<6` ⨑* @` `2@`  D2 @ 20`2` 㿐<<! `@   `h"h<)H /* 'H    TH "HH 0 h? #<)H /* 'h     ( "l# l"hH 0`l ` l" # $ $  x&%<)5<$3<0`$ :@*`hH /* 'R 1<0  * *`   T0<)!ȓ*@ @ "@ "$"H 0 h? 3$ l`#@ :*hH /* 'S   * *`   j 0<)!ȓ+ @ @ "@ " l"@l"H 0<"ؒ # h" HZ @ h? ;< l c2 ?*  @  l l  2 h h@2V 4 @`  l 2 l l"@l"`l"$@0h"0 0Q& 0&<!D6``4< @ "*` 6`4 $ " # $  㿐  'Д ) &㿘-!@` b``n`?2&`#&``d?2&`?#&`V`  ?#`S?"&&V`   umaph @!: @8@} -,  v T&(&&,&$&X k&`h "_   ʔ `D $+ $ ,s$  N",l* Gs<>''' H*@ Ѐ J 0-0 "0$ ` D8 <8 $8$@bȐ Y+Ȣ Z$@ @  + YȒ @ $@   㿘!@6` T 4`` | 2 R!@ &!@ 㿘!@ ` 4?4 4&@ 㿘!@  @㾘 @֔!!@   "' @6@6`@ &`&`&` &`&`&`&` ``L&`  d &`$@  Z` @  Z `<@   㿘!@   - - - -umap_bypass: %s umap_bypass: user was %d, group %d umap_bypass: user now %d, group %d umap_bypass: component credit user was %d, group %d umap_bypass: component credit user now %d, group %d umap_bypass: returning-user was %d umap_bypass: returning-user now %d umap_bypass: returning-component-user was %d umap_bypass: returning-component-user now %d 3<C`P        <@" < ,  &x #@ x "  ""  H@@" " `" `@ "`4 2`4  أ<`?"&ݐ&`P  `<@M" D`P" ``"<`@># ?&x` "` `P  ` `<@%#H Dݒ`P x`<@#x H*` €  , @ ?" "  x@ `"@ @  <`?"a22 b2  D?`P   `<?ѐ#"&`P  " ``<?#?#`P   `<? Ԑ`P  "`   `<? 8㿘߹   @* &  㿘ߪ @* & ݐ㿘 2 Ԑumap_getattr: mapped uid = %d, mapped gid = %d umap_getattr: original uid = %d umap_getattr: original gid = %d 㿘 " F)<CD  `"`  P  <!0?9  D@` b`u`  P ` " <!`?" #"` _  P ` " <!?   ?#"` 㿘  h` D 8` P㿈 <>''' H*`  㿘  "`"`"<)<c$<0  #@ : * hH /* 'R <0   *@ *@   G T0<)!ȓ*@ @ "@ " " "H 0& y 㿐 <> PX`$ P ''PX H*`@ €$ P㿐 <> P`$ P ''P H*`@ €$ P tag VT_UMAPFS, vp=%p, lowervp=%p 㿘 <`!8>^ umap_rename: rename component credit user was %d, group %d umap_rename: rename component credit user now %d, group %d 㿘 )<C`   P` $`  `< >)!D P  `< >!w?$` 㿘<#h  |"@<# @ 㿘<#. @   "@  "@$  㿘<#.  `"  $"㿘 @ 2` 2   ` ` Đ  2 (  (  ?& (` "` ""   y  "  ( T&   l& ??& > 8  _??& > 0 <#h, `& "  " &  (`& (}㿘 㿘 ~㿘 h 3??? `0 2 `4   :`02`8`8`< :`8  @!union: unidentifiable allocation㿘a@\  ` ``<;i" `" `h`h@" @ `@``  ```4 4`4 ` @P 2  "``!< `!<"; `"77`"34` !<, #h    2  2 `D2  $  ` 2   P@"  (   `  ( ($ (" `$ ( @ ` J "  (  ?$ ( @ ` T $   9 $  @?   *@ 4 64$ `"    %`  @2` `8 S`<!D Ԗ ` `Ӑ`w0s<)H /* ' ∀`2  @ T "" `"∑H 0`0`"`0`h`h"`h??$ $ < 8< 0$ $ 4 64  $ (`$ ,$ $ $ ( ` T $    $  @   *@ 4 64$ $ $ $ ` <#h, `$ "  " $  (`$ (` 㿘  (  ?$ (` "` "  " i " c  " ]  " W  "< T<#$<0 <)#@ :@*` hH /* 'R <0  *@ *@    T0<)!ȓ+ @ @ "@ " " "H 0&  H#<>H ``  * ''''?'!<>@H##$*'''' @%`'`H*'' @# `H*$''''@ €ސ@ T 9<=%<='`H'$*'' @耢  2)!l'@!l ''''''''%H*`'' € 'ؐ$?' ''''J Txܒ@t kM (`  5% (`~<= ''''' H*` ఒ <>ܐO<= '''''  H*@ <>''' H*` ܒ @ޖ ( $#  %<=#<=''''' H*` `ܐ`'''''`H* @ $@ &% $㿘\ '    @%'  '  + '' '   2  '  ' '  ' `476`4 2 0 ' ؖh#\˜ "] A<>< -<>  `  ?   ? ? (? 0? 8? @? H? P? XXt?'@???''H''D'L`H*`$? €@<=cd'H`Hcd'@'D$?$?* @@ D'\ D`H'X&*` X<>`'\``H'X*'` @X &8<> 'Đ `H''ȓ*` €@ܐ#\H _`0B "`<> D'Đ D'`H$?*` €M- <>cc `H''''*'@ @<>#0'#0'`H &*& @  <> D' D`H'&*` € %:``@| a'  `@'x' 'l'h'p<'t` hx'|`''`43`4,` z`<`<>`D'X'\$D H*` €X`<@А<<ɰ 0Y<   `? <`` <` <` <` (<`  0<`( 8<`0 @<`8 H<`@ P<`H X<`P<`X'`<>$`'@X'D'H'L $? H*` €@`<= 8'@'H'D$?'P 8`H*` €@ <<=.'H'@'L'P'D H*` @ < `6 2`6%E<㿀`"<= 6?6 6<=  H '''''* @㿈@Ґ (   ?& (` "` " (  ?<>& ( ''' H*`   "  <='x'|"?'' H*` €x  ؀   union: dircache table too small㿘<!D H@ `" 4 6 4@"@`&@? &<6{" &    ڔp%'ܐܒ ' ,`2'' Ɣ T*'є ' `","' @`` @ ' "<>̩  4 `3 4  D#\#` 2<> " ,"`,<>  H ''*`' €܁㿘 , |   ,* T& ,union:::x8@@    -"     P`44`4&(&&$&&,  >&h    =  $      $  $$ $ $$ 8 2 <>00'''' H*` ఒ i  @$  2  :` a $    D 8@ "  D`8 "<8 $8< D` 88  $8<$@ Y!Mܒ Z"@ @x   "<  <   <  <  < @"@  Z "@?! ܒ $@M@ O   `` 㿐!@6``@6 1    T `@"   2 R`4 $`5   "@Y@V  `'!@ $!@x!@ 4`2 4 2<>x'x' H*` €  .`  `"`4 2`4  #\#`  , ` <>''' H*`     @ ( "( -㾘!@ @!`   D  2H" " &` &`@D   36@6`&`&`` @ђ@&` `  @@` &`   &`&`&`&` ``L&`  d &`$@ Z` @ Z `<@    - - - - -㿘 ʋ` (& (㿀@@1 0 <= D'` G&@ 44 4l 2 0<= '' '' H*` 谒 02+0/   @2  J` ` " `8 䀤"& h " l& union_lookup -> . (%p) != startdir (%p) ` ` '`D'X   a@ $ ` `'\a'd`( 2 p )<>`( $`('''H*@ d`c  ` d@`( $`(`ؐ  ``"@  ?$  ?&\ @2  \ <=  d'p'h't'x'l H*` h  \؀ \  \ F2E ɛ`$ 2 $ \X  $ X$\  <>'h'l'pH*` h 0`` d@k '`< '``X"@  ?$  @ `     'X 42 4H` 2`  ?$ ` "} ,X h`2)X`(<> ?d$`('h'l'p H*@ hd7`d``(  $`(X UQ'XX <>'h'l'pH*` hXD `#\#`d`  ` "XX ,`@<>  @2 <>'h'l'pH*` h   J`. `@<!2Fp  `2  ( 2`4!`4 4`4 (`$ ({ D<=8'''8''`H*` ఒ  #`ܒ#\  [0X 㿈     - ( 2   <>0'''0' H*` p  `4  ( 2`4Ő`4 4`4 (`$ ( D<=d'''d''`H*` ఒ ܀` #`#\ > 0 㿀   `  2K h`  h ?4` ` `z Y<= ''''' H*` I h? 8 $`D 8`2B  $ $ $`<=''''' H*` <> '''  H*@ 0 ? 8  (`D 8`" (  <=2<=''''' H*` 㿘  ` 2& `$`?"`$& <=`H* @㿈  ``D !@( 2&  & <=` H* @0 +`z& '<= H*` € <> 2 &  H*` €<>''' H*` 耤`   $ (  2  <= 'x'''|' H*` x 2A` ??  2 h   <=  'x'''|' H*` x "` ?? Ϙ @ "  @ 2 ` "   D ``"㿀`  `2   h`2 ``$`  ` @ G` 0 `,  ( 2`= `<=` !@`'''''!@`H*` ఒ `` ?2` `$? ` ??`s㿀  ` "```?`"`(`Ɠ  2   <= !l '''''!l H*` ` <>''' H*` * `    0 4  ??  8  <    ??union: missing upper layer in write㿀  ` 2`(< /!h 2  <= ! '''''! H*` ࠒ   `0 `4  ?? 㿘   " & <>cH* @㿘   " & <=aH* @㿘   " & <=aH* @㿈   <= ''' H*`     <= ''' H*`  㿘   " & <=bHH* @㿀  ;   ` "` 1 ``?"`(`| 2    <=t''''t' H*`  <>''' H*` 㿘   " & <=bH* @union remove: null upper vnode㿈` ` `` < .!X 9 ( 244 44 (`$ (`(`2 4 4 5 4(`$(`     & <=''''H*` 谒 0 2 a`    D!@k``union: null upperdvp?㿀` ``  HH`  k' 2f' ` 2` (!<> ?$( ''' H*@ `    7!<>'< .$"` '''  H*` €`` ` `'''  H*` 0B "`` ''' H* @€0` '''  H*`  ' "  "(-`0 2 4Đ 4 4 4(`$(`<='''' H*` x )<H!D @    \ 4`44% `H!D@2H` `L     "  `4`4`4  H!D@  24 44(`"(  !D H 2    4 4 4(`"(  <= 8''''''8'H*` ϐ͐   ``  B`  ( 2 4' 4<> 6 4 (`$ (`''' H*` `<=̐#d'''''#d H*` а "``0  D`#`#\ ` Q0N union rmdir: null upper vnode㿈` ` `` <,  : ( 24ʐ4 44 (`$ (%`(`2 4 4 5 4(`$(`      & ` <=''''H*` 谒 А0 2 `    D!@``x   `%  ( 2`4u`4 4`4 (`$ (  <= ܐ''''''`H*`  "@ 㿘  ` 2`( 2& F & <=c H* @㿈  ` "```?`"`(`·&  2& " & <>` H* @` <>''' H*` 㿈  ` "```(`? ` `ƒ& 2&  & <>`D H* @` <>''' H*` 㿈 ` , <>X   , T$ ,<>'''`H*`  (` 㿘  unionlk2㿘 u @. ` ` (  T`4    " ( $ ( (   <$ ( ( r ` $ ( 㿈   ( ` $ ( <>''' H*`  ( `$ ( $ ( (. 㿈  ` "```?`"`(`ѐ&  2& < & <>a  H* @` <>''' H*`  tag VT_UNION, vp=%p, uppervp=%p, lowervp=%p union: upperunion: lowerdircache:㿘 < # ,   `" <K#  `" ,<C#  ,   !<6#    (2  㿈  ` "```?`"`(`V&  2&  & <>a H* @` <>''' H*` 㿘   " & <>aH* @㿐  P ` "`& P<>X'' PX H*` €& P㿘<.` H4`"`@Ӓ @m <@͒ <* @f.@ƒ * <T2 @\a<㜔 +"'!n!m:"`<C"`<C"x *`*``` "`*  #<4`D* @4`#<<# 6`&% * ,   , @ƒb.`6@dos2unixtime(): month value out of range (%ld) 㿘 6` &f& g2 ** "@ "`*`@ , **`  @ d<(@>?" @2  2  `"!n!m`@ ` <C"`<C"x a2  ?<#+~  ? : ?*  ? `. @*`" *" * b <*"x<*bx@ &@  d* "*"@ *`@*`@ *`&㿘 <Du<C`<D(   < 4 <C<D` (@   ".@ ..@<C<D㐄`     ` /@  .@㿐  ` *? 6*.`  `.  .(  .@ .  .  .`(  .@  @ " .`    @  ` ." 2  < @/ "& " <C" `` @+ ` 2  + ? `&   " ."  $  ' <C" `  `   2* * 2 ` *  `* `2@ _.@@  .@; 9 @֒ 0?.@m   @ @ "?& "@   "  ~ .@   @? "."(("@   ( ** * * 2 ? &@((` ? @((` ? @((`   ((  @*㿘  @ 2?V?(( @`M @` N?<D ,-  9 5 <D ,  $   <D <  ?    ?<悀 @ ?ca @ (( ` *` ` 2?R` @?(( @  (  /">( ` 5?< `  (  /%0 ` (*`8( ?< `  (  /" ( `   *`( ??<    ( 0㿘`?` "`.``?` ` @훒 msdosnopl㿈<0a4<.2  : Ԓ ;Ô <#"<:<:a4\< =<<"#`#d#h"`p#\   " 㿘6)<.'<#Ԓ @*` " @ @2 2 2  ( "  ْ` #0 2   <. < 0Ԅ ( ## "    deget(): pcbmap returned %d 㿈 t#c@2 `" <  <&۰ c`  <&а ""  @ "$ $ $ $ 0  $ $ @}$ ͒`$ ,  $ ` $ ( tc@% <@"# 0c "0, d t@ 2$ p <$ p @@ $ t !4 n, e4 f4 h4 ja4 l@ 쒒 } c , X , Y , Z , [ , \ , ] , ^ , _ , ` , a , b ` , d , e ` `* @4 f ` `* 4 h ` `*` 4 j ` `* @4 l ` `* 4 n ` `*` $ p ` `* ` `*` *  ,$ tt@   ` `*` * $ p d  " h p?c @ʘ `< T*  $ t'E"8  "`h  `4 2`4&㿀 <>''''' H*` detrunc(): can't truncate root directory, clust %ld, offset %ld 㿈` `d0 ``, t#@<``'"X    @  `t@` ` T@ 2@  @` "  `0p`p?''$`p `@  T@_2@  X@ 0 ? \ T"*@  D  @  T \6@ "@ + ` ` l0D@ ~` < `@6"$ $`t` $``  `  [ 􀢿 @̘?  T2@$`$`쀢`  t2@ ??@deextend: file too large㿘 `0   ,t#@" d4  d " t. @ 8`<$!0@T@?2@ 2 " P@   @ޘ    t     & t` &  㿘 d Ӑmsdosfs_reclaim(): pushing active㿘 <<c8   V 4 <"ΐN "<$ <"!s&  msdosfs_inactive(): pushing active㿈 << c8   T 4 <#(x `X <>`(  D 8`   ?  ,`X <>''' H*`  `X`̒ 㿘 h@ l@ 4$8@  @ 8@ &2&  h@8'㿀<a ,"a '?2p p 1' d ) Tt.@ ΰ  \ @"2@& \ <".@@&2&   Tt.@ `"@ 8 ' 2&  "' `''@&@ '<c4 "c4<( 8* `" :[ t t2?y @ @d h쀢@ "  ?Dఒ X t#@ <@ @  *`  * *  ' < ` * ' t 2 ' t 2 ''  ' t2@ ?? u  T \"@  D?*  && $x$|^02& "T$?$  x  +   `"@(   ``@"`" x ? " 㿐 x "S  P # |4  *` @  *   L   4 * 4   *4 4 *`@ @: ? x& |  $?| & x!  < S* P2 * P* P* * |2 * |* |* @   | @"&   6!  4   `0h `<'`<@`0  Y  & 4 @0J㿐 P 2* $ P@  * *@#@ @   @" P$ P& 㿈`L(` @@``?  T0+`t# <@ @  *  *` *   < ` * `? 20`@0@?8& e?`t#"* U#)N耎`< ` * / `@<@/@ `<0`* `< 1* 7  <* < '* < <  *   *` * @@( 0` <0`0` *`< * <@*` &`d'耢  㿈`@ L?  0@ݐ@= A ?& 쀦t#1? t`#. ]1X膎`<  *` <@ o@ +``@<0`* 耠< *  7'4 3``<*`< *(  @< <  *  @ *@ *@ @@( 0`0` <0` * <@ *` < * '@2 t􀦠2t  $ d 㿘6` *` L?*2`@, `"  " ?@    *  8㿘  2* (  #  P & P   2'`2'@ 㿐`   n@''' H*` Аؒ  &`" ) Ȓ `  <>  <>''' H*` Ѐ `@  ڐ`  <>''' H*` А  '@0 "  J@ .2    2  J` .2  #  '+  "  ݰ  "   '"   2 ``2' 2 ' W ?Ș|  G< ``? `24` }\ A &    2&`   ?Ɛ @`@5 "% ?% _%$` @  }' Ȗ  \ @ @&@* ``22  ". ( )<=   'ؐ`''''`H*` а 3%$%  (` % <>'''H*` ? @`@  + *  ct@    * @*`< "  '# Ā "|tc@ "<`26 1#@B<=`  ''<='''`H*` €а p Ā 4 44'@ ``@'@`L`G ED 8` #@2  <=  'ؐ`''''`H*` а pĀ} ^ v`'@ (% m <>'''H*` ` '<>'''H*` Đ2 .`0E`6 3$  .`06p Ā4 44"'@  0"{0`<> 2<>'''H*`  '@ @@ 㿈`t`  `,?`"T@ 2  '     t ?٘ 0T`t*@ ` &`tT2 X찒  ` X @?z찒 X`  < @ `X * `Y,  `Z,  `[,  `\,  `],  `^,  `_,  ``,  `a, `b, `d, `e, `g, `f2 ,  `i, `h2 ,  `k, `j2 ,  `m, `l2 ,  `o, `n2 ,  `s, `p2 ,  `d` `w,  `d 2 `t2 ,  `d  `u,  `d  `t, `,/ t 2`$`p,  `p, `$ B`$ ? 7&`$` X@"z[谒 P` &` T2@  Ę찒 D?y찒 : ` X< &` ? 6 `$? &`$z+谒   `d `pt '<"'  #z. .. 㿈 ,  m  >`? ?y' / <"'< %< `" 2쀢`@〔  @y   <@  zo `zj 0zg  doscheckpath(): .. not a directory? 㿐`d ' f' d "c `pp\ [`,'`t@2 `\`<P`\K ?`p`T"*@ `D`@ x`` < <` 5< b@ 2/   * `t @  *` * @p@Ҁ` `<@`y'  `d`2`\   y 2<!, 8  㿘 X`  ` T  \2 "@  @* *  T` \"@ 6  <"@  D*@@   ?xA  y &  X <  '㿘  , 㿈`( ?,  &`( *`?  `X "*x찒 1` 2- `X( ' `T?4  2 ?`w y`0`X<  `"Ơ  "  yQ  㿈 , ``  H F    `; 9(  ?w * <   @  <@  y `Ǥx  x㿈 ,   2/ `?wq x 0"<@ @   @  "` `  ` @ * @xȐ Ӡ xĐ  x  msdos㿐!@`t$ `p$ `x /$ `| ` $  $  $ 2  t#@$ @(  `   $  msdosfs_mountroot: can't setup rootvproot_device<!<@ L <b!<{!Ȁ <"#<"<""ؒct 9!Ȕ!x't'''@( t @ "@  t@ tet 0t<<#D""#D@ 2##D"t#D"`@ʒ @tK x  8@@"[x@  ` @  P  8@2 -  5x8@0x `%`  #<= `'`'h'l'd'p`` H*` 5<>'`'d'h H*@ `  *@$x x| @&(&&$&&,\  h " lΐv  #< @(2`@ & h `( 8 #<=5<> ` `'`'h'l'd'p` H* @`'`'d'h H*` ` 8@@2 @;x   {0#x \ Y\ Z$@ @ xݔ Y\ @ $@  @RRaArrAaUHl '. v  <!Ȁ m `   b  8 ' <='''ܠ?$?H*`' €ذ K|' % <=HĐ?" 'h """+ '' @  `( b` `  "?uL  $`" $ <| ` a U2  a 2 ! ;ڔ  @z!$  *  @4  * @4 ,  * @4 * 4" *` $4  * 4(  *` 4* ,$|`2"+  : 7*2  3*2  ?8 "2   *`  * * $,  * @ * @*@ $0 * @$,$0?@ܓ2`0 @w  27 a p a l" h4 d * @]-  $t$$  *`  * * $4  *`   $ $ $-| Bt@ `@, @(@2&0!@+@ @ 04@ ,$0 @$, @"4 @44" @$4@t$8@  " !*  # $*` * $<@48$D & %* @$x @4 *8 $<@+ $D$@D0@#"  4$H@$L$p|`/ 2 *?* 2     t`oo8   / $$t$ / ?# $$$to2@*` $hh@$l@o?$\@|?$X@e$`? *@ $Tq u9x`9'$?s d<$ <a@%  2%$x<$a!@  2$x<$a !@  2$x#@   2 $x ! !*` ! !* * $|t'L < 2 * ' $$$W % 8  $  $ $d<"'!@' `" 8@ ' 8' dl  (" t  <= ?H ''''ȕ*' @  "⇒ <ℒ ;'!@ 㿀6`  *!@``l ?"``  `<=༔?''''' H*` ``U <R ; 8*$ 8$!@㿐!@ 퍖  `&@ -㿘!@ @6@`@ &``&`H&` P&`P&` &` &``L @ Z` @{ Z `<@r  msdosfs_sync: rofs mod㿀!@d    6 <'Ր   3``?'<= D2   ` T ` "@`ڐ   t'''''t H* @ 2 2 D`<=t`?''''t' H*`  2㿐!@`` 2& `&㿘!@ג`  `0`4&&   2@ "`"` - - `p` ` `t@ p @o KȰ <`  ! <* /''   `*`'` " '|`,*  * ' h''l''hޔ茖  /`  ڐ |  ؔt 'pd C< @26<#$<0 <)#@ :@*` hH /* 'R <0  *@ *@    0<)!ȓ+ @ @ "@ " " "H 0 d`7"<#$<0 <)#@ :@*` hH /* 'R <0  *@ *@   ͒ 0<)!ȓ+ @ @ "@ " " "H 0㿘   2  @4>:< <0$<)#@ :@*` hH /* 'R <0  *@ *@    0<)!ȓ+ @ @ "@ "  "@ "H 0   㿐 R`4 3`<*`В``*" *  * ''  $   &  n l牖  d . d , `   j z    h fr e  ?&  㿘 !m `d `,!h   u㿐<*  *``," *    * ''` %2   $``n`l; `d ,`d`, `` `j , ` `h`f$`e` ?$``$ `d`"` \`p T?"  D* @) `p  \? T D" * @  <@`2 @$ `d !m!   @$ $   $$$L`t4 < `nT`l`,   `j K,`h<`fF `e $H48$<$@$,$0$H `d 2$D@$H$D `$( X`t *     @愒a: "  ` g<= '''''`H*` ఒ U 2  4 ,? ,`j 6  4? 4`n`l. `d` `,`d$` ?" H @Ea: ,   `d  ,`d` $` H?  +a:  H@@ `d ߐ ,`d` $` 㿀```  ,   6 d{ p 0w  k "j`  @`T  '`X`` @ " 8 t" ܤ &   \ O `?o%`< `` ``Tt*  `\# * #\+@  o? `\`T"@ +@ n?%`<``4"@8 <8 $pR쀦 " ` $ $] msdosfs_write(): bad file type㿀    ``h `' ,  <+0 䀈`   t>`e ϐ `` ] `W  `  B   n B    t@ 2`` ( `` Ӑ 0`'8``  t  @ '2,`@ ()``  @@ B TB?@ݔ`  @ 2"@  䀈`р  'oT@?2 ?'8`'@յ\$  @X  @ O`` @ D @՟@կ @թ42 @   3 t2@. p '`0 @=`<H"4D\HT"@ ;   ?"`H`H?2` oM "a a?m͘ ` X`"@` `$ `<  B  t      ' t@Z@2<nb ` n n  ' ` T`@ K@ I 䀥"`$`? ` @ `  @ b &`>` t? `@2   $֒  㿈  D 8`2̰ <*`В``*" *   * '' -  $  " n l㵖 d , d , `2     " j 㡖   h f㙖 e  ?$  d`$  (  Ɣ耢 2~ X* Y* Z* [* \* ]* ^* _* `* a* b*  d*  e*  g* f2 * i* h2 * k* j2 * m* l2 * o* n2 * s* p2 * d` w*  d  t2  *` d耊  u*` d耊  t*` , tc 2   p* p*`  m 0m;㿘  h`  A   ͐  ʰ㿈 <> D''D' H*`   -msdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory? 8    D'D'`D ` a@`.@`D*@ !<> D''' D`H*` €@ ] " DW D''' DH*` 2 װ p  !<> d`)` `J`.`  ` <>  " <>''' H*`  $   `  <=' '`/`  '''?` H*` %<>''' H*` ``pp2 %# 9 26 `@2<- ~"4 2'  ` "` d     B  qG  `T谒 2+!<>` ? $`<- B# '''`H*` € 2<- (#8 '''`H*` Ͱ  #` "<- #8''' H*` € <>'''H*` e h  X' \' `7 b/$ X $ \4 `, b% $j%  $ X$ \4 `, b (`$ ($` z " T 0  ̘ O'''H*` €C  $  X$  '''H*` €(' p 2 \<- #P \? T?"  D*@@  `jR  "k  < s * p2`*k''' H*`   $   p `, t@    ?dƚ <p @R <*`Ж ``h*" *  '*  'l''h'ޔ  /`  ڐ u  ؔm ?'\ dT"*@ D@ k` < @`<D <a@q @g <c+ d2 + + ؑ2 + + ֑2 + + + ڑ2 + + ޑ2 + + ܑ2 + t@ p<" 2+ ;+ :ٖc+ 0ؑ2 + 1+ .֑2 + /+ -+ 2ڑ2 + 3+ 8ޑ2 + 9+ 6ܑ2 + 7t@  d+ d+ p+ 4 p+ 5j0 [dpȰ Sdd /''' '|`  Bd`@26 <#$<0`<)#@ :@*` hH /* 'R <0  *@ *@    0<)!ȓ+ @ @ "@ "`"`"H 0  ` `:" <#$<0`<)#@ :@*` hH /* 'R <0  *@ *@   A 0<)!ȓ+ @ @ "@ "`"`"H 0I 㿘    g:'  " B`  B  n$ $ X  n 㿈 <> D''D' H*`   -...h`'   ,' d ` '̀ ?'  @һ!` `  "&` `" u'ܕ2*('̀  <)K"H<)H"h@<)C"<)@" <)9"<)6"耢<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    T֠ @"H 0`"@`p2  '`t#@2h``<2d` @  @'2\`@ 4W`iC `i?`4 4K`<1#aШ `t2 '`\`<`T?`D" * @Z '  /   <1!/ 7<1  !/7/  ? 7`@   2` D`"  =@̸ Ъ`  $`t` "`ԑ:` `T@d Ԙ`X$`` "8t"  8 Д䐘䴒 ?`gN䴒 4"@8<    k "v? ?  ` o౒h d?+  c`t*   *` *    `\`<`T?" `D* `\`T`D" * @ը  '/D3`+  ;  '/ ` U/*   ? 7`@ ? # `  D=@̸ `঄ < D } h+ ``=`>`&`Ԑ t  d b 4 `2``8`` "@"` C@<`<0$<)#@ :@*` hH /* 'R <0  *@ *@   ƒ T0<)!ȓ+ @ @ "@ "`"@`"H 0`"@`"gɰ0" 㿘  ѿ 4㿘  `ѵ 4㿘 `Z 4㿘  `  "@ 2   " "    U  msdosfs_strategy: spec㿘  P`h? `<3&# H D`, \ H T "@ 8 - ?$ H H  <@1 0 H$ 4<>`  l` $ 8cX H*` € 0i̐tag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %d, %d 㿘 <4`    pr  c? 2 <4  e2` 4<4`!㿐 `  t    0#\ s'``,? 0<4( ҘҘ,PҘ\hҘx҄`   `  " ` $`   `   `  `    㿘` 0<4"̓.` €0ppppp0$ / /    /   /  /    $( (" H /*'<(# H p@` H /* '<(`2H 0  ` 6`&`6`&@&`@#   dT 7"&`1&`H /* '<al F  &`@I > &`H 0` (` &`6`&`(&` &`$&`4&`0` ` 7``` "@&`&` `   `@O`&`&` & A;" `"`"` bpf: ifpromisc failedbpf_detachd: descriptor not in list㿘 0  . 0 @~  " <5!   <5 `@!2 @" `2&   "@& < 6 㿘?2  ` *` * " <* b     @w L<Dx $ 㿘?  2` @*` * " <*  H o*@ g   H 0@֐ bpf㿘? 2`  @*` * " <*  ` @ 0rH 0k #H 0c H /* ' ; %<5 2 "   "$ !Ŕ # ? #H 007    $  $   $ $ $  " 2H 0  H o*@ g  $ $ $ H 0㿐? 2`  @*` * " <*   `2`2  `- < h`  8  2" 8 ( 4 (  ,`H /*!  x H p@ "" ," " " ," " " (㿘? 2 * @*`"@<o*`@ @  7"q@ "i@"`"h@ "f@o"j@"` "@N"t@"`4  w@"n@<0  "~@" "p@""k@"`Ѱ  "u@ "}@"ư  "m@<0   v@ "g@6 0 "l@o0"f@"` H /* '` ```H 0&` 2    8$` &$`@~H /* ' =H p@0l"j H /* ' `0`  @a   ,`0H 00P "N K 2 G @0C@?@ <0$@  2$`  . ,$` a ` @/&` @ύ<0@$&`(&`,&,`266@ $`4 ? $`  $` $`8$`<`<&㿘`  $@ 2I H /* ' & $H p@-@b1,` } 2`) )  @P "H /* ' & $H p@    㿘N@ .` ` А ( `< 0` @  8*@`@ $ @<"쀤`"= ` "5@ @˝ 2/@ 0 2 - 2  @$ #H /* ' @  ېH p@ `2`  "@ "` "` "` 㿘?  2` @*` * " <*   H /* '`A  2 2  ђDH 0㿘  !< (& ( $@ " @I" 2 (bpf_mcpy㿘%<9`2` @`@̇@@㿘 `` @`  #<9 (& ( $@b " @`L 2 (㿘    4   ?@ $) 2 `2  , H& ,& & & & &  8` < Ғ 0Ő  [ N D& D  " Ґ 8` < ޵ 0Ө  > 1 D& D @i$$  4 $ & 㿘   &    & & &   φ  7㿘  " $|   " v  " $p  $ "&j &bpfattach㿘  β  2<<9+#" "@""""" "&""x` $  0` & 2  & $a 6 0? & $~ 6 0  0  ?  7a???؀ "6 0& $ D"@ @6   @ " @ *  ((,  ,   % "  " @  @ *  ((  *  ((  *  ((   "  "@ @6   " *  2" "   * H ܰ?  ? `<:"ȓ*` €$8hLt T(l4pP(HX``h  A  Ŕ5   J  &  Z ` Q "  6H  @@ ݰ  @ @ *  *` *    @@ ð  @ @ *`  @  `   "  6  @   2 `   "  6  @ @ *    * @ * @ * "@ * "@0  (   *   2   "  * z(  *  2  "  * db`&`0VTR.P6 M J& @B E @˞ ? ; 8 5. 260 ., 㿘 @B2`)65 60 @+ &9144`    @Ƃ`.``?㿘@ 㿘/<D㄀  <*!p"!p"`& & & <*ap` & `""`-<( %6 ,<D#  <D㈒ **"㈐ˢ (`@Ȧ4 (F %( @ 5@(   , 8 ˅ @% `8,`8 , `@@ȃ, (* , 4<>4 , "!$`($`  `$``"``& $`& $@& $`, ?* 2& <D#& & 㿘<*!p ) ""  `  2  @ @  0 "    "   @    2  2  㿘<*!p " 0 "  "  `  2   `"   @@̐    2  2 0 㿘      <D#  <*<#(. @ :<*!p`5` "-` 2$  "   @   @`* " @( "   2``2` 㿘X 2  2  <*p`` " `    2``2`  㿘 ` < ` "8 `2/  2 @@, "( `"   @@" 2 `` @   @`*   2㿘 -`@ ) `%` ! `@R`. `.@0! &`@2`.&`@ . (  4 .<>!㿘 0 ?  6 05   2@ @7㿘 0`@76 0㿘7  & && 㿘H /* '<*!p  T .   .*` 4 . `" @  2T .H 0<0a <>#$ 㿘<*!p "  @  2    㿘0!@0!$@@ܐ   !@" !@"  !{@ !@"3  !2@ !1@* u0!5@"p 0!@0!@"`<{ 0!~@ 0 !6@"b`p `06&`8&:M `0" 2H /*'$H p@`02?H /*'"H p@`0?"R a ` 4`0 : {$`<: v`m: f ` ` -!"+ !"% !  !"*`0!00! 0`0!0!0` 2` .  !!!"0!#!%` 000! " 0 !0!6 x@<*!p ]` "[@ ' ' ' '   ??ؒ  2D@=` <0!؀5 @F  7  ` @:  ` " ؒ۔  2 Ԓ`  @  @"&@%s: can't handle af%d 㿐 0 A Aư 2<* Р & p  && t 4  @-H , 6?4 6 4  t "  0 4  @- 0@-/ $ t " Ac <@@A  (  A ϐ"p /   `  `??"6`  `` "@&` &`5֔ ` ` ``$`R 7`++ + + <@  +  .*` 3 *` *` *` *`*`*`H /* '  @    & H p@ 7 \` & \$` 2" &  &  0 d&  |@H 0 `5-atm_input: NATM detected but not configured in kernel %s: recv'd invalid LLC/SNAP frame [vp=%d,vc=%d] 㿘 0 O(<* Ѐ & p & t X & X<A!0>@ %( 8  W<@b@µ   <A``* `" 0* 7 (<(<0<* ` "⤀ *X ̒ <褐 <!40#H /* ' @ `4"0 & 2" "" "H 0<@ ܐ" %*4"8"x*5`*6 %@" `2`( 5(`2@unoutput: sending pkt to: %x  %s: can't handle af%d 㿀 0 A A  n 2'<*В& p`S& t4  @+  +6<?@ 46`xT4 "(4 "$4t " 04  @+0@+ $t 241 A 26<"46 A?46$&t "X`Ѐ  A @ `<B"*` € l  ,    T                      L`! "<D#`#7'2 @:7耢 2`ڰ    ^//////`!;( 0(7沐 4I /(`! `<D#`#7'`` / / / / / /` `* @.` .@``(  5(<// cx // //@4   &@w`!䀤  0(沐 3 ؠ0`" `  `  ` / / / / /  /@Ԗ䪒 >`耊 `#6``!"M` 0(H沔 3  "A`  2   "   "   $ $  3;        $  33 3   +  +  +  + + + ` 2  `" 4 `  " `  &` &` 2 ` ` `` $` `` * ** < a+<B  '<Bв``$<B    7 7 77 7 7  <B    / @` 2  `"   " `  $`$`  2 ` ` `` $`2`Z 73 33  3 3 3 3   +  +  +  + + + H /* '  @    & H p@$ 7 \` & \$` 2" &  &  0 d&  |@H 0`b"  d & d`1clnp packet㿈 0 4<*`В`& p` X& t  & X@` <D#@  !"6 # "`  ` & `` * 2`<(92`Ke  5.2`Ce<0<* ` "⤀ *X 塒 <y <!<(<0"  <* #"`*X 勒 <Ec <Eז"@;K0<0<* `@ "⤀ *X t <.L <.    "w  〢  "p 0w "v 0?"@ #@3  ?&& & 2 ?"   ?"   ?`&&  1a <  &<@2`2`2`2`2` 2 ` 2 ᐀`<D"<(<0<* ` "⤀ *X  <̐ <@# :  ***** ** #    .@ .` .` .` .` .` // ` @+ +@ *.@` x 0&00#H /* ' @ `0"0 & 2" "" "H 0<<Dx  : 0 *@ `  *@`*@`<* x㿘 <B   %. 6& 8& x. 4. 5  2 & * 5 *  5@X & <D#& 㿈H /* '     0,  77 7'+7  2 <Dc<Dc#'7`#7' ^    //////' 7H 0a / 耊 2 `H 0R  @  2   @          & H p@0  7є   H 0" 7 &6 6 6 & 6 & ` & ` "`&``& ``&`H 0 4㿈H /* '     0,  77 7'+7  2 <Dc<Dc#'7`#7' ^    //////' 7H 0D /` @(  2   @!      2  H 0$ ?  & H 0  "  "  "@֒ 7`&`H 0 4lo%d㿘<. ( ;?9<H7<G ( 5 6 4 x  0 8 <Gd" $ $`5!%@@% -..@) : `` ବ` ଠ `ۤlooutput: no header mbuf%s: can't handle af%d ` 2<*<GI#<* А & p  (& t 0   t't'' 'x?x&`4 @" L.4s p 3n A L & L` \@ & \ "<.  <G  <G  <ۆ!    <# #(.yF /H /* ' @ .f H p@- 7&` 2"  <( b <0 ( @ <*#b *#X M  D%  D & D` X@ & XH 0 ` "`P  @ 000<H"(  2@ 1@ "  /  / " " " "" " ifmedia_add: can't malloc entry㿘    2"`<Hf""` "` "@"  "`& 㿘 ``` @ @ݲ``ifmedia_set: no match for 0x%x/0x%x ifmedia_set㿘@ 2 & <H#pƔ:<H'#㿘 x `us0!50 !6"&j `@g `` " @2@2T &@& K&H& ` `&`&`&`&`€`   * TZ  ` .$`  2    `$*` "ے T&`   :  @  "2sl%d㿘<3" /<I-?+<N)<Jo`$?`g($@!($?| b\"H 2 4?t,?x$?$?$?$+ < /切osl%d: can't allocate buffer 㿘 ̀`x( ֔  $ <I " 0  4 0($ ̒x$ Ȑ @.$ а 㿘<! `͒a: ]`h <3W " `H  ̀ 2IoƐ "I 7&`$`$HH /* &`p d@&`pH 00 H *`Ln$`` @ %]$@.$  H 00$@$H 0 / 㿘H o*@g Ԥ. h` & pF$`& `̒ 8$`$`$``  H%`#`H 0X@ ?ଐ "%s: af%d not supported %s: no carrier and not local 㿐 <J"",l /`&lĀ2p+ 2 20 @2 0+<J"(p A`@  2 +ݐc 4  2H /* ' 쀢`"! H 2 <*pИ"'t"@'Вb@ ?? $ Ē`@7&  @ `+& H P 7 !&P&`  <*&"  &  & Д&p&t H &@  H 0 㿘`԰ <)H /* '(  '| d @"(H 07<) `H: `ȟ@`H42`<<0#$`%@ : *hH /* 'R@ <0 . *`  ޒ 0<)!ȓ+ @ @ "@ "%@"H 00 23 8`<<0#$`%@ : *hH /* 'R@ <0 . *`   0<)!ȓ+ @ @ "@ "%@"H 00j`L* "@  @2`b<<0#$`%@ : *hH /* 'R@ <0 . *`  s 0<)!ȓ+ @ @ "@ "%@"H 003H /* ' "  % % $ ?% "  d % d  % % $ ?% H 0 23/`<<0#$`%@ : *hH /* 'R@ <0 . *`   0<)!ȓ+ @ @ "@ "%@"H 00/<* `H`"` ` `@K@` 2/ 0@   @,  @+/  ` `-@@* /o Д% p% t`H`  \ % \$gx<( 9<( 3  ` `? $$  \% \ $?    ݐ $4 " \%{0 % \H /* 'T*` ?5  " 0@ 4"`440"0<I!l ($R,$( ?44#H  2 # "  \%2#  T0% T L `% \*% L㿘H /*'<(#< H p@` H /* '<(`2H 0  ` 4`$`4`$@$`'ے  `c*  ( Ԓ ?  & ( (& $``(  ? $`4`$`($`,$` $`$$`4$`0 $``@+ $`$`$` 㿈<b`Ԑ `"b?2 ``p 2 `X` @2`X`ؐ $`ذ `0 `'$`X 2!$``䀢 <*` В` 6$`<*`А @`  $`$``䀢 0<*$`   ܀ "`` 2``܀ 2 ``܀ 2 `$`܀  ?$```в" `$`o @ ` @ @+  p 2`0 O*@`0!@ `@,V` $~`Ho@w p2v`H`'r`Д p@,D` $l`H`04`0o  `Р*@{ o` T<*`D $`DД$`p$`tH /* ' <۔ @ `"`H`h$`H(F$`h0  2" "<0<(`b<* " +#X#b" 4 0  H 0```̀@`*@$` $``ؐ $``H $`H`$`ܐ8$`$`ЁH( 2@  1@,  @ @"*  @0~@"8 2 /020i8  8 "" /  /H ppp%d㿘<" 1<N/?-<Q+<R 2a,`$?Ԕ` #$@%$?`  a4?X,?\,?^$?$?$?$ $ ($̐ ݖ !᠀ߢa㿘<  Ȁ``!  ```!` 0A?$ Ȑ%4 $ $ $!$!$!$! $!$$!(<)H /* 'H  . T $!L$!L"HH 0!L "$!8@)G$!8$!@!0   " ?! $!$! <*`а$!D$!H㿘, 0& 6 0& '$  ̀  & & " Ԑ?& Ԁ '    & & " ?& 耢 &  􀢠  & & " ?& !  &&! ! 2! &&!@!L&!8`5&!@<<0#$`#@ : <)*`hH /* 'S <0  *@ *@   f 0<)!ȓ+ @ @ "@ "!L"!L"H 0&!L%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x x J@u S@"{   N@"@,?0| V@) Z@(?0r  Y@"%    Q@]  R@H?0b  M@"{   K0 L@ ?0S P& M& J&!:Q E H o*@ a @ @@[ H 0'<?c @$ H 0  !:# > $@(4   & !: !L " H /* ! @( H   !:  0$ Ȓ!: ` 8  ـ<D#`v#@ 2l` 5 H /* !!8  !4@@$!4@؀  $!8 @@<P 뱒  7H 0' *$ H p@0H /* !!@  !< @@$!<@؀  $!@ @@<P ~  7H 0' *$ H p@0\@ 2@ @@<Pؐ @ڒ  \K  !0E  L@2 !0=&!:D 8!0"3 H /* '"  @ʐ@H 0 H /* !<*`и !D"&!H" &H 0  㿘<! H /* ' !2 @  !1@C !@"0 ! @"'  !@"0 0!~@") 8 !@ 00!z@^0!{@"$&w  @t ?r20 ` `: eb$ 8`&"] / YW /""" """"" "$"(","0"4!&!"!"! " !$"!("!L 9 "!L` "!L " !L"$!L`"(!L ",!L "0!L`$!"4&"`"`"` "`"`"`"`"` "`$"`("`,"`0"`4!8 "!@!4!@ !<4,H 0%s: af%d not supported %s output: 㿘` "԰ 2 0 @. 2` 2ʰ 2`?Ė*@6`<R` ` a0  !6` *   ! / 22` 2  `"  &`"   $   2&`  7&``< * * ** `  `&` `` @``@<R!Ԓ @`  *!<* $aDa, "`3`*H o*@ g  a`"&`$a/!<*`@ ` @&&` "&` "H p@`P 7a( $a("$`P !<*"" "`"@a Ж  L& p \`& \& t& LH 0 #S㿘! B!   *`@ `! !0  "0/ %$"@    @& " " P!(`& P&!( 2" "" "  #$ 2&!㿘H /* '  <(<0b+`&  <* #b*cX  0ΐ H 0㿐H /* '    $$& ?$     $$& ?$H 0  2$  $$   *  `!   @-+01`!,+0L(   !`!  ` 2+02 @$ۖ  p " ,  / -,, , , @Δ +0`!@"1  @,8 (@$ '   4 88@ `" "E  "? `` `` `!@ `   & & `` 2  **  ?& & 㿘<"H o*@ a ) Ԡ?@#?   $  H /* '@$?H 0 ?@0@H /* '?   $?$"@?$@H 0 2 !aH 0if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) 㿐` 4 `@`` ` `  ` `*  @@ @ @<T# 瞔0 @?`<U *` € T U< WL WL T T WL WL WL WL WL WL WL WL V H o*@ g?# & H p@ 0 ` @ ` z2$!@!8t@!4 @    hH /* ' @& H 0 0US@ @!<#\ $   Ĕ EH /* ' @ 0*@ & H p@ 0/ `,2!@!8&@#!4@ 0@ !<(€H o*@ g * & H p@ 㿘!8 "!@!4@&!8!@ !< @&!@㿘H /* ' ` 6`&` Ѐ 2" &  <(<0" `&  & <* #"`*cX Ԙ 0q H 0%s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full 㿀!   &!' `` @`<V x^ @`  * `  ?Ȑ*6`H o*@ g & H 0 @!@`>8  9`!< , 2   c`  * 7 @ <V  H /* '( `&  & H 0  `   !<0  2 *   `` @`(-!L  @#}  H /* ' 7 & H 0 -/ !L ` #\  @# @ @<V H /*')<(#M H p@` H /* '<(`2H 0  ` 4`$`4`$@$`  $`   dG$@H /* '<al  $`   $`H 0` (` $`4`$`($` $`$$`4$`0`` ``(` `  " ```  ?$@ :`0_` !, , ,,  @  !`$` ` `?"@ &`&` `  ``(` `  "   P$@`  ?$@4I$@ `@` ` `  $` H /* 'V`<(*`@ ?2@ ` " `0@ `4"`4`4`0"0<`P!l`` ``(`$`Y`,`&`( ?6`@#$@:H "! d !L ސ` #\  p@"r 6  ! @@<V 䔒 0, d8D`` "@`H /*'<(#0 H p@` H /* '<(`2H 0  ` 4`$`4`$@$`ϒ   `  5&` `&`&` *@<*&!H!, "`ஒ`!**  0 !0 "`0l<(` ``?<0&`&`  &`<*  `*cX  <ݐ <!  H /* '  @   # H p@  @<V!  h %& h&`  <*#"  # `# H 0  D X`& D& XЀ`& p& t @0  H!` &!& H%s p + | <D  c 2  @*   @ *  ** ޔ  >*<X*㉐#tun%d㿐<  Ĥ ' P H T L X  4 |  < ` 4@<Y㰒 <Z$!%%<Z#%@<D%# 5&&@&&''@p   '`ȸ ȶȴȲ`Ȱ ȮȬȪ`Ȩ Ƞ Ȣ`ȀΦȁ%s: open 㿘:- "?!2   ` *` *  <* ` `   <D#`6 <Y"  %s: closed 㿘?2  * @*`@<*`@ ?#@ 2@ H /* '     $ $ &  ?$ H 0   0 "*H /* ' 䫐 0`@  `2  2 @ے   2H 0$<Dc <Y"➒  %s: tuninit 㿘<D#` <Z ⍒  0? A4 0 @ 6 $ ` 2`"  0  " 0 6 0 " "   " 62%s: address set %s: destination address set %s: broadcast address set %s: interface mtu set 㿘 H /* ' !@/   ! @ !@D  !1@ > !2@1 !@"5 <Dc .<Z!x<Dc %<Z!<D#`<Z! 0#<D#`<Z!  & 8"  /  / H 0%s: tun_output %s: not ready 0%o #<Dc <Z#ɒ   c <Z#ᾒ  @ Ā   t''x'x 't = k"7`  ` `??" 6`  `" &`` @ &` ` ` ` `` &`  7 Y$ `@] @H /* '  @  `B$ H  T 7 :$ T&` 2" $  $  $ H p@ L $ L!" / @?c 6Ր   0  ? 2  ?  0 (((<  ~@jY@/<D@u 0w@ }@"_  X@" W@"=y  Z@ v@j 0n<Dj g"b H( 4  H O  3 43 4H @ "82?"-2? "#2?2H( ""H  #  " %s: read tunreadDropping mbuf 㿘?  2` @*` *  * <-<D@   <\!PG @  <Z#<  @H 0 #H 0 ?# 4@H o*@ g )<\` ` $$$`?$``aђ`@4!!`F Ѐ`"H 0`U T`<( ` @ 8 `K``yH o*@gT`*`@ ?5@ ` ")<(`0@ `4"`4`4`0"0<`A!l`` ``(`$`J`,`$`( ?4`@#,H   ` "` `  <\ߘ!h{ H $H%s: tunwrite %s: len=%lu! ?  2` @*` *  * <%<D  <] m" `   耢`?"`g  ??g`/`  <] В`@ 逤< /aH /*')<(#ܒ H p@` H /* '<(`2H 0  `4`$`4`$@$`|   d 7N 7'` K`<( ``D 8 $` `$``3H /*'#ٍ H p@` H /* '`4H 0  `4`$`$@$`4`   l "`  ` "`H`H T%`H`""Ā    \'\'t'h'p hH /* ' @  %H p@ `T 7`a%`T0'`" `2"`%``%%H 0 `D<(<0"`  <*%`D#"`*X E 0 %s: tunpoll %s: tunpoll q=%d %s: tunpoll waiting 㿘?  2` @*` *  <*    H /* '%<D  <^!# `A`  <^!   <^!   `2H 0<X X < " < "ax㿘<!x```<!X@ `< @  no memory for packet filter hook㿘6   <^)# "` "@" & "`& "@"`"& 㿐<!x``` <aXaX'@'` <  '@'pfil_list_remove: no function on list 㿘<_2`"`& "  02<_j <x   0<X< 㿘<!  !:H [H /* &`h  `Ԁ   H 0@  0 2  H 03 `"&!P@&!P?<a<c<_#&!\&!P&!\& & & 6!&!x&!T&!X&!`&!d&!h&!l&!p& &!t@֐ 0`@6 0` & @&`ԕH  㿘H /* & p  Ԁ  . h&  @ H 0 㿘H /* &!t  &!t!x " &!x $<c! & H 0㿘`Ԁ  0tH 0m H 00eH /* & !'<; ` @@ހ H 0E #`!Ƙ  @ `h "  H 0- "`p`( ` ` $ $ $` ?$ H 0``   2`㿀 p     @2 h  h  " ഀ 8` @` ` ( 700<( H /*'<(#֣ H p@` H /* '`4H 0  `4`$`$@$`4`  &$` `#(,`H /* '<al j $`m b $`H 0` (` $`4`$`($` $`$$`4$`0`  ```(` `  " `` ?$@ 8   $` ` ///// `  x 㿘 Ԗ``q? P@]   U@2 X@!V  W@"   T@I  O@B!:+ GD$aPaPA& !: :7$apap4& !: -H /*&aP@ aXa\*  $a\$aX$aTH 00aP@ 0 Q   R@@<E*  @2 (2 `* 2 㿐`. <(͐ 2H( #? !<*a  ~&a Hc 6a Д &`p&`t<(W H 0-H p@H /* 'T *` ?6  "'<(0@ 4"`440"0<!l ($,$( ?4H  as 6a HaP  2 *`  +@*  Ha $&a %(#H /* & H }b v \ xH 0a  `&a `? b ^ aaP: ; *` @  *   }///a :`:` `; * @ `*  },@` ,@,@` ~,@`H o*@fH  "    H?0* H 0 a $@&a  $$ &atH!$atH /* & @.  `$ <c!P `&`H 0㿘H /*&   `("H p@㿘 Ȁ` ԟ@ H c  $ p    @  # 㿘 H o*@f & H p@㿘 Ĥ r!x<( `2``H /*'<(#ǒ H p@` H /* '`4H 0  ` 4`$`4`$@$`h  9&H /* '<al ӑ $` Ӊ $`H 0` (` $`4`$`($` $`$$`4$`0`  `($"%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! 㿘`Ԁ`+`@'<@a` "Ѐ  $a`@<d ``"+ `2` "``p`l# @2`*` <&`p*@  0  `p`Ȑ =`&`p@0H /* &  ``@ $`<E> *`   * `` $`H 0`@@ ~2`aa 4a@?`0   -<a @) H /* &  @ $`@@<da 8֒``Ha` $a$`H0*@$`H 00z 4%a| u@<d H׸`H /* &`Ha``  $`$`H$aH 00T` ?  "` axa|@ 2$a|a|! " a|ax$ax"` `H /* &*  $`H 0A0!   ap*@H /* &   } $`H 00+$` H 0a`2?aax2" ax2 " `@<d `ax`  ```"$a|?4a $a`  ?@<d x`B*$a *a`$a4a  " a  `@<d `%  a*aa|`4a$a  " a2 2`@g<daJ *`]``đ*2 `  4a`@Q<d* a|` "``(` `` @ "  -&` `  ?&@ %@ 2o@ 2 `@(<d ֏`#`$a|``&` ````" $a &` a<E*@a`*2 $a* 2@ "4a H /* & `H a`$`H$a$`H 0 @ %s input: 㿘`!!*@ &!! `  <f!2 !@!&!%s p<E"  > **2`  `* ** <f*"HR` ` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘    @= 2  @:      2 `  @ `<  8@ @ @   @ ` @  㿘@` V`  ` @"``V` ` `2   @ JJ@   ` b` 2\:   :  ",@:`` V`4 `A ;``2` `@ .@  "` T4" ' @8        2  Y    2 @2`  ` 8 ( :`0 ?"  2"( * 㿘@`     @JJ@ *J 5&&"  *`:  ` ` @ ``V`8`     $ $ &` &   @ 2& & &  rn_addmask: mask impossibly already in tree㿐/<⤶ @ " @& <a<ᐔ @>`-<@7$@ L? "?$@4 !<E<EbD6"bD<"<u ,"D 6$"D"@ a$"D*)<"<a` a@ 2 X`V⤒  0  M ⤐0@  0@"<7  <ha(o  00       *  L :  <E"8*`J:`@ 2 $ $* < 6   .  @ 2  :  @ ` *  Mask for route not entered 㿘<cH  "cH  q  2&<i`p  & & &  6 .  " & & & $Non-unique normal route, mask not entered㿐  `    2   < C` ,: `@뀦``"T`@W @`v @``2`@2$` ,` $`$ 2$ $   $`$` $`" ? . & 6` $` 4` ` ` ,`  <@:  T  6  .*:   " T &  2  A &  2 ``*:  V 6$2V$&`J-`T:   0D  & ?$@`"  T@*,: %<iV& 4# "  ` ` 8  Ӑ  Ɛ 22Vܐ&rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Mask㿘@ 4  @@" 2  `Œ       2  `"S N <j $`a8Ј   <ja8Ѐ 7 <#cH"cH%" ? +" `T V : 4% "  V   " 2 <ja`N  2  ` A  & 2& &    2 <j "  2"  a   p & & & &  & & @2""" Y"`   2""&`"1 V  "(#2!# < & ? " H"H"`<j<jaŐ  "  && &  & & & " "`2""  # ` , , #㿘V  6   `   `V  6     @   2  "  㿘  t;  ϔ  4 @n t&< , \ * " " @>`*` 2`$\`#<# `<i# ` <j# `<g# `<ga<k# # d܄h`@bd$$ $$$ $(  rn_init: radix functions require max_keylen be set rn_initrn_init 2㿘<# !<(⤀@4$"2("`*`<l`0 0*  f #< $a<lސ h" *@ "<a<  " "a?*  **<"<o <l p㿘  <E 7H<EL̐ "$   `4 4 <aԔaԀ $a" "a$  㿘  "`"  " "@ 㿘  `< ԝ㿀<!'T'X'L'H'P E  @@2= `" `@25  "  @ 2+  @ 2!沔  f  D( 2d    <   2 D  d < 0  㿘  &` `@ 㿘 &` `@ raw_usrreq㿘`   -H /* !`  `2~ `x.`<m! € \ x `a:`Z Y U!0Q00[0K    * (? `   8` `   " `  0+ 2`  9 0!   -  Ґg0   9g0<mh H 0㿘<#  "  $* €  2 rtentpl㿈 #h<.<mc`!T#\#`#d |  g 6<3֐ x㿘`  `<  `4  @ &h <3 x*` '̑H /* !  /  € )< &c$`' 4!    @J̢  6'̐ 4 6   4"  ` 6 4 6<c$` 2``  ?'Ԗ???'@* H 0́rtfreertfree 2rtfree: %p not freed (neg refs) 㿘 2 6<n̫!?* :`,6 6 4 (  <<n̙!` ?"` <n!,0@z @R`. `.@  2`.  <.!Tɓifafree㿘 2V .<np"  . 06 .p  T 3; @  0@ 2   @ ~ 2 A`- "  " 4 (  4   < @y < &<4 4(  @Z  A  ``'@Y`<c$ 2c$ 4  ???''''?' @KЁ -㿘   J @ c 2  `6`@? 2`6 `   Ð "rtrequest delete㿘H /* !`<3 x*`   2 "  V0A`0Ő 2`    <o|!ʐ&`t 4 t ?` 4 4T 6  64 6&`t`@` <`(  <` ` "` '@V`6 `6`6`60" @ 2 4  D >*  @:   0  R +<.n 3+<.aTz d 7 @K | 4 4$ x@b 2S 7 @  @@  2`. t " L ' aT/   4`.$ @` $ <@L$ LP$ PT$ TX$ X\$ \`$ `d$ dh$ hl$ lp$ p`(` @`'@ 6 4 6H 0㿘@ ?    ?    0 "  ?  @8  `(     2 & )  & t  & 0@@   t  R`6 `62`6& t 4 P & t 㿘@.@ @`.@ `     .@`@ *@ "@n rtinit: wrong ifa (%p) was (%p) 㿐 ' `2) ,       " , 6 @?@ 4 6Ra 3_ A ,  [􀤠@````   @T 6  6`4 6:`29`26 "2 6 @?&4 6<p#hr @`(   @R`. `.R $ @2`.$ @ $ < . ( 6 .  @Y/work/tmp/mrg/src/sys/net/route.crt_init_done == 0rttmrpl㿈!<E"P "  <q<q<q!Вaؖ@ "o#h<<qb!#\#`#d   ĭ < <r<0a "vڒ  $"P㿘<E"P`    2& &  & <  `&  "`" & "㿘  "/ #< ` "`   "` "`&  `"@ "  €      | ;a  2  ` "`  "㿘 x!<` "`  "`""`"`"!  x2㿘H /* *<b@H 0  x"<2` "`  "`""`"`"!ܒ <ۀ2<ې! 2" 7""" x " x"`  x& x" """& 㿘H /* *< b@H 0H o*@ a< `7 .`@ 6-`  `%< "`   "` "`$` "@ "  €       n` 2 ` `2`H 0<0a <r"u 㿘`$<)H /* 'h     "hH 0 $ @= `# !<*@ ?`"``@0`"0? "@? "?" ?" H /* !`  `2 ' `<:    H 04<*#@ `"``" #@<E`"<E  ##@  " "  " <E"X<Ebh" "O`@4H 0route_output`'L'P'T'X'H  'İ         2 ΰ 7  2 <sk"@ K'   '|  ݔ  's 7 6 <'h +a L0 &'@’ Ԁ "Z   8V ؀ "  8N   a  ` @t 2? 7` '  <! `a: "/ ?`)<t d*` € Є ( ( (؀Ԑ ܚM Ā L @K$6?26"DԐ ؚ5 6 $66<3 `x* @2  / ܶ 26  66 "    ^0Ȁ0 '0''D' 0"<`"'` '@'`0`"'@ '`,6'Д  @@    -@  Д @i V4&L&$P&(T&,X&0\&4`&8d&<h&@l&Dp&Hz& ؀   n E " " `耢` ؀   "F耢 k 2  ؀ V4A "$  "  @@`" R`.`( ؟@R`. `. &@2`.&@ . 7 .&< $@]L@ "  (ؐ  2&DL *@ &L $ &L - "& @&"`'` @ <*#P`4 ` H0!  – `26`Ԁ <E <E2"z<E<E<Ebxh2X` 6`  `" `" @`" `" ` "  `" `"` " """ """""  8 "*#   쀢 rt_msg1㿘   C`  ` ` Ld  T Ld( <u@#& & &  @^`  ,`"`@- &@ ?   $``,`  ,4, 㿘` &@    L  T L2 ,`@"`@ *@&@ ?    @k``,`+' &   &   "  =  &&  &  7 ,,4 2' 㿘<*#P``A @ " " @<Ebx "  22<E<E bxh Xp<*#P`!   ????'Т  4` , 4 V 0 D@$ <E"x$ <E<E hX3 p<*#P ` `f    ????耦 '`   `   @' `'`'' "?`, 2 `0"`,""  ` <E`bx"(` '0''Р "` ,2V4"@ "" <Ebx<E<E 3 3 bxhXz``h@ 2  V 4`@2 a   ? 0? ? D' <'''?耢'  @''0` ' Д ̔ 2; ` "7 ` "3 ` 4/ V 4 #  8#  L# $ P# ( T# , X# 0 \# 4 `# 8 d# < h# @ l# D p# H <,# 3 # # # `̔ "`&`̐ &` h<*!p  ????耤w'``" ,@2l  @' Ù 2d` T'` "Q`` 4M`, 4 T04$ @֔ DА$ `̀ 2G6`"@@  23`@ '`'` ' ̀ 2/` " ``"`` 4``  ,2 `,"`0""``L̀ "`̐ &```ǀ '''2` x  t `" o  '''  g '''' ''''H /* !%  0<3 x !<w.`@ "` `@2 ` ( ԟذ  ``.`00ذH 0 7    Ē 䀦@ '"  &  *` * " @ &route㿘 ( @. &&&*@"?&$,   6 &. . 㿘 (   . @y'@'h '@@t`.`"* *  ?@*"?.`"* * $,   6 &. . 㿈?@ ` @ I 'E,@ `  2X @ &` ` 2``@2  ` *  @ @ "4` @ &` ` @ ``@ @ ` *  @@ @ 2& &` 2`  , @2@&#$@"` 2 `, @ @`@2``@``@ < @  `  ?*`@` ߔ` 2   ?*`@ Ӕ ` "``* 2 ?`2 , , , ,  @`" * 2   2 , , , ,  `@?#,2  4, ,,  ,  ` ?#+ 2  3 , ,,  ,   1<y#-  € H H H H H H H , H H `  H H ``` ]@[`2`` "2 ` ` "2` `` "@ ? 3 , ,,  ,  ` 2 ``@耦$  `@  `."  @.@ `@ ," @.@  4 "@& & , ,  @Y    & `@P ` p.` `.㿈` @#\@    &  ?@xߔ ?$   @!$@㿘\p"3   ? # @/ 7 *" *  `* *`'h `@( ` 2 * @`l․@@6   ' '@$ ' `@   "  $? ' $ ? c 7 /  `*`" *  * 'h ` *`*` 3     + `   `0  "@    # W#   @"@ P#   +     * @3  3   + ```2    *  @ 3   ` 3  ```2    *   @#    # `` `2    *   @#    # ` " `2    *  @ 6    ` 6   6 &@ "6  6` @@`?# @3`@ @3` ;`6'@ $ ? ` ' 7  <E0 <+a a  *    :4**  0 *   *  *a㿘H /* !<Eb <0 !<{@ʠ#0l <*␀`#<*` X@`Ѐ8@ `2`H 0arp_rtrequest: bad gateway value arp_rtrequest: malloc failed 㿘<E`0 `H<*А `"А "<0a <{#0l_ `4 "  0"+ `0 ` 6`4<E` (`<<* 4`0,``< ,4` z&`X" `` ```<@ @q ` <{ @ 8`<c 4,``<`,^4`  1  &`H<|` Đ 0Q<<ሐ"Ē`"#"Ē @ $ `4$6`4<*`$" "$ ` `@``1`<&`X 5  `@ ,` `@ <E <. (&`<<a?"a` "` "&`H`4 {6`4 " 㿈   8 d 5*$` $`" ` ?$`@g  , ,  5  , ,  , , @   @  *   @   //`a4` x arpresolve: can't allocate llinfo 㿘``H @  2  `2 `X<}`( xR `0<*Ѐ( ` 2 `"   5 `   @g`7  "$ V$ `X"- `4 ?6`4 `<*Ѐ"" &`X <E @ $  `@ `@ ]`  <E`4`Xb6`4 &`X$  arpintr㿘<E쀢 K H /* '쀢  "$ " ?$ H 0 <} 2 <}v!    *     * @h@@f ؐ 쀢 %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arp from %s: new addr len %d, was %darp from %s: addr len: new %d, i/f %d (ignored)x` ܔ  *  `/ +` +` +`  *  / ( ( (܀`; 8 @!!<!* @%` 2L  0`L2`` ` L2`2 2A@!!* @%` 2L  0`L2`` ` L2`2 2   `2ब `` 5@ @ 5 !<}#H'@a 0!<}#'@ِ O 'ܐ `?@1 `  0 "C  `@g ";  4(!<} #'@ 0j <!<} #}'@ <` 0T!<~ ('@ e  `"  @ !<~ P'@l     5 !<~ x'@\  5Ր  , @= X<*<E % X 4 ?5 4` `%`x %` 0O2   @ ऐ  @  @     `@  0  @@`  *` @ @` ܐ @   ,,,,`  <6`   *``*  &`//&` x arptfree㿘 `2R`6<:#p $``0" `  2`*& `4 ?2`4 `   y host is not on local networkcould not allocate llinfogateway route is not oursarplookup: unable to enter address for %s (%s) 㿐< *ȐȖ * @ 2 " Ғ "& 64?`26< d20<  `<H @` !< `'@j   -㿘``  ``   d `,<|`@!6`,&`(㿘     *     * @h@@0㿘   * @`G` <E0A`?0=#`8<E#  3#<Ec -<    `  @ !<  !+! <* a*  *  *  +a +  +  $c + <!㿈   7 d 5*$` $`" ` ?$`@P  , ,  5  , , , ,     @ @`   @  @`  //`a4` x revarp㿘+<E<E)<E "c%#%c  #<'<%<0 aؓ2 : Ȕ #c ??  %#<!ܰ &@a& 3atm_rtrequest: RTM_RESOLVE request detected? atm_rtrequest: cloning route detected? atm_rtrequest: bad gateway valueatm: couldn't add VC 㿐`4 d`0 "Q   0ZY<9!00U!<E` @ؐ`<`0 4, `< ,G4 <%!`0A  < 8 a 050 a{/ / / `8 '@f07H 0`L``P"`P`L`P"&`\&``&`d`] &`h @~g!* ` &`L``@~^!* `L"P``@~V!* $``@~P!* &`P?! "% `0"! ` `" @2``p" `H" `@"  `82` `2@ xH /* !`    `2   $@    2  $  `&  6(  2 @H 0X  && & `   `22 &  6H 9  &  "`"&  @ `//逢 ' a1؀  "  "  "@ 6H   fH 0xH /* !  ? & { ` "`  " / '  a2ؐM 6H 0inpcbpl㿈!<# 2& #h<<"X`(#\#`#d \  0  $#&&   Ė &    <E#f#6 & 6 㿘<"X1 ' 7 @z \?$ T$ X$ & H /* & @$ $ `@2@&`" &@@= H  㿐 <* b  X ' "  2  D2  " " `d, ` ` `< 8  `, 6`Ɛ ,  1 2",  4` @# N:  2  !<` 8 '4`@0  ` 2 D  b2 ` 2e 0`4`'@ " `R @ 2`T 0`& D,  2J6  4 : " D@ "X# <E<E#b cf D*. *.4`4"@ `?,  24`@(', '2@͖    D?2& D  # 4 @& 446 @j  㿐`  `ǰ  ` "` / %<* " D``  `$`$` ($2  D`  0`2`p`T`2`  D 2s D    `@2R6  ` R6 626$  `2 "  < 2   , , ``$ `< 0`"@`2```4` 4``"[ 1`  0```T`2` `"O 1`< 8 2`\ P "`\ "`\ "   `" 2 ``\- 1 D``' ' X`@5  " D 0 2`  2   v #2   #& D`& H` @6  㿘<"& H6 @   @㿘  %"` L " A K@ PH o*@ f @i   X@ "`"`   X@ "@"`H 0<"X` "` " "**""  2 D"` "` " "**""  2 H"㿘@`\.) / 2`2  @  *    H 2 2  D2Ā` 2 H㿘@`@ `H` @2`Hp " $  ??'& ??' 0 ' 'T 4鰖  4  +  ;    0✚ 0ᓐ㿘 & @ @& *0  2  H D@ `  2 "   6   2 @*+ 23  @   (  H 2  2   2 D "@ 2 H     @"@ "@" * @2 @   (   2 D " 2 <0`  (   2 D" 2      " ""        ``") 0W X  D`` (#`` (  X  D (" X  D (2#  H X  D  @(# @(   H X  D  ("@ X  H  D   (# # 㿘   H    . . H& interneticmp_erroricmp len㿘 ` @ * <;P "P`?؀@ ` 2% `! @*  @          <;aP` h"`  # c 燒  ^`" <; $  d"@   $ `< xP .` ``" * #`` #`+`  `2 +`2+` "+` :3`+``@w  쀢: <} $  $ $  $ @@ ` "`"` " `" 2*@  * @<*ߐ㿐 `'L"'P'T'X'H<;aP`\ ""`\ $@8  6  ѐ 2 <;aP`\ "`\ "@& @& @ <;aP`` "``  "@& &  @7<;P* l `" @``< T*` € ? ? ? < =< ?0 ? ? >4 ? ? = =( >< ? ? ? >\ ?Ѐ _< ,  € < < < < < < = = = = = = =     CP   >P  9P # P` `*` `8`P`d "`d< 8  #<Fa|  " <F"`<@<`c@ @ <E* *  * |ra|`0mP`X i"`X2.@K @a.@&`*&` <F!x`Z @P``<F<F` "   H .@&`` 2 P  0 2p Pp$` P`h`  "`h@* `@2" 0. P#( `d` `*` `8` P`d "`d<F!" `<Fa"``!<F!|$   ͚ G @n0橐㿐   ` *`' 2   ?  P ! @wT% <* @`2L  0`L2`<F `0 <F` ! `2 p<F2<F!"   <*"   0`T2 2`Bo % `c- @D   z   $ <b"8`"     8  D 2 $@ @u $ $@` ` ` ?@ `4   ``*@   $  "5 @* @ %  "&  "&  `@t  6 @ 厐㿘   , "@& & 4`@"@4`  "@& &   @  㿐@T@qda* &. .  @p#㿘`    *<F!x㿐<F!|   r 4 (<F 0   J " L?^"L P"P T"T X"X \"\ `"` d"d h"h l"l p'"p<F"<b|ߐ 0<#`2! L  P@ ``  * $@`<F`! < 8<F! *`@`` (*` L a' < 8@  $ L P  $ P icmp_mtudisc_timeout: bad route to timeout㿘 2 4<{"P  2  L+  ;    0Ś 0 "& Pipqeplip_init㿈 E#h<<b!#\#`#d (       <E<L"<Eh$ *"@ *`" *  *  * " * "<c@: `*@@ 6*@<F!<   &<<E#@ch  `2 4S@ " 4 " 4$*"@ *`" *  *  * " * ":+  4 `4</" <*<*<F`<"3`#!<*""""`!<<$!  <F"`$!<F{b<F"㿐/<ۑH /* '耤` ` %"$`?"H 0 `<*"`+<*b %b` ` bL  2`  $ `<  b`\ "`\2 <8` ` "` + 2`b` "`@ b` "`@6`b` "` b` {"`$ `` 2"@ $`$` 槐`'d4`̛  <F `"` @ r`o` 2 <F"" @ a!@t<* @` 2L  0`L2`2d`0 %< "  `2p"QH"M@"I8"E` "A2< 8 $?   `2 ` @ ```2@`2 b <F!` b,`L",0@ 0?@bH /* '-<   H 0  </ %H 0 </ "  2  @2  @2 @" 2  "2 4*` `*bd "dH o*@ g%H 0 0l* 4*  ? b<`$! 2" h $hH o*@ g%H 0 0G* " @I 2DH /* '%H 0 0I $D`  `*`4@~H /* '%H 0 b`8< "`8 @ <E* @*`@*`t €0|0㿘 `  ` *`  " & E& <)H /* 'h    tZ @"hH 0`<*</`` &@`" "`&` <.`  ` .`   6` &`    &`  Y&`3  2 P`      @  2 :  ``  " `0  @<* 侒 2 "@2    " @ "@ < " "@u 2 2 ` %` " &` `  %  %" $% `     ``      ? @c *   <*l`@"l|  '<.&, &! 2 5``%` `%`@``"`@`"<)<c$<0 &@ : *`hH /* 'S <0   *@ *@ t  0<)!ȓ*@ @ "@ "&@"H 0 @ `*` & @  * " `&  ` @`@ & b`+"`<! 㿘 "%< "  " "@`2` "` "<)<c$<0 & : *`hH /* 'S <0   *@ *@ s 0<)!ȓ*@ @ "@ "&"H 0㿘H /* ! H /* '%<   H 0  </$H 0 </ <*" ? *`  `{$` 2 H /* '$H 0 H p@㿘H /* '%<   H 0    $H 0   </`  <*" ` `6$` 2`H /* '$H 0 㿐  @ * ?` `<F"( `ڀ`   `D$`D"y ``"T °&`2&<F" `"Ѳ  /<F`$%  2`& ` '@& -  `. . .J @'`$ <%` ``8, `a, `b, `c,  , ` @  q@ 8k&`&(x 2 ```@' "r  ``, `a* `b* `cN*h$ @( 2   *` ? X$=&      " M`H ` C<F"$"    "#&`` $ 6,&( "&  , '  * , * *  , & & <F"`@     $     <*b`T  #`T㿘< d? <  R6 626<" `  <$ , ,f `< `   @ܐ <㿘 ``+ @!<#@n2<F"" $?㿘!<F"    " ) <+  &    "@ +`+`  㼠* ?* * *   ?" <#"㿘  @` * " @m  " &  "& `"4`@@* @ $@㿐   !   `' 2 `<*,`ތ",0`     P<< d,`  `@   T 6  64 6<" `  ,,`'<$կ``     ` D'<   < @%<F 4 0  <F  `<F!``<F @"D` @  <F"` 0   <F"``  ! @l <*`, "`,`$  "`$k0g`0 "`0bAJ <"* € c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c  `    <`P "`P  #x  d@?   &@ 4     &@ 4   //ـ ,7///ݐؒ   &@㿘` ?` <!0*` € e` ex e g e e f f fD f g$ g<F1!<F+!<F%"<;"x` <Fb}<F"<F "<F" <E#X|b3<Ftbb` 5<F b<FbN&b J3<Fb F$ B&b3<Ec`Sc`<Ec`cd  ?#4&c`-&c`* 3<Ecd;cd<Ecdc`  ?#4&cd&cd 3<F$b<Fbb 0 -0 'H''L'P'T'X   `@W " <*  =<* `*`* & @ %<*66&`<  0 "`<D $% * 2 '%%% %'4 "R6@ R6 626%    ((   ' A  `8 .2 Pӄ2P<*b`X2 A@<`88 "8 4`" 0'< 8 2b  '"  6  . "T`0`8 .T`0 @2  <*b`X 3 "`X ` " ` `"`2`& `   `2 ` @ ```2@`   "@_ i`0 "%'0c `& )' " `0  P 12L `8@8H ( ! >6 'F  " `" @ 3   2  46 @d6 `x@ %<*&@`P ( "`P$ ?'' ( A`@ 7 "`@ %  '' %<*H /*'<(# H p@  H /* '<( `0 H 0  6  & && 6 ٙ  <'   #'& &'7$ $  $ $ @% ?` `**` && ' @ :  4   4  "@'  4 4 e  t&& @ & 4 @4 L "L t'* 2`$ ^&  @66@6 6 H /* '``" & 7H 0 ` & `xt 2 `<*b`H "`H`R`6 `62`6%Q L 2㿘 ?` c`? n`@ 2$`    " :M H /*'<(# H p@` H /* '<( `2 H 0  `#`3`3`#@#`؋  -<' #`   & & #@ # &   & @h    @& & & @V   ``@hڔ&`4`㿘  * ?쀤``  2 ,   4 "$@@h$@`?" ,   㿘`   `  2`< *` € t v t t t t t v v v v v v v v v v v v, t L@`"n ` 2i ``d<!,*` € ut u| u u u v v v v v v v v v v v v uJ, 9H, @` 4 B$ 4 ??$ 4` 4 9$ 4 ?6$ 4` 4 0$ 4 ?-$ 4` 4 '$ 4 ?$$ 4 P@`" ` 2 ````" 4   4 ?$ 4 $ 4  *`ص~`x<"ܓ*` € w0 x wt wt wt wt wt w0 xT xT xT xT xT x x x x x xl wt wt  ' L "V$`  $`  L`@gO ђ ' `-$` <#*` € x x x x$ x0 xH xH xH xH xH xH xH xH xH xH xH xH x< x 9 @ T 4  42  42  42 ``" P@Ҕ ד ' $`  4`2` `" *㿘 `.`&`  `P "L G``   A &`  @U`***-* @ )   ` )'` 2$ ?` ?&` ,` ```+@ ``+` `+` `@T+`$ע@` ,& א 㿀@  X 5j  2&@M 7 ,$,4?`7<"*` € z { { { }Ȁ"+  2'  $@h!<* @ `2L  0`L2`  ` T`0@" 1$"  2  ,"  2  8 ,"  2ݰ <8 @@ 2հ    ? /?'' *" " 1P <`@hE!<* @ ` 2L  0`L2`  ` T`0@   ,  @2 @   ,   | 0x ;,  "@ o 7 k4"h  2d <8  "Z  @g!<* @ `2L  0`L2`  `"8 1   ` @2 @     ,  1@  ?, ?,  " ?4 -  @@@@ii 5&@㿘 Ē   &7 % * -02 ``"` @ "< `<@ ````2@`<``"<"" `` "` ` ``"` `*  -㿘     , @ 駠   , i 5㿘沐   ` 4 `@E*`4 { 㿘<." 鮔 㿀   //   '7?' )<. `*`" 4""耤 S A`"D @2GD`"H@2?H`` @27`2沔 ֩  "+`4 ``$]``D] 2 `䀢 "' '`d <  K D'"耤2 A`(`4 ``$`D,``D, 2 `ջ䀢 յH`d <   D0 ի<*b`4`8?"`8"`4㿐 'L 'P 4 `'T'X`$?'H ?`#@>  2   "   "   & &  յ  "    "   &   *2 A*  2 D"  H*"# L ?#@$ N! (@"F  <*<* 2 2<*b``  "``  P T 㿘`  @ * =ڞ䀦 # 26`" ` 8`  ` 4  ?$ 4`Ժ    ' "  42  "@ J 㿘`  ` <*!p` 1 ?  /     2  1 $`D` ` <*p2   1 "H /<" Hrip_usrreq㿘`  ۔H /* !`  `` `.`<  € ~ 8 !: nr "`ls <F`H  <.<F<F c<.bܐ ]`Z, A鲐0V[Rx L`0H㡐0)P0B   6 `  8W  0'  9g^0H 0    -鞒0驒0<f H 0㿘<<ݓ* "@*`"@ *`h@ d""$@4 4 $  8@b̔  8 @a` "$ $ $ $  $ $ $ $ $$ ( $ ,$ $ 0$ $ $ $ $ $ $$ ($ ,$ 04 4㿘 ,  ` `  `!``<;"``   @@  `$`     v` @ q@"  " @@ @&a&<a @  " @` ON@@#@ " ` Ւ` %"`  `8#@   "  $`%@ !"` `$ ` մ @``"`@`"```"```<"<a$ 4@``"`@`"```"```"<a`2b`<;!<!  <;<;`"l " `""`""$ $$ ` $$ $" & $@ $@" %@$ $ "`&  $V  $6 `"2 ` \@2- ` @& \`$ `@`!<`"`@`"```"```"`` "` x` !S`D!`d <ؒ Dp)<;"`l` $`l'7'H 'L'P'T'X    7֐  ' Z ( 2 ` $` $ $, 4 @. "`x "`x 2 * &"`| "`|-4   :  - 2 "` "` 쀥 `($ !L 2 !`(@B @2 ! ! 2 ! '' ' ! <' 'ظ  a 2"А`& '  2Ԑ S&Ԁ`Q`` t`2 " "`*@` V <" " 7" "  " " " " "  $"$` : ` ` `@ F` `@ / "9 `` -@  @2 W`2   2W`2"`ؐ %"`W`4@"`@ \耢 ` V` 6`x<<F &` @'V` 2  `7 2 耢`@,  `\2 `" `P@2 `<`l@2 " `" 4   @< < &`&` \ `8"@ $ `l"@ 4 `p`P@ <FbV` 6 " ` " <Ȑ"@  `V`z " `|"  @"`8`h ༸# ฐ""ฒ &`8`8`l@2` &` 2`<!V`@ &`` < >`h4 `8@2W @ 2S `H`D`P"`L" 4 4G "`̄ #` `D`\ &`\`p#`p `t #`t  "& }& `d <`$  <F"̀`  ! 6`$6`$<00`&`00`0"`4"0`$&`4܀  @"& & `H`D`P" `L" 4 & `h`\"@@ & V` &`X ̀ `  `L"@ ǀ``l"@ €``@@ = ހ" &` `< &`8&`<&` `$`&`h6`$&`d&`\@D`$"<F`"Ѐ``*! * * 8 &`p@b`&`p@Q `8`L" J"`+"`@U`$ ` ```.`.`H /* '  H 0  6`$H 0  : H * `$?В* 6`$H 0 V`z`"  @Q  6`  $ `X " e `Z"4  `"" ` ?&`D &```  `L"@ ``l"@  `耢 `2`\``쀢 <`\< `"@ @ 4&`" " Ē@  ""`\ " <   &$ ` 4 & 4 & 4`$"`2 `$" 6`$ @ ""  @" "   @ &"$ 4 "4 & 4 &` " V` $  "  @?"`" `\ `X"@A"` "` .`` "`V` 2`X `\" `<@ @  "@& & `X Y` `\@T``$" 6`$`"`"`ю  "4 耢  ``@   `"   `  0  < &`&` "``?* : `< *` € ( 0 0 0 0  = 67`86`" `" `@ 6`2V``$ `$` "`8 Q  " 퀌``l"@ 而`"`ݕ"`@`$ ` ```.`.`H /* '  H 0  6`$H 0   H * `$?В* 6`$H 0  &`D `8"@ ['<F 216``P@2-6`" `" `"%6` `8@2 6``<F * :`@ 46``p`P `< ` 2 @_] `T  &`p6`@ `( @_`l&`t&`T&`6`z ` &`<@ &`p` @_V``t`<$@ `x&`pv&`<`p` @ @ &`pn`Ȁ <FbV` &6``p`t 8&`p6`bV` @ 2 `t&`p`l "@@ :6`` @&`p6` `l# "`  "``8"# `" "<Ȑ"@  `V`z"   `|"  @ `l@2`&`   2`p<!V`@ &``p`t`  @_c@^ÒȀ "` `T@, `h`?# * 8 &`p`h  `h`P" &`P`h:  5`P "&`P` < ݞ `< &`8&`@ 4 "@<"  8 !4 & , !8$@  @4 @4 $L"`"< 21<< $<l@"  $ D㿘 , >V :`h 6`L @a @Fz* :``6  ` 6 @Fka 6 `l "*`@Lb6 : 6  V * :  : V 6    6 㿘@G?. @ <F?@. " <F"؀`  . $  㿘H /* !<!0  $ `02$ 2$H 0㿘H /* !<F b<F@L<<* "bH 00W <<F  2T  "/  @"<! 8$@ ,   @K 2 `2 2` xT z  z`4 x4 z2<F<!<F<F@" !t ` Ȁ $"$"H 0   㿘`" ``" 0`V  <*"`<V x <F & z`*`:  6  <;6 b`$ "`$V  <ɒ <;(`"( V * :  V :   V <F*+  @L+: * V :` @ 6 6 ` 6 <!V V @  & ) ,  *`:` 6 6  86 zV  & < $$6 $ P p 8  2 @K] ( @K& p& t6 0wV * :  V :   V  <;<F"V x@  <;<F+ 0@K֑: @<;<Q"<<;b`,"`, . "H. "<;`0 #`0V  $7 , `* )<<*" <F"V x@ $`4<Fbؐ  #`4 \ 8 (? 8 (? \ ` <<F<<F  & 8"8 <ztcp_usrreq㿘 `  Ȯ6H /* !  `     T`` .`<!l € h  ( ` H h x x  4 H ` x \  8@ 퀤` " T 2 x4  ٰ     ؔ π` 4`    ʔ `͑ ` $`(V 7 `  ?#H*  ,` <;<a " 4`$`   $`8$`L$`T$`@$`l$`< -@G@d 0}z` Ɏhok 5fH 0p " @ "@ Q  2 @"J !2F  ` 2B   = #&  `7*@ ` 3,`lht"p" 4 d# 7?hh `8,`"@ $`@,`"`  `ђ.@ <| `   Y H 0㿘 H /* !`  H 0f 6 bΞx nH p@0P3 E$ *"!  ( `"`$`$ 6`$?# @6`$"  `$ `@4 6` 0 ؒ ' " "   *`$ "@`"@H 0㿘`l <F`H  <<F8<F<9 <c/ `; "`2    ? 4`` 7@4`㿘 ,V `    T  p  ǐ@ D@  #㿘V `<!8*` € P P P d d ln6   6  V   ,ư`V   <*"<a & 㿘`  . <F* c@@ 6 *2  `@g `@gv *㿘<GL<#,m X%<< <'L'P'T'X$<'H '.       2  F$`  " "@<`  0"` ' ' ' ' '```'' / `7 @ <`" < 8  ' $ "   //   '@7? #< " "@& & & c,c, Z `@2QD`"H @2IH`  @2A@@2<2沔   "+4 `$ػ`Dǻ 2 J "'D '`d <  Ʃ D'` " c,224<` "` `$`D؁`Dǁ p<f<' ,'@`{ + < `$  '̫`    $   c`  I$ ' '  '  '  ^' 0@ //   '@?74 2 d" &  " "@& & &  D  <`d <   D0 ` "` 㿘 2`8 `d <   D ` <   h㿈< - ,<F"4. ?򀢠 <# `0 <` `' *` ' #,#\'0`'#, S 㿐'L 'P'T'X'H     "   "    & &  q        & ?9 7# 4 (   .` .`&@&`6` D<G&` H&`6`H6` 6` 6`@* `6`6`6`@<.`9<.` `"  `P 0<Ludp_usrreq㿘`  H /* !`  `` `.`<# €  h t     ̀  8`l <G`H  <<GP<GT/ r<c,& l<F` bh, @0dI _ Yè0U` 4`<0$ Dđ0H  ` ^< `  D 8  M0+  9"ɤ$ D6 0H 0 1 /  -ْ00<x#H 0㿘`  <G   *0 *0 <G H P<G Tdd㿘-<G'<G࠶T <"h , @* @2A  0 2<   @A  24  < <#<G@`*B ?;#%@ * <"l<G<G  D  ࠀ #  ?"  <G" &% " ࠀ, < `B :㿘<G<G"?" <`#@  <<c`  A"`<G`` ""  +`<G<"h@ *` "  " " @ " `@"``<"`` !"` `+`"``<G"`` "`` "`` "` `$"`$`("`(`,"`,`0"`0`4# _"`4fr_authnextP ,"F@   ,"<@ k ,"=@<Gf 0 "N@<^0"L@0"M@U <G    ,""=  "=@;<) 2 > $@&<)<#$<0`$ : *`hH /* 'S <0   *@ *@ E T0<)!ȓ*@ @ "@ "$"H 00 H /* 'Ȁ    TD "ȑH 0 @A  <G $   < $&@$ $@ذ c@A 00!<G<G `<!* * <*bh @A 8  $ $  <Ð !(]ɖ !<G0@An D` , 5<* h `0`02 <a, @ `#?""@ H /* ! `$    Ռ <c` @"`c` ;"`7<ۆ @`  7  2" "<0<(`"<*   *X#"`  f   e  <c`$ "`$c`  "`   7,<G*  <Gh`?` # "@ <G    D  #` ?"  @<G" # H 00 㿘<<"la  ? $$@`D <G `8 %<)`$@<#$<0`#@ : *hH /* 'S <0   *@ *@  D1 T0<)!ȓ+ @ @ "@ "#@"H 0@`2`㿘H /* ! <"h<-<Gc   ? %<!,` "`K`(?$`?$%`(%`D` D<G `D <#'<)? 7%`$@<#$<0`#@ : *hH /* 'S <0   *@ *@  C T0<)!ȓ+ @ @ "@ "#@"H 0(`$(`@`2H 0IP Filter: already initialized passblockno-match -> blockIP Filter: initialized. Default = %s all, Logging = %s disabled㿘H /* !#<G`耢   !< <ΰ @ <vː"ؓH p@6 В  $`<# @>C p</  @>>+x<Eh <(b|<<"#$ ""(H 0<Ga쀊  <"<#<Œ#<<Ő# v` IP Filter: not initialized 㿐 'H /* !!<G 耢 ! <<<E#<"c" @ <$   @@@uH 00 <vU H p@ !<G!,0@?4 <G <G''Ț` <G<G'''' `' '`'`''@? Ȑ @= ? 2   p H /* !   @ H p@0Z   ,@H p@0L"=@7 ,"<@"T@"?@"<G"@/- "E@<;&  ">@g<;2"@@0  "H@> "I@<; 0"A@<; ,"F@e<;  ,"D@ ,"C@ <;d"x ,"G@] 00"M@ 0"L@0 "N@Ѱ 00,"K@?02"J@<;ذ <;"x`Ӱ В,/,*`*`*`, "x`4 <G**** . . . .<;"x` <G a<;"x` <G! "  @Ô"x`4 z<# @< p<G &" s"<Ga,@> <G` <G''Ȅ! <G!''<G!<Gଢ!'''``'`''''@= 0H"x`4E "B 0>"x`4; 3(/( , , , @ m . (. .$.@@= 0<;"x`  j "x`4   @  H 0㿘<*!p @{            d"  & " d H@=X `   ``@  "`\ `  ``@ "Q `` 2 <G <G!Ԁ Z<G!ē.@* `   @ژ "/ ` <# @; pL`m" ``v\`m $`?$```L`* $``vN` $`?$``` $``L` " v>` $`?$` 0, (`(@; 0,  (0,"K@  @<Д   < < ݰ ' ,%@   "  2 ``@ ` "  `B? <`  ,"=@ ,"D@Z 2   `  `` ` ?"` 2 J ``@?$<)<#$<0`$ : *`hH /* 'S <0   *@ *@ ? T0<)!ȓ*@ @ "@ "$"H 0V Q  <) HH /* 'Ȁ    T? "ȑH 0 )` %``"`  "` @<     $ < @$ $z    $ @֖ ? 0    ? 0     㿘 !      <'c $:? ! 2  ( $ $$ @:Q (<  $  $   4`  4 `  *  $` @$`,`   (, @4 4` <F,  , 4  " ,   ֘ 㿘ǖ    h``'' #`#`#` #`'+` ` #`؀`,  `@ 4?`"`<2 `4'܀ & 3$ A `0'@`"``8 "`8` 2 4 <Ga<G*! `&`,"@$<Ga,`p "`p&`,@ ` 24 8 8 ؒ@4 ؐx@Ǭ@# D 4      f ʬ ( ? Ĭ ( 7'̀@  ' <( H /*'<(#l H p@` H /* '` `7` H 0  4``$`$@$`4`0  <'` #/7@$`&@$ $  $ $  @=` `**` &@$` $ @ :  4   4  & "@ 4 4   $@4 @M4 #@` '̐#@ ̔444 @64  $`ؒx@2 2 <G` "``` "`@R6  6 26 7瀥 㿘?0` 0` `,(`0`0`3<G0`$`<(`@0.@( @ (`0`` 0`" `0    "Q@t<;  "R@<G "P@<;00"W@<;0"V@<;00"S@0"x`4ߪ ΀ ت   Ӫ @3p Xl 4 $ ?$ L D "  , T@  D $   ,: $$ $ ? $  ,?  (  ($  0 <  *`2  4  @63" $ <%`H` "`"x`4 { 2 % `2>   "<@ d<<0#$`$ : <)*`hH /* 'S <0  *@ *@  6 T0<)!ȓ+ @ @ "@ "$"H 0<`H`?D"`$ @4 <G#</c <H%"$","( " @2є 00.@2̔ @ @2Ĕ 0!"x`4 " @'"x`4  @' `.  `. `. . H 01<<0#$`$ : <)*`hH /* 'S <0  *@ *@  6" T0<)!ȓ+ @ @ "@ "$"H 0㿘 T@ "  X2 L L"@ L  X@ "  D2 P P"@ P  D I   $ `A$   =  "<@ }<<0#$`$ : <)*`hH /* 'S <0  *@ *@  5 T0<)!ȓ+ @ @ "@ "$"H 0<`H`?"`@P@ H <H"<)<#$<0`& : *`hH /* 'S <0   *@ *@ 5} T0<)!ȓ*@ @ "@ "&"H 0㿘!</  @0W%% @0S%<G     H H$ 2 H<" \㿘<G## J < H `;% '<) #<%<0)<0@ c$$ :*hH /* 'S   * *`  5 T0<)!ȓ*@ @ "@ "$"H 0`%` $ 4   㿘 `  ```@`2 `" 24<<0#$`& : <)*`hH /* 'S <0  *@ *@  4ǒ T0<)!ȓ+ @ @ "@ "&"H 0? &X`'L'T 77ր    'L 0' <)H /* '   h T3۔ "H 0 ( -`'̨  >̑5`  > > > > > (> 0> 8> @> H> P> X> `T`j& ` `'7-<)'<<0 `,` 6'` 3쀦/$& :@*`hH /* 'R <0  .@ *` 41 T0<)!ȓ+ @ @ "@ "&"H 0˰ 쀢 vր;  L ('?}$& :@*`hH /* 'R <0  .@ *` 3 T0<)!ȓ+ @ @ "@ "&"H 0 8ր`6`/$& :@*`hH /* 'R <0  .@ *` 3 T0<)!ȓ+ @ @ "@ "&"H 0V ` '쀍``*`2   4```,4`"`` $``,ր "`` * `2`@  4``4`,` `,怍`2`( $```<Ƒ- 2  8,` 3Ȁ@1,$& :@*`hH /* 'R <0  .@ *` 3B T0<)!ȓ+ @ @ "@ "&"H 0ܰ ,L2 `-0` (''5`'@' ` 怢  ?$` ` ?& & `& ` 2 2   @@' 6 86 :#6 <`` / `'/ & `?& ` & 3`` 22  @ @  `-6 <6 :6 82`3` @ @ @ 2`3` @ @ @ @ 8"@ 2` @@ 2` @ .& ,2 T/ @"&  2`` 2 @2   2`3` @ @ @ 2`3` @ @ @ @ 8"@ 2` @@ @2`  & <G !o & H@0" !</ * & T!o& L"  @0 * %& X<G& P"> 0> (L& D`(T& \ && `5@5 <H `"" ` $`㿐@ `0   /(3    (    " `2   ' '`(    ' * '`(@㿘    &`0`   " `` 2   %? @`2`  $ %? @`2` $ 0 2`3` @ @ @ 2`3` @ @ @ @ 8"@ ``6  !  6   6 `  6   6 `F<G `` * `!`: 82`3` @ @ @ 2`3` @ @ @ @ 8"@ 6 4 Ő <G`< 2`3` @ @ @ 2`3` @ @ @ @ 8"@ 6 3 <G#$@㿘!</ @/n!o* %` (./`2 2``"  \@2 P 2 P 2 P @2 P` 82 P <  P ဤ` 㿘!</ @/6!o* ` (./`2 2``"  \@2 L 2 L 2 L @2 L` :2 L 8  L ဤ` 㿘!</ @.!o* %` (./`2 2``"  \@2 L 2 L 2 L @2 L` <2 L 8  L ဤ` 㿐  ' '    $  <4 㿐,       `@2 ( ?( ;c@? ?   " ?0@ @ "  L 6` D ,  ,?6`5 1 6<G# 2` 2* "&  "  $  2 0 2L D 5 @2L D @ " 0  2 `^ " `  @<`<G& $@ c`0 `(@ CB<`0<`( 6 2`< " 46  `@@  <H`@@  <H 8$@ 2 `` `@<H? " 㿈 3c(@    '    ' '쀊 " 0   젒 I c@ @ " =  ,` ''(4` .<G#* 2"`쀊 ",(  20 "`4`@2   2 `   @h@i쀢<G#$ c 0  (@ CB< 0< (  @6&  3< :`쀊 " 46   @@ ? <H`@  <H 8$  2  < `  H<2<`H? "`H 㿘z㿘H /* !<G # `# < H@? "@ `H`H $``$``2@H 0㿐H /* !<G# `; `\24`H`D`"0`H`,?2,`H` 2(`H`??$``2`4  @  @ 2`4  @  @ 8"@2 `   2 @$``H`2`\H 0<GX<<2<"$" " " x ( 2  ` ("@//7''@,]!(   @)Y +< <)H /* 'h    T-t "hH 0 2<b`  *"`b  %"b &" & & && <G& ^& . 6 ?`"+ 2 @<6 <GX` ""X㿘<2$  ?㿘<w䀢 " & ?x` ` (` 2  `` `("@//7''@+Ȓ!( 4<#b @( 2&"`  "@ "`&"`& &``"  2  26  6   $ Ր 㿘<䒒   ` ` & "`㿘<2$  <2$!*`" " 2*`㿘!/<2- $@8@-<)+<$c$#<0` :@*`hH /* 'R %<0  <)* *!ȇ+   T -$ 2 " "H 02?ē- !/<- @@@-<)+<#<0%<0$`"c$`""`c$` :@*`hH /* 'R <)  ***   T @,Ȟ$@ 2#@" "H 02?- 㿘H /* ! '<2!,$@`U@`*` J3``<`<G<)<<0<0@"@@`"$@`"`@$@#X "##X$#@ :*hH /* 'S  ` * *`   ,g T0<)!ȓ+ @ @ "@ "#@"H 0@ @`2`,!'<,@`\@`*` Q3``<`<G<)<<0<0@"@@`"$@`"`@$@ `#X" ``##X` ""`$#@ :*hH /* 'S  ` * *`   , T0<)!ȓ+ @ @ "@ "#@"H 0@ @`2`,H 0@Y 0@ 2`2@ @ *Є  8 @((*`8,  @J@ @`Є  `(J@ @( ` *  ` @PORT %s %d,%d,%d,%d,%d,%d PORT 0 @2` 4 @*`[  "???'7/` ؐ"<ݐb//@%֔  2 ` \'\\* `2 \* `2 ,`@ @2 {\ L` 2L?L   L? 2y ` 2v ` *2  `$#\` <`<ݠ )4`b#`#d^ѐ@%Ր@$ " `6` -? 'd`, (3`'` dژ` 2< 4h ' 'h 'l 'p 't 'x '| ' ' $' (' ,' 0''$$$$ $44` '&` D   <G#"@ @f&` 㿘.227 227 Entering Passive Mode@  42`@*`~  "??????'`4 4D<ޒbh//@$  `&<ސbp@$  㿘 0̖V" 2 2 ``   `   㿘 "  2~ ` @2y   0D V l 2` `f ` |`aբ @) @,`@(> 5<)H /* '   h T)e "H 0 2   >> > > > > (> 0> 8> @> H> P> X> `&` & `& ` . 6 6 <& T& X̛,`<G & \& `& 4& P&"  㿘   Dq "F? 2``4`0 *  <G`*` * " * l?`+"` `$` ` @͔4``4w 4`  @  H@ CB < H< @㿘<G#     2(@#ݔ  (@ $@ `(  (  " 㿘 < 4*`!@ @2\ \"@\<G# #2` `"@`k T`8< X 3<<0#$`#@ : <)*`hH /* 'S <0  *@ *@   ) T0<)!ȓ+ @ @ "@ " T" T"H 0<<0#$`& : <)*`hH /* 'S <0  *@ *@  (ܒ T0<)!ȓ+ @ @ "@ "&"H 0㿘 0@ 0 `(&H  *Q `?. @/ @@@(/ 1/  W@  / @ @`@# `@? @@@ @@  7@  (S (`?./ @@@J $1F $R  (`?. @/ @ @@/ 2 /  $P@  / @ @`@# `@? @@@'@@  0@  (S `?./ @@@ 1 / P/ @@&@# *<H,<< td" $" 0㿘 H /* ! /< ,d@`d@< t` ` `0  `T` `U 8  ` C<)@$@ `0<`<0<0'<H  %   % $`#@ :*hH /* 'S   * *`   ' T0<)!ȓ+ @ @ "@ "#@"H 0,$,  @``,H 0㿐 "U@( "@* 0)0"A@2%  / *  * *  8 `' `.  `. `.  . J@# 4@ ?@@ 2?)<H ,(2  <`t`? "` '//, 0 $ ( @$ , 5@   "`0?"T`0? ` " ``" , Hհ?` ϰ?4 D* 2 *@2`@ 4 F , H'<t<H `H"?$ `0 4 F* 4 D 2 $ H @$ L *4 R4 P 2  @ $ L'<t `"  D `?@<)'< t4 F*`4 D`<H2`* D#`@ 2$ @ |?<)H /* '   X T&  "H 0 t`? X"`<!< < < < < (< 0< 8< @< H@$< P  < $  ? < ` ?$ 4$ 8`4 >4 <`<4 B4 @@d `` , 1@,` * @, 1 $" ` "`($ `($ $$ $$ @ ,  ?$  , % ,@` n 㿘 (   `?`" H L"  L H`2 L& H  L"   #`2 H& L  H"  #`& &  R@* P4' .& H  & L6 P& H & L6 R<`t "`t  TB>    @C> @)  㿘`,@ ( @^ 2 `$` "`$` " ` " `$! `$ = ` 9 `,5 `(1 ,/``D0) /  `F `   `$ `, `(  /``F0 / `D0    `8`42 `>`<2 `B`@2  `102 㿈?@ @ " 0 ` W<ǒ`t<Ò`t`!` @#[ <*ad <+< 023` D@2.''#\ 7 "! H @@2@   3<HH$   B< `t %`t `B <  2 0x<`!   *  @#*<*ad g< 025#\''5` " "@ >  2 0D<`!   *  @"ۭ*<ad*@ 3<+< 02*5#\''5 "<H   DB< $ `t  %`t `B < @ 0 2 0<`t`  "`㿘 )<,!d@`8@'<)@$@<#$<0`#@ : *hH /* 'S <0   *@ *@  $Y T0<)!ȓ*@ @ "@ "#@"H 0@`2@Ó,<H" ,㿘H /* ! -< ,d@`Q@< t)<H` E? B#`@<)$@ `0<`<0<0  $  $$`#@ :*hH /* 'S   * *`   # T0<)!ȓ+ @ @ "@ "#@"H 0 ,% , @`2`,H 00  ` 0 ` "@ ("@` `h<H`f4<H@"d) <H<" ]<(  d ̄`` G) E C) `? ) <H0:"`  `) `<H&<H<H<H0("` ` <H` 4<H8 <H4"` ` ) ` <H<H8"<H4 ")  <HP @ 8 * *  [%d] 㿘#<c<`XVLcJ 2ؐ *c㿘 J` (J 2 (*    )1<**#clnp_er_input: m %p, src %s, reason x%x 㿘< !` ?U !<!8U-!<"@*  ``/$"4 1`. "+  &$"`0$"!   ` `0 `0    `  `@RYclnp_discard: m %p, reason x%x 㿘< !` T <"ВTΔ      ` @#0Őclnp_emit_er: m %p, hdr len %d clnp_emit_er: to %s from %s clnp_emit_er: packet routed to %s 8'<ܐ  ` 'T` < #T  ????'   `  ` @ / @@ ` @` `@ / @l@ `Ң@  " R&  "@Д @    I` S !<#T%S !<#T ` S !<# TH /*'<(#Oْ H p@ H /* '<( `2 H 0  4$$$48  Z<H$ `~ ,`~ `,  `,  `,  `,  `,  `,  `,  `, , @ @ ,@` @ʐ ?@ ,@` ,@`,@`,@`$@ $ ,    > , , @&m  8 "@\!<"@ *   `$  x] 0 Ѐ`R`6 `62`6<H~ꀠ(    8 /work/tmp/mrg/src/sys/netiso/clnp_frag.cclnp_fragment: total_len %d: mbuf %p, m_len %d clnp_fragment: sum of mbuf chain %d: clnp_fragment: seg off %d, size %d, rem %d clnp_fragment: last fragment clnp_frag:lost headerclnp_fragment: sending dg: 㿐`'D \'LP  "<D\@ u" ?  &耤<<<8`"8` @ /@ `/ ` / `/ `/ `/  ɰ 7<ܴ! <!S  )<%< S(  @ !@S@8      <!hS˖&  <SŐ! a沔 @  i 9  g<`<a "`< `  @,  `+*8****, , ` <Q!$`, ,  @%* <Sy!Ѐ` %< Sq( 2 DxL\  @+` B0% &74[ M H *' 70 <L"L:  (clnp_reass: found packet clnp_reass: new packet! 㿘<H .<ܢ!%< *@2$ 8@  " 8@   " 8 ` S @@L $ 2 ** 2< !`<R"@@ 2  <@"@ޒ  㿘 <)H /* '   <  "H 0 2 W  ;  4$ 0<<0#$`$ : <)*`hH /* 'S <0  *@ *@  ' 0<)!ȓ+ @ @ "@ "$"H 0 @j  @f <H4 * , , " $ 84 .$ 8 @x$ 4 clnp_insert_frag: New fragment: [%d-%d], len %d clnp_insert_frag: current fragments: cf %p: [%d-%d] clnp_insert_frag: Previous frag is NULL [%d-%d] clnp_insert_frag: Subsequent frag is clnp_insert_frag: previous overlaps by %d clnp_insert_frag: subsequent overlaps by %d clnp_insert_frag: internal error! clnp_insert_frag: clnp %p requires %d alignment clnp_insert_frag: cf now %p, cfr_bytes %d 㿘`7<  *`  "  ? `  * + <!p22Qђ<Qΐ! 4"  4#<QĐa2 4`s,  5 82 `<Q!耤2<<Q"<"Q<Q"(<<Q""Q 5@ `"<, "PQ~2`, -` \0`, 4   "$"# 1<,4`@: -`$ , 2`QY", 9 , 2` $, ,   ?,  ` "<"ؒQ7 Ґ`& ` <#Q(54`&&&  & ' 4<Q"0$clnp_comp_pdu: comparing: [%d-%d] to [%d-%d] clnp_comp_pdu: merging fragments clnp_comp_pdu: 1st: [%d-%d] (bytes %d) total len: %d clnp_comp_pdu: 2nd: [%d-%d] (bytes %d) clnp_comp_pdu: shaving off %d bytes clnp_comp_pdu: first frag now: [%d-%d] clnp_comp_pdu: data for frag: mbuf %p, m_len %d clnp_comp_pdu: complete pdu! clnp_comp_pdu: pdu is: 㿀 4g5<ܲ9<7<` "P@2Q''' ''` 4<P" P-<  +<)< P!(  @ Pw c0 Pq   )< Ph!(  @  P`$``<PW#X $ 2` ` 4 <#PA<P># " #< P6c 2  2j  . 2e  `  0<P # `<P  #< P c 2 <H`2  8 "` "`8" 8`2`8<<0#$`& : <)*`hH /* 'S <0  *@ *@  m 0<)!ȓ+ @ @ "@ "&"H 0clnl_init: no raw CLNP clnl_init: no tp/clnp 㿘  Ȕ  <H<O# x" *"@ *`" *  *  * " * ":<**bw    <H<O <Hx" *"@ *`" *  *  * " * ":<**a<H <c<<"L"< " "`clnlintr: src:%x%c dst: 㿀H /* '<` ` ""$`?"H 0 `` `    `2  ?'?` #7`' `4 2 `x` / / / /` / / / /` /`` ``?$`($` <B @%<` / / / / / / / / / / / /`` `?$`$` $`< !`&<NӐ!@<!P    :NȐ  $ <N!X    :N  $ <N!`` `   2 `<b` ="``   <`v"0.` `@$  2`<b` "` <*`!H@€0X0clnp_input: proccessing dg; First mbuf m_len %d, m_type x%x, %s clusternormalclnp_input: clnp header: clnp_input: mbuf chain: m %p, len %d clnp_input: total length of mbuf chain %d: clnp_input: from %s to %s clnp_input: dropped (err x%x) due to bad options clnp_input: forwarding packet not for us clnp_input: raw input of %d bytes clnp_input: echoing packet clnp_input: unknown clnp pkt type %d (%<ܐ 'T'L'P'X`'H   < !8`V <!<! Mޒ < ؀`  ;<b 'b ` <Mʐ!  @\<MÐ!  7< M  @ <!M 2 "@ b "   b"x * @ p <Hc@q @m   @ / @]@ `2 @b"F ` `@ /݀ @Bݲ@ ` b"+  `"!<"ݒM<!<"(M5 ` ``b"  @&@/`/`/`/`/` /@8& @_  2 2    "   2     @ Ȑ Ȁ`? b`\ "`\ , :`  <"0Lߒ0à@z 2 `<Lѐ"h@0"<H#`2 <HR   @!  ` `@ݔ b`P  "`Pb `"  `q < *` € H H H H H H H H H H H H H H H H H H H H H H H H H H H U R  0P<* !<H*@ *`@ *` ؟@0? ` <"LM<* "w<H*@ *`@ *` ؟0" `<L6" @ n0<"L' b `""  clnp_update_srcrt: src rt terminated clnp_update_srcrt: current src rt: %s clnp_update_srcrt: updating src rt 㿀 `@ `@  `< !`*<K"0& @Ԕ<ܦ   /!<"8Kؐ@u   <K͐"` @ ` *`clnp_dooptions: record route: option %p for %d bytes free slot offset x%x clnp_dooptions: recording %s clnp_dooptions: option dump: clnp_dooptions: new addr at %p for %d clnp_dooptions: new option dump: 㿘`F<   a ?<N` #Ky< Ku!< 8ΐKn<Kk XN` @Z4`$N`  `"6 ?.  < xKS@> .   <KF N` @Zx  &@  @ 2 ؀ 2 O〢 2  瀢 "@ &&@clnp_opt_sanity: checking %d bytes of data: clnp_opt_sanity: opcode is %x and oplen %d clnp_opt_sanity: clnpoval_SRCRT is %x CLNPOVAL_PAD CLNPOVAL_SECURE CLNPOVAL_SRCRT CLNPOVAL_RECRT CLNPOVAL_QOS CLNPOVAL_PRIOR CLNPOVAL_ERREAS UNKNOWN option %x clnp_opt_sanity: SRC RT clnp_opt_sanity: end of src route info clnp_opt_sanity: UNKNOWN OPTION 0x%x clnp_opt_sanity: return(0) 㿘'<ܐ  `      <"J@Yk@6 .666666 6 66666@`Ȓ@`@ ` I` <"J|<"Jx Ȓ??` 7<!8*` € ɼ ɀ ɔ ɨ l <J_#% `<JZ# `<JU#0 `<JP#@ `<JK#P `<JF#` `<JA#p `<#J; `@u ?` <"@*` € ̬ ( ʐ ˴ t p` `  @ `@ y ?2  "  &@6.y@  <I#  ` ` @` 8 @ `  `&@ `@ 6@ 62p  T<Iߐ#Q@@` ` @ *@D@ ` 1  @&@`6@ . L @ 0` ` 8,@@ (@'@  `@   ?21  &@6 .` `  %  2"  &@. ` "@ `. `<#I    ` <Ix  clnp_output: to %s from %s of %d bytes options %p, flags x%x, isop_clnpcache %p clnp_output: ck cache: clcp %p clc_dst %s isop_opts %p, clc_opts %p  ro_rt %p, rt_flags x%x flags x%x, clc_flags x%x clc_hdr %p clnp_output: using cache clnp_output: no mbufs to allocate to cache clnp_output: freeing old clc_hdr %p clnp_output: freed old clc_hdr (done) clnp_output: NEW clcp %p clnp_output: pkt dropped - option unsupported clnp_output: packet dropped - flags unsupported clnp_output: calling clnp_srcroute clnp_output: route failed, errno %d @clcp: clnp_output: packet routed to %s clnp_output: new src %s /work/tmp/mrg/src/sys/netiso/clnp_output.cclnp_output: sending dg: 0`'X`'P'T 'H'L` '` @" 3 `I 3`)<ܲ!` !<! H!<!8ېHz<`<!P`DHt``D`2` %<!HiW3<!<!H_<`<!HZ``"<<R`4HR!<!HM<4HI"73<`<@3b@ ",3<``"(3<$@2$3<`4 " 3<@23<4! `<H!" 4 沔   2 4&4 '3<b`T  d"`T,`D 2     $`D! `<G"@d 4!  < G"p4 `<Gސ"! `<"G֒&&&& &&&&& &$&(&,&0&4`@ 2 `< o !N  ! !  ! `<G"o! `<G#b0`"0z 0   mb`0; ?H /*'<(#B) H p@  H /* '<( `2 H 0   ' 7 7 '' ɒ   b3b`0 7 U"`0`,` "`, '& `<H  b<H   h<H  <H  .@ .` .` .` .` .` .` .` `.`` .`` "`<` .``< ! `<G#H`< (0@ (@@0 !0`2`! `<#pF<Fݐ#@U 80ٰ!&$` &,  " (!<#) Fɐ 2  0  `I!<#F ` .` @   ,  @ `  $&  $ `' .`   k <H  , ,  , ` .` `' `< 沔   2} 7"' ` .`  r (d2``    &4@Q &`<&```<H 777  # .@ @ *****$` <`P  >0$,@"4(>.`.`a' .`.``@ђ ! `<F    @T  2 ,$ `x($,( #\Ú  <" , 0`" 0" ,㿀<H'P'T'X`Ȕ'Hu'L㿐 'L`'P'T'X 'H  "   "  /`@ &0  rclnp_ctloutput: op = x%x, level = x%x, name = x%x rclnp_ctloutput: %d bytes of mbuf data 㿘< !`` < E " ? <E H @TS?#22  / 2.  0'`"# ` 2 ` o 2 ` &``X#   ~P `X&`\      2'㿘`;`` \`x`<)H /* 'Ȁ   В   @"ȑH 0` 7 @  k$v ``X "`4~`4`" `R`6 `62`6` 2$````" `\` 4 ~``~ `\ B~> $<*!p`F 1 B `Em `@  $`$`,1   <*' !p`2 ! 1  `@  `$` $`0 u   ` ' 㿘 `" `"6  <"z    " & clnp_ours: ia_sis %p, dst %p 㿘< ؀ <ܤ!#<  aH DDT I@2  < H J"@ @   2 <  2  clnp_forward: dropping multicast packet clnp_forward: %d bytes, to %s, options %p clnp_forward: discarding datagram because ttl is zero clnp_forward: can't route packet (errno %d) clnp_forward: packet routed to %s clnp_forward: congestion experienced clnp_forward: setting congestion bit (qos x%x) /work/tmp/mrg/src/sys/netiso/clnp_subr.c`   '????耧`'` < !`<C̐!  ,Q )<ܢ! `  !<"(C  ? , ` <C"X<$"$ Ѐ  Ж̘@ Д @٘Ȗ!Ȁ2 ! `<"Cy  v<4 "4`  !<"Đ Cd'<(<Hc "(` @@ А@ݔȖ I G 4(`?"(V"4<H `@ #!` <C."耦 ` ` <#C  А X `" X.Ѐ` <`P @ @@q!@ @ `x̒t 0#\̒ Ѐ`R`6 `62`6clnp_route: freeing old route: ro->ro_rt %p clnp_route: old route refcnt: 0x%x clnp_route: OK route exists clnp_route: allocating new route to %s clnp_route㿘"5@@`" &`R`6 `62`6&@&`&`&` &`&`&`&`&` @ `  ` .`.`@  | 1t< &@2'2r&q t1 .&@#!<4 ` @ $  !<ܐ! ` @< Be#@<R6B`#@R6 626 &@! `"@<BO#@" &` .`.`&`&` &`&`&`&`&` ` @ *!   !<#돐B/sb@28 3   "8@ @`'<@   @`4 ``0& clnp_srcroute: complete src route failed 㿀` @ `@@`  / ` /   @  3 `  @@y   < !` A<A͐" Aclnp_echoreply: output returns %d @ @ C 'P'T,< a <#Asending on route %p with no mtu, line %d of file %s route dst is 㿘< XA<A @<`  8*@ 2 㿘 4%<   8`@ `$`@{U 2`@@`"@{L 0<H`2  8 "` "`8" 8`2`8<<0#$`& : <)*`hH /* 'S <0  *@ *@   ̒ 0<)!ȓ+ @ @ "@ "&"H 0㿘<H H o*@ a <" ,?  *,  D`$ D82 ,H 0㿘<H z <3  clts: unknown option (%x) 㿀 'L'P'T'X'H @ @     ` @``@~<(+<3 `P @ "] ` À " `0cY0`. ``@ ` . >. (<H /*'<(#;M H p@ H /* '`"`7`"H 0  6&&&6x  i& @@ ^` `@ X @ ` @@s "` J%>  @<?,#P`P@%`P@* @ ; 6<3<3aa P2 `  )$`   @ 2  "& &   Dq <3P`" `d <  d D  y y㿘 `d <  N D ` <  F h㿘 ,`  &`#`   <F <F  "4b4 @<3<8! L<F"4 <3<!@㿐 'L'P'T'Xp'H  l<H `ؐ      ??"6     "@& & y  "    "  &    @ .@.`.` .``@@a` ²@ .@ .``@`@S  @ .`.@ &@ @<3P`"@9`?y, 9cltp_usrreq㿘`  @ wH /* !`  `` `.`<" € 4 @ d X | d 4 d T l d s 8`l <H`H  <3<H<Hw b<3@Oa]@:0Y@ T@ݒ N0J60)0D  x x8 `  8@  x0)  9 @0H 0 x x -@8 0 @8 !0<<!H 0㿘<"a<!<0! "@L ! <"G <<<Hc!" "㿘`   ``` <!t.` € T t t t t t ` t t t l t <q 8`a:`B " lf <H H  <)<H<H V<)H /* 'h      "hH 02"7 7""" """<aa "a" "a"%$    wސ02wِ @Pwѐwϐ  -m 00  -㿐 'L'P'T'X'H  2   "  @ߐ <`` ,2`  <`` #2`   "  <` <`@<@l <@<` 2`<!`@I0wtesis_rdoutput: ifp %p (%s), ht %d, m %p, oidx %p destination: %s redirected toward:%s p 4   0  n    < 0 `  <`` 2`/<< a 2<HR`< =C!< 朐=<!<!敐=5 v^   5 @ d  ''Д   ,,,<H`ԑ2 `, `,@  * '  @@` Ԓ '  @ 'Ѐ  Ԑ@  *А `''Ѐl$`   N N 2   N ` " ```(` @ "     ?$@  v  $@`v50]`$`  'Ԑ "N `N@Ԓ@NԖ 'N  `@ ?* ?* @ *Ԑ '  `N@ @rNԖ '` А@$` 'А$, @    ? ?   / / /////??//x؟ 㿘 ". ` (   " $   ?&4@ @ &@& @& . esis_eshinput: esh: ht %d, naddr %d nsellength %d esis_eshinput: comparing %s and %s esis_eshinput: nsap %s is %s newold㿐< `  `3`  *  @   @ 2@  @@(@` 3``  @ ^9<ܨ     `" H29<ܐ! `<"p;B, ' @ @@G )@'7<5< 9<ܐ ` `;; @ @?" *@`  @0@ Ħ! `<b̐` < "<` 2`<";_` <H#` <HR ` @  @ esis_ishinput: ish: ht %d Unknown ISH option: %x esis_ishinput: nsap %s is %s 㿘/< `5< `4`  *  @  <;"!<H! `c  ` Y4`:)` +<)<`<H#`  J#<H  * `@ b 4`@  :!  *` @ @  ` <a7  <"` 2`<":̐ <H# `@ <HR`  @# Unknown option in ESIS RD (0x%x) esis_rdinput: rd: ht %d, da %s : net %s 㿘5< `<H   3`   ~ <H! `y  * t@    8`:/<    @` X3` <-<  2 ?J  `E  :V  ,* < !``!< 8㢐:A`-!< X㗐:7`- @ "@@ 3  @6 0`  2` 3  @+ @@㿘<0a <HR!<@"ђ <*p . 0 "'  "$  "   `2<Hc<H    R<H#<H#Ȑ @H  2  2 0esis_shoutput: bad pdu type esis_shoutput: ifp %p (%s), %s, ht %d, to: [%d] eshish%x%c esis_shoutput: adding NSAP %s esis_shoutput: extending packet m0 %p, m %p, data %p, len %d, cp %p h'D'P` /<`   2` `<9#0(/<` 2`<ܐ `(D<#`<#<  .D; 9n << ?PH  :9_ P<9X  r   5` @Ӕ d`  '''Ԕ  6.. . . `. А `''Ѐ` %` ԒД٘  7<؀ V`` H` IL`؀  JJ@Ɣ < J27 <`  J@` <+ <ܐ ` S I<8ԴЦ I 2 rH  5$'Ԓ$  < ``2M(  (   " <  ?$ <8 8 r  $`r50F$ 'Ԓ?* 'Ԓ *<H 'ԕ2*  <Ԕ*  `$  ` 'Д< `8А%`Ӓ . @ #   ?ؔ  //P???/@XDx؟ isis_input: pkt on ifp %p (%s): from: to:Error in sbappenaddr, mm = %p 㿐%<ܐ !'P@'L'T'X`'H) <!x88 < ` `  :8-``$<8&! ``  :8``$<8  59<H * ,2` @ <ᨀ/!<& r  "  DE  `d < " ; D  !`!7qÐր  D$  `d <   D0qisis_output: interface not found isis_output: ifp %p (%s), to: %x%cisis_output: error from ether_output is %d p'L'P'T'X'H8  %<< !`M<7#J   `!  <`  7~@@:<< 8;<@7u`0`@  :7n@*@<7h    ?ؐ  @//ݒ`???/@Fx؟  ` < @7G0 " q& 㿘 < ؀   D@# " <@D  <  D 㿘<"!<`"`t!<H!0"""@ @ <<"#\㿈< ` 'P'T'X`'H'Lp0&!<H! @ @?  @y   @ڐ ` ? D6 ` `d <  - D'L'P'T'X'HH /*!`!< @`` ``@?8?g@   H p@㿘`   ``` ~< .` €  T t t t t t ` t  t t l t <" lf 8 <H H  <)<HP<HT V<)H /* 'h    I "hH 02"7 7""" """<aa "a" "a"%$    p02p Zpp  -e 0/0  -㿘@ eonattach() eon%d㿘<ܤ! /#<ڀ``<6"<b 6F %$ 8<$`Ȑ#<㘔    $ x$ , 4, 5, 64 06  @a < /aP"aP" <5ߐ"eonioctl (cmd 0x%lx) 㿘H /* '< ! ` <#5Ē ! @2  `0 4`0 `<!&(H 0eonoutput : gen csum (%p, offset %lu, datalen %ld)   && & & & & &&&& & ,  .@, `, `, `, 4  `   R6 6g" &26&f" 8 &8  P  & . . . . 6 < !  '''x< Px 5G x @ 㿐`H'  0/0,f  N!e ,` R`6 `62`6 =&`H<.`` @&`P   3&`H @ @<aP!?$ 2`0"     $   $   , L  ,  P?&`Peonoutput eon: got non headered packet eonoutput dst ip addr : %x eonoutput ip_output : eonip header: 㿘-<ܐ / `   <4#<* Ѐ L & p `& t& LH 2&      `N `?``2  <<! )` 2 ` 9  2` A 2 <4l#   , 2{  . . . .``H /*'<(#. H p@  H /* '<( `2 H 0   # 3 3 ## l  < #   L&`&` &`6 \,`2 @& \`""" " "" /  <4#<3#А@Bǒ   .    P L  \"@& \& P& L`mɐeoninput() %p m_data %p m_len 0x%x dequeued eoninput: DROP eoninput csum ok class 0x%x eoninput: eon header: eoninput to clnl IFQ %p enqueued on clnp Q: m_len 0x%x m_type 0x%x m_data %p 㿐%<ܐ /#<'L`'P'T'X`'H<#p      3 ؀  p{  `<ڒc`| "`| /`<3v# H`mV$ H0`<* `XА `"`X"`t"`p  P<ڲ& @o  <ڒc`x "`x ?&  /` <`3H#<3E#ؐ@B  2<  <6 ` "<  <  D 2 D<ڐ# `"  c`  "` #`"#<ڐ# `"  6  D $ D&  /`<3#<#H /* ' @ `l" h D$ D$ hH 000&  2" ##" /` "<   V 2  @A <(<0<* ` "⤀ *X   0  H 0eonctlinput: cmd 0x%x addr: 㿘< !` <  2@U< 2 8 < . #  `" iso_addrmatch1: comparing lengths: %d to %d a: b: iso_addrmatch1: returning false because of lengths <%x=%x> addrs are not equal at byte %d addrs are equal 㿘<ܠ! `<  2U@< 2R @A < 2L @@A` @@`(< 2? *  #`  %< (20@NN@`   < 2$!X< 2!!`  < !02 @ʔ`?㿘 `iso_hashchar: unexpected value x%x 㿘 @5    -< &@` `" N``" L0  L@* N* L* 1 LN*L@* *`M  @ ` Ԥ``?&@@iso_control㿘 < ؀  %0  %0  < 2 %0 "@0 !!@# a@ !@ 0 !!0 !%@u0 z!! a @ 2  < I J@9 a < 2 a@ Y !: m   < /͐#K0 <)H /* 'Ȁ    < "ȑH 0 ԰ 7 @͔ $ <<`` <$ @`""`$  $ "& D d $$ $ $ 0  0 <HaX "aX 0  10 !!@  !@g !@6` "@ 0 !%@6`{   D0   d @  E    2 I D@Ք   J@ " P  @g P@Ô  0 "1 2 @W d0@   2p``"p@b p 2=$ 80;@; ` "`&  "@ <`" @ @"`@<"  @ <"T . .b ?4 . a @ Ė  - 㿘`, `H.`H 0        d`,?# @6`,.`HxH /* '`D ؐ@4 @0  a  H 0@ 0E&@&@x<B @2 `H`,<!pa&`(6`,`H.`H0  @&`  " @`e 2@  `c```I? 8 .`i  d`,.`H`6`,H 0 (  㿘< ؤ E  "> < 0 ": <  e 2 I i j@w "/ I@p J "$# <    J @ `  @ * @ I@P J 2 < < 2 iso_nlctloutput: cmd %x, opt %x, pcb %p, m %p iso_nlctloutput: data is: 㿘<ܠ! `<  /q    < /f @>/ iC -ISO address: suffixlen %d, %s %d.%d.%d.%d: %d㿘    #< aغ/A0  <   ` ! 2`/6 iso_check_csum: m %p, l x%x, m->m_len x%x iso_check_csum: new mbuf bad mbuf chain in check csum l 0x%x i 0x%x m_data %pASSERTION NOT VALID at line %d file %s /work/tmp/mrg/src/sys/netiso/iso_chksum.cBAD iso_check_csum l 0x%x cum 0x%x len 0x%x, i 0x%x㿘      -<ܐ k` < "(.ٔ@79< 7< 5< /<   @ `@" k$` ."X @   x. 2  . 8  &Ө@@ @:  k`< #.@* .  enter gen csum m %p n 0x%x l 0x%x 1: zeroing xloc %p loc 0x%x 2: zeroing yloc %p loc 0x%x 3: zeroing yloc %p gen csum final xloc %p yloc %p gen csum end 㿘9<ܐ! k`      < .BE!<0 &    8 .6+$! k @<!." ,@ k <!0. - k` <!P. -$@@`& @! k`<!h-&@ڐ"@ --@ @ --! k`<-א!    m_compress returning 0x%x: A m_compress returning -1: B m_compress in %p *out %p m_compress in: len 0x%x, off %p m_compress *out: len 0x%x, off %p m_compress copying len %d 㿘 H /* '  &@< !`< -#ȑH 0 H /*'<(#( &@H p@ ! H /* '<(`2H 0 @ 2@"@@" @"@2 ey &@@ 2" &@< !`<-7#H 0?@ " n+<ܤa)< r <@ - <  (- @ P-   "   < < "- !\ 2@D "   @" 8 r @< x,@  @֐ @ "  "@ & eђ @ "f@&@ r <,А#H 0?@" @"`@&@ 2 rfa `r <#,H 0iso_pcballoc(so %p) 㿘< !`< H,<)H /* 'Ȁ    q "ȑH 0  7 @ $ $  2&  iso_pcbbind(isop %p, nam %p) iso_pcbbind(name len 0x%x) The address is %s iso_pcbbind: bind to NOT zeroisoaddr iso_pcbbind noname iso_pcbbind returns 0, suf 0x%x 㿐+<ܦa  <!@,2)< ؀ K7  2 0`2  t   & . t. u. x. y. wx. v  `<` ,!`!<!l`, ` `$ ? @@6 ` ? " @  <+! ؀  I` H J@"   < 2 I 2 @t 1  t沐 f`  2& lf 7`&  @ @ `")   `2 `  @ " `M 0 8  ` / /c7: 0a6   * a `  <+!#N * 2 #4N*`2 (N$4NN7 , , @  2Na `<+q!ذ iso_pcbconnect(isop %p sock %p nam %pnam->m_len 0x%x), addr: iso_pcbconnect localzero 1 iso_pcbconnect localzero 2, ro->ro_rt %p ia %p in iso_pcbconnect before lookup isop %p isop->sock %p in iso_pcbconnect before bcopy isop %p isop->sock %p in iso_pcbconnect after bcopy isop %p isop->sock %p iso_pcbconnect connected to addr: iso_pcbconnect end: src addr: 㿐+<ܐa ``< !@*<` *!h @` 6 `Ȱ  " `ð / 2 < ؀' 1 ` I  `@ ` `  @y `I@`      a `<*!     "   < *!<*!ؐa `< !*;a ` `  Q   I t `@ ``@    co  "Q 7" & l &  I  @,`@`@U`J ,@,`,``a `< "*X ` @ @    c>  2& p 7 &  @ @-a " < "P*4<*1" <*,"  iso_pcbdisconnect(isop %p) 㿘< !`<"X*  "  `"   ` * @ଐ  ` @" c p & ` @Biso_pcbdetach(isop %p socket %p so %p) iso_pcbdetach 2 iso_pcbdetach 3 iso_pcbdetach 3.1 iso_pcbdetach 3.2: clcp %p freeing clc_hdr %p iso_pcbdetach 3.3: freeing cache %p iso_pcbdetach 4 iso_pcbdetach 5 㿘%<ܢ `  <#() j&$  ` <)#P < " ` c< ` <)#h  " ` [@ ` <)# D` ` `< 4#)y 4 " ` c `  D<)l# Dc   <)b# `<)Z  ` t@c6 l iso_pcbnotify(head %p, notify %p) dst: iso_pcbnotify: CONTINUE isop %p, sock %p addrmatch cmp'd with (%p): END OF iso_pcbnotify 㿘H /* '#<ܨ a `<!Ȓ).'<%<  a ` ``@` a `" ( (    2 8"2 H 0a ` <(א"@iso_pcblookup(head %p laddr %p fport %p) 㿘< !` <#(@"4  ",") 2% ` @X 2`"   ` @I 2   @?` 2  iso-domainllc_rtrequest(%d, %p, %p) llc_rtrequest: got non-link non-gateway route llc_rtrequest: malloc failed 㿘`<< a`0 `5`H<!(R`4 y "X! !i`P" e`P @ <H [ߔ0a _  < a     &`H<aP& E`P$ $$ $ $ `4$6`4<*`$" "$   @@ , , , ,  , 2`P , @4  "  " "@u `4&`H 6`4`P `<`8?&`Piso_setmcasts: %s unable to add mcast iso_setmcasts: %s unable to delete mcast x<Hc  ????6c%<#<` / / / / / /   a1؀ ``2    a2؀ " c'   2iso_snparesolve: return SN address 㿘N`  <H< !`<'h!`` ?#`< `" 0`H "  0  "  0`0 ` `  @ 0 <H 3 5#&@2 㿘< `""` # 4  0 V 6  6Xݐ 6 6   0  YV 4V 6  6X̐06 6snpac_add(%p, %p, %p, %x, %x, %x) snpac_add: rtalloc1 returns %p snpac_add: cant make room for lladdr snpac_rtrequest㿀 5 7@'<ܤ!   ,`  4./ <"; 3`#\&ז!<H#9 @Z @@ﻒ?X <"& 2@ 6`<Hct@ <H  <H# <#a>4   3a> 4  4  4  4  4  4  4 4 , @ <H4 , c4 YD 2  H 6?e7 6 4? 0d7 6`,`**   %<    Y$ `(@R  @ '@"  * **-`((:4 [ 2 2+ H <b$ : <Hcc6` 6`6`6`6` 6 ` 6 `6`6`.@6.6. H`(<$x#<*`Б4  ' X`` .`<H#`@<H#4 <H cz *"*@ * ?*@`@ **@<H@:#4*@`@**@#4@*@`@**@snpac_ioctl: cmd set, type x%x, ht %d, ct %d snpac_ioctl: cmd get 㿘< !` !'@ <<N#V%V %# !'@/: "6  ` $` <H`<H "c1<H<H<HV 2`V2<"~  j6  !(@<H  #<H.<H<H 6`66 㿘#<`4 4 0"  6R6 626 6<H`#6 6$`V 24<H 㔐  W 0V  6   `  X 㿘<0a <*" "@* <*#<*    X`" `Ѐ@:ѐ 2 㿘!<H#   <HcȐ@찔 "  #  <Hc@쥔 " 㿘<*   <@2   " 2 snpac_rtrequest: adddeleteunknown command dst: %s gateway: %s 㿘< !`!<H<$#  <#2<<##$!<#$!<#$<Hc9 @ @@<HY @ @t!<H#y @ @g ,?,<H#t / ; W"㿘<H#9 @ @@I<HY @ݔ @>!<H#y @Д @1 ?,? +  @  D V3 TP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0) CR datalen 0x%x data %pASSERTION NOT VALID at line %d file %s /work/tmp/mrg/src/sys/netiso/tp_driver.cConfirming connection: pevent: CR_TPDU emit CC failed done T_CONN_req.trans m_copy cc %p sosnd @ T_CONN_reqtrans: CC_TPDU in CRSENT state flags 0x%x dropping user connect data cc 0x%x TM_retrans.trans m_copy cc %p sosnd @ TM_retranstp_stash returns %d after stash calling sbwakeup XPD TPDU: tp_Xrcvtp: T_DETACHT_DISC_req.trans tp_ucddata %p ucddata @ T_DISC_reqXPD retrans emitting MT_XPD_req: sb_cc 0x%lx XPD req emitting MGOOD ACK seq 0x%x cdt 0x%x GOOD ACK new sndnxt 0x%x 㿘  `9S<#*` € hl | h | h x h h iT i j0 jp k l l4 lH lT lp l| l l m( mX n o o p8 p q q q rD | s, s t t t u v$ vh v w w w x x0 z$ xt y0 y z z4 zP z z |H |`@.1  `` @(`  .T< !뀢`  !0 <` !]`  .T`64`   D " ` ! << Д!H j ` mOD&` <۔px< a "x! <!4!(kn    @  64<۔p|< a "|  <!!(@.DkN `"4 "@&<< !뀢` Ґ <!!H k~ @.C0k0 沔 \  < !뀢`   <0 !p<a@2  @ n `i.TEVn D``$ ` lА D&`  2`    =  2 5 @-@#t`B  2 &`&p .&`&\&d&`` 1  `    @I V&l!&l&``  &``  @-W&` &`"  @#.`  @-E@#0@.  2   &p&\&d@# `  @-0"V6&` є <ےcp&`ax "ax j64ٰ !<ܐ! c` <  < 5!<ےcpa| "a|`6"`` 64` @2&<@-K0&`! c`  0<  !0[ &0jF ``$\ D " ` ͐ << Д!* ` lD&` \  @ V&\<ې#p t`" t0 &< 沔 [ 0 < !뀢`  <"ʒ<0@1b 2Y 76  @s "V 2 8VG&`<ےcp` < "`  286 <0 沔 [I    @N " 2 8V6 &`0 "VZ&0V&` i&\V&\@*;1<ܒ! `e> <"8l   \ @ V2&dV/&d@. jђ D< (  1<V Dj&\@*! e` <"8@  `\  @ !Vd 8&d! e`İ  <'"P <ےcp`L"`LZ)` V&\0 "`Z&0`` @&]` iG&`VV&d&\ 20 " Z&0 i4&`VV&d &\ @2` `2 ` k$ D<  <` @0bp @+  jR D  @ $` @&c&`@<ےcp`P "`P D   @+ <ۖpT "TY` VH&\  i 2 $ i  2$ <)" @!Z @,= 2,  i 2 $ i  2$ <"  @!= 0 沔 Z$  "  @!)@,  20 沔 Z     &p .&\&d< !뀢`  <0E"<b@0]@  <Ib V6&``   0 沔 Y֖  <ےcp`x "`x 6&< @і "V 2 8V&`<۔p`"@    <28 @*ٔ <"<۔p&p&\&d`"@    <28 @*Ŕ <"   @ V6w&``q&< t Y < b <b@/<ےcp`  "`*V: "@ 6  @q V+@I&`Ɛ`@.6C  6 "@] <ۚcp`| #`|V1&` <4 8 .T@*ېV(&l@  @"#   V&\@` `\  @7   ' t Y < b " 8 <tf"<c@/~ @ $` @ V&&6&`<I"؀`" 0<ܰ! a`  h <` #>` " V&\ h aɰ  <P+#8   ` 2V<ۖpĐ `"\ @ј V &`V hh&\@&   V&\\  @ 4`2 VVƀ Ɛ`6V* &d D H L" P"@ 4 z @,v <I"؀`q t 2'\ D D"  "@ 4 & @nn8Ȁ 2 6l|2 2  *2` 6l6l\nl ($?? d" `$,,@ 01" . <ې#p!"!ʐ  .`\  @B<I"؀` 50   G << Дs#)  6@)G@1 㿘`*  "&! d"i` "SV`  B F 0N TR 0"f` wU Y 0a e 0"`!r "a 䀢   0! 0"`!w!D!b 0"`!!t 0 0V` հ Ӱ V` ϰ /Ͱ 0 ʰ 2Ȱ 1V` İ 4° 5V`ƀ  3 1   `         `     :@#  " ;0`\ `, & `l $`," * $`l`$ @ "  $0z y $w !` s "`\ `, & `lh %`," *c %`l`$ @ "  %0V U %S #a@N 'L *@H 'F ) @" @ <> =` : -8 .` 4 ?2 @` . +, , ) B' F` # B! G  B C` 2`0  沔 V    @   㿘@`*  <Ibܑ* @`  <I<J"*` @  V  4`tp_emit dutype 0x%x, tpcb %p, eot 0x%x, seq 0x%x, data %ptp_emit: csum_offset 0x%x, hdr->tpdu_li 0x%x ASSERTION NOT VALID at line %d file %s /work/tmp/mrg/src/sys/netiso/tp_emit.ctp_emit CR/CCDT tpdu: class 0 m %p hdr %p DT 2 tpdu: class 0 m %p hdr %p Adding subseq 0x%x Calling ADDOPTION 0x%x, %p, 0x%lx,0x%x after ADDOPTION hdr %p hdr->tpdu_li 0x%x after ADDOPTION csum_offset 0x%x, hdr->tpdu_li 0x%x 2 after rADDOPTION csum_offset 0x%x, hdr->tpdu_li 0x%x 4 after rADDOPTION csum_offset 0x%x, hdr->tpdu_li 0x%x data len 0x%x tpcb->tp_l_tpdusize 0x%x tp_emit before gen_csum m_len 0x%x, csum_offset 0x%x, datalen 0x%x tp_emit before tpxxx_output tpcb %p, dutype 0x%x, datalen 0x%x OUTPUT: tpcb %p, isop %p, so %p OUTPUT: returned 0x%x 㿈<ܐ g'P`     < P"(3`` ! 5  > <(`4`  2` $.4H /*'<(# H p@ H /* '<( `2 H 0  $44$$S <" $  7T 7 $ $&$ $ `<* * @&@.`"4 ` 2 `!` ` ,   *P<*Q* . k` x < "h`<!#*` € , , ( x4 `Ȁ <А*`@%&`|`l 6` 6` * 6`@%` 4 `` `l&`d&`h&```m * * @$*@$@'3`  <* * @$ ` p `` @  * @`>$ <ې#p `" a2 `  < < "7!"`΀ 2  < < "+!#  ,a* a @6a  a@ , `,`ϐ* `ΐ @'` `ϖ ,<ےcp` "`  ,   *`*  ,``c V`*`" *  * 7  ,  * ** `,```  ```   ` `  , @   **  ,``- /:7# ` < < "!?`6`쀢   ,* *  `,  ,  ** `*  ,`2 `  ,   *`aR *`  , ,  *`*`  , l( < "  *@$` <4 Scp, ` "`` 2 - < < "Y!p` * <4 $p  "` 2  < < "@!x* $`    . @ @@  $  **` $ <ےcp` "`` 2  < < "!* $`   .   $  **`   $ <ےcp` `"`* $` c  P *  7$ ` 2' <ܢ `g S < "Ք @'Ò`S* ,  `g`P < #Ô @'`P* * @$ S *@* $ P <ےcpat "at<ےcp`  "`` 2 `hk < < "!`h `d`t   @#`l `\&`` `$? &`d<ܐ l` ` '<`Ȑ &`Ȕp`"`d '<`,$@ & ```,@* ``Ȕp &```"``     $ `l4  **` $ `m * *@ $` 2$6a`Ȁ <܀"6a l`" a < a+#8a  6a  ,  *a*a*  ,`Ȁ` P B `D<a&`Ȣ'7 `b`4  7Ӑ < #P    ,   *********  , `b`"` < #xڒ < #Ӓ`&`h`4 ?`&`V`V` `Ɛ6`V`* 8 V`@(i p< `b "| < # S* <, $p  " ? j( $a < < ""$ k T < < "" 2 $ H < < "t" $ ,`@  <4 < < "`"<ܦ b " `& <!  S`@$ g <!` PH g " ` <!  x<`  ` <` <ܠ g <J <!  @& g  <J <!`!` <JJ"`" ` 2   >? 4 `ɐ < < "#``  4`@`?<ܘ g` <!!( `! @' !!@#;  tp_error_emit error 0x%x sref %lx tpcb %p erlen 0x%x chan %p [error 0x%x] [error&0xff 0x%x] [(char)error 0x%x] DC case: DR case: TP PANIC: bad dutype 0x%x error_emit ER len 0x%x tpduli 0x%x error_emit DR error %d tpduli %x before gen csum datalen 0x%x, csum_offset 0x%x TP panic! cons channel %p but not cons configured tp_error_emit 1 sending DG: Laddr Faddr tp_error_emit sending DG: Laddr tp_error_emit DROPPING %p 㿐+<ܐa h\`` d <%#(AH /*'<(#  H p@ H /* '<( `2 H 0  4$$$4Nk   d 7$ $a `h  А <%. #h: @   @    @<* ,@ *@&$@ :!<0A@!<ې#p  `" ,@ 4` 4`4`a h`=  <%Ő#@$ 3 !<ے#p`  "`,@4`4`,`a h`$ } <%#@$  #p  `" ,@4`,`j < < "#b <%# " @  @,@ @  *** @` `?,@' @ k B < < "n#.a h`" @3 <% @#` @@  ! "  ,@ @ *` @ $  `2O O $ @`@,@ h`" @ <& @ 4 @@$# @$ O7 @z,@ " a h`  <& 0a h` ؐ <! !  ͐ <& `R !a h`"  <& @# <& @#  8 `? 1"a h` <&̐ @# <&Ő @#   h`!< <& #p8`N"8  2@!" 0 2! @*  `* 2 2 !`0`" D`" H `" D 2   D" H " H ``?`"""" !" H0 D" " 2 * "`  *tpip_mtu(tpcb %p) tpip_mtu routing to addr 0x%x 㿘< !뀢`  <(!01 <( H+!H &  㿀 D'T'X'H'L'P@ Htpip_output_dg datalen 0x%x m0 %p tpip_output_dg before ip_output tpip_output_dg after ip_output p)<ܐ! g'X`'H'L'P 'T <("H /*'<(# H p@  H /* '<( `2 H 0   ' 7 7 '' LP  6 '  P' ' " P`"* * " ""22`'  *@<" cp"`l! g "`l<(b(@$  p g`O <(~"P0 M<ےcp`8 7 "`8tp_input, pullup 2! after tpip_input both pullupstpip_input DISCARD p'L'P'T'X'HH /* !7<ۖpd "dPf` I<V   <(+   2  26    `@ <PJ  < !`+ <)" "< !`<)`@$5   "& &   '//<('//ِ"pؖ @Q 0 !`Ȑ <) Mp`< "`tpdu_li 0x%x m_len 0x%x 㿘#<ܐa i`" S <)# O  "=   `   @ۃ& V   <(+   2  26    `aOq  a<ےcp`<  "`< `  <) #?tp_newsocket(channel %p) after sonewconn so %p so %p so_head %p so_q0 %p, q0len %d conndata after mcopyASSERTION NOT VALID at line %d file %s /work/tmp/mrg/src/sys/netiso/tp_input.ctp_route_to FAILED! detaching tpcb %p, so %p tp_newsocket returning so %p, sototpcb(so) %p 㿘 [" )< ! t`"(  <*!hݔ@   #<* a V 0  "    aT 0   `@ϔ & ʐa,`l4`l$`*2@4a0 沔 LR ! `c <*a@"$`0 4`,`` ,`a <*<*!!]`V!H /*'<(# U H p@ H /* '<("`2"H 0  6&&&6I  @h@@& ,`@ K !! c`   <*"0:@T  i`  <* "`+tp_input(%p, ... %p) input: dutype 0x%x cons_channel %p dref 0x%x input: dref 0x%x sref 0x%x BAD dutype! 0x%x, channel %p dref 0x%x CR dusize 0x%x malformed prefered TPDU option CR fsufx: 0x%x. CR lsufx:CR acktime 0x%x alt_classes 0x%x param ignored CR_TPDU code= 0x%x CR before cksum checking if dup CR duplicate CR discarded HAVE A TPCB 1: %p CR: bef CHKS: flags 0x%x class_to_use 0x%x alt 0x%x opt 0x%x tp_class 0x%x CR: after CRCCCHECKS: tpcb %p, flags 0x%x abt to call tp_newsocket(%p, %p, %p, %p) tp_newsocket returns 0 HAVE A TPCB 2: %p state of dref %d ok, tpcb %p CC dusize 0x%x CC calling (local) sufxlen 0x%x CC called (foreign) sufx len %d AK dref 0x%x Subseq 0x%x %s%x, subseq 0x%x, cdt 0x%x dref 0x%x AK FCC lwe 0xparam ignored dutype 0x%x, code 0x%x INPUT: inv sufx DCsref 0x%x, tp_fref 0x%x INPUT: inv sufx DRsref 0x%x tp_fref 0x%x INVALID dutype 0x%x ERROR in tp_input! hdr->tpdu_type 0x%x takes_data 0x%x m %p tp_input: before driver, state 0x%x event 0x%x m %p e.e_data %p takes_data 0x%x m_len 0x%x, tpdu_len 0x%x after driver, restoring m to %p, takes_data 0x%x tp_input @ separate: hdr %p size %d m %p tp_input after driver, at separatetp_input : m_freem(%p) tp_input : after m_freem %p tp_input DISCARD RESPOND: error 0x%x, errlen 0x%x tp_input after error_emit 㾀'X'T'P'L'H'H'L'P'T'X///<<ܠ i  7f` '  ''7d''/ //'  \ <+P!< n#p  `  ' ` " $ "$ " @ <ܐ n` 4 p*!( `" <ܶ@i2 ` ``7F" .5<+P!ВL F<+("C6`   .<+P" 62@% p "C@<J @2` `<`  @3` 3` @ * `/?/7_ ?{`k-<-"$*` € t 0 <ܐ i` h <+"H ` 8֪ NN  < i`"N K <+"X/<ܐ i'`/' : <+ i"x'   7<+9<+ . "H [  $ <ܐ i'`/  <+ F"  7<+9<+  " 9   u p `" & k//!/f/g@ِf* `7f 7f<ܐ i`"YN ߐ <+f "QNN`` <J  2 +`3` ؐ   <ܐ i`"6N  <+" .N<ܐ i` p  <+ ܐ"p %p<ܠ i    <+ ͐#  p i " N  <+# N p2 <p $"`" $" '!  2 !@t 2  ʀ T @2          2!  <ܐp $"`" $f  i` > <+ m#@!F)<+(6` "@2` ! X  "<ܐ i`   N#0<܀2 "<ܠ i " c  <+#H = c "`  7<+`ʐ#``  .`?7  @` ,`@3 &6` //7/̀/͑0   ///Ր @   p <<L  p "`" H <ܦ c " @  <+`ʐ# @  ''`    ' c    <+T#X P`  <L @? ` XPʖ 2 <ܐ c`"{ i ~ <,  r< ` !X`` T`'7`'`@ե` !`7aa@ՙ` `F7`" @ `2`p`4 "`4` p`0 "`0` p`, "`,g<ܔ/aS }`pa "a`t (p` `D`D"  "@ 4 & @_``n`n8`Ȁ 2 7`l`|2 2  *2` 7`l7`lp ̒`" `Ȁ2_ <!7``l *`'`|7` 7` H*  7`7`7```@8F `*   `|2 " a'`|!'`|!'`|`| 2 2  `@*`27`l7` 7` *$7`$.p  "' `5`/<"@ p<!l+` `" paT  2 p` "`5`<"@ p<!l.` `paT`2 ip "`"    ` u <, ( aT`2i ""  p`  "` " ` [ <, @ `Ȁ H` 7`H"`` 7```@8#@`*   `|2 " a'`|!'`|!'`|`| 2 2  `@*`27`l7` 7` *7`@<J3  `+  @ `@ '<۴@ <`p`! "+ "@-"!&"""`!"` i&" i("`&"` i,"` i-"` -"T in- i-"%N-"  i/"m` i/ 0 ` `@8- i "N  <, ` N    i  `  <+ ͐"X` (N  "& ' C "   <, p /o'!/f/g@f* `e7f b7f i' [/' f <,'  TN P K @` "EN  E' /d a:/e E <,d  r52N /``'***/^/_/\ a/] ' <,<,`a^\ P5N  p  <,! Dp %pN p2@2  ?`V<2!*` € ʹ p  0 ˼ ` `/7`@* & 07 `02  * ` ////7/Δ/Ӑ@    p "`"  ` 'p`4 "`4` p`0 "`0` p`, "`,'`΀p@ѫ`Ѐ p$ap@љa  p$ " "$CFp7Ж @ "В ` H'F`"(6`pm <,`"!@`"p`$ X"`$p Ȕ `" 'F`"(6` P <,`"!p} p`""`  p $b`" $Y Ė  ` F"7 /'' 'ؖp ` "/d'/`  `* '`'@ ' ` `'p  `" t'`  `*@ ` 'p  `" c'`  `*@ ` 'p  `7" <ܐ |`<* Ԁ`" ` ` pa "a` 2`' `2 '쀢 ` +@3`'3` '`2`'쀢 pal "alp  `"  '' @ 5<ܐ i" `B @<,2`!Β `p` "` @" & @  @& @<J2 `<"   @  ?   p  "" `2 ?`<3#*` € $ T D 4 <$'?&' ?? .'p'h'l `%''t<( '|'x H /*'c= H p@` H /* '<(`2H 0  `6`&`&@&`6`@  2@BG S <     &` `h@A &@&` x`*y*z*{*|*}*~**** * * &@2   6  <( .H /* 'V`* ?3  `3 H 0 6`@`' ' @<,2`! `ۖ p<h `i "h <,`!ɖ <,Ð"0 <,b@    뀒؀` ~ <*<*!&G` `2 `8r <*<*!&H` `8 "2`8؀   <ܐ i` W <,"p)  J <*<*!v&h <ܐ i`p 7  @<,"b<,b@zpa "an<ܠ i  <,#LAU i`] <,#@0U` "`<ܐ i` <,1#8A:Ap <ሐp ("`"" ( Cp "`&" @<ܢ `iF  (ِ <,#P6``P#\#`LX#dT `hp <,#xp`< "`<tp_headersize:dutype 0x%x, class 0x%x㿘` `      <5`"̒` `     ` <*<*!&``2`<J. ". <J b @㿘 !0    @ 6@@ϩ`iso_putsufx on un-initialized isopcb 㿘! 0/ t  2 &...? <6n @  ?    &@p $ @ @i..  ((iso_putnetaddr: should panic ISO_PUTNETADDR 㿘 !   <64!00  t @2<"@< "`"  <6!P `@. iso_cmpnetaddr: should panic ISO_CMPNETADDR 㿘 !  ѐ <6",  t  2<&< "`" ` <6" `" `` `@@Ͷ  `@ͯ``?㿘2  `"&` @`@&` tpclnp_mtu(tpcb %p) 㿘< !뀢`  <6#P  & `  9abt to call clnp_output: datalen 0x%x, hdr.li 0x%x, hdr.dutype 0x%x nocsum x%x dst addr: src addr: at tpclnp_output㿀<۔pl< b 'T'X"l'H'L'P ? <62 # h? 2 <7a 8 <7`0@w` ̖ tpclnp_output_dg datalen 0x%x m0 %p tpclnp_output_dg faddr: tpclnp_output_dg laddr:  㾸<ܤ! ~'T`'H'L'P 'X <7! @ @ʔ 'P@* Ԓ'T@$  ~א <7!@ݐА <7!`֐ɐ <7!$%<ۖpl"lb X` R`6 `66 02`6tpclnp_input: m %p clnp_len 0x%x at tpclnp_inputafter tpclnp_input both pullupscalling %sinput : src %p, dst %p, src addr: tp_clts_ dst addr: tpclnp_input: FAKING %s QUENCHQUENCH2p%<#<ܔpa i)<,d'X`'L"d'Ժ'H'P'T #[ <7"<7c@  " "@& & &  J `2  A  i  `Ԑ~0_֐ [  `@a<#l`i <7c(@m`~ <7 #<7 #H<7#x<7# = <76# <7Ԑ!ƀ a #<*  `  @ p`d<7#<7#<7# pd   @ 㿘  @h㿘  @atpclnp_ctlinput1: cmd 0x%x addr: 㿘< !`  <8"ޒԵ I` E 9<8#$.  € t <<8"LT! <<8"Lp <<9"L <Fb4 @<<8"L L<Fb4 @<<9"Lpړ 㿘!<J" @8  @@̚? tpiso_abort %p x< !뀢`  A <9 `o  5 /'2؁x  ')؁tp_consistency %s %s TP_FORCETP_STRICTp_class 0x%x, class_to_use 0x%x Nretrans 0x%x use_csum 0x%x xtd_format 0x%x xpd_service 0x%x tpdusize 0x%x tpcb->flags 0x%x dt_ticks 0x%x x_ticks 0x%x dr_ticks 0x%x keepalive 0x%x sendack 0x%x inact 0x%x ref 0x%x rx_strat 0x%x ack_strat 0x%x tp_consist rtns 0x%x class 0x%x xtd_fmt 0x%x cmd 0x%x 㿘@à'<ܐ _`  <9``<9!<9!`<9<9! !Ґ `"$# 2$ ` "    `_    2E  `_  `~ <9!0$`85   "0  `_ " Vj <9V!XV $" V $ V 4 `_  !S <9!hM <9{!xG <9u!A <9o!; <9 i!, 0 `2 ... `2   `2   0 `2 ` m_len %p %s TPOPT_FLAGS value %p *value 0x%x, flags 0x%x GETSETTPOPT_PARAMS value %p, cmd %s %s DISC dataCONN datam_len 0x%x, vallen 0x%x so_snd.cc 0x%lx tp_ctloutput: sosnd tp_ctloutput after CONN_DATAtp_ctloutput sosnd at endtp_ctloutput *mptp_ctloutput *mp after compress㿐<! `H /* !)<ܪ ! r`  <;`Ѐ  #\`"& & A?H /*'<(# H p@  H /* '<("`2"H 0   3 # ## 3 8  2 # H 0 7# '?#?` "۰ &`2 <հ & ѐ#"? Š!2 r`n@ `x`H@ "$`x` 2$`x`n `\  `H$`x#2 -8 -`8 "` 2` "` 8` " 2` " 9`?* 2  "v 9  " ` !c - " `] -"[ - YtR -O!L -: A ? ` <! `ʀ 29 r@ 45< & 0 ʀ 2  `̀@2 ``"   ! ``DD `  @ǂ` "!  2 ʐ 4`4a &$`$`$@?a@ [ <;<;!8"&a@Șaa ? a@Ȑ4a?`΀@ ? <;<;!8k"7`ΐ@|``" ? , <;!hY `@i4` r` <;a<;!<;!Ȑ N> `ʀ2  `ʔ &"` _`! <;a<;!<;!Ȑ #! r` <;a<;!<;!Ȑ  `  n!`@ & &e" "b `0 _!8[$`0 ` U! r` <;a<;!<;"ܐ  <; "`hӔ<;`|@bH26!`0` `  8* ( @(# (""``0 ";Q!$`0! r`<;`0@b` '`"!@! -! r " `|<;@b<;@b "8' l I <;<;!8u" " r" r <;@bH 0㿘<K`  "`<(  Kʔ <L< "L"@ " <ې#p @!ȁ㿘G  6 㿘 G   4 .!T@ xR @  tp_freeref called for ref %d pcb %p maxrefopen %d tp_freeref: CLEARING tpr_pcb %p tp_freeref ends w/ maxrefopen %d 㿘. )<+<ܱ6 !la.  u  @ʐ <b<>! 0 c '< <>!$@,!T`!l*     !l 8!l "a u: $ $  <> Đ"㿘'<ڒ` `   "` ⨑* "($  * * ⨑* ɰ  2 1 ?$ <* $"al%b@ƩI @; $ .!T⨔⨒$ :`&"㿘` ` ` " ` ?4``,€`4 `<J*` #*$`@0$`$tp_attach:dom 0x%x so %p ASSERTION NOT VALID at line %d file %s /work/tmp/mrg/src/sys/netiso/tp_pcb.cBAD4 in tp_attach, so %p BAD3 in tp_attach, so %p BAD2 in tp_attach, so %p BAD in tp_attach, so %p 㿘 )< ! c  @ <?  "l 8 <KH  <K<KG !<)H /* '耢  !  "H 0 n 7 @Ą! 64 V ;$ 4 H` $ x`4 ?, $ D`?, <J* @*`"@*`@  @Ŕ &  *@ Ȑ    @$ (,!R$ $ <$ $$ ,4 $   !    ` <?<?!8"5 2"  c`N <?!`|r ! c` A <?!o$ ! c " $3 <?!a$ c ( <?!Vtp_detach(tpcb %p, so %p) so_snd at %p so_rcv at %p so_snd at detach about to call LL detach, nlproto %p, nl_detach %p Unsent Xdata on detach; would panicreassembly info cnt %d rsyq %p calling (...nlproto->...)(%p, so %p) so %p so_head %p, qlen %d q0len %d qlimit %d after xxx_pcbdetach tp_detach from listen: should panic SETTING ref %d to REF_FREE end of detach, NOT single, tpcb %p 㿘%<ܢ `c    <@!ؔ `c "! <@!0 h͔ D<@ |@ aP  <@`,!h! "  0 <@!H!t 0 " `c5 `c "  py <@ t! p p "@? " & & Ȑ ?& `c`" ] <@ !V <@`"R`0R`2R`4 `,€  `c`" D <@s"@  2!T<"` "@"` `  "' <@V"X!T  c` <@ H">  c`  <@";㿘'<K<"+!(ഐ!@ ! ʀ "  ̀@2      " ഀ`` 㿐`   - `"a`   " u / ` ` *` 7   " a O` `   :T '<# $  * 2 #5 *`2 2= 4 7p        @ê . 6 5a@áa<K` 2    ` ` `ʰ  -`ʁtp_goodXack Xsnd before sbdrop㿘!@2 !<&! `<B!@ v`H)!t %s tpcb %p, elapsed %d, delta %d, rtt %d, rtv %d, old %d tp_rtt_rtv:㿐<  "耤 " $@<  &  & &  $ : @`&  & <`& & <b< &    $* @26 Ɠ* :``6  !S@6<6 < !耢`" А  <B<B#\ #`!aH 6 āgoodack tpcb %p seq 0x%x cdt %d una 0x%x new 0x%x nxt 0x%x goodack discard : tpcb %p subseq %d r_subseq %d %s tpcb %p seq 0x%x rttseq 0x%x onxt 0x%x goodack dupacks:goodack returns 0x%x, cdt 0x%x ocdt 0x%x cwin 0x%lx 㿐+<ܐa a ` w  P<B D" H#\ Du! a 4@y<Ka a`aY <B!"ؔ a@g<K!p 6!6 8 8<K * 2`@ D6 8  < P@ T8a a`2. <B<B #c@W ( @_ D& @& P& <&!p& & T@J 8@S  P @$@ @& < , a a ," a& P& Ta <  & <<  , ," <K @a<K  8@ $ 4 < @ 8& < 46! 6@6 46 6 D&6 8 , `0e ," a` H& " `0V U`@ @@  "  &`$ , ,@  " *    H V &!p @ < @ @ɐ@)6   l 8  P& < & D ,&   ` ,@  & P& T `` Ȑ & Ȁ`<ےcp`\ "`\!p  V &!p&!d P D@& P& T@ 6 4a a` A <B <#Xl@mtp_spdropping too much -- should panictp_sbdroping %d pkts %ld bytes on %p at 0x%x 㿘  D`h (`h" $@  , @ ` <D> `F  ?< !逢`"   <D $ ' < "   <  B h$tp_send enter tpcb %p nxt 0x%x win %d high 0x%x tp_sending tpcb %p nxt 0x%x 㿘 D H `? `hV !\V " $ 4 & < 4 $ !  < H$@  ,  "   -<ܐ e`"  T <D P"Ř T " D ( P"  @ $  @ ` i L@ ,$@ &bb P *^ P[h 2     2  : &Z H% 沔 22  N e`"  PJ <D P"@w P , 3`8 `8 27 H P& T H $ @& H& H<"& &  H @& P& P!p 2  P " PV 6 V &!p&!d P , $@   H    H L" , &. 0" :. ɁSEND BF: maxsize %d totlen %d eotsdu %d sndnum 0x%x tp_packetizetp_packetize 2SEND out: oktonagle %d sndnum 0x%x 㿘  h#    `"+<ܐa e` ` <E L!Ȓ ɀ :` 2 <Ei"  2  " L<E^" $ & L & L  @`@ݒ   $  2C0@ʒ < $"#)<E 4` )" @ A@  L$ $ & L`& L" L  4 . ɒ . < (?"p  $` #"p& La e` ? <E L" l Ɂ stash: so_rcv before appendingstash: e_data before appendingstash EQ: seq 0x%x datalen 0x%x eot 0x%x stash: so_rcv after appendingtp_stash - drop & ack 㿘 `` ` `"` 2`'<ܠ s " ` <FX@E`<F` @A`` \ 2Q p s "   <F` `` !X `. <K " &!X ` @ D \ $ t & \`$& \@ n n*  p*@ @`" ` @א D t& t$ \  $  & \& \ p t 2 s`Q<F X@a(0K 2 n@ \ p n  $  `   , 6`   ,"  # 6` ((` / 0! @w2`* `"`  s`<f <F!H<۔pX``"X/` 0 $ t & t@` d@"`` <<ےcpa  "a a<@ @ "@` tp_rsyflush %p 㿘 t`" p n p*   " ?& t/] t p? :`"  p <G C& t p & p㿘  ?# `H  n@ 8,`2 6 n p  p ,` "  @ & ptpsbcheck nohdrtest %d; len %d != pktlen %d on mbuf %p tpsbcheck shorttest %d: cc %d != %ld || mbcnt %d != %ld tpsbcheck㿘   h * <G)<G  2 f @   @ (2 @"   "0˜<GI"` 2 @ <G"p<G1"ref 0x%x lcdt 0x%x l_tpdusize 0x%x decbit 0x%x cong_win 0x%lx 㿘 t (< `D`D"  "@ 4 & @  n n8 Ȁ 2 6 l |2 2  *2` 6 l6 l< !쀢`2  <G3  <#  lZ TP PROTOCOL ERROR! tpcb %p event 0x%x, state 0x%x 㿘 <H`A! indicate 0x%x lsuf 0x%02x%02x fsuf 0x%02x%02x err 0x%x noind 0x%x ref 0x%x x< !`` a` .2`#\` <H`#dL !hL`#`NaN`Ѐ '  " 6 -   .?#` #2.''''` " """ ` > D  6  48, 2` 948` <㿘 #  & $   !S2V  & , & ( 6 㿘! @e @ В @a @ 6!6 @ tp_quench tpcb %p ref 0x%x sufx 0x%x cong_win 0x%lx decbit 0x%x 㿘< "``] !<H #U  <H2 <# ` `< & <cpa  "a < ? & & <cpa "atp_netcmd(): X25 NOT CONFIGURED!! 㿘) <IX ASSERTION NOT VALID at line %d file %s /work/tmp/mrg/src/sys/netiso/tp_subr2.cASSERTION ERROR: tp_mask_to_num: x 0x%x j %d tp_mask_to_num(0x%x) returns 0x%x 㿘  :@  ?:@    <I<I!0!䀦   <ې <I!X< !` ϐ <I!㿘V   *   *   A H <h '<0 @)@"@& l "  @ @B"@ & & P "`8"@$```  l@8= h\`"  H H8 D=udd 86`8 ? *4 "& <& T,  * & @  * 4`` * . tp_route_to( m %p, channel %p, tpcb %p netserv 0x%x) m->mlen x%x, m->m_data: tp_route_to( CHANGING nlproto old 0x%x new 0x%x) tp_route_to calling nlp_pcbconn, netserv %d tp_route_to returns 0x%x 㿘%<ܐ c ``` <J` x/ <J` ) `@` O   R /`  ` ` .` 2``  R`4@ .` .`` @  c` Ɛ <J` t $ c`" ` <J`!`<J* c*  &` $€` 2 ``€Ր c` <J!8’stash EQ: seq 0x%x datalen 0x%x eot 0x%xstash 0: so_rcv after appendingtp0_stash: tp running over something wierd 㿘<ܤ! s`D   a <J`#h``` ` `"` 2`` so_error is 0x%x PRU_DETACH: not detached PRU_CONNECT: so %p *SHORT_LSUFXP(tpcb) 0x%x lsuflen 0x%x, class 0x%xpcbbind returns error 0x%x isop %p isop->isop_socket offset 12 : PRU_CONNECT after tpcb %p so %p npcb %p flags 0x%x ACCEPT PEERADDDR:RCVD: cc %ld space %ld hiwat %ld PRU_SEND: eot %ld before sbappend %p len 0x%x to sb @ %p so_snd.sb_mbm : to be addedPRU_SEND: eot %ld after sbappend %p PRU_SEND: after driver error 0x%x so_snd %p cc 0t%ld mbcnt 0t%ld so_snd.sb_mb after drivertp_usrreq UNKNOWN PRU %d %s, so %p, tpcb %p, error %d, state %d returning from tp_usrreqp'<ܐ r'L`    <OL"p78 `  <O8-"`  -H /* ! `` `<P".` € Bd B C C C EP EH E E F| H I0 H F@ F| H I IH 8ڐ "ሒ 'ؐϹȀ   c`ꮐ <Oݐ"  ؐ    $<b& & ba 2` ` &I" c " t <O "V 2ሐ  " c O\ <O#ꊒG c " P <O~#8m 7 3 c "< <O#`ʒg3 <Oa#8P ΀ 2   ! 24  8`(€ݐ   ! r " <O3# "Ɛ "  @ް r` <O#DHP" L"@ 4   "    9 Lq @L " ` `@ѐ ሀ` L L``  ?2` `2L `?* 2  Ly 9 {h `遐 <OL#ؖ鬘<P`Ē`<PL`(L {"h <PL 8镒<P`` 2 { 'ؐSذ { "BO <P `}I <Ph `u<P``.  (ሐ  /'ؐ-H 00     !  <P E - r`  <P`<P!  0H 0Tp confirm called when not confirming; tpcb %p, state 0x%x x    ݐ <R` ! 'ؐϒذ㿘'D&  `" ""    D e  "#&     D #No nspcb㿐 'L 'P'T'X 'H<RH#  B2 D+2`'<K2`<2`2`2`2 `2 # `@ # ` 2 ``" `` " ` `" B  2 `P` ,S  ? `& & &  А D4   `d < 3 D0#x㿘@  2㿘 @ 4 82ܐ㿐 'L'P'T'X 'H       `  "[  2#Gk 7 " *@   & P H`` 2  `"   "   & &  #a `"> 7` `` &`5 7` . R. 6 6  6 "6 $6 &6 6 6 6 6 6 6 <K ` 6 ?``6@6?6 ,@  0㿘``   W0   !ג  y 7`D<S#*` € O O O P P Pl O    # `P  @ -2  # 2 2* `R* `2 `2 `2 `2 `2 `2 `2 `2 ` 2 `"2 `$2 `& 2 <  # " " 0'    2   "  "  ``P  6`P* 6`P  `.`R   "Midp_usrreq㿈`  @H /* !   `` `.`<T" € RH R R S R T R R S R T T S S S S T S쀧 u 8<K<K2 l<ې@ݒ` g@ d0c@ ^@ Q X10T1`@ 80O2 0L"  7 7 7 "7 $7  &`79 8@ , 30 - 9`(@ 7 7 7 7 "7 $7 &H 0 !  -@ 0@ 20<T!`H 0㿘 `)) 8`a:` <K <K2 <ے` @K <+ 8 8  000P0ns_control㿈  <3!  #  #  8 2 # a@"  ! @7 !@3 ! !@"  0!#@0!!@ 0 a @ 2  8 B@2 8 D@a 8 2 a@  1 !:    <Uv!f <)H /* '   p  "H 0 <3z 7  << < < < < (< 0< 8< @< H< P< X< `< h$ 8a` 8$ <`""`$  $ "& @<(  P$$ $ 0`   , P, Q<+ 8 84 V 4 X 4 Z$ 0   9<  '  7 1 !@" A !@"H0 ! @0a@00!"@"#00!!@ 00!#@0 @6 B6 D6 F6 H6 J6 L6 N60    P6 R6 T6 V6 X6 Z6 \6 ^6 2 P 7 R7 T7 V7 X7 Z7 \7 ^74 P4 R4 T4 V4 X4 Z4 \4 ^ 4 P4 R4 T4 V4 X4 Z4 \4 ^ , $  =  P$  7  M  !  2 @ 6 B6 D6 F6 H6 J6 L6 N 6 B@20 D@" 0 "! 2@f  4 P"4 R$4 T&4 V(4 X*4 Z,4 \.4 ^ O`J @_C@B `9< "` &  "@ 8`" < <"`<<3"! < 8"T . . ?4 . ? ' <3!!<cx2cx2  2   - 㿘`,  0      `,?# @6`,㿈`FH /* ' '<`@<36`@`B76`Bx`D76`D`F76`F`H76`H `J76`J7 `L6`L7`N6`Nx7!!@! !`  a  m`F4x 4 @4 !@cx cxcx,cx@N  @Icxcx44 4 `  a  9x@23  @2.  @"`<' `< &`0&@S`@&@`0   `B`D6`R6`T  `, 6`,H p@ 6`B6`@6`D6`H6`F6`J6`L6`NH 0<3 3` 33b*`(00 "( 80 R`2  B`2 B` B2 8 D"   8 B2 8 D 8 2  #* 2 <` & :" (2(0 ""   *" : ns_err_error㿘`  ` 2 ` @ې c ` ]<#0`"#0`#0  R%  `    J% 3  E L$ $b<X^"0*   :`" 4 4 @ܔ * , , 4 `<K4 `4 `4 `4 `4 `4 `4 `4 ` 4 ` 4 `4 `􀢠4 4@ L4?4 @ 㿐 <Y#\     㿘   L6   L 2 <c0`` I"``'<  =0* p"`6"3*  "`""6  "   "  ` 0`\"  "0`\    `  @  0 @ 00`\ "`\1㿈  `" <  29  4 7 ?7 #7 7 7 7  4 4   4  4  4 4 4 4 4 4 4   4  4``@4 @(  㿘<K<K 5< 3<(<+b <.& &b 2 8 87 <2cc7`7  & <3 <<*3<(5<  .`.```0 7 007 ""00㿘H /* '<.  ""$?"H 0 <K` "`      <(<a` "`<("" #沦  b  "`   @<a` "` <K $ $ $ <K `(?@##4@@O* 2` 4@<a< "a4@xx` @ "` @ `@"  u<+ 8` @ 6 8` @2<`@-<`` <``@6<cc` ".`<# # ``@"$` 2 ``` "` ` 8`0<#x*2`  #x ` @ `@"`@z0#``@ <K` " ? P  `  @#0-00  00㿘 < !<K! `6  " 4  & ` )`` ` b! <S@2 0 @l  <K!`  !    forward: src , dst hop count %d 㿘<K!  `    <[m  <[h  <[ b <K! `F"   `, "   *  і )<@! +" ")     "@, #<* @`H ! " < `H`~ `<z !v ?# -  : ?2` *@ *`22`@ *`2 2`@@ 244!@ ZX?"`@O <[#H*` € pL pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pd pT pd pd pd pd pd pd pd pd pd pL pL pd pd pd p` pd pd pd pd pd pd pd pd pL pL"""@"  t `<@5!`<*@/ Hs㿘&` .`&@&`&` &`` *2 2 2 2 2 2 @`  `< 2`80  &`8㿘  V 6  606 6㿘%<(l<#x沔 ϖ  "^` 2  `"    "  `  #`#`  S `">` `` #`"5<# <`# 3  `3 x3 `3 `3 `0 "`` "` `2B3 D3 F3 H3 J3 L3 2` 3 沁p<K!('T'P'L`'X`'H 3<c q沔 N &c2 '&&& &` .` .  6` 6` 6` 6` 6` 6`   H 3 `4  `O &͐`9 3`<2`84<K "`8 4 ``2 0` "  0  ! 12  8@<K0<Ka, "0x & (<K!,`9  ` R`6 `62`6&㿘 T !    @ T$ i&   7㿘 &   2e  $ 2a `F ` `X ` 2 ` ` 2` ` " ` ` ߥ6` 26` C 1` , 4` + : 5<1 5<T4`@ "`' 0`6 `6 `6 `6 "` 6 $` 6 & 26 &<۲ 5<+`&* 2` k6`&6`&`&T@ 2`&6 & 㿘`  `  `  /`  1`2  ` 2 `  , `22`@ - B`@2)@D 2 @F`@2@H` @"-4@@ "@ 4 2@4`4 `4 `4 ` 4 ` 4 #  &@@`" &@R`6 `62`6&@1<# # 44`4@`4B`4D`4F` 4H`  4J 1<@ "  < #   .`.``4`4 `4 `4 ` 4 g4 #  3#  2/&@   <<3!` ` ``8`2` `2`B` 4` 4` w` <3!`2`B1 14`D4&`@˔ ' 0 2`$ 2`& <  <#x#x4  4" 4$` 4`4`4`4` 4` 4㿘<"T"T6  6  6  6  6   6  @㿘  3"` , _8 ` "` 0 00000 0 ((0 0 0 0 "0 $0  &0 ` "` 0 00000 0 ((0 0 0 0 0 0  0 㿘H /* '#<` ` !   @2  @2  @"   `22 8 ƀ"`L` 2 H 0㿘 , & ,㿘<    N .`0&2C  2,  2(  % " 2  2 " 2 2 22  " 6 2&network systems2MSLKEEPPERSISTREXMTdropresponduseroutputinput< 0No nspcb in spp_input 㿀'<'  'P'T'L'X$'H  <`  (`j<* )  * 2  e$ 2`<K"Ȁ` `<* `@o *% 6 `4 `4 ` 4 ` 4 "`4 $`4 &  (6`  .` b.`6`b` 6`D6`J<"y`"#` `" `$  ` 2`2   &  **`2`2`2`2`2 `2  7 7 7 "*7 $7 &7*` * `4 `4 ` 4 ` 4 "`4 $`4 &G 4 4 4 4 "4 $4 &  2 @Ӑ`  6``&6`(`( 6`*.`Z.`  " O6`J`@` 2``4 6`J$6`F .`  :" `"`@` |2`$`"$` 6``&6`(`(6`*`` 4 3 ` 6`F`$.` V`T `T`.`****:`:  : 6`V6`X`6`P6`P` 6`P6`T <*<K"Ȁ`"  `    ? & & & @I "N`ZRN`Z  ` `a  @c` `3.` l * `  `<*<K"Ȁ``  0` <*` `<K"Ȁ`` p 㿘   `  ` @ <K"̀`   . `( *" *  $`&  . `& (" *  4A. [` ". [ , @6#<'cĐ "`& ( 2. [`( *@2. [ [<K . [* Б:  2 .`&$ 0  .& 0. Z6 . @ے P6 T/6 F4 : & 0 .$@*  46 .` . [ ,`&`" *   <'# Ȓ`"  ,6`&#<'c̐ "V T`"C ,`& R" *  $< ,8 "8 V* :  T" *` 6 V 6 V* &  X* :`#  *  6 X 6 X T* * 6 V6 X V6 TV X* :  : 6 N`6 P ` 6 P ,`& @2V H 6 F @. 2 0 P6 F 0 @ $@N @* < 8  & 0`& $"@ *``6 'h| 2  < $h`&6 ( . (" *  &6 . 8`$" *   2?  :`&" *   26  *`(" *  6/ ` `( :`&@26 * *" *  6 6 *#<'c  Ĕ" " `(6 *`$6 8`&6 :`(`& " * V 6:`@ 6 46 6  . `$ "@*  %` #<'c`  r"`cഐ "`` " `$ <"@*     ] 2` " S "@*  6<'#`2" `$?@@  <2c` "``  ` $<"@*  #<' @`2`<)H /* 'H    Ec @"HH 0`2 "` <'c`  "`"` "@" &"`<'c`  "` "@" $"`` `+"A. ] \`. \`<( ` $ @Ő 6 `#<' `<)` <<0<0D - \ ?. \D "$@ @4@`$@`"$#@ : * hH /* 'S   * *`    E0<)!ȓ*@ @ "@ "#@"H 0c " baL    `@ A    . "  2* 2  # @ =`H /* 'T  * 2  * 5 *H p@  4 $@ 4=`2 @    $ $ $  @  0`#z 6  6  6  6 " 6 $ 6 &    ?$ $ $ #>`2:`  d < " D 㿘 ] *"<d!.  € ` >`` 8<K! <_`0 '<d" 0%"  0 <K! <j   (<K @ 0  0Ԓ    ($ 0㿐` 'L'X'Hh'P'T   ƺ ` ` `   @`2` ` `?)`" `j (  ,` R  ?2`@`2` 9[$ `,` %` "`` ``(` @ "    `  ?&@  &      " *@&   2`k 7 8&` *&` &@` @j `6`6 `6"`6$`6&`6(` 2!`b  Y 2&@A  ? .  @.  $$ `b! *`" `\ . `\  *(? + .?``6&`"`4``. `(`0" `T`4c:` 8L`Z 2`"`4`H4`N`" * :  + : @  4`.4`F 4 HDP'@L"@ 4 `\   ?<',`\t `"tX%? ` ? ` : : $%h``" ` * 2 @ &,6 <'* *  * @ " <' x`" x ` ,` h J T`F F T`H B 4`N@H=   $%?`.4`^```$"@*  ``2``.$ <'`4`.`  "`` T` @t` "*`` 沐   <'`$`," *  <K`d T"`d`\ O"`\L`Z` ` 4`<'c`p "`p ` <'c`l "`l i   *` 8&`&` &`` @  `<K6`6 `6"`6$`6&`6(`,`6$6. ,```2 `<K"Ȁ` `  L   26 `L`Z 2`,T`H &`,$" *  6T`FT`T  4`,<'c`4  "`4$4`T4`RT`F 2'`.`(@""`PT`H`4`F4`H4`N$" *  &4`, 8T`T 2T`F 4`TT`F 2`P4`F``@L`Z `@.6( `  6& 6 @|6?6 ,``2 `<K"Ȁ`  ` ט   ``,  <'0 `@g,`0c`X "`X`,`Z ` $ *,` 4` 2G`. ,`` spp_output REXMT㿘 VV X* : V F  : <K"Ԁ`"V N<gӸ!HV N<K* @6 * :`` 6 H `x x6 HV N  N`6 N㿘` <[ ( P 0 R    7`?<g"*` € L    # `   @ )2 # `  #2@ # ` 2`2` 2`"2`$2`&2  *# ` 2`2`2`2`2`2  M'"K   E ` ><g#ܓ*` €  D X  ` `") ` @ *@ .`  `6` ` "`b`b!6`b?" @6`b ` .` .` q sp_usrreq㿘 `  HH /* !`  ` 2   ( `.`<h! € < \ t D T t $ <  8<K<K  <ے`   ` d    7 @ d     $  հ 7 @ ? , 4 84 ,$$ "4 `l`h`t" `p" 4 * @"$ @$ 0`h`l`t"`p" 4 * @A T  $ <4 X4 P4 T' (  @@  &      ,  &      { А<'c`  "`, 4 @ ?4 J, Z7 O e -@6a@+ [ 0@  ,  O, 5@" 5HH 0W \   `@  ` @ &  ]/*- `l`h`t"`p" 4 6 \ K 7, \` Β @.@ <hѭ Ѐ ` <K"Ȁ` y H 0㿘`    ( `* 㿘   <  *`h22 2"2$2&2222 2 2b26 6  `@`h3b #  " 4  @ߑ* & @& 0 `h "  "@ 4 * @% T 0@& <& <㿘 A /<)-<+<0)<0 `$`"$`" : *hH /* 'R   * *`  8 E0<)!ȕ*  " `"#"`H 0 u`2   $(ΐ<'c`0 "`0 㿘㿘㿘    ` <'c`( "`(. <'c`, "`,28㿘 (㿘H /* !<   <'#  (`" ` "   *` `< 3$`<2 (H 0㿘H /* !+<`  2` H 007`& `FT *` 4`    w  2 `DT`T `T`4`D4`T` 2(<"ؒ`@2"ؕH spp: SPPT_2MSL went off for no reason 㿘``\. Z``"  N0_`<jѾ#~6 L`*`:   6 N <'6 N@l"@<'D<K`"D VV X* V N:  * @: * :``6 P ` 6 P PV N` 6 F V X* : @6 X6 V (6 T 06 .`V 4c:` @82``$ *` $& 0 & @<'H`"H g0&<' L # L `(  `"6 DV D$  P # PM   6 JT"TҒ <㿐a"@  o7+  %  " """"  o'6   @8 `      ' 7` ` 7㿘  $?    " ? ` ?@@@ bind failed 㿀   /'     @  ` $@ & $" *2` @ ( 0 <kз#@}     @$   Ԓ  <$$ @( <K#     $ $ $$ $ $ $ $ 8## $ 4 ' '  $# $#\#`<k"Ԓ @  ;` "``   H-* I( P  "" K   H H J L`  `  ?   `'''@  쀢  㿘` ? @    l3H /* '<al ʻ  &  ʳ & H 0  (  & 6 & (& & $& 4& 0  2     & @"㿘 4   ̒  2  @  ?      a.@&㿘    "  " " " " "㿘     2    "  &@.@ .` .` .` + nfs: bioread, not dir NQNFSNONCACHE: type %x unexpected nfsbioread nfsbioread: type %x unexpected 'D D'H`'P!@'T 'l `   'd  '` Dh H l߰ l" 'p  DP@Dh H lB l(0l!y't "wl`z .  "D<mv @u   D?`P p@  <='`XD'x'|"?H*`Pp'' €x ><=aD'xa'|"?H*Pp'' @x m`\Ā@.lDh  D@1   ?`D P @cp 0R-rO`  J"`-iF '`\ >`=l!]<* `h BDD!@@ 6<hD P@p!D  ``@D`` @2h`z 2 h 7 Dh 2 Dh  D@Ӓ   ?`D P @p `?`h 2D`z @ D P @p  ?`D`z h0 " !    <m  <m DH@PDH@P" Dh %'h  <mr! <mm! <)t H t@:H t @'d<N '\ @:` \``N l਀ID< 2ED / t`a@œ:` D- lDt@Ap a  $" $P$ $@  l $@$ $,nl਀ t @@: @ ʖD` tD,ߒ  D$@  @@D t@p # $" $@%$Pp@ Htd @8H @ >`b @  8`6ddh /D  Dt@p  $X %$$ <><m˥!c'x'|Pc H*` €x Dư +DD <hd  "@&`<)t0  0D$@p  $" H$@%$P@p HH$4" @ 8   W'd<)t8!  8H%<)l D @ HlHD  #\  @) H @"  $`@2 $ `@t $D@3p "S $"2"`$ %$ =pP@Np "`+a c ;D@  D P p@= /`@ " <  2< <  (h@    `@   $  ? ? @<N+D@ǒ D P @pc<)<N'd'\H `Hd#  '` d@:)h"T   ?PDD#\@zl   "?  ݪ`dh 6p   DD#\@Wl   "?  pD  #\  @B l p \t   "?  \ <d`@-" l਀ , ``@(``z #$D@3p "  $"P $< p$ $@ "   $@$ $*^ ˥ ` h<'hhdH+Dh`" `z` <m`<m H$ %$H`8 w!  *' H  Dh `` !@Ͱ `z  ?`t4`z" `& `&@`&"&``z  $`X @ݘ  `<=$`X'x'|"?''H*` x @>`` 6` ` @ 2``z  `@ 2` g )0c $h$ $)p9<>Y @a6<* `h $ `zD!@@ `z @2'`z @ؖ! 7``@ `` @`z   @U  !`<``z <)` `t 'tt@pp` @D0`t`$ "`$`@.=``  `%@ `a @i: @ "  `?=  5$ ``z4`z` @@8 2 X`(  X @   <@@D X 4$  T6$ #'x'| P# H*` €x  !:<* `h $ `zD!@@ `z @2+ < @)! #``@ `` @`z " <( @  o`<` <  X`  T8@ $ T $ X$ T$ X h  T& X d X@   X $ d8  @ $ d $ h $ ?$ $`z` 2$ `$$ #'x'| P# H*` €x %`z  @M  "`0!  $`$ $$ @) `'`   㿘 D!@`@!( 2#<0 @y  a + (ז "   (˘ nfsvinval㿘 D!@`@  <0! !*`   z )<s`4 z z !` "  z "  z @yx 27  z  4 z  @yc  z ? 4 z ?4 z z  >c 䀧  z ? 4 z ?4 z z nfsaio㿘'<N`  } <!" # ! `$!  P Da@ @2!<ژ!x  *` ``$*`! 4 T`T!* @! )<s4!!`"  @x =a2!<0!  *`! `T!* @  $@ \?2& "& @ 6@& \ $@ ` & $2 & "& @ 6@& `& ! & !"$!!`4!   Process killed due to text file modification nfs_doio: type %x unexpected h PD!@  $@'ذ '%`%`-%` H : 0*  <2`%`@  $*` ?=`<)`t`  "` %`@$ΰ<)`t`, %`"`,'̐@; $@" H < 0%`''%`h`<)`<t0`m<t0 H<)`t: `2*  * #`=`@ &`% d H: 2*  0* #@@ "  @8 <  @h@% h% h 0% hn 0 j !<* h !D!@@  !@<t @ <t!M H\ 4 F<t !˒ ̔=&<)`t`4   "`4=`@/t<@"< p=` @P  @*@$@@ @饒  % d` 0`" = p% hj!@ "n` $% ((% $h`<)t( T:  X2 <* #($* <%`@ ' $C @=`  'Ѐ%`'̐ ' $@ % $@FȰ ̀  $  $ ?% $ $@*@% $   $   $ % $ $`=` "` $$% $`" % X $(% $%t% (z 5z% X% T`Ȁ`% 4@iD(*nfs_boot: '%s' not found nfs_boot: trying RARP (and RPC/bootparam) 㿘#<a   <Ka<u#0В` #($`  1<uƐ#P@'  @ @  @㿘@ @ @ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d p   ? ?  ''''?? Ԕ A <v hq0!0aȺ <v   ?7 aȨذ <v Rԁsetaddress: socreate, error=%d setaddress, error=%d P   <v!203   ?  ? ? ''''?????/Ȓ " * /" *  /" *  aW <v!deladdress: socreate, error=%d deladdress, error=%d p Ԕ  <v#0#   ?  ? ? '''/'? *" aذ <v# cԁ㿘   "  ?#@#`c 4㿘   "  #?c # 㿘    $  **2"knfs_boot: timeout... nfs_boot: sosend: %d h\`'Ԣ  g <`<w`e 耦ƀ RԐ 'I 7   <w!G;'РԀ ""'Ѐ "'@''̐ԔؖИ ̰ # ? ဢ П Ԁ`'@Ѐ %'Ԁ nfs_boot: add route, error=%d h  ??ؐ  ///??*"??А Ș( <w"nfs_boot: del route, error=%d 㿘 <       <wŐ# 㿘<3<wcnfs_boot: getfh - no pathname nfs_boot: mountd `%s', error=%d nfs_boot: portmap NFS, error=%d 㿐 @! H " H  X $ $  H$ $ $ $ D@{! :  <xĂ * @1 <x 0v0 "     ab+`  <x4  XXnfs_boot: mountd error=%d 㿐"  %a?    2?@  C' A  K… <x!07  =&` $*` &  `@&`& $   ' H  @  H͐ nfs_boot: SIFFLAGS, error=%d revarp failed, error=%d nfs_boot: client_addr=0x%x (RARP from 0x%x) nfs_boot: set ifaddr, error=%d nfs_boot: bootparam whoami, error=%d nfs_boot: server_addr=0x%x nfs_boot: hostname=%s rootnfs_boot: bootparam get root: %d x  <x#`Ñ0[ `4   ఒ <x#<x# z$ 7 <x#n1 '$ $ $  / ?, $ @6ܰ " <x#<yT <y<ܐ 8Ob<y`P@ <y XD Q  unfs_boot: bootparam_whoami: bad reply 㿐   " a b'$$ \$  o"@ a$ 4`b'  ! >`    %'`  < 4` <$`b|"| '<."<`؀ '6 '<y֐"( H " nfs_boot: getfile name too long nfs_boot: bootparam_getfile: bad reply (<|<"  '@ "I ab   >X Y' -' (''  '&HH"`"`"`   @.H  "` Z*`<y #ؒ :@,  Y@P<z [= nfs_hashlocknfsnodeplnfsvapl㿈<0a4<. s <##,<3<z    !<:#<:!4a\ <<z a#\;`#h    <.<z;`#h#ܚa#\ h        㿐<.<ڐ ,* `'<3`L D 2`,T`x2`,`D@ 2 `,`L9m  2&`2`L'<3 " 2<"ܒ 6{ &  0< x  @M $ $`L $`,`,"`0$@r$`0(   @<)<)G"HE"h<)<)@">" <)<)6"4"<)<)/#-#( <)<)#H#h<)<)## @<)<) # #耦<*<*  (H /* '   J9 $`D$`D"H 0`D`|$`D`D@0<.4`x# $`H  :`::::: :(:0:8:@:H:P:X  & nfs_inactive: pushing activenfs_inactive: lost vnode㿈<< c8   R4 <{ ;"h h  ($( "Sz R`4    08o " <{L"  8 @ň8 <)<#$<0`$ : *`hH /* 'S <0   *@ *@ Q 0<)!ȓ*@ @ "@ "$"H 0z<> 4z ''' H*@  nfs_reclaim: pushing active㿘 <<`D#8` a@T`4 <| ;  ,` 0"`0 , 0"a"`h 4` @  8$ "`8 8@  4$ "`4`h 2 MLENmbuf siz=%d Bad nfs svc reply0`<('D'T  'L'P` ' @ LP "@@"6@ c 2 `@A`H /*'%<(7 H p@`!<H /* '"`5"H 0  `4`$`$@$`4`  ` * $`  *`"`#2<"` ```0 "> ` 87   `U` 4    @uF @ @DD``'`d% `( "(  @"  @   ?$ 8H /*'%<( H p@ H /* '`5H 0  2"""2  $ $ '    $ '"" " " "  " " "  ᓐ ( <  < #l#h#pT#d#\#`#   @uߚ . 2  " 4    "    ""   "   " ? "@@ `` 0`` `@ @`B @ @ @%@@b `"@@lܐ@ @"? H /* 'T`<(*`  ?0 ` "%<(`0@ `4"`4`4`0"0<`!l`` ``(`$``,`$`( ?4`H  2 ``"'`@  2Z@nqexp㿘!<*  @%      <  #  ` ` 6    0怢@ 2  "    2㿘7< `@ ``  ?cߒ 4`]`٢  2բ  2<K<M!` <K#8 4`h<#b;<9<0` "` " ` @`"`@``"`@`"`8"`p<(` `     ` E(H /* '  R`*@ ?6@   '1<(0@  4"`4 `0`4" 0<ΐ!l  ",$(    2  "( # H ("@ 2  0 `"   2c$<) $@ :*`hH /* '<0S  ` * *`   /0<)!ȓ*@ @ "@ "$@"H 0x 0<)`ta<?"a<@<*㾘0@'4L'08 ,PB   " 2  '040 @x, , $$ $ $ $ $ $  H$T;` #\  H@fΚ ` {  L  H" >4  0@ "@ 2  '040 @xv, ?,$$ $  $ $ $ L$ 4  0@ "@  04@yE  0'04  0@ "@ 2 '040 @x9, 0X,L ``$\#\#`#d @ $T;` #\ @fF `   L q H"+  "! 1 $T;` #\  @f" ` ϐ   L M H   #\#`#d\<='@'8'D'H'<H*` 81t $TL  ;` #\  ;` #\ d @e`   L  H2   (  " C  ?  4< H /*'<(#$ H p@  H /* '<(`2H 0   3 # ## 3   " ''#   ' \    $   (  "S E  ?  S=H /*'<(#’ H p@  H /* '<(`2H 0   3 # ## 3 !  " ''# `TT '@( 0  @' L' 8  , B   "    ' @v f` `$$ $ $ $ $ !$  H& T;`#\  H @dϚ |  ` L  H` `C  @ "@ 2 ' @vv "$$ $  $ $ $  L$   @ "@@wG   5U  "D6 '*<`<+ 0 * @  @2  $@2   (@ߔ  " 2(    ' ȶ2   "    `2  ?cߒ 4 p<)tD!@`" @o $S x  ?' `(   " $ `rS x  ?$4jS x`  (  "  H  ? $A H /*'<(#Z H p@` H /* '<(`2H 0  `4`$`$@$`4`﹒  l<~#"`''$` ? @R`x'#@` #? Rx@TD  D@ve   (  " C  ?  4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`H "`''$`  ` '#@`#`)<*#\#` В @`I찒 E .  @ "@  2` ' @tۘ ( @`@ Р `@`       @@#\'ܐܒ@y#  !0<) D t a@#   D@n S x  ?  `'(   "@ $ qS x  ?$@4iS x  ```( `  "@  J@`  ?#@@B H /*'<(#  H p@  H /* '<(`2H 0   3 # ## 3 k `l<~# " ''# ` @#`  Rx'" #? Rx@D  D@u 0[    #h#l#p#d#\#`   @o5 T.  2   " 4   "   $ $    "      $   ?  "@''\ @f P`@\\ @f@㼐'P'L &0&@&,@f 0@'LD 'Pz L D   " 2  'PLP @s| j  &&&& &&!& H&T ;`#\   H @a` =  L  H y @L  P@ "@ 2  'PLP @s6 $&&& & &&&L`L  P@ "@  PL@t  09'P`  0,$`4 %Lz"h 2z` @` 28 8$`# 8 8@  4"`4`"8"4`@ 2`$`" 8$`, cld kerbnqnfstimr@@"6""d 22"h<"#!  Ā4" Ѐ@4"H Ȁ 2" A 2 "&  & & @&"" Ēh:&""$&"" 2 䀤2,  (B 2"  6` `O` `n?`2 #* ` b?  *@,  ,&!<"`  P "  D "   ''''@\o"  +<*)<=Lh`ЀJ @+  2i &  @@`4@8& "`88@ 4"`4z ` O&4`" h h @ux ]  ꫖z 6z\06& `2"t'''%'"t H* €z #6z`А , z ` @2  ` +a  2 &  @@  ݖ >+&  ""L   &X "8 Q"$&" " <0 @x < !"` "`  "`"`& "  3 2  㿘`4'XX `8& `8 8`8`4 4 `z& `z  @6`z`z߄ 6`z>`&`h  h82h24 &`8&`4 2 & 8 & &`8&`442 8& &4nfs㿘<Kc0 "c0H /* !<""  " 2H 0 %<<DD@*)<)'< & l `|@H@y  2@a@! @ `h"`h`4@ 2`h@&D@ܐnqlc㿘 ` !< 6  #   ` ?`# @6 㿘 ?# @`6 Ybuild > MLEN㾠0@'4L'08 ,B   " 2   '040 @p, ,  $@$`$`$` $`$`$` H$T;`#\  H @^  P  L  H"n >4  0@ "@ 2   '040 @pK, ?,$@ $` $` $`  $` $`L $`4  0@ "@  04@q  0'04  0@ "@ 2  '040 @p, 0,L ``#\#`#d @| "-L  $T;`#\ ;`#\  @^   L  H  @{Qذ    @UӚ `?`h     @UĚ " % @U "     @U "   @U "<='8'<P"?'D'H H*` €8))  $TL  ;`#\ ;`#\ \ @]  ? L  HP@zИ`  ```( `  " D` `  ?#@ <H /*'<(#ڒ H p@  H /* '<(`2H 0   3 # ## 3 9  " ''# `   #` '$㾘`0``@'4`L'0`8 `,PB   " 2  '040 @nӘ, h, $$ $ $ $ $ $  H$`T;` #\  H@\  ꔐ  `L  H"! @4  0@ "@ 2  '040 @n, $,$$ $  $ $ $ `L$ 4  0@ "@  04@o^  L0'0`L ``#\#`#d @{ $`T;` #\ @\| ° ) `L`\  `8 #\   #`#da<='@'8'D'H'<H*` 8' $`T`L ;` #\ `L  D T;`  #\ @\0 ݐ  `L  H "`Lg  D T`  ```( `  "  F`  ?#@>H /*'<(#u H p@ " H /* '<(`2H 0   3 # ## 3 Ԓ  "#  '`L'` `D`T#` `L DT'@y’( 0 @  8' L' , '   B   " 2  'Ē @m_ R  $$$$ $$$ H% T;`#\  H@[s     L { H"԰ >  @ "@ 2  'Ē @m $$$ $ $$ L$  @ "@  @m  0'< ` ???? ?(?0?8?@?H?P?X??  @ "@ 2  'Ē @l !<!H@  @ "@ 2  'Ē @l  /'  @ "@ 2  'Ē @l y!H@  @ "@ 2  'Ē @li \'  @ "@ 2  'Ē @lN A!H@  @ "@ 2  'Ē @l1 $'  @ "@ 2  'Ē @l  !H@$  @ "@ 2  'Ē @k       ?  @ "@ 2  'Ē @kט ʰ ! +  @ "@ 2  'Ē @k ' '<*`В``*" *  * ''  @ "@ 2  'Ē @k  ! +  @ "@ 2  'Ē @kr e' '<*`В``*" *  * ''  @ "@ 2  'Ē @kI <`m  @ "@ 2  'Ē @k-  'P'  @ "@ 2  'Ē @k 0?# @ '<* ` 2'  " `'  :`?  " `''  " L' *`" *  * '' L ``#\#`#d @w , L  % T;`#\  ;`#\ @X 提  L 뀦 HD #\ (  \   8#\#`  #d컘T<=(''''' H*` Ȱ ` d@ h䀢@ # 4$ L` % T;`#\    x;` #\@X} *  L  H߰ #\({ ??2`h :  D`802`h  -  @P) $<=@''̢$@'' H*` <=!''$''!`H*` Ȁ # % T L  ;`#\   D x;` #\@X 岐  L  H  #\(@tr[ `  ```( `  "C E`  ?#@ C=H /*'<(#F H p@  H /* '<(`2H 0   3 # ## 3 㥒  " ''# ` `DD#` '@u㽈0@8',L', '(  (B   "    '(,( @i8$ 2$  $@$`$`$` $`$`$` H$T;`#\  H@WL    L ̀ H" ?,  (@ "@ 2   '(,( @h$ 2A$$@ $` $` $`  $` $`L $`,  (@ "@  (,@iÔ  ",'(,  (@ "@ 2  '(,( @h$ $䔐0 4 ? $ H $T;`#\ @V̚  y L M Hy @uŐL  ``( '#\#`#h''#d#l@oњ, I F h`6 <"$`/h@sL H<>'H'L'P H*` H@q$$''''p4`24 2  ""'    <`D!ڰ  <=X'0'4'8'<'@ H*` 0 ! ,L  $T;`#\    X;` #\@V'  Ԑ L  H\  8#\#`  #d!<)<#$<0#@ :@*` hH /* 'R <0  *@ *@   vG 0<)!ȓ+ @ @ "@ """H 0 @q# @ D `$@ d$` D (€` <='8'0'<'@'4 H*` 0!. $TL  ;`#\   `D`XX;` #\@U  6  L  H  X@rŘ. i`  ```( `  " D `  ?#@ <H /*'<(#˒ H p@  H /* '<(`2H 0   3 # ## 3 *  " ''#  `   #` '#@ #`# `# ` # `# `# `Z# `  ```( `  " C` `  ?#@ 4<` H /*'<(#d H p@  H /* '<(`2H 0   3 # ## 3 Ò  " ''# `   #` '@ql  @q@qX0Z`  ```( `  "C E`  ?#@ C=H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 Y  " ''# ` `DD#` '@rO`L'H`0``@'L`8'P `,'''? '|L   "  ' @e s  $$$$ $$*$( H`L  %`TP;`#\P;`#\H  H@S` ័  `L  H" @  @ "@ 2  ' @e $$$$ $ $$`L$  @ "@  @fi  W0'<(   ;<(9<H /*'c H p@` H /* ' `6 H 0  `4`$`$@$`4`p H /* ' !lޒ  $` ֒ $`H 0` (` $`4`$`($` $`$$`4$`0`  `( l d $` '|&` $$$"$` $`%` #%`L &&& ``#\#`  >&&&#dH @q 2|`L` %`TP;`#\H  P;`#\H @R`  `L  H  @p+  h & $ `L `\ `8#`  #\HL#d<>'''' H*` <=@L''''' H*`  "%`TG| %`T`L  P;`#\H   \#`P #d#\H@Rs`   `L  H"q  @@o 2f   $%  "@ |@n"`  ```( `  " B` `  ?#@ 4;` H /*'c H p@  H /* '<(`2H 0   3 # ## 3    " ''# `  #` '"|"nfsrv_read iov`L'0'H@ 8'L,'P''''ԠC   " 2   ' @c ð ` `$$ $ $ $ $  $  H%TP;`#\H  H@Q` V  `L  H"C `>  @ "@ 2   ' @cQ ~ $ $  $  $  $  $ L $   @ "@  @d   0Z'܀#  @ "@ 2   ' @c >          @ "@ 2   ' @b     @ "@ 2  ' @b՘ ޴0 L <  @ H`4 L H%TP;`#\H  H@P` ގ " LL V H{ L ``#\#`H#d @oS ,L  %TP;`#\H  P;`#\H @P` V L  H   h  ܀     2%L \ 8#\#`  H#dvL  @HQL    @HHL<=''0"?'$L'(<= H*` € 'ఒ PL`%TP;`#\H    T ?` F   T T"  ? %TL 2  P;`#\H  ܐ ? P d#` P#d#\H@P`Pݮ P 'L t H" ܀^`  ```( `  "c D<`  ?#@ c<H /*'<(#H H p@  H /* '<(`2H 0   3 # ## 3 ۧ  " ''# <`  d dH#` '% 'Y T`  ```( `  "G D` `  ?#@ G<H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 K  " ''# `  H H'#` ' D <(  `` ` ` `( "  ?$@`$`_H /*'<(# H p@`!<H /* '`5H 0  `4`$`$@$`4`  H /* ' !lW  $`Z O $`H 0` (` $`4`$`($` $`$$`4$`0$` &4`-`'  <)K"H<)H"h@<)C"<)@" <)9"<)6"耢<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    Tn "H 0Ԧ ) `2`<l#`  ``(` `  " `  ?$@  $$ ` $ @ $`  `@Ԡ  8   ' <=l ''$l''( H*` <)<<0#$`$ : * hH /* 'R@ <0 , *`  nF T0<)!ȓ+ @ @ "@ "$"H 0 <=''0"?'$L'(<= H*` € B' "i4 %TL  ܐP;`#\H ܀  X#`P #d#\H@M` @ L  H. 0@jј'  @k0'   ? ' @i"܀ % <!H<!% % '  0 @'| ,'L L  8' ''x`'@ 耦B   "   ' @^ ` `$$ $ $ $ $ $  H% T;`#\  H@M ` ڶ  ` L  H"{ `>  @ "@ 2  ' @^ f$$ $  $ $ $  L$   @ "@  @_  0B''  @ "@ 2  ' @^r '    'x  !  @ "@ 2 ' @^M ,0  -  `)`  " " ` "`" " `$ #"@"  `4݀ 6, L L   % T;`#\  ;`#\  @L&` Ӑ  L ܀ H #\  ``#\#`#d @j + L  % T;`#\  ;`#\ @K` ٛ  L  Ha #\l 3<='(La''''a H*` '| h       L  \  8#\#`  L#dߧ  @CL 7 L` % T;`#\    x;` #\@K` 0  L 9 H #\|( @g 3<=-'  <)K"H<)H"h@<)C"<)@" <)9"<)6"耢<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    Tj "H 0 &&` $" "2 x` ,  >&&&&'<='''' H*` <)tH`"H<)<<0#$`$@ : * hH /* 'R@ <0 , *`  k  T0<)!ȓ+ @ @ "@ "$@"H 0''La'''a H*`  " % T L  ;`#\   `L``;` #\@J\`    L  Ht#\|(@fɚ 2° `  ```( `  " D` `  ?#@ <H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3   " ''# ` x `#` '    <# #  [ `  ```( `  "C E`  ?#@ C=H /*'<(#5 H p@  H /* '<(`2H 0   3 # ## 3 Ք  " ''# ` `DD#` '@gnfsrv_write: nd_mrep not free@'D'P&D'L`' 0 @' L' ,% (% 4 % H<*С; 4`, @,`b2*@ *@ b 2`* *`@C3`+ <K#+`<<`B@ C=L    "` ' @Z䀢     =`h=`p=`x,%`* H`L  %`TԒP;`#\ԒP;`#\  H@H؀P֪ P@'`L H ;  @ "@ 2 ' @Z䀢 b%`h%`l%`p %`t%`x%`|`L%`  @ "@ @[u  0@ '耥&  @ "@ 2 ' @Zh䀢 &     @ =` %`H  @ "@ 2 ' @ZD䀢 #0: =`` ;` B=`%`P  #耢  " " ` ""  "  " "@"  䀢 @ /  %`T̒Ԕ#\#`#d  ̒Ԕ#\#`#d  @H؀ #\ ( @d̸  %`,%`4=@H /* !`H   @  ``@`` `8`` @8` ` %` ` ` "`$` $`  %`$%` `H` "`$&`H`H%`$`, k `t *  @ @`h h@c:   ` `h0` `` @4 `h``  @`h h@c  "`"5` %```"`$``%` L `` `@  ` @c P 2@Y  `@`h `@`h h@b   `L %``"`$%`H 0#<*``Ѕ: 0(@(@c3`+  +`@ b * 2`*``Ж`B`2**;@ B H * `H Ӕ'  2 4   4 2 ``H $"`$  $" ` "`  "H p@ , L% , 8 `#\ L `#`#d h Ȗ@e '# ;<=a''('?L9<=''! H* @ h      'Ȁ2 H L \ Ȕ  8ؐ#`#\  L#dڴȒ ĔL@>  H  ,  &&& >  " &   42 &*'  <)K"H<)H"h@<)C"<)@" <)9"<)6"耢<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    Te "H 0& $" "2 ;<<=''''' H*` <)tH`"H;<c$9<0 $ :;<)*`hH /* '9<0S   * *`  f= T0<)!ȓ*@ @ "@ "$"H 0zȀ;<=a'''?a'L*'H@ '1<( ' % T̒Ԕ#\#`#d  ̒Ԕ#\#`#d x@E؀#\(@b% T  `L``2 ̢Ԡ#\#`#d @Ep؀k#\(@a  #<  ( @  "@ ` B    ?# ;c H /*'<(# H p@ H /* '``5`H 0  2"""2  Ԙ "''"  c В`#  P' H c  Z   "   ( @  "@ `C A   ?# C;H /*'<(#^ H p@ H /* '``5`H 0  2"""2п Ԙ "''"  В`DD# '@b ,`% 4<Ր!ȑH /* !   =`H % `H "`$&`H% $(   ` $"`$  $"H 0 ̀H /* !   <`H $ `H "`$&`H$$H 0 #<* 24H 0H o*@a 4 "  ` $"`$  $" 4P'@D' 2 4H 0 nfsrv_coalesce: bad off㿘```"```"` ``$"`$` `$"` @4  ` @ ` @`<2#$ ,j`, ,@ 2`,"@`> ѣ`,`H` &`,`2 ( H 2 (& H ( &`  (` "`$& ( (&`$`(   "$$"$ $"@ ( "  ( "`$& ("$`(2 h0 @L'L8, ? '' '''8A   "   ' @Ub   &@&`&`&` &`&`&` H%T;`#\  H@Cw`$ ` L `H* =  @ "@   ' @U  &@&`&` &` &`&`L&`  @ "@  @U  0 '  @ "@   ' @T  4 ? $ H`%T;`#\ @B`Ъ `" LL `H" L` ` L''#\#`#h'#d#lx@\!<=L(!'' ''$'(!H*` 'h '`:<L  %T;`#\    x;` #\@B`L`L (`HS #\( @_ G -0C``?`??? ?(?0?8?@?H?P?X??  @ "@   ' @T  "     'w '    @ "@   ' @S  %<!H@  @ "@   ' @SԘ  /'  @ "@   ' @S h !H@  @ "@   ' @S L '  @ "@   ' @S 2 !H@  @ "@   ' @Sg  '  @ "@   ' @SM  !H@#  @ "@   ' @S1        ?  @ "@   ' @S   *  @ "@   ' @R  ' '<*`В``*" *  * ''  @ "@   ' @R˘ z ! Z   @ "@   ' @R \ '<'<*`В``*" *  * '0'  @ "@   ' @R 3  '/0 /1 /2 /3 /4 /5 /6 /7' C'  @ "@   ' @RS  2<<2 bА <@' ' /` '``  `    :?  `` L\  8#`#\  L#d:<=`8''0"""`8H*` € <#$<0<)#@ :@*` hH /* 'R <0  *@ *@   `j 0<)!ȓ+ @ @ "@ """H 0䀠`a<` (!<= 0!@? ``?? ? ? ? ? 8? @? H? P? X?0'4''?'' L'$'(!@H*` /'䀢 `` `?` ' `6gs "2L Q` <>D'' D' H*`  %T;`#\ @?`6`CL `H"= 0;L\ 'ܔ 8#\  L#`#de<=`d''0"""`dH*` €  %T;`#\ @?E` `L ̀`H ?#L @''''ix _ %T;`#\ @?`Ȑ ` <L `Hΰ <#$<0<)#@ :@*` hH /* 'R <0  *@ *@   _N 0<)!ȓ+ @ @ "@ """H 0@@ {  N<>D'' D' H*` %T;`#\  @>`c `L >`H 0g N _ <>D'' D' H*`  u 8^  . <>D'' D' H*` `Q??J`L  @6A @L \ 8#`#\ L#dL<` <=?`@`???(?0?8?@?H?P?X?@?L??'' ''$'(`H*`  ` `& @Yl @`D `&@ d&``D (€` !<=L!'' ''$'(!`H*`  v!䀠` !<=` 0@Yj  2 L' !''$'('! H*` ' `%TL  ;`#\   `D`Tx;` #\@=`\`L 8`H6`u` %<``(` `  "# E ``  ?#@ #<H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 U  " ''#  ` $H $#` '  @ ` ` `  ` ` `@Z| #\(@Y `  ```( `  " D`  ?#@ <H /*'<(#{ H p@  H /* '<(`2H 0   3 # ## 3 ڒ  " ''# `   #` ' @Y `  ```( `  "C E`  ?#@ C=H /*'<(#! H p@  H /* '<(`2H 0   3 # ## 3 Ȁ  " ''# ` `DD#` '@Zv- "  \ <>D'' D' H*` @ Ő  㽀`0``@'`L'`8 `,  ''8A   "   ' @M   $$$$ $$$ H%`T;`#\  H@;`ɩ ` `L ܀`H =  @ "@   ' @M $$$ $ $$`L$  @ "@  @Nt  0 '  @ "@   ' @Mh t 4 ? $ H`%`T;`#\ @;`/ `" `L`L b`H" `L` ` ''#\#`#h'#d#lx@T)<=(!' '('$','0!H*`  `6`L  %`T;`#\  ;`#\ x@;0`ݐ``L `H< #\( @W 0 0,  @ "@   ' @L͘ <L a* @ ,*()<=[H <>D'(' D'$ H*`   @~ O  I<`???? ?(?0?8?@?H?P?X??` ` " `  ' @Le q#<!H@  @ "@   ' @LG S /'  @ "@   ' @L, 8!H@  @ "@   ' @L '  @ "@   ' @K !H@  @ "@   ' @Kژ '  @ "@   ' @K !H@#  @ "@   ' @K       ?  @ "@   ' @K   *  @ "@   ' @Kf r' '<*`В``*" *  * ''  @ "@   ' @K> J ! +   @ "@   ' @K  ,' '<*`В``*" *  * ''Ȁ *  @ "@  ' @J Ր+ * ? @   ' ")<= Yi <>D' '(D'$ H*`  @ 0s q_'`L`\  `8#\#`  #dט<=`8' '$8"""`8H*` € <#$<0<)#@ :@*` hH /* 'R <0  *@ *@   Y 0<)!ȓ+ @ @ "@ """H 0`R "`L0X <>D' '(D'$ H*`  `L`\  `8#\#`  #d^<=`d' '$8"""`dH*` € \?# @'''xz'<)<#$<0#@ :@*` hH /* 'R <0  *@ *@   X~ 0<)!ȓ+ @ @ "@ """H 0`@@` {<>D' '(D'$ H*`  `$ @S= @ D `$ d$ D (€ '(!' '$','0! H*` € I'(!' ','0!'$ H*`  c` %`T`L  ;`#\  ;`#\ @7`M```L `H`u` #<``(` `  "# E ``  ?#@ #<H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 H  " ''#  ` $aH $#` '         @To #\(@S- " Wd <>D' '(D'$ H*`  @ m  g0@'L'8 ,   B   " 2  ' @H| 2|` `$$ $ $ $ $ $ l H$Th;``#\  H@6p  Q  `L Y H"X `?  @ "@ 2  ' @HL| 2A|$$ $  $ $ $ L$   @ "@  @I  "'  @ "@ 2 ' @H| |0`4 ?`$ H l$Th;``#\ @6$p  ѐ " LL ـ Hذ L `d  ''#\#`#h'#d#l@O-d <=H''''' H*`  \d h 2  0] 9 0 2  2@mhL\ Ĕ 8`p #\#`#dɽL" 8#\#`#dɰ<=Ԑ"'?'"H*` <>D''D' H*` Ā;0  d<='''''H*`  d $TL  lh;``#\    xlh;` `#\@5Xp   L  H  h#\H@QŚl X`8`0'`@ `L``, ?  ''''' H''A   "  '  @Fޘ 2` `$$ $ $ $ $ $  H%`T;`#\  H@4 Ÿ  ``L t H" `?   @ "@ 2  '  @F 2t$$ $  $ $ $ `L$    @ "@   @Gi  " P'   @ "@ 2  '  @F\ 26`4 ?`$ H %`T;`#\ @4u " " `L`L  H `L` ` #`''#\#h'#d#l@M| 쀣 `<='0'8'4'<'@ H*` 0 '쀦 A`L  %`T;`#\  `  ;` #\@4 Ɛ `L  H+ #\ @P#\ 0 @P쀢  H  D   @ "@ 2  '  @E   $$$$ $$$ H%`T;`#\  H@3 j  `L ? H"ΰ >   @ "@ 2  '  @Ee ?$$$ $ $$`L$   @ "@   @F4  0'   @ "@ 2 '  @E( `$%۰ H`L ``, #`#h''#\ '#d#lh@La 耣 `<=0'0'8'4'<'@ H*` 0'Ɛ '耦 <>D'0'8D'4 H*` 0)<)'<%<0#<0x |h`  h `  `  h 2h` 25 4 2h l `h 2Dl `D D@` B ` B  Ā  @N; "? J|`L`\ Ĕ `8 #\#`#dơ`L" `8#\#`#dƔ <=@j)`L`" `8#\#`#dƂ<=Đc8'x'|'0"' '$"c8H*` €/#<>`D'''`D H*` € א ҐĔԐ`D'''`D H*` ?" p)<)'<%<0$# :@*` hH /* 'R #<0`  * *`   R 0<)!ȓ*@ @ "@ """H 0쀣 <='''''  H*` '耢<=Ȑ'''' 'H*` '$#@ :* hH /* 'S  ` * *`   R' 0<)!ȓ+ @ @ "@ """H 0 %`T`L  `;`#\  `  ;` #\@1 A ``L  H`ܒ#\@N#\Ԑ0@M 쀢 "耢 " 8 p<)<#$<0#@ :@*` hH /* 'R <0  *@ *@   Q 0<)!ȓ+ @ @ "@ """H 0Ԁ H<)<#$<0#@ :@*` hH /* 'R <0  *@ *@   Qh 0<)!ȓ+ @ @ "@ """H 0<>D''D' H*` 00 @L'8 ,'ذ  ' '8A   "  'ؖܒؔ @BԀ 2 ` `$$ $ $ $ $ $ İ H$T;`#\  H@0Ȁ  H  `L R H"Q `?  ؒ@ "@ 2  'ؖܒؔ @BCԀ 2ǰ$$ $  $ $ $ L$   ؒ@ "@  ؖ@C  "L'L D   ؒ@ "@ 2  'ؖܒؔ @BԀ 2` `$$$$ $$$İ H$T;`#\  H@0Ȁ    `L ̀ H"˰ `?  ؒ@ "@ 2  'ؖܒؔ @AԀ 2A$$$ $ $$L$  ؒ@ "@  ؖ@B  "'  ؒ@ "@ 2 'ؖܒؔ @AԀ ԰]0n`4 ?`$ H $T;`#\ @/Ȁ  B " LL L HK L ``#\#`#d @N =L  $TĒ;`#\   XxĒ;` #\@/WȀ   L  H  x@L#\ H  h`2 LV Lؔ `  ''#\#`#h'#d#l@HI <=H''''' H*`  ' \ "  D D 2  0L\  8Ȑ #\#`#dݘL" 8#\#`#dИ<=Ԑ#'?'#H*` <>D''D' H*` @[ ,  Q<=x''''' H*` <='''''H*` '+) $TL  Ē;`#\   XxĒ;` #\@.]Ȁ    L  HĠx@K#\H@JØ P`0 `@ `L``8 `,?  ''''B   "   ' @?쀢 22  %% % % % % % ܰ H%`T;`#\  H@-   `L € H"  ?  @ "@ 2  ' @?쀢 2%% %  % % % `L%   @ "@  @@l  "ʰ'  @ "@ 2  ' @?_쀢 2 4 ? $ H %`T;`#\ @-x % " `L`L E H `L` `Ԑ ''#\#`#h'#d#lx@FԀ <=(''''' H*` ' 'Ԁ < ` ???? ?(?0?8?@?H?P?X?z?  @ "@ 2  ' @>Ҙ쀢 ##<!H@  @ "@ 2  ' @>쀢  /'  @ "@ 2  ' @>쀢 !H@  @ "@ 2  ' @>z쀢 ˰'  @ "@ 2  ' @>_쀢 !H@  @ "@ 2  ' @>B쀢 '  @ "@ 2  ' @>'쀢 x!H@$  @ "@ 2  ' @> 쀢 [      ?  @ "@ 2  ' @=쀢 9 ! +  @ "@ 2  ' @=ʘ쀢 ' '<*`В``*" *  * ''  @ "@ 2  ' @=쀢  ! +  @ "@ 2  ' @=쀢 ԰' '<*`В``*" *  * ''  @ "@ 2  ' @=Z쀢 d`4\ H(   @<)<)G"HE"h<)<)@">" <)<)6"4"<)<)/#-#( <)<)#H#h<)<)## @<)<) # #耢<*<*  (H /* '    TJϔ "H 0'P P  'X'l'T'h?`'\'p` 'tX@;6 2",  @ "@ 2 ` ' @<쀢 `', "#`L|K. <>D''D' H*` @f 7 _ `\  `8В#\#`  #d<=''$?$?$?'  H*`  5l4?# @`''''ﺐx *< @E̔ @D `% d%  D (  <=''$?'' H*` <<#$<0<)#@ :@*` hH /* 'R <0  *@ *@   J 0<)!ȓ+ @ @ "@ """H 01<<0#$`$ : <)*`hH /* 'S <0  *@ *@  Ja T0<)!ȓ+ @ @ "@ "$"H 0Ԁ<='''''H*` 'Ԁ %`T`L  ܒ;`#\   2 Xxܒ;` #\@) b `L  H u` #<``(` `  "# E ``  ?#@ #<ؑH /*'<(#w H p@  H /* '<(`2H 0   3 # ## 3 [ ܚ " ''# ؖ ` $aH $#` '              @F #\̐Ȕ(@E`  I| Ԁ <>D''D' H*` @   1<<0#$`$ : <)*`hH /* 'S <0  *@ *@  I; T0<)!ȓ+ @ @ "@ "$"H 0㽀`0`@``L'`8 `,'   '8A   "   ' @:n   %% % % % % %  H%`T;`#\  H@(`0 ` `L q`H =  @ "@   ' @:+ m%% %  % % % `L%   @ "@  @:  0J '  @ "@   ' @9 1 4 ? $ H`%`T;`#\ @( ` `" `L`L `H" `L `  ''#\#`#h'#d#lx@A <=(' '('$','0 H*`  w '`9<`L  %`T;`#\    x;` #\@'`[``L `H #\( @D  < ` ???? ?(?0?8?@?H?P?X?p?  @ "@   ' @9. p#<!H@  @ "@   ' @9 R /'  @ "@   ' @8 7!H@  @ "@   ' @8٘ '  @ "@   ' @8 !H@  @ "@   ' @8 '  @ "@   ' @8 !H@#  @ "@   ' @8m       ?  @ "@   ' @8L   *  @ "@   ' @8/ q' '<*`В``*" *  * ''  @ "@   ' @8 I ! K  @ "@   ' @7 +'-'<*`В``*" *  * '!'  @ "@  ' @7  /'  '<>D' '(D'$ H*`  z0LuJ `L`\  `8#\#`  #d<=d' '$8$$d$ H*`  % @@ @ D `% d%  D (€  <=' '$$','0 H*`  <='(' ','0'$H*`  `%`T`L  ;`#\   2 Xx;` #\@%H```L 7`H5`u` #<``(` `  "# E ``  ?#@ #<H /*'<(#s H p@  H /* '<(`2H 0   3 # ## 3   " ''#  ` $aH $#` '              @B #\(@A@ذ `  ```( `  " C` `  ?#@ 4<` H /*'<(#s H p@  H /* '<(`2H 0   3 # ## 3 s  " ''# `  #`  '@A `  ```( `  "C E`  ?#@ C=H /*'<(#r H p@  H /* '<(`2H 0   3 # ## 3   " ''# ` `DD#` '@B$ <>D' '(D'$ H*`  @ h  `0``@'`L'`8 `,   'dA   "  ' @5| 2| $$ $ $ $ $ $ l H$`Th;``#\  H@#p  L  `L  H" ?  @ "@ 2  ' @5G| 2A|$$ $  $ $ $ `L$   @ "@  @6  "'  @ "@ 2 ' @5 | |0-4 ?$ H l$`Th;``#\ @#p  ̐ " `L`L  H  `L `d  ''#\#`#h'#d#l@<'d <=''$'' H*@  'd 9`L  $`Tlh;``#\    xlh;` `#\@"Úp  p h`L  H #\ (@?2ld  Q| h   2 0  2  /<>`L `\ `8`p #\#`#d`L" `8#`#\#dv<=Đ#'?'#H*` D''D' H*` @ 0Ԑ Ґd<=('''''H*` d $`T`L  lh;``#\    xlh;` `#\@"!p  ΐ `L  H  h#\(@>l L0 @'8'L,'? 'PB   "   ' @3܀   $$$$ $$$ H$T̒;`#\  H@!ÚЀ  p  L c H" z >  @ "@ 2  ' @3k܀ d$$$ $ $$L$  @ "@  @4:  0@'`$  @ "@ 2  ' @3+܀ $      !  @ "@ 2 ' @3 ܀ 0: L'?` >< # ##4L ``#\#`#d @?  `h  솰  (L  $T̒;`#\  ̒;`#\ @ Ѐ   L  H \ Ĕ 8#\ А L#`#dʖ`<='L''' ' H*`   Ē  @L !)L` $T̒;`#\ `  X̒;` #\%5<>'' ' H*` €(4( "  @ <)<)G"HE"h<)<)@">" $!<)<)6"4"<)<)/#-#( <)<)#H#h<)<)## @<)<) # #耤<*<*  (H /* '   T?є "H 0#<=(?8 '0;Ē`'D'(','4'@'H'L'Ē0'c''?''c`H*` €8 ? " `<=L''''' H*` 耦 Đ''' H*` €耦 o@h<)<#$<0`% : *`hH /* 'S <0   *@ *@ @ T0<)!ȓ*@ @ "@ "%"H 0  ? T $TL  ̒;`#\    X̒;` #\@h   L  H@< FD$T`  X   ̒;` #\ @5Ѐ `e@ T0<)!ȓ*@ @ "@ "%"H 0$#@ :* hH /* 'S  ` * *`   > T0<)!ȓ+ @ @ "@ """H 0Ұ '''`$   `'''`4:Ԡ  Π' $TL  ̒;`#\ `  X  @@̒;` #\@Ѐ  e L Y H"p `c@:`  ```( `  " C` `  ?#@ 4<` H /*'<(k H p@  H /* '<(`2H 0   3 # ## 3 \ ̚ " ''# ` #`  'Ȑ  `  ``(` `  "  '``  ?&@<( ` v  r  ? " '' '@ր r#<<(@7<` &@&` H /*'kr H p@` H /* ' `5 H 0  6``&`&@&`6`Ӓ H /* ' lkA  &`D k9 &`H 0`` (` &`6`&`(&` &`$&`4&`0`  `( l d&` $`` aH`&v q<(@7<` &@&` H /*'j H p@` H /* ' `5 H 0  6``&`&@&`6`[ H /* ' ljɒ  &`̐ j &`H 0`` (` &`6`&`(&` &`$&`4&`0`  `( l d&` $`` & q<(@7<` &@&` H /*'j H p@` H /* ' `5 H 0  6``&`&@&`6` H /* ' ljU  &`X jM &`H 0`` (` &`6`&`(&` &`$&`4&`0`  `( l d&` $`` & q<(@7<` &@&` H /*'j H p@` H /* ' `5 H 0  6``&`&@&`6`r H /* ' li  &` iؒ &`H 0`` (` &`6`&`(&` &`$&`4&`0`  `( l d&` $`` &`<(  q<(@7<` &@&` H /*'i H p@` H /* '``5`H 0  6``&`&@&`6` H /* ' lif  &`i i^ &`H 0`` (` &`6`&`(&` &`$&`4&`0`  `( l d&` $`` &@7q$@``  .  q<(@7<` &@&` H /*'i  H p@` H /* ' `5 H 0  6``&`&@&`6`j H /* ' lhؒ  &`ې hВ &`H 0`` (` &`6`&`(&` &`$&`4&`0`  `( l d&` $`` : '  `v'$& q<(@7<` &@&` H /*'h H p@` H /* ' `5 H 0  6``&`&@&`6` H /* ' lhZ  &`] hR &`H 0`` (` &`6`&`(&` &`$&`4&`0`  `( l d&` $`` $&`''' zIĀ s<(@7<` &@&` H /*'h H p@` H /* '<(`2H 0  `6`&`&@&`6`e H /* ' lgӒ  &`֐ g˒ &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` $`` %<& r<(@7<` &@&` H /*'g H p@` H /* '<(`2H 0  `6`&`&@&`6` H /* ' lg[  &`^ gS &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` $``  <!H&&̀@  )<`&&` ` &@&` )<#$'<0% :@%<)*`hH /* 'R #<0`  * *`  8ޒ T0<)!ȓ*@ @ "@ "%"H 0#$#@ :*hH /* 'S  ` * *`   8 T0<)!ȓ+ @ @ "@ """H 0('D  0' @ L 8'L , ?'''̢0O   "   ' @)   $@$`$`$` $`$`,$`*D H L  ! T;`#\  ;`#\D  H@耤   D`L x H" ?  @ "@ 2  ' @) @$@$`$` $` $`D$` L$`  @ "@  @*^  0'  @ "@ 2 ' @)R 10  'D   L!  ` > < % %%4D`L ``#\#`#d @5  '`h  Ȱ  +D L  ! T;`#\  ;`#\D @.耤 ې D`L  HC D  <=!' '$8"?',L<='0a H*` € D L \ ܔ D`8#`#\  L#dܒ ؚ @L gD`L`a `T;`#\ `-<>' '$'( H*` € (4( "  @ <)<)G"HE"h<)<)@">" $!<)<)6"4"<)<)/#-#( <)<)#H#h<)<)## @<)<) # #耤<*<*  (H /* '   T6 "H 05%<= '?'$'' '' '(','ܒ'Ж̘Ȑ'?''' `H*` €<=a' 'L8 <='''! H*` ܒ''' H*` `ܔ`D  P `-2  #̀  "  "  ̀`3<<0#$`#@ : <)*`hH /* 'S <0  *@ *@   69 T0<)!ȓ+ @ @ "@ """H 0<<0#$`% : <)*`hH /* 'S <0  *@ *@  6 T0<)!ȓ+ @ @ "@ "%"H 0D  `T`L  ;`#\  ;`#\D X@y耤 & D L  H D8@2 " 2ܐD;`#\Ԕ `T h @N耤DD8@2`  ```( `  " C` `  ?#@ 4<` H /*'<(#c H p@  H /* '<(`2H 0   3 # ## 3   " ''# ` #` < ' <  H )<)'<%<0$# :@*` hH /* 'R #<0`  * *`   5" T0<)!ȓ*@ @ "@ """H 0$% :* hH /* 'S  ` * *`  4 T0<)!ȓ+ @ @ "@ "%"H 0 ''Ȁ` "    @ '@'Ȁ`4@:Ȁ  h'D h'  `T`L  ;`#\  ;`#\D@7耤  D L Ȁ H"L D8@1t`  ```( `  " C` `  ?#@ 4<` H /*'<(b~ H p@  H /* '<(`2H 0   3 # ## 3 ݒ  " ''# ` #`  '  `  ``(` `  " ``  ?&@@l<( Ȁ g`"X   Sܔ D     "` ' 2F !! ! ! ! ! ! `D  `! d! `D (€  <=a''' <=L''a H* @    `t  ''D 'Д|@1R%<H ''x': 'p  r't<(@'<` &@&` H /*'a H p@` H /* '`6H 0  6``&`&@&`6` H /* ' las  &`v ak &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` %@`` H& q<(@'<` &@&` H /*'a/ H p@` H /* '`6H 0  6``&`&@&`6` H /* ' l`  &` ` &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` %@`` & q<(@'<` &@&` H /*'` H p@` H /* '`6H 0  6``&`&@&`6` H /* ' l`  &` ` &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` %@`` & q<(@'<` &@&` H /*'`F H p@` H /* '`6H 0  6``&`&@&`6` H /* ' l`  &` `  &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` %@`` & <(  q<(@'<` &@&` H /*'_̒ H p@` H /* '`5H 0  6``&`&@&`6`- H /* ' l_  &` _ &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` %@`` $@@-$ 6 <(. <(  p q<(@'<` &@&` H /*'_: H p@` H /* '`5H 0  6``&`&@&`6` H /* ' l_   &`  _ &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` %@`` $@@-$ @ Ȃ`?''Ȁ@ ܀ s<(@'<` &@&` H /*'^ H p@` H /* '<(`2H 0  `6`&`&@&`6` H /* ' l^v  &`y ^n &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` %@`` %<& r<(@'<` &@&` H /*'^1 H p@` H /* '<(`2H 0  `6`&`&@&`6` H /* ' l]  &` ] &`H 0` (` &`6`&`(&` &`$&`4&`0`  `( l d&` %@`` Ѐ <!H&&䀦@  '<`&&` ` &@&` '<%<0$)<)# :@*` hH /* 'R #<0`  * *`   / T0<)!ȓ*@ @ "@ """H 0$% :* hH /* 'S  ` * *`  /R T0<)!ȓ+ @ @ "@ "%"H 080@'L'8 ,B   " 2   'Ȗ̒Ȕ @ Ā ` `$$ $ $ $ $ $  H$T;`#\  H @  K  `L Y H"X `>  Ȓ@ "@ 2   'Ȗ̒Ȕ @ FĀ >$ $  $  $  $  $ L $   Ȓ@ "@  Ȗ@!  0'  Ȓ@ "@ 2 'Ȗ̒Ȕ @ Ā 0L ``#\#`#d @, 0L  $T;`#\ ;`#\  @   L ̀ H˰ #\  (@* #<=a''Ԑ$?''a H*` €<=t'''ؐ $?t' H*` ''Ԓ($?''a H*` РG  $TL  ;`#\ ;`#\  @   ] L l H"k #\(@* 2` `  ```( `  " C` `  ?#@ 4<` H /*'<(#[ H p@  H /* '<(`2H 0   3 # ## 3 Q  " ''# ` < #`   '# #  㽠`0``@'4`L'0`8 `,PB   " 2  '040 @, h, $$ $ $ $ $ $  H$`T;`#\  H @     `L ~ H"t @4  0@ "@ 2  '040 @, $,$$ $  $ $ $ `L$ 4  0@ "@  04@o  ]04'0`L ``#\#`#d @+) -`L  $`T;`#\ ;`#\  @   / `L  H @) PD <='8'<$'D'H`H*` 8  $`T`L  ;`#\   X   4;` #\ @ 2  ߐ  `L  H @)n 2   4`  ```( `  "  D `  ?#@<H /*'<(#Zq H p@ " H /* '<(`2H 0   3 # ## 3 В  " ''#  `  4  #`  4  5'   ;`@#=;  $$   ;`@#2;  $ $   ;`@#';  $ $  ;  $ $  : $ ($ ,$ 0$  $ $$$  $ $ $ 㽠`0``@'4`L'0`8 `,PB   " 2  '040 @", h, $$ $ $ $ $ $  H$`T;`#\  H @ 6    `L ~ H"& @4  0@ "@ 2  '040 @ޘ, $,$$ $  $ $ $ `L$ 4  0@ "@  04@  0'0`L ``#\#`#d @)g -`L  $`T;`#\ ;`#\  @   m `L  H @' PD  T :  @"-<=!'8'<$?'D'H!`H*B? 8#`#d#\$`T   @ | )@'˜`  ```( `  "/ C` `  ?#@ /4<` H /*'<(#X̒ H p@  H /* '<(`2H 0   3 # ## 3 +  " ''# `   0#` `R@0' "    ,    (    $㾀0@'$L' 8 ,PB   " 2  ' $  @ h` `$$ $ $ $ $ $  H$T ;`#\  H @ š o  `L ~ H"` `@$   @ "@ 2  ' $  @j $$$ $  $ $ $ L$ $   @ "@   $@9  '0 ' L ``#\#`#d @' -L  $T ;`#\  ;`#\  @ L  L  H  @& #<>a'@'DP $?'La H* @@ '@'D $?'La H* @@  '@'D $?'La H* @@ '@'D $?'La H* @@<='0'('4'8', H*` (f  $TL   ;`#\  ;`#\ p @Ϛ | L  H @&  2f  `  ```( `  " <E`  ?#@ =<H /*'<(#W H p@  H /* '<(`2H 0   3 # ## 3 s   " ' '# ` <`!H#` <"  '"" " " " x! ,& T;`#\  @D` x T ,  L& T;`#\  @*`א `2 h D 8`"  0 h    2 04  0  <=@? <=) <=a'xa'|"? H*'' @x <=  H 'x''*'|' @x`  @" nfscn1nfscon sotype㿘 `% P  P  T_ X  P R % \ U @R`H /*'<(#V+ H p@` H /* '<("`2"H 0  `4`$`$@$`4` ` $`  #,,$4*`2 "  4v 0?  %`" ` \ I 90x H /* ! % 8 #<0#<a 6* @W`` "8 2 `" `<@ B  8 <08  48H 00ܑH 0`A<0! *@ 44f4f4 T     ! *  * " <Y, h` "AR`H /*'<(#Ui H p@` H /* '<($`2$H 0  `4`$`$@$`4`Ȓ ` "@ $` ?c  R` 2? H /*'<(#U' H p@`" H /* '<($`2$H 0  `4`$`$@$`4` ` " $`  Δ   !a* *`  '<0d<@a @"4@'4d* @*`% |% % l% % % x% t% p% % % % |%   ?4H p@@0nfscn2㿘 %<*@' #<?  b?A ^  <"`" `2@`$ @"`$@`2` 㿘 P & P X  ????????'@ o@ "nfs send error %d for server %s nfsd send error %d 㿘$ " E P 2 ? @&$ ; &$\ R    " V` @?  `  !< c W$  @  &$<` W ? # 2 short receive (%lu/%lu) from nfs server %s %s (%d) from nfs server %s impossible packet lengthshort receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s `<! &"@` T" P"@ z >` ``$`'  P `@"(`<) t`沔  ` &```H "`$  ?"` "` `@ {"0 @2``@ t"w}x ̔Ш  '''''''?' @ 'Ȑ ؖ  Ȱ # ` #`$  #" 耢  ` <" ah  W+  x *   ! '`< <a W c ' @ 'Ȑ ؖ Ȱ #" " ?" L耢H̀  <` aؔ"  V < !''' "Ā   'Ȑ ؖğĀ`8 # ` #`$ B #瀦 "Ȁ  <X>"  " " '̀ K I?H   &`< bV `@u"   "` `@"* 2 * (    А"@''' 'Ȑؖ Ȱ #`$ 怦 #" " '̀ &nfsreply nil㿀<) t@x % @   ? # \ P2 8$` " ' ` '耊`   '  @䀢 <#,@! 耢 "$!( %!(!(`%!(<"`<"<K!c` 2@` 2@<L @`$` $`X$`!<"!*` * " `4* " `4 *` l| <*d  ?* `:`@ ` :`* `:`@ `   `4*` ?*  `4*` ?*  ` d` $ (`$ "`8"@ !`  ?"@$!4`$@<  @ $$`$ ?$`$$`$  <K`4#*` `* l `8: `#@  `# `4* `*| :`#@@ " $`2^` ` @!$`%!$ $2 $   <U!#x$  is alive againnqnfstry@'D D'H'L!@'T'X    <)H /* '   @ "w "H 0$ D$ <$ H L`$ 4` @`@''܀$&  'Ԣ ` 7Tܖؘ@*  "!Ԓ#\#`Tܘ@*> " 4H0yTP` @ *`*  'H#d#l#\#p#`ܖT#hL@q9<ܢL`(`/<* " TT /` 2  `" 4 `  " `  $`$`  0 `" `` ` $`` ?` "@$ $   eh$ (<K$ ,$ 8c` $ $$ $<)$ `t "H o*@ a$"$ "@"P >T  (@1H 0 \`@  沐 . P`\ @*   $ @ !$ $` $ $H 0 ?$ 8  H /* ! `"  "`""  "H  $` $ $?$ 2   $ < <`@    ' o'   "    'ĖȒĔ @6 2Ű<   <*ah2 -$<*#8 2 `2 PА"@   $  ` T#\@)İ " `Ȓ` Đ " 6   @ْĀ 0u'  Ē@ "@ 2   'ĖȒĔ @Θ ]   Ē@ "@ 2   'ĖȒĔ @ A"?b% #!Fа ж@ -)<*'<  09Ӗ Ѐ <L @ pFbDb X Ȱ @\ @` @R0!Q  @ "@ 2   'ĖȒĔ @V `5  @ D"@  `2   'ĖȒĔ @8 Ű Ш         #\X @\ @` @ <)<#$<0`$ : *`hH /* 'S <0   *@ *@   0<)!ȓ*@ @ "@ "$"H 0   +  h build > MLEN㿈\H /*''<(Nr H p@ H /* '<(`2H 0   4$4$$ <!  ,H /* '<al N7  & : N/ & H 0 (  & 6 & (& & $& 4& 0< "@ &  $ <`X $, $I << $   <*c8.$ $ l$ <*!h $ $ d$#$`L@ `@ޒ *  L<'`@2`<    @e 2d<'l?'p '$ $$ ` (   "  ?   ?$ 48 H /*'M H p@  H /* '<(`2H 0   3 # ## 3   $ &   & ` $ $$ $J KHop Lfj $ $ `"  (    @ "  A&   ?& 9H /*'M% H p@  H /* '<(`2H 0   3 # ## 3  &  &  & `L`` $ h$  $ c$ `$ ]$[$  "  (    @ "  A  ?& 9H /*'L H p@  H /* '<(`2H 0   3 # ## 3  &  &  & `@x$$`L  b  "  (    @ "  A&   ?& 9H /*'L_ H p@  H /* '<(`2H 0   3 # ## 3  &  &  & `L $ $`\ $@   $``S$  "  (    @ "  A  ?& 9H /*'K H p@  H /* '<(`2H 0   3 # ## 3 ^ &  &  & $` 2%`"d "@<)`ta "a not responding㿘H /* !<"  <) t   $ 2 <@) " 8 $ $ $ < $ 8h2"d 4<K#*` d *l@ |  :    : *l@ |  :     <L * @  8 $`4 $`$ $  ,@$  (< <`@F $ $ $ , (@& T  $  $`t$ $ ` dn$ , dk$ ,P`"h?$ 8`l`h`t" `p" 4   &X(2  $ 2@6K沐    "B` ` `   ` ` `   ",?") #"&\ "!4`8  $`"` ,  $ $ d$ , d$ ,:  $!$ਐ $$ $!$$ 8 2  !<*<LD  Ѐ@ ?"D  Ѕ: 0(@(@c3`+  +`@ b 2`* *`B*2*<`<3@ ФB  H`"@8 `8@ 2 HH 0<b<" 㿈`"`$ "  @  )!  nfsndlck㿘 `  `@`<*  !$   @ @'<`Δ & H4ʖ!2<0!  *` @2` @& nfs sndunlock㿘`@2 <Mϐ!`& ?&6nfsrcvlk㿘  ""*# a'<  < " $`p4 a %2<0!  *`!2  !$nfs rcvunlock㿘a2 ~<M"@b& |&5Bad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad P`0`@ `,'"'   " ' ( ' (@  u<$`X8 0   "    ' @  U$`T$`L<"8@  I<" <.   J   " K`  K `2 $`L $`D.  2`L ̒ L`L`` `Ò L2 `D<Lb* @$`D!`L<.`ܐ ? $`L    "    @ C 0'  @ "@    ' @ 8 ` @ P 4`$`$` i  +  @ "@  +   '+ @    `4*"  4`4`T``$@`!1 G   "  ;' @ ̒ 4 0m'<''   0%?  ``&`&` '^ H В`!  ''''?  'ܔ @  <  @ "@   ' @  $  <M"ǒ`  @ "@   ' @ j   <M_"`.a  .a .a .a .a .a .a .a .a .a .a &a.a`L @$`L``&` <M5"|`  @ "@    ' @    <M "T`  @ "@    ' @  ' @'` *   L`:<*`2``<``    @ ` ```2`` <* `h@  `l@ ``pĀ@ `&`h` $`D$`TW @``L  $`L  $`D$`TJ A `D <  @ "@   ' @   `L $`L  @ "@  ' @ n M0  $`\ $`0$`@nfs server %s: %s 㿘 " K<aLKҐ h`0`V I'`$ 沐`n&`0沒 "' 'ԔؖИ ̖ #Ѐ 2` ##`0%   "`8" &`$&`8 "&`  2&` @M 7`0 2&`0 /&`0!沐" '' ԔؖИ Ѐ`Ԁ " `( "&`$" &`("   `#2`0Ѐ א" `$ `0 @nfs getstream㿐 0  <J  % 0 <O 8 4  0 `   ` / * * *`` ?$` $``` 2 @` ` *`` `?$`$`  8? % 8% < 0  0 ?% 0 <ᔀ  0 8  , % % % <% 8  @  <(@? ` @ {" H /*'<(#E H p@ "T`H /* 'T`*@  6@ H p@ `  6 & 6 &&  }`d(1 H /* '<al  E & E& H 0  (  & 6 & (& & $& 4& 0  F @`& `` @"$`$` %  <  @  % <@@ &x`  8% " % 8% < , 0$  , ""@@@ 2@"@ 0 " < (` ,"`% $ ,% ,% (z 0 # % 0 0 # ?% 0㿘& 0 "E 7 $`2`? 7 & $$`& (T`  $<)H /* 'Ȁ   ؒ HF "ȑH 0$ ,$ 0$ <`$ @R  &&a )Ӓ Hnfsd wakeup㿘 0"<!H <<  " ?`$ H D`& D0$ 0 2 <"`& 0""㿘<L`< 4*= <##8<3a"a" nfsrcnfsrv cache㿀 < 2  Xr <, ! /5  X)<2   '< 8* @ r<3<)!`t X @2f  D @2a  !     8@  "U  ! ϒ  ` , ! "` "$$ "@$  <H"2 !a,  )$a, a4 $a4 #`#d#\  ʚ    a4`$a4   & a0  $a0,   ! , ! , !00 2 X<)t8#<<L `bP "8 $ 4J bP$bP$  , !$$ $ $ $ $ $ $ 3<33<3a ! %<`, ! . a !  , ! ` "`   "`"  "`a"  "@ !  @   ! @J H /* '  R <(*` ?2   "(0@  4"`4 `0`4" 0<Dw!l  ",$(    2  "( <( 'D\#H  ! , !$a$ "@" ,  X$  8  `2 ! ! , ! $ 沒`@, ! 8 ? $  D$  X2 ` 8* ` $  X 2  * "`  X 2`@8 @ *`"  X2  * $ ! ``, ! `, !/. 㿘 < h X<`2  < c8*  [<L <L<La"|#< X @2M  D @2H  !     8@  "<  !` `, !b -  X` , ` , ! D*  `" ! L 2  * ` T$  , !沐  !$  , ! !  , ! , !.Đ0 2 X㿘<3!耢"<!` "`  "`"`$`"  4 2<""Pbuild > MLEN㿘H /*'#<(cB H p@  H /* '<(`2H 0   6 & && 6  (, H /* '<al B]  & ` BU & H 0  (  & 6 & (& & $& 4& 0 & D!@a<*hЀ  z 2 <K#D.` А  <K#D.` `  z @   `S      (  "  @&  ?& 9H /*'cA H p@  H /* '<(`2H 0   3 # ## 3 U &  &  &  " P"     (  "  @  ?& 9H /*'cA H p@  H /* '<(`2H 0   3 # ## 3  &  &   & " &㿈 ' `H /*')<(#Aa H p@ H /* '<(`2H 0   4$4$$ ( , cH /* '<al A(  $+ A  $H 0( $4$($ $$$4 $0 <"@$ D$$ `  ```( "  = %@ 48 H /*'#@ H p@` H /* '<(`2H 0  `4`$`$@$`4`~B $$  !<!X $ `` <!Ȁ` <L@`L<L*` "!$!X<La  "a "aa<pa"$@8`$@<"8`$@ `% I$@` $@ ba"$@b`  $@``$@<L"|. $@`$`$@u "(  @ "  F$   ?$>H /*'#@E H p@` H /* '<(`2H 0  `4`$`$@$`4`}  l($<C̐# $  $ $@@`$@ `$@ `$@? ?`$@ ` ,  $@`<(   (      ?e H /*'#?֒ H p@` H /* '`6H 0  `4`$`$@$`4`}7 (,$H /* '<al ?  $`} ? $`H 0` (` $`4`$`($` $`$$`4$`0$$  "  ( " ?$8 @  &$ @t "$ 6 ,  $  "(  @ "  A  ?$ 9H /*'#?0 H p@` H /* '<(`2H 0  `4`$`$@$`4`| $$  $ `\ $@\$`<(   (      ?e H /*'#>ڒ H p@` H /* '`6H 0  `4`$`$@$`4`|; (,$H /* '<al >  $`| > $`H 0` (` $`4`$`($` $`$$`4$`0$$  "  ( " ?$8 @  &$ t\` ?"  6 ,  $ $`$@dh$ (l%`%`"@㿘  "@ "Q ` $^ @ 2 X @`+0"M H "@` @ S`-`< ` B#$@>`&`$`ߪ@@`8@``?&`&@"@@"@"&4`&&6 @!&㿘m@`? ?" <( `  ``(` `  " `  ?$@ rH /*'<(#= H p@` H /* '`5H 0  `4`$`$@$`4`{  ",$` H /* '<al =p  $`{s =h $`H 0` (` $`4`$`($` $`$$`4$`0$` %`  `(` ``  " ``  ?$@    @ t` -` $`  <  @ C"$> & `&@""J"`$]``  ``(` `  " @  B`  ?$@@9 H /*'<(#< H p@` H /* '<(`2H 0  `4`$`$@$`4`zP $` %``   6` *@`` $` &`  &'@ 㿘@ 2  &  0 8& " H /* '  0@ 4"`4 4 0"0< =G!l   ( $P ,$( ?4H p@a  z  $` $`  $$`$ ($`( ,$`, 0$`0 4$`$`4$` H /* ' ` @4` 0$`4$`0$ 0`0" 4H p@ H /* '  0@"  4"`4 4 0"0 < <!l    ( $   , $ ( ?4 H p@$@$ $ > H'9&@ @$  $  ?4 '  l@&@ `` 8 `@  $ `` @"$`$`   l@ @ H   "   H &" "@㿘       (    "   ?% ?@"@ ` %    @ ǔ &% <( H /*'<(#;t H p@` H /* '``5`H 0  `4`$`$@$`4`xՒ l(,`H /* '<al ;?  $`yB ;7 $`H 0` (` $`4`$`($` $`$$`4$`0`  `( l d$` %`  "@` `?$`   `    ?"@ @ :&$` x&` ` &@ ;``  J@`#㿘 D !@<* $`l$`p @ I T $`($`<`<$`@  <)H /* 'Ȁ  ! I  $`T$`T"ȑH 0`T @!㿘 1<MA!h4` ?;  `(<*`( *  & : ' % 2  $?> `l& $&`l& ( 2 0 2    2㿐  D`( a@u1<M!h  W $?R 2   2  ( ` "`$`@  "@ ` "`  "<)<<0$& :@*` hH /* 'R <0  * *`    I0<)!ȓ*@ @ "@ "&"H 0  `(* 6@<)H /* '   0 I  "H 0@@ `T*  ``" `T @  "@ ?+*`@&  `\`l& $ $`l& $>> `]& (`p"IH `<`<)`<<0<0`"``$`@``"@```"```"$#@ : * hH /* 'S   * *`    X I0<)!ȓ+ @ @ "@ "#@"H 0$`p &  "`$& & `@ & `@"@$`@㿘  D (`!@@`" < <`I`)<)'<%<0#<0```"`$ @``"@```"```"$#@ : * hH /* 'S  ` * *`     I0<)!ȓ*@ @ "@ "#@"H 0 <`2``A$ p T`=<<0#$`#@ : <)*`hH /* 'S <0  *@ *@     I0<)!ȓ+ @ @ "@ " T" T"H 0  `?#`$``2#`$ $ l㿘<0a <*?a% ⣘ I <' <<."7<"#<)<+<-</<1<*3<*5<.%<'<$b8 d# &%"8%c,%%&!h&c8&$H$@ʒ !< $"$"@Y <K0 2<<<K# <Kc<<K4 c8 0<b"b" !<+<! /ޔ $ 0<""""`좐 㿘<<!xa *"@"{N㿐 D D@@` ` "  T  @㿐D@@"<L@ * `'*``+`D@ `H'`%'@<L aԑ* @``< @ <<"Г2`  `4`8' `*`" *  * ''`2h?" h'`$h<#$Hh? <cD$H" <$ $$ $H$C$L&$\H o& & L&& 4& 8D``+& ` & ` & `& ``     @ > "& (``      @ > P`8  & `<& ,`@& 0`L& <`P& H& @.> X` & ` `& `& ` > "`& (` *  :> P`(& `,& ,`0*`" *  * & 0& 0& H`<  & <& @`@> X& D  2 $@!<* 2 z  8 2   $@( >  < @ ~ <*<<* Ѐ.$X> > > > >  (>( 0>0 8>8 @>@ H>H P>P X>X `>`z$!" &,$&0z"&4&8 㿘 '<*`X`z" В `\@A" В @:" < ;В @3" <)`t<) `t<)`t`  ["``t "`t`H@ 2 $`@"! 2 `z  8 @2  ` $@( @<  <@@ @ <@>@ >` >` >` >`  (>`( 0>`0 8>`8 @>`@ H>`H P>`P X>`X `>```z$!"` &`,`$&`0`z" `&`4`&`8 @'<)H /* '耢  " T @"H 0'<=c'c"   '''''''?'#? H'''ė*' @耢 $ c7<$5<0$@ :@3<)*``hH /* '1<0R  , * @  T0<)!ȓ*@ @ "@ "$@"H 0`$#@ :*`hH /* 'S   * *`   Ғ T0<)!ȓ+ @ @ "@ """H 00& &`@ :  @@&@u  q 7<`$ ޔ7<$5<0$@ :@3<)*``hH /* 'R 1<0  * *`  y T0<)!ȓ*@ @ "@ "$@"H 0$#@ :*`hH /* 'S   * *`   L T0<)!ȓ+ @ @ "@ """H 0H`$\l(%  @<)<)H"HF"h<)<)A"?" <)<)7"5"<)<)0#.#(  <)<)#H#h<)<)## @<)<) # #耢<*<*  (H /* '     $`$`"H 0@ @ `@"@ "] H " *`:  2, /2,K `  @, ?'@"& & 2<0h#\#`#d @ #<`h    `"$`%<)H /* '  $  @"H 0`K : `  4 <)<#$<0`&@ : *`hH /* 'S <0   *@ *@   0<)!ȓ*@ @ "@ "&@"H 0<`_<)*`:  %2T,K   K   K ` ? @$?А?K ``* ?`@$?А?ɐ *5 <#$<0`&@ : *`hH /* 'S <0   *@ *@ ƒ 0<)!ȓ+ @ @ "@ "&@"H 0_<  K ,<)<#$<0`#@ :@*` hH /* 'R <0  *@ *@    0<)!ȓ+ @ @ "@ "`"`"H 0$`` $ $$<#h$ $ `J`/"'d ~ $ >`!$`d$`4 24@@ `@d$`&  <>''' H*` "  `$  1<><)H /* '  $ i @"H 0` $   '''''?'''''` "?'  H* @ 7 <<0#$`&@ : <)*`hH /* 'S <0  *@ *@  ʒ 0<)!ȓ+ @ @ "@ "&@"H 0c<2Ȱ  #İ ?(9`@@<)<#$<0`#@ :@*` hH /* 'R <0  . *`   0<)!ȓ*@ @ "@ "`"`"H 0$`*@$`'J /2   `4' 2`4`$`$5 "`<#$<0`<)#@ :@*` hH /* 'R <0  *@ *@   7 0<)!ȓ+ @ @ "@ "`"`"H 0     1"  + ( 0$ , " "   (  #2" 㿘\`@X` "``(` `` @ "  B<`  ?$@ :H /*'<(#1Ғ H p@  H /* '<(`2H 0   3 # ## 3 o1 $@ `$`  <!$` #@h` "``(` `` @ "  <B!H`  ?$@ :<H /*'<(#1| H p@  H /* '<(`2H 0   3 # ## 3 nے $@ `$`  <!H$` #@   `#@$#`4`#@8#`<`#@@#`$'@@㿘`X` "``(` `` @ "  B<`  ?$@ :H /*'<(#1 H p@  H /* '<(`2H 0   3 # ## 3 nf $@ `$`  <!$` "[ ` "``(` `` @ " W XB<`  ?$@ W:XH /*'<(#0 H p@  H /* '<(`2H 0   3 # ## 3 n $@ `$`  X<!H$` "@ X&'㿘`&` & `& L 6<L@* &` /&`  &`$&`P? &`T& `L 2 &$`L @ `3  &(&,`&4&0`&8`,&<`0&@`4&D`8&H`<&L`@F&P@<La* @&@`<<<<# ` *`# ` &`$&`(&@ 2`L?&`P*2 @ 2 & `&$`&(`,&,`0?"&0@M#&0`4&4`8?"&8@D#&8`<&<`@?"&@@;#&@㿀\&`@x  d  <b b V 2 d F8 2[ $  R  ` ` `# `*0"17    &&S   * #@ S 6  $$` <>''' H*`   J  (J 㿘   0!  @@ @`   `@G`   H( D2 `` T`$``$"`$2DH L`T D<M (P  R  R  P?# @ <L  + ? *@ :* *   㿘 @ P 6@  &` &` 6` V  ` *#@V *V` Ɛ0 !: ) D@'''''O   ???' D`'d' D( `o nfsd init㾘 !: O<bԀ "@ '<3#<"ԐД$"Ԓ c "Ԁ "@ !@.1`9 , D''''' !0 " D <a@ "``@ @ `$" `~@  `  ] `'  @ܰ` | @ À   `0 "@@ *  L    @2  <      o     2   <M!`@ 6 `0 $`@ | 3 `0  ~ 3{@ ` ` "`   "` "`$`  "  l  $  @ϔ PT $ 4 $ 4 l<*$ lp$ pt $ hx4 x < "$  `   $ ` $ 沐 $ Ḕ< m= $ $` $ ` "@$` @Y *  L` $ @P *  L " @H * " L@B *  L@$ Ḑn`L @"L@ " `"` $`@ ? 㿘  R   <# 2 T<"`0`"Tl@԰    !!|Δ "Tl/0À 2@ H /*'<(#, H p@  H /* '<($`2$H 0   3 # ## 3 jJ   "@ ?# c y  `2CdR 2?dH /*'<(#, H p@  H /* '<($`2$H 0   3 # ## 3 j   " #   yK d4f  ?4d4`4! 2  @:!$``$` $@<3$`"@"$`$`  4 $`H o*@ad< a4d$$ $`0TH p@ nfsdmbuf siz=%d Bad nfs svc reply㿐'H'L'   H /* !  ! 4H ' @!L%!%<H% "@"!<M! $!L<*`̐  `   `2= #<b `!<M%<  !`% $!!u !? $! `b " `2 < <3!Ѐ 0 ` "D202  ?" " 0`Z` %<*@ː  $0$D% ` 4$0H 䧔 w\С:4`,  ,``0( (b2* <**`К@`C3`+ ` +`<B  H`" @ 8  2 ` 8      %   0   "B 0 H='H 0   `V4 s%<*Р# ``` < # d# 8  ' ?% 8 `'  ' \!' d `   2  h!! 2 H |   L`̰ Q? `S<Mᤀ <K c0 <M! <K#!8@#c0"ᤀ  L 2 D  !# T# D<M "a   %   "T"D <) tR(`%`2! `D 2`D<K#` <Mᤀ 2 `D! `D<LH*`  !  D  a 'a R < 0<) Da +`@  B @ # ,  %<L  @a   <  /< . $ -$   2   " 4    "    " " i  "    "   $   @"@`Ԓ 0  <ս iQ @ @h <"G ,H /* 'R <(`*@ ?2@  < `(#<( 0 ` 4"4 <`0`4" 0<*!l ",$(<  ?2<"`( <*cH  ,  h `@ސ` ߛ ?! H@tH o*@a<L @` @ h ,`<h`5%<*<<0#$`#@ : <)*`hH /* 'S <0  *@ *@   [ H0<)!ȓ+ @ @ "@ """H 0'Ѕ: 0(@(@c3`+  +`@ b * 2`<**``Ж`B2*`*<`@ B H * H` @   2 `    H 0`\H /* ! ܔ "   % @%  L`̐? ``!<M "` <"!L "@H ђ 4!'$!@Đ 㿘 0  ? & 0 & d 2d""u@ i  `EH /* 'R` <(*`@ ?2@   "(<(0@  4"`4 `0`4" 0<)u!l  ",$( }   2  "( <(#)\ H g g $  ! ` "`   "` "`&  " g H 3`2 H /* ! H  $$ $ $"@ . H 2 & HH 0㿘 D? & D 0 `"  "`<3"! "  2㿘'<Ԁ <+А#  "$#<3aЀ a 0 )` "`$ " 2 22a$a<""#<3a$a& "Ԑ `%"Ԓ $ݐ<!H"!H"`<⼐! "⼒ 2 !<$# @!#`"` "`aД "a" & #a$a" #<ܐ! 2 $b @!b" "" " "@b$ 㿘 <!h!h((     2 L@ @ L@" D@ @ D ` 82 ` `5<*к `&.  `( d Ѕ(`&@( ` ` `h   !!hnfsidl㿘3<al ? *`" **v  al"+<Nb`̐ `%b`%;/<"@a?6$aa耤 2%<M ` "`$a  "@aTa 4ab`* : *` 4a a $@ \ `c  "aa ͒a耤 2 <<ڤ!ax<a?$a$8$!  ` a耢  뀤` `a?$a"b`%̐al"%b`nfsauth1nfsauth2㿘" \ `%#<<0! @&"*  Jbp`<@ 2@"" * &"! Tڔ &!& & &  & & " ;<5<0  ė* b`<"  *&" P "  V T"*@&"' % , , , ," 7$ &"* &"K 㿈` ?@M*  쀦`"!<*` ```2``!<*`h Ѐ@6@? ``"`& `@"&@ &` "&   TX  "`t & &" '`l``Ѐ    Ѐ 2 `p``p@  &`l`&`p &`p`l '`p'' '' x @'\ '   " 2   ' ,܀ 2~%<*''蒢@ a,q<M! 6   &  | 3 ` "`  "`"`& "@&`&А'&h&l&t&p.x.y.z.{& & "@& `@ ?*  쀢` &`@ ?*  " `@x ?* " `@r ?*  &     " &  ' 颒 d''@nfsbuild > MLENp@' "Lh `L 5`  <)@<)`t` "`  D №' S x ` ?` ``(` `  " $ pS x``  ?$@4hS x  ```( `  "  H` `  ?#@$A` H /*'<(#$ H p@  H /* '<(`2H 0   3 # ## 3 b?  l(<(g p " ''# ` ?#`  @R`x'#@` #?  RxdD D _0?` ``(` `  " D` ``  ?$@ 4<` H /*'<(#$p H p@  H /* '<(`2H 0   3 # ## 3 aϒ  " ''# `  ` #`   D'@v#\#` К谒 " .*'  @ "@ 2` ' `ܖ  @  ؒ뾖  ؀ 耢 b䀤  @ "@3䀢 2 䀤4''  4 ܖ w 6@6` 8 P&`"&`        aB + 3`  ; &`      @   aB + 3`  ; &`     @   aB + 3`  ; &`     @ &` $     @  &`&`&` &`&`&`&`@@ `L@ Z`@ Z`<@ b~ɐp<)`t` "`  D࢖`S x ` ?' ```(` `  " $ rS x``  ?$@4jS x  ```( `  "  H` `  ?#@$A` H /*'<(## H p@  H /* '<(`2H 0   3 # ## 3 `_  l(<& p " ''# ` ?#` `@R`x'#@` #?` Rx@D  D  #\#` J찒  .'  @ "@ 2` ' ܘ  @  ܒ: w t  @ "@/ 20 ' 0岘 [  !! >$ @ ` ~ $$ !! >$@ ` ~ $$ !! >$@ ` ~ $$ ?<     @ " 8 <2 (< $a6/root on %s nfs_mountroot: getattr for root<!<@ Z <*`Ѐ ;! <"`А!   @!`I C<a tp@S 4<!' ht<<#D""#D@ 2##D"t#D" <p ""` `<=p'x'|"?'' H*` x <%M!@? `4q nfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d 㿈< h<M8a ?"8" _  2 <#%    @$ #\ D@  @|"@<#&' 0&nfs_args: retrying connect nfscn3㿘H /* !`  ` ?&``"  2 *&`  @   @  &H 0 ``""``,!<0#<! @Ab@0 @; ! & db@6  d *`& d" * 4& d` " ``0  d& h d& h` b`  `" `  > & "&   @   @&  4& ` " `$  > & "&   @   @&  4& ` @``(  >!& "&   4 &  `"  &  4& `  `4  4& ` `8  4& ` `<  <4& `"  T`@  $&  T`   X`@"& T & T`  P & X˫ T`%<#<* !<%y`    Ԓ 8 H 2W " 8Q K@@!@ 2G ?`#  '’9 ĒȀ 22P Y 2( Z$@췒  Y 2 $@쩐@zؖ  2 '#\@`8@@\^ <)H /* '  " ה @"H 0 @l"&a@$``$`$aa$a<`h$` !" &`< "2<0 ?#<= Dx''x H* @ 2 T ` " T>  bt'''''bt H* @؀ 2\ T 2 D -㿘`)  % -`2!L& !K!L& 1<) t&!L  aL     t!L     -㿀  t#\#` ̬  .]5build > MLENpD!@@j<)tP"P  HHS x ` ?' ```(` `  " $ rS x``  ?$@4jS x  ```( `  "  H` `  ?#@$A` H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 [  l<!-! " ''# ` ?#` @R`x'#@` #? Rx@D  D᱒ ʐ`  ```( `  " C` `  ?#@ 4<` H /*'<(#5 H p@  H /* '<(`2H 0   3 # ## 3 Z  " ''# `  #`  h@ `` '􀊠2 2   #@2 2 #@ #\#` ˄찒 R .'  @ "@ 2` '  4 @  ܒt & ܀ "  @ "@ 2` '    @ 2 [ "0@S  D 8` h       D h  @`" !4<* `h $@  @ 6  i !" 2``@2  `` @2 `z "p   X%  k @J`a<``z -   X  "Z @9$`X h  <=̒   <`<=!'x '| "?''! H*` €x :2$`\<=!'x'| " !'' H*` €x "`\"Ā@" h 2  ⓒ   <`   WŘ    @$`\!"$`X 㿘  h $D!@@a z b     @Oe  z 4 z   W $ X z  ? t4 z x Da@`z # "$3`z 䅐 <)' `t`D  "`D  D ۖ 'S x ` ?` ``(` `  " $ oS x``  ?$@4gS x  ```( `  "  ?J@`  ?#@B?H /*'<(#7 H p@  H /* '<(`2H 0   3 # ## 3 X  l(<! " ''# ` ?@#` Rx'" #?RxdD DE _0` ``(` `  " D` ``  ?$@ 4<` H /*'<(#Ȓ H p@  H /* '<(`2H 0   3 # ## 3 X'  " ''# `  ` #`  D'@  #\#` (찒   .  '2  h   `(!""`(Y㿘   H?` - 2`D ?2`D ,?2 `D 4?2`D ?" `D 8`  ?2`h $?"O 4`h?`%<!*` €u,u4u4uu4u4j  4? ,?  ? ?X ??<< `D 8`O   @@   $   U   3  H: <?2`h ,?"`h    UŘ  2  @  ?2H $? H:` <@p D<)a@tH  "Hb  D`  < `' S x  ?` (   " $ `pS x  ?$4hS x`  (  "  H  ? $A H /*'<(#\ H p@  H /* '<(`2H 0   3 # ## 3 V  l(<! " ''# ?  R`x' #? RxdD Di _0 (   " D   ?$ 4< H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 VK  " ''#  `   D'@`f`?]  (  " D#<  ?  <H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 U  " ''# #< aH  ' `'<Y   (  " D'<  ?  <H /*'<(#1 H p@  H /* '<(`2H 0   3 # ## 3 U  " ''# '<   ' ` ?^ #<(  " E   ?  <H /*'<(#Ӓ H p@  H /* '<(`2H 0   3 # ## 3 U2  " ''#  aH  ' ` Y   (  " D  ?  <H /*'<(#y H p@  H /* '<(`2H 0   3 # ## 3 Tؒ  " ''#    ' `?^ #<(  " E   ?  <H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 T{  " ''#  aH  ' `Y   (  " D  ?  <H /*'<(#’ H p@  H /* '<(`2H 0   3 # ## 3 T!  " ''#    ' ` ?`$?"c #<(  "  E   ?  <H /*'<(#a H p@  H /* '<(`2H 0   3 # ## 3 S  " ''#  aH ' `   `$X   (  " D  ?  <H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 Sb  " ''#    ' `,<* Ѐ _  (  "  C  ?  4< H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 S  " ''#   ' `, `0   (  " E   ?  <H /*'<(#G H p@  H /* '<(`2H 0   3 # ## 3 R  " ''#   ` 'Y   (  " D  ?  <H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 RM  " ''#    ' `4<* Ѐ _  (  "  C  ?  4< H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 Q  " ''#   ' `4 `8   (  " E   ?  <H /*'<(#3 H p@  H /* '<(`2H 0   3 # ## 3 Q  " ''#   ` 'Y   (  " D  ?  <H /*'<(#ڒ H p@  H /* '<(`2H 0   3 # ## 3 Q9  " ''#    '   (  " D  ?  <H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 P  " ''#    '   (  " C  ?  4< H /*'<(#+ H p@  H /* '<(`2H 0   3 # ## 3 P  " ''#  ` '<*  h`<<<<# @ *`#  $` ?2$ <* $ `?2$ <* $ `$$ `,$ `0?"$ @#$ `4$ `8?"$ @ #$ #\#` [찒 "`r .``  @ "@ 2 '  T #<aH@  @ "@ 2  ' Θ 6 '  @ "@ 2 ' մ   ܒ  'ؒ  Qw   D`!@ @   &D 8`"h@? ٰ h հ 'Xxܔ a  2`<=` 'x'|"?''H*` €x  d@  zXA"`d @4  44’  22& @+`<=` 'x'|"?'' H*` €x   `@ <) t `" @ w `(%`r z\&<) t   L`" " L`` $ H  t`'pS x  ?` (   " $ `pS x  ?$4hS x`  (  "  H  ? $A H /*'<(#f H p@` H /* '<(`2H 0  `4`$`$@$`4`NŒ  l<!p"`'p't$` ? t@R`x't#@` #? RxdDp Dst _0 (   " D   ?$ 4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`NU p"`'p't$`  ` t D't@pO, ? `(  " $  o`  ? 4g`   (  "  tJ?  ? AtH /*'<(#{ H p@` H /* '<(`2H 0  `4`$`$@$`4`Mڒ  l<!p"`'p't$` t? @@ 't#@` "?` @x `pԉt `h` d#\#` ɚl  . +h'\  d@ "@ 2h` 'dhd Y` lw `@ q\hd׷ li f\`$   d@ "@ 2h` 'dhd .` lL `@  @hlB Hh   d@ "@   @  'd hd ` l' `@ X  R`x2 D`D@ܤ 2DlNа 0IRږX X`S Lh'T  d@ "@ 2h` 'dhd ̘` l `@  Thd* lܰ Th'P  d@ "@ 2h` 'dhd ң` l `@ Phd l 'LLhd l L&lNd `h%`R`x2D`D@& 2D4  44R[X XNGl0 L`Th'H  d@ "@ 2h` 'dhd J` lh `@  Hhd֨ lZ Hh'D  d@ "@ 2h` 'dhd !` l? `@ Dhd l1 D'@@hdr l$ @@  "``(%``@"&@ X 2 &XH <vZ"`&lM 9  `@ @  d H 4"d v< "@@   D`8 ?  `(%`㿘 `h 2      D* 㿘 `h 2      D pD<)ta@T "Tb  D ˁ'S x ` ?` ``(` `  " $ pS x``  ?$@4hS x  ```( `  "  H` `  ?#@$A` H /*'<(# ݒ H p@  H /* '<(`2H 0   3 # ## 3 K<  l(<d! " ''# ` ?#` @R`x'#@` #? RxdD D _0` ``(` `  " D` ``  ?$@ 4<` H /*'<(# m H p@  H /* '<(`2H 0   3 # ## 3 J̒  " ''# `  ` #`  D'@s#\#`` ͚찒 "^ .)'  @ "@ 2` ' ] ? @  ܒԻ 1 .  @ "@ 2` ' 3  @ H ΋䖒  KpD@=  aB@ "   a  K0Kڰ H0Kְ 0<( <)`t`X "`X` , P 'S x ` ?` ``(` ` @" $ `oS x``  ?$@4gS x` "( @"  ?H  ? $? H /*'<(# G H p@ H /* '``5`H 0  2"""2I  l(<А! "''" ? @R`x'#@` #? RxdD DV `K00R` ``(` ` @"  B ``  ?$@ 4: H /*'<(# ג H p@ H /* '``5`H 0  2"""2I8  "''"  `  D'@ "( @"  C  ?  :H /*'<(# } H p@ H /* '``5`H 0  2"""2Hޒ  "''" 􀥠 `   ': #@ #`#` #@`#`#@#\#` ՚찒 " .?'  @ "@ 2` ' e o@  ܒƖ d܀ Z  @ "@ 2` ' A K `'ؒҢ @  @ "@ 2` '  )@`  {䖒 I% 2      <)nfs: writerpc iovcnt > 1pD'L!@'T'P` b    <,B#T @``= B 8̰ İ  I PI PP<( 7<(<)`t`\ "`\  ?` 4 X Ƕ`'S x ` ?` ``(` ` @" $ nS x``  ?$@4fS x "```(` ` @"  ?G`  ?#@$>` H /*'  H p@ H /* '``5`H 0  2"""2Gs  l(< ! "''" ` ?#` R`x'$ #?RxdD D! ``H P` ``(` ` @"  A` ``  ?$@ 49` H /*'  H p@ H /* '``5`H 0  2"""2G  "''" `  ` #`  D'@ת`c` "```(` ` @"  @` `  ?#@ 49` H /*' G H p@ H /* '``5`H 0  2"""2F  "''" ` #` `  '; $` $  $P @$ \$` "```(` ` @"  B `  ?#@ 49` H /*' H p@ H /* '``5`H 0  2"""2FG  "''" `  #` `  '$ $ $ $Җ -`L#\#` ?찒 "`ۀ` .   @ "@  2  ' Θ  <!H@"  @ "@ 2  ' ˲    \@ `?'  @ "@ 2  ' ˑ   ܒ ܀ a  @ "@ 2  ' h  6@%" "@ ;` `` b >`&`   2 "  % %%ؒ@  T  @%  %'ؒύ \؀ H`4" \F쀦 P%W<)P  @&`X D!@  ` "L <>D''D' H*` Z -%<*<)tl`"l  ? 0 T` `< ' S x  ?` (   " $ `pS x  ?$4hS x`  (  "  H  ? $A H /*'<(#< H p@` H /* '<(`2H 0  `4`$`$@$`4`D  l< Đ!"`''$` ?  @R`x'#@` #?  RxdD DI䰒 _0b (   " D   ?$ 4< H /*'<(#̒ H p@` H /* '<(`2H 0  `4`$`$@$`4`D+ "`''$`  `   D'@ E ?  ?` (  " $ `p  ? 4h`  (  "  H  ? $A H /*'<(#O H p@` H /* '<(`2H 0  `4`$`$@$`4`C  l< א!"`''$` ? @'#@` " @K  \䰒 w  (  " C  ?  4< H /*'<(#ߒ H p@` H /* '<(`2H 0  `4`$`$@$`4`C> "`''$` <L  *` `'#@^  (  " D<  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`Bߒ "`''$` < `H  '#@%<Z#`  (  " D%<  ?  <H /*'<(#$ H p@` H /* '<(`2H 0  `4`$`$@$`4`B "`''$` %< `  '#@  (  " D  ?  <H /*'<(#˒ H p@` H /* '<(`2H 0  `4`$`$@$`4`B* "`''$`  `  '#@  (  " D  ?  <H /*'<(#s H p@` H /* '<(`2H 0  `4`$`$@$`4`AҒ "`''$`  `  '#@  (  " D  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`Az "`''$`  `  '#@,<* Ѐ _  (  "  C  ?  4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`A "`''$`   ` '#@,`#@0#`  (  " E   ?  <H /*'<(#_ H p@` H /* '<(`2H 0  `4`$`$@$`4`@ "`''$`   `` 'Y#@  (  " D  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`@e "`''$`  `  '#@4<* Ѐ _  (  "  C  ?  4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`@ "`''$`   ` '#@4`#@8#`  (  " E   ?  <H /*'<(#K H p@` H /* '<(`2H 0  `4`$`$@$`4`? "`''$`   `` 'Y#@  (  " D  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`?Q "`''$`  `  '#@?   (  " C  ?  4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`> "`''$`   L` @ '2`#@L? 2  ~#` %<*(  " D   ?  4< H /*'<(#2 H p@` H /* '<(`2H 0  `4`$`$@$`4`> "`''$`   `'<<#  <<#*`  $$ $ $ ,$ 0?"$ @*#$ 4$ 8?"$ @!#$ ؐ#\#`  rܰ @ . ǀ  Ԓ@ "@ 2ؚ` 'ԐؒԔ Ж  @ `M$  Ԓ@ "@ 2ؚ` 'ԐؒԔ Ж  @  @ H    Ԓ@ "@   @  'Ԕ ؒûЖ ٰ  DC̖ ϰ  L5  Ԓ@ "@ 2ؚ` 'ԐؒԔ ÔЖ  Ѐ`"@@   Ԓ@ "@S  Tؒk T  'Ԁ`'Ȓؔؖ  Ȁ``"}:  @/F  Lq  Ԓ@ "@  2ؚ` 'ԐؒԔ ;Ж Y <@H@%  Ԓ@ "@ 2ؚ` 'ԐؒԔ Ж : Ѐ`  ` \@ `?'  Ԓ@ "@ 2ؚ` 'ԐؒԔ Ж  @  ؔV  `> `<| <@gE'<#$<0<)#@ :@*` hH /* 'R <0  *@ *@   ? 0<)!ȓ+ @ @ "@ """H 0 `z` 2`z " X|j㿐   |]h'D @  @ b  es`` 2(<)t```"`   ? ( L`` `< ``'S x  ?` (   " $ `pS x  ?$4hS x`  (  "  H  ? $A H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`<  l<D!"`''$` ? @R`x'#@` #? RxdD Dɒ _0a (   " D   ?$ 4< H /*'<(#L H p@` H /* '<(`2H 0  `4`$`$@$`4`; "`''$`  `  D'@R  =B ?  ?` (  " $ `p   ? 4h `  (  "  H  ? $A H /*'<(#ϒ H p@` H /* '<(`2H 0  `4`$`$@$`4`;.  l<W!"`''$` ? @ '#@` "  @  ` ܒ v`  (  " D  ?  <H /*'<(#_ H p@` H /* '<(`2H 0  `4`$`$@$`4`: "`''$` 􀎨 `  j' #@`%<(  " D   ?  4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`:b "`''$` <*  b``'``#@`Ȑ $i#@#@`?_1< %<(  " E   ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`9 "`''$`  `H  '#@`Z#`  (  " D  ?  <H /*'<(#= H p@` H /* '<(`2H 0  `4`$`$@$`4`9 "`''$`  ` ! '#@  (  " D  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`9D "`''$`  ` ! '#@  (  " D  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`8 "`''$`  ` ! '#@  (  " D  ?  <H /*'<(#5 H p@` H /* '<(`2H 0  `4`$`$@$`4`8 "`''$`  ` ! '#@`,<* Ѐ _  (  "  C  ?  4< H /*'<(#֒ H p@` H /* '<(`2H 0  `4`$`$@$`4`85 "`''$`   ` '#@`,`#@`0#`  (  " E   ?  <H /*'<(#y H p@` H /* '<(`2H 0  `4`$`$@$`4`7ؒ "`''$`   `` 'Y#@  (  " D  ?  <H /*'<(#  H p@` H /* '<(`2H 0  `4`$`$@$`4`7 "`''$`  `  '#@`4<* Ѐ _  (  "  C  ?  4< H /*'<(#’ H p@` H /* '<(`2H 0  `4`$`$@$`4`7! "`''$`   ` '#@`4`#@`8.#`  (  " E   ?  <H /*'<(#e H p@` H /* '<(`2H 0  `4`$`$@$`4`6Ē "`''$`   `` '#@  (  " D  ?  <H /*'<(#  H p@` H /* '<(`2H 0  `4`$`$@$`4`6k "`''$`  `  '~#@ %<<(  " D   ?  4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`6 "`''$`  @ `' ` *`` <* $$ $ $ `,$ `0?"$ @«#$ `4$ `8?"$ @¢#$   #\#` 찒 @ . ǀ`  @ "@ 2` '   @ `M`$  @ "@ 2` ' a  @  @ H    @ "@   @  ' < ٰ D;%ܖ ϰ  L`5  @ "@ 2` '   `"@@   @ "@S  T T  '䀤`'ؒY  ؀``" t    @&  ` Lq  @ "@  2` '  Y %<@H@%  @ "@ 2` '  :   ` \@ `?'  @ "@ 2` ' y  @  Вז  Ѐ 6B `  # t(    =  < @^"<#$<0 <)#@ :@*` hH /* 'R <0  *@ *@   Ȩ 0<)!ȓ+ @ @ "@ " " "H 0`z  2`z" XsӐnfs_remove: no namenfs_remove: bad v_usecount     $<@>#(T4`4h<@7#@ `= ( 0<=  'x'|"?''H*` €x 2( ((^   2J `   @S `"   < <@% <#$<0 <)#@ :@*` hH /* 'R <0  *@ *@    0<)!ȓ+ @ @ "@ " " "H 0$Xs:s8㿘   @ pD<)t!@p ?`"p"  $ H L`'S x ` ?` ``(` `  " $ `pS x``  ?$@4hS x`  (  "  H  ? $A H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 3  l(</! " ''# ? @R`x'#@` #? RxdD D _0o` ``(` `  " D ``  ?$@ 4< H /*'<(#8 H p@  H /* '<(`2H 0   3 # ## 3 2  " ''#  `  D'@>4/ ? ? `(  "  p  ? g   (  "  I?  ? AH /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 2  l(<D! " ''# ? @ '#@`@ " @º ˒ #\#`  찒 "`6z .`q  @ "@  2` '  Y <@!H %  @ "@ 2` ' { :  ` \@ `?'  @ "@ 2` ' W  @  ܒ  ܀3 `z 2`z" Xnfs_rename: no name㿐 ` $    $2`D<C"0D@;  "`  D@4 "` T 4 $`   (`2`  h  @"u 2` p֐ ` ``#\`@6#``h   h \,\*p p ppp " 㿐`#``  #\``@hD<)!@tx``'Ԙ ""x  H 'S x  ?` (   " $ `pS x  ?$4hS x`  (  "  H  ? $A H /*'<(#  H p@` H /* '<(`2H 0  `4`$`$@$`4`0j  l<!"`''$` ? @R`x'#@` #? RxdD D _0P (   " D   ?$ 4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`/ "`''$`    D'@s  `(  "  p  ? g   (  "  I?  ? AH /*'<(#$ H p@` H /* '<(`2H 0  `4`$`$@$`4`/  l<!"`''$` ? @ '#@`@ " @! 2 lS x  ?` (  " $ `pS x  ? 4hS x`  (  "  H  ? $A H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`.  l< !"`''$` ? @R`x'#@` #? RxbD D ]0  (  " C  ?  4< H /*'<(#* H p@` H /* '<(`2H 0  `4`$`$@$`4`. "`''$`    D'@0`0! ?Ԙ `(  "  p  ? g   (  "  I?  ? AH /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`.   l<6!"`''$` ? @ '#@`@ " @  #\#``\ 찒 "6 .  @ "@  2` '  Ȱ %<@H@%  @ "@ 2` ' l    ` \@ `?'  @ "@ 2` ' H  @  ܒ w ܀   @ "@  2` '  X @H@%  @ "@ 2` '  :  ` \@ `?'  @ "@ 2` ' ٘  @  ؒ7  ؀. z 2zz`2z" X" XH     D`D  <>D''D' H*` lE  <=t'ؔ ''''t H*`  D<)@t|`"|  ? D  ̤' S x  ?` (   " $ `pS x  ?$4hS x`  (  "  H  ? $A H /*'<(#ے H p@` H /* '<(`2H 0  `4`$`$@$`4`,:  l<c!Ȅ"`''$` ?  @R`x'#@` #?  RxdD D̰ _0 (   " D   ?$ 4< H /*'<(#k H p@` H /* '<(`2H 0  `4`$`$@$`4`+ʒ Ȅ"`''$`     D'@q`S x  ?` (  " $ `pS x  ? 4hS x`  (  "  H  ? $A H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`+P  l<y!Ȅ"`''$` ? `@R`x'#@` #?` RxbD D̰ ]0  (  " C  ?  4< H /*'<(#탒 H p@` H /* '<(`2H 0  `4`$`$@$`4`* Ȅ"`''$`   ` D'@ ,y; ?  ?` (  " $ `p  ? 4h`  (  "  H  ? $A H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`*e  l<!Ȅ"`''$` ?̐ @'#@` " @  ̰  #\#` Sİ "< .'  @ "@ 2` '   @` @ İ t   @ "@  2` '  Y <@!H %  @ "@ 2` '  :  `` \@ `?'  @ "@ 2` ' u  @  Ӗ  +><#$<0<)#@ :@*` hH /* 'R <0  *@ *@   Β 0<)!ȓ+ @ @ "@ """H 0``z` 2`z " X`" Xhɐ " h`<)D t!@  h ` `` # h@K``  ?L(@  < 'S x  ?` (   " $ `pS x  ?$4hS x`  (  "  H  ? $A H /*'<(#Y H p@` H /* '<(`2H 0  `4`$`$@$`4`(  l<!"`''$` ? @R`x'#@` #? RxdD Df _0  (   " D   ?$ 4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`(H "`''$`  `  D'@` x  ?` (  " $ `p`  ? 4h``  (  "  H  ? $A H /*'<(#p H p@` H /* '<(`2H 0  `4`$`$@$`4`'ϒ  l<!"`''$` ? @`'#@` "` @l`  } "뀦 ?^  (  " D<  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`'[ "`''$` < `H  '#@ '<Z#`  (  " D'<  ?  <H /*'<(#頒 H p@` H /* '<(`2H 0  `4`$`$@$`4`& "`''$` '< `  '#@  (  " D  ?  <H /*'<(#G H p@` H /* '<(`2H 0  `4`$`$@$`4`& "`''$`  `  '#@  (  " D  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`&N "`''$`  `  '#@  (  " D  ?  <H /*'<(#藒 H p@` H /* '<(`2H 0  `4`$`$@$`4`% "`''$`  `  '#@ ,<* Ѐ _  (  "  C  ?  4< H /*'<(#8 H p@` H /* '<(`2H 0  `4`$`$@$`4`% "`''$`   ` '#@ ,`#@ 0#`  (  " E   ?  <H /*'<(#ے H p@` H /* '<(`2H 0  `4`$`$@$`4`%: "`''$`   `` 'Y#@  (  " D  ?  <H /*'<(#炒 H p@` H /* '<(`2H 0  `4`$`$@$`4`$ "`''$`  `  '#@ 4<* Ѐ _  (  "  C  ?  4< H /*'<(#$ H p@` H /* '<(`2H 0  `4`$`$@$`4`$ "`''$`   ` '#@ 4`#@ 8#`  (  " E   ?  <H /*'<(#ǒ H p@` H /* '<(`2H 0  `4`$`$@$`4`$& "`''$`   `` 'Y#@  (  " D  ?  <H /*'<(#n H p@` H /* '<(`2H 0  `4`$`$@$`4`#͒ "`''$`  `  '#@%i2 ? `(  " $  o`  ? 4g`   (  "  J?  ? AH /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`#V  l<!"`''$` ? @@ '#@` "?` @  2t`  (  " C  ?  4< H /*'<(#凒 H p@` H /* '<(`2H 0  `4`$`$@$`4`" "`''$` << #$<* @ $$ $ $  , $  0?'@#$  4$  8?"$ @#$ `` #\#` њ찒 ") .   @ "@ 2` ' _  @`M$  @ "@ 2` ' @  @  @ް H    @ "@   @  '  ð D(ܖ   L5  @ "@ 2` '   `"@@   @ "@S  T˔ T  '䀤` 'ؒ8 t   @ "@  2` '  Y <@H@%  @ "@ 2` '  :   ` \@ `?'  @ "@ 2` ' n  @  Ԓ̖  Ԁ #7<a*<#$<0`<)#@ :@*` hH /* 'R <0  *@ *@   ’ 0<)!ȓ+ @ @ "@ "`"`"H 0`z  2`z" X` " h`<)`Dt` 'a@   d ` "d b $ H`  < `'`S x  ?` (   " $ `pS x  ?$4hS x`  (  "  H  ? $A H /*'<(#X H p@` H /* '<(`2H 0  `4`$`$@$`4`   l<!"`''$` ? `@R`x'#@` #?` RxdD De _0| (   " D   ?$ 4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4` G "`''$`  ` ` D'@!ߐ ?  `(  " $  o   ? 4g    (  "  J?  ? AH /*'<(#m H p@` H /* '<(`2H 0  `4`$`$@$`4`̒  l<!"`''$` ? @@ '#@` "?  @j `{ `?]  (  " D<  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`Z "`''$` < `H  '#@'<Y#`  (  " D'<  ?  <H /*'<(#᠒ H p@` H /* '<(`2H 0  `4`$`$@$`4` "`''$` '< `  '#@  (  " D  ?  <H /*'<(#G H p@` H /* '<(`2H 0  `4`$`$@$`4` "`''$`  `  '#@  (  " D  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`N "`''$`  `  '#@  (  " D  ?  <H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4` "`''$`  `  '#@,<* Ѐ _  (  "  C  ?  4< H /*'<(#8 H p@` H /* '<(`2H 0  `4`$`$@$`4` "`''$`   ` '#@,`#@0#`  (  " E   ?  <H /*'<(#ے H p@` H /* '<(`2H 0  `4`$`$@$`4`: "`''$`   `` 'Y#@  (  " D  ?  <H /*'<(#߂ H p@` H /* '<(`2H 0  `4`$`$@$`4` "`''$`  `  '#@4<* Ѐ _  (  "  C  ?  4< H /*'<(#$ H p@` H /* '<(`2H 0  `4`$`$@$`4` "`''$`   ` '#@4`#@8"#`  (  " E   ?  <H /*'<(#ǒ H p@` H /* '<(`2H 0  `4`$`$@$`4`& "`''$`   `` '#@  (  " D  ?  <H /*'<(#n H p@` H /* '<(`2H 0  `4`$`$@$`4`͒ "`''$`  `  'r#@  (  " C  ?  4< H /*'<(# H p@` H /* '<(`2H 0  `4`$`$@$`4`v "`''$` << #<*@ $$ $ $ , $ 0?'@#$ 4$ 8?"$ @#$   #\#` a찒 6-` . `  @ "@ 2` '    @ M`$  @ "@ 2` ' Θ  @  @ H    @ "@   @  '  Ű `D ܖ   L`5  @ "@ 2` '   "@@   @ "@S  TY T  '䀦 'ؒƖ v ؀`q  @ "@  2` ' = Y <@H@%  @ "@ 2` '  :   `` \@ `?'  @ "@ 2` '   @  ԒX  Ԁ ` `z 2`z`" X   " Y    @ а  Lh`2  <Y < @D"`"<#$<0 <)#@ :@*` hH /* 'R <0  *@ *@    0<)!ȓ+ @ @ "@ " " "H 0YNp  D@  ; bY?Y=<)<#$<0#@ :@*` hH /* 'R <0  *@ *@   Ւ 0<)!ȓ+ @ @ "@ """H 0[ <)tt``"t  ? $ H ,`'S x ` ?` ``(` `  " $ `pS x``  ?$@4hS x`  (  "  H  ? $A H /*'<(#ۈ H p@  H /* '<(`2H 0   3 # ## 3   l(<! " ''# ? @R`x'#@` #? RxdD D _0r` ``(` `  " D ``  ?$@ 4< H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3 w  " ''#  `  D'@  ?  ?` (  " $ `p  ? 4h`  (  "  H  ? $A H /*'<(#ڛ H p@  H /* '<(`2H 0   3 # ## 3   l<"! " ''# ? @'#@` " @    #\#` 찒 "`z< .`q  @ "@  2` ' w Y <@!H %  @ "@ 2` ' X :   ` \@ `?'  @ "@ 2` ' 4  @  ܒ  ܀ <#$<0<)#@ :@*` hH /* 'R <0  *@ *@    0<)!ȓ+ @ @ "@ """H 0`z  2`z" XB'B%VV " nfs_readdir: lost in space㿘` ` Dh!@@  !2$ް ` ` @ @ ` u 5- '  <)K"H<)H"h@<)C"<)@" <)9"<)6"耢<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    T# "H 0`"@   <)$`t` "``"``"` "@D 2>` ": <] <]l#??  :`"@   < ?? "@$" ""@`"$`"@pD<(a@  "     k <)ओ2  `: <)_ `t` "`  D   'S x ` ?` ``(` ` @" $ oS x``  ?$@4gS x "```(` ` @"  ?H`  ?#@$?` H /*'<(# H p@ H /* '``5`H 0  2"""2s  l(<ۛ! "''" ` ?#` R`x' #?RxdD D! `0` ``(` ` @"  B` ``  ?$@ 4:` H /*'<(#ע H p@ H /* '``5`H 0  2"""2  "''" `   #`  D'@n` "```(` ` @"  C `  ?#@ 4:` H /*'<(#F H p@ H /* '``5`H 0  2"""2  "''" `  #` @  '` ` ;  ` ` ;     $X ` "```(` ` @"  C `  ?#@ 4:` H /*'<(#ڒ H p@ H /* '``5`H 0  2"""2;  "''" `  #` ` ' ऒ #\#`` <찒 " .I'  @ "@ 2 ' ˘ e  ܒ+ Y܀   @ "@ 2 '  ?' ' $~0\  @ "@ 2 '  #  @ "@  2  ' i         @ "@ 2 ' H :   H0` ? " ?"@ @4@"@"@"`"&`` :`8 2(@@2 $,4", ``@&` "@ "_䖒 @$*@"@"@"`"&`  @ "@ ƒ䖒 0m'䀤  @ "@  2 '   @ "@ 2 '  B@"      >` :>``:?"    @ "@ 2' i G 0%`?A쀤  ""4* `2` :@#@"@"`"&``? D'L!@'0 ԰   ', '4 p, <)`2  `: tc t"  \#TS x  ?'P `(  @" $ sS x  ?$4kS x "```(` ` @"  ?J`  ?#@$A` H /*'<(#Ԁ H p@` H /* '<(`2H 0  `4`$`$@$`4`ߒ  l<!P"`'P'T$` ` ?#` TR`x'T #?Rx@zD PP DT Pe4` "```(` ` @"  E `  ?#@ 4<` H /*'<(#  H p@` H /* '<(`2H 0  `4`$`$@$`4`k P"`'P'T$` `  #` Tb@  'T` ` ;  ` ` ;    $ ` `H D#\#``L UL H` .H'<  D@ "@ 2H 'DHD @ L@  <HDG L< HL44  ,@ D"@  ', 2H  'DHD @ L@& &$  H  D@ "@  2H  'DHD @ L@       ? " ?"@ ? @ 4@ "@"@ "`" &`` :`8 6+ @@2 $,4, `@&` "@"@% %HD wL@$*@@"@"@"`"&`H  D@ "@ HD L0U'DH  D@ "@  2H  'DHD @ >L@ b@"      >``:? H  D@ "@S 2H`T 'DHD T՘@  L@X@ TH  D@ "@  H  'DHD @ L@ H  D@ "@ 2H 'DHD @ L@``@HLv H4`  D@ "@     'D HD{@ L@Vx2DD@! 2D4'4 54 '8U8 8 L'4 Y44Xޔ 8<<H *` 2 ,40  % @@) %` 5409.4  D@ "@ 2H 'DHD @ TL@H`  ` D "  HD L0?'D4 "HN'4H  D@ "@ 2H 'DHD @ !L@ 7  H  D@ "@ 2H'DHD ˘@ @L '4`?L  "" 4* `2` :@ #@"@ "`" &` 4`>4 Nunfs: sillyrename dir.nfsAxxxx4.4㿐9Ӑ`h``'<f <)H /* 'h    T @"hH 0 &@&``4<f 4`4 `2  <N&` bh&` &` *.`&` @ :.`  @:.` ` @ 2.` @ .` ` ``*`:  z.``@@ c  `@@  ( M`@@ hD<)t!@L `""L  $ H   'S x ` ?` ``(` `  " $ `pS x``  ?$@4hS x`  (  "  H  ? $A H /*'<(#h H p@  H /* '<(`2H 0   3 # ## 3  ǒ  l(<! " ''# ? @R`x'#@` #? RxdD Du _0` ``(` `  " D ``  ?$@ 4< H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3  W  " ''#  `  D'@f ?  `(  "  p  ? g   (  "  I?  ? AH /*'<(#} H p@  H /* '<(`2H 0   3 # ## 3  ܒ  l(<! " ''# ? @ '#@`@ " @z  ސ#\#` }˚찒 "`р` .ɀ 쀥 $  @ "@ 2` ' W  @  @ H    @ "@   @  ' 2  @`& Rx @ '܀ @4 RxD Jܐ|"DRx @4 D @ J "D D@L2xUx2DD@ 2D4  44ܰ  0V L 4'  @ "@ 2` ' Ҙ ( @  ؒ0  ؀ @   0'ԐԒ   `@  Kt0'@pD!@`  <)t"  DS x ` ?' ```(` `  " $ rS x``  ?$@4jS x  ```( `  "  H` `  ?#@$A` H /*'<(# H p@  H /* '<(`2H 0   3 # ## 3  J  l<r! " ''# ` ?#` R`x'$ #?Rx@D  D `  ```( `  "  C` `  ?#@ 4<` H /*'<(#z H p@  H /* '<(`2H 0   3 # ## 3  ْ  " ''# `   #` ' $$ $ #\#` {ښ찒  .  @ "@ 2  ' m r <!H   @ "@ 2  ' O T '  @ "@ 2  ' 5 :   ܒ , )  @ "@ 2  '    Ԓ@  $ 1$ 㿘  "  `DH @͓:` $ nfs physio/async㿘  $`  <j4#p $  <!  $@" ` \ $ ?  T 㿘     @ nfsfsyncnfs_fsync: not dirty0`'T`D'a@@''L'P* @ !' '??   a@@"[ T`X`H /* %``F `C$ 2;. @``2?$` -`$$"@ H: T2* * ;@ C `2X (X  X" :@ C8 @  `H 0`^? P&@& " - @H ; T* X2# * ; @ ; D`Pm  !1 d`D %??#a- @ $ $$"`d/ `'`d$$X$$$$T $$Gu2 - H /* %``g @ )<>+<k$ *L`2X`2T$ @$$`XH p@ P K<0!  *`'$ <k h`T`$ 2"-&`T`$ $$$H 0#''P# H*` €0H 0`L`D'6 `,`d "!``!<k`0`d'`0} X "`d pP 怦2`d<0!  *`'`d 2`0`` T`W`z  ?`t0`zp` D!@`` P <l"*` €8  8 88 (` "<"@`  8"@4<)t"  DS x  ?' `(   " $ rS x  ?$4jS x  ```( `  "  H` `  ?#@$A` H /*'<(#R H p@  H /* '<(`2H 0   3 # ## 3   l(<ِ! " ''# ` ?#` @R`x'#@` #? Rx@LD < D] < 70! #\#` x찒  .'  @ "@ 2` ' + '@  ܒ 쀦 ;  @ "@ 2'   0G` "`   "` 0  <0"@ "@< H ` `?"0$"` !@" 2 !<! 2 ! @9 2 `  "@ "@ 㿐   `P@ #\ 9 tag VT_NFS, fileid %ld fsid 0x%lx 㿘 <n  X`H Γ  h2<nmԐ<nΊ   - -㿘 @  bwrite: buffer is not busy???㿐 $< $ `! <nΐ! $?!~ @& $`` PE  P" P`0 "`0 P@ d` @ `2" d H : T2`*   :*`  $ @ @  X& $ P#  `  $@, & $ 2  $& X ?& $& T/\ !1  P`D `<> $@ & $<> PX'X' H*` 2 /` PD0`0 "`0, <=!'x'| " !'' H*` €x 2  "  D 8`"   h    2   K㿘 <*` z<=a3 z`<# *"@ *`@ *`# $l* @㿘 <*` z<=b3 z`<# *"@ *`@ *`# * @ `z c I<=d3zP`4`C<=`D 8`><=<`???? ?(?0?8?@?H?P?X??z!" '$'z"<=''Ȑ!@'x'| " !@''`H*` €x<= <*` 㿘 <*` z<=a3 z`<# *"@ *`@ *`# $lt* @㿘 <*` z<=b3 z`<# *"@ *`@ *`# t* @ `z # b! <*`В`# `*" *  * #$" <*`В`#`*" *  * z#$3zP`4`C<=`D 8`><=<`???? ?(?0?8?@?H?P?X??z!" '$'z"<=''Ȑ!@'x'| " !@''`H*` €x<= <t*` file system full %s: write failed, file system is full 㿘'@` 02  Ā "C   >  `  ̡,  ( @F <@R d$ 0> @Q " $06 2 `@ @7<t#@_  ` `@ $`$`'@ @Pޖ  <p@<p ˁ  dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevbad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim㿐\%@`````̡, `( @`<@ d$ <p.` 2 <p"`0 ˹`<p"?(  '>` @P\ "`*W0@@ `dH,@"<p"А `[$`$6 `2'`<`*@_`(@k `̀#<t<pb `$``<`(@N@Z d`̀`0<pc ٔ`Ԗ  $`<p#@S`<pɴ#h<t#@o +`d, "H@ @6 `T$?  @x>` `$$+1 $  <# $@ %@>`  @O̖ )`<p@ <p l`԰  `%$ ׸   `D`H d :@-`H@:@2 Ȑ@G| 2 @Gx 2 |`*`` * ?? 0(t t)u 0` < @Gx` *` * ?@   &@ "  0?'ߘp jp < @<w#@ Z,` @ @"" 8`@!<N" (t(vt`" `&`<>ؔ '''''H*`   " (p (Sp @,`@H` d 0@; @ d,"H 8   (p (t mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free 㿈   " `Ȁ "R < @ 2@V``,@Ӓ: @/<x#L@ "5  D    <>'''' H*` ) ` x`"   <r"Xɸ`<r"x<r"`ɮ&  & ܐ &   <r @ <r"`԰ 㿘 , @    l p: "ؑ:*  *` 6  @&  :@]㿘 `\@  .? 2Z`8`   @`` @A y`8.? 2 ` @`@?@; `,@`Ġ @1`l`p: bؑ:* @ *`  6,`: C `lb`p: : *  *`  6`: / `X +& * ``*  " `@0  @$b`8 @$b`8 @`D@``|*"@ *`@ @ܓ*`?@ؒ@`8㿘  "`,, @@6&@  , `,@[   ߲``,@"   㿐 pؑ>@l* .@ *T@ ` ': /? 8? 4İ  @m@h.@  d , ?% @<bU  "<*#Ԁ  <*'  ' 0`А$ @T>!@ "U ` ` :  ` ` ` ?"@: ؘ  8" #@ "U ` `:  ` ` ` ?"@: >   ># *` 4 ?" #*`  " T>4 @"U  ` ` : ` ` ` ? "@(** $ $ $̀pl>@$̑* @.@ *`  ?"  ,&,㿐 pؕ>@ l* .@ *`  2 02  @@.@  d , ?$ݘ @<bU  " #Ԁ     <*0<*&9 ð  $ 0 2 T D@Ֆ%08>   4,` @ `@ ,`@ O  S D@@8 # 4@"U    :`c `   ? "+@*8`@   $"@ $ $̘ p l>@$̑* .@ *`  +` " , `%y 0S @  % 0G@,`! 4@"U    :`c `   ? "+*@`@* $ "$ $̀p"l>@$̑* .@ *`  "" , $@*`   %*@pos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cyl㿈 `@ "`8(  @2;@bU ```@> ``eP`$`8cX'`|@Z`@e@U-`TT  @U"X- @9* @4@`@<@,`@@ޒ@$`@ؐ@@*`@ ,`V`@`@ ,`@,` @ ,`,`V`,``@,`,`V g@%@``@/ eL,#\@ eT@@* R? <u#`<vM 2eT,#\@ @@Ő* R @U`@d 2)``eL?2eXe`@@ $ <u```:@ <u#Ů`<v @`8 @B 6&( , ``;@bU@> `@_ @ݘ?bؚ&`Đ&` `p`l;@ *` +@ *  # @]`|@i``|@W@ `@a``'@O`|@J`@@``'@A`@eP'@8`@CbU * - Ԑ X@&* @ @Ւ@)@@͒@˒@@Œ@ @bU * - Ԑ X@* bU?7 -TT bUTT  ?#.` @`ffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost block㿐`.`T@6`  @@.@  d ࠓ, ?! @ <U@ "hԀ h.$   @ ``@ $@@  ?` @@ `4@Ty"༐@v"8  @`: l:`*  & p *@       *`   B @& @"U!<w`@ ה 2`œ#@`@$༐@`* @ <wˆ#`. @3<w`Dw"8wc@@&`"r0" cg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in map㿐 pؕ>@ l* .@ *`    @@.@  d , ?! "v 0'@`<U " #Ԁ <*"c   Ѐ$ @F & : b \  ?&:@ T 0 "@ : U:`b \ @< 2  `U@ " \ @, 2   0<x"ؒ\<x"@U "@ b \ *`    *``<x#A<x#( $ 0U:` \    & +@  * <?$ Ș pl>@$ȑ* @.@ *` ?" ,  $ pl>@ $*` .@ *  # !_@dev = 0x%x, bsize = %d, size = %ld, fs = %s blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockblkfree: freeing free frag㿀0   @> @   <y#(©<y #X༐@$@ <y#p™<y@0L @x@s-  d ࠓ, ? !003@`<bU " <*Ԁ "<*!" 0%`А$@0 `@bU@ >@`@  " <y#L<y#@bU@"`ؒ@ ; @ ؚ`$Đp= l$ē*` - *  # @ |@ପ|@@@'@|@@@@ਠ@P'@@@bU * -` Ԑ X@Ւ* @ϒ@@ؒ@@|@z@@t@@ƒ@bU * -` Ԑ X@* @ 7bU -`TT @bU2XTXT8?.@@bU@:c`   " %  : :@ 4?@ ܘ T > @6>$@"U9<y@  : c`  : ,`$:@  #Y<y#"`c   ? $ *@ `@*$ؐ$$̘pl=$̑* @- *`  " @bU@; c` 8 " ?% ::@  @ f `@bU = `@  $8 "@ $$̒8p#@= l$̙+ @ -(  #@@5 $p= l$ē*`@ - *  # @|@ପ|@@g@'@|@@Y@W@ਠ@OP'@@@bU * -` Ԑ X@* @z@/@@s@'@%@k@@e@q@bU * -` Ԑ X@T* @ 7bU -`TT @bU"TT  "@ ,ifree: range: dev = 0x%x, ino = %d, fs = %s dev = 0x%x, ino = %d, fs = %s ifree: freeing free inode㿐   ``,@   <| !}`Ԓ@a`@``@- `  `d? , `C  0t/@`<U  " <*#Ԁ "<* e `А$ @` U 4 \ : 2  <|"Ж`L`Ҁ 2 <|-"0U@ \  (* * 0 *$ 0 bؐ $ `<`p``l=$`ȑ* - * `" 2,` ?$ ``p`l= $`*` - * ?# ,` start = %d, len = %d, fs = %s offset=%d %ld ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in map㿘" ,`@ & :  & `:  , : #@"bU ``8%<O*@  ?"? * @ 6bU@ ``8Б*@  ?"? * @ <} ؒ`bU<}` @ #ؔ  <}]!"*  &,:/ `8 @ ""U:@ <N<N#"b  : `   ?&:  +` @! @ + *ڀ <}!(`<}!@ 㿘e$l h>`.`# (.> . # (.@.e$p   8(! .@`@ `. @ ``@@'@ ,? 8(! .@@ `> @ @@!@ 4 /` '.  ' $e$*  'e$(` `4 cT( uid %d on %s: %s 㿘<~b Ԙ ( 'T''P`'  P @m T` Q` 40 *:  8  20 @8<0 <D L 0 3` / [0#\P 0@  ;   @= ,  H`d:@ $@   %  ` G ` 4.`  `0@ :    ?ǘ W "+0 <D L  ? K0_#\P 80N`@< :    DL ϖPŚ .  d`'* "H0 @<"4 dH: $ T`%  @9   *  ' 2  0P '0 O d, 0"H<'@l  "4 2*  % `%  E   >.`2 0 R 0PG .@%*   0d', 0"H<@,  "4 t* @*` `*% @@* ?0 Z<*  30P B %0Ę d, `'`"H0 @<"4* %Q ` 0?|  00  d', " H T# @  @0b`0@  2'  < P @@Ė   # % % 㿈 D 8`2 <*`В``*" *   * '' / %  "%  " %   "%  " (`B % = (%  % %  M  % e, 4   5 |5 ~ `@` @``@,@ ` @K@`x``*  `d `0, і? A0 @5`x <*  x@q   D`8@{װ itrunc: newspaceȸ    h %D <:` ``2 2@ϒ <>  $<"ؔ '@g'P<> $'@'D'H'L'PH*@ X@@? ܰ?(($t$x$ $|2Ie<,(Ee<e0ư 2e<e4(e<0`PE@¨  $    < <@ؐ@`<<<> $"ؖ '@'P'D'H'L"ؐ@H*`   2`PE<@   $    < l <`P * : 8 2`08e<`0e<eD `L @\<$< @<`<$<@l`0 : E`P@:B??'`tР$'`t @Q$'`0: '4 ????????'Г,` #@ # ,` @,`@"@<> $"ؖ '@'P'D'H'L"H*` @?X?`?h?p?x??'<<<<<<<(<$2 (     /O ?'`t '`t @ڒܔ"',`@ `d- @8 28  @ '@`04@`|<ߡ,` @,  "#` $`P`* : 8 2`08e<`0e<eD `L < @ @ڦ J.  E 4`0`P * : 8 2`08e<`0e<eD `L <`P * : 8 2`08e<`0e<eD `L # <!8  `T:  < @ <"`$$ ?@= ffs_indirtrunc: bad buffer size㿈'D' 'X      t@ @~D0 : y $b# <! `, ",$0@ ,$$<><c!<>$HX''PX H*` € X <0(   @<)<)G"HE"h<)<)@">" <)<)6"4"<)<)/#-#( <)<)#H#h<)<)## @<)<) # #耢<*<*  (H /* '    Th @"H 00@ct- " *@ n 2't@I?&@, "? dD. ??찒 2'0D?@ @}ْ,  dD. ?찒 2'`3<0<#$`$@ : <)*`hH /* 'S <0  *@ *@   T0<)!ȓ+ @ @ "@ "$@"H 0 X$@$$X 㿐   `P @| 4`0*:  8  2`0 @8e<`0e<eD `L  "  ? " l0 e< < @#  "@㿘 8<OЇ/` / -.`<N<N⬀``'@?" ) @@2  & 8(@/@ (`/` ܀`ffs_isblock㿘 8><0#  <@ `?>@ *  @ *  *@  `?>@ *` @ `?!Hffs_clrblock㿘 8 >  <0 <.@>@ *` @ *` * * .@ >@+ * .@o"ffs_setblock㿘 8 >  <0 < .@>@ * @ * * @ .@ >@+  .@@"Ёffsffs_mountroot: can't setup bdevvp'sroot_device㿐<!<@ J <b!<-!Ȁ <#<<#c* 7!Ȕ@   @*"@1 0'<<#D""#D@ 2##D"#D" a@ `Ԑ@~"   Y@y @*Y @U` %s: file system not clean (fs_flags=%x); please fsck(8)  p   8@@"r!@NҀ "`@  @ @1   р  .@   . 8@0@ NҀ 5 8@2 `%`J #<= `'p'x'|'t'`p H*` %<>'p't'x H*@ p ђ * ... D2 @&(&&$&&,%A  h " l-  #< @(2`@ & -{ `(  8 #<=%<> `J `'p'x'|'t'` H* @p'p't'x H*` p  8@@2@k  -f "!@-a07lԒ!Җl"Ԕ"@ @|  @~_ Z  Yl Z" @| NЀ р.<* & *<! Q:@<  ffs_reload: dirty1ffs_reload: dirty2h8  @   * <=<!<=!' 'Ԑh ?"?"?"?"?'!H*` Ѐ " ( @y< ?F̰   @   h̠<@} h%\F!T  0@@̀eg" x 00,0"ؒ@}Ȕ |#T$#T h@}’ h#4$ "$z T %(@ &<  4?@y 6&%$ 8@ 0 4@$  d@*@ ?̰  `<@ ̗* @} <L 8@ @& 8%$ $ , @ #T%$`" ,@ `"U `D<*`Tb- @`+   ) "`<Đ! @  @?  @:,@   @~@ x `?*  d 0, ̰ \@~ x <* @x@}" +`2`D Pl  ?/ߐ c.P <!Ȁ Z   )[ P8   <='''ܠ?$?H*`' €ذ 9<=HĐ " 'h""+ '''@ @ " (<` @xn'   F <aT\ 2 h>":@  <@|0@@4۰ eg8ְ  а `͐@x, 4Ű +  L @ 8B 8   2L@ (L ?!P   ]  @z!P%`h#@$ "$', ђ * ,,4@xP $`,* @ 3  (804@*%d@*@ w \<@|`ؗ< *" 8 '$  , $T$ ", <#&@'&`&d8(@&<&8%@%`%`t`%`$d %`(8 %`," ?l `@># 0=aH0   @v; 0B? 8 <0, 4 (<0% i f    <= H ''''ȕ*' @`J &@㿘  *   @ &  %L?&  &%P%, %  0*` * ?:   t:`>%0<`@vR%0 @C  >%0 H L;`;   ;`; >%@>%8 㿀6` `@E @a@`L Ҁ 2`@U  2 ` р  , ѐ@  ``l ?"L Ҁ`  `<=༔?''''' H*` *`"~ϒ ~̒ ~ɒ `8*$`8$a@㿘<<#4`" 8@!@ *#`   , @`" @9.  , * ffs_statfs㿘!@F aT\ "6@<^"4&`0&`(&` @}8̢@ &`< d(#  < @u;   d@uy$"@&`,@}?&`Ȑ @@ &``L @z Z` @z Z `<@x  fs = %s update: rofs mod㿀a@ LЀ   LҀ " `<#< #` 3``?'<= D2`  ` T ` "@`)   t'''''t H* @ 2)+ 2 D` <=t`?''''t' H*`  2@9ΐLЀ` <*,`А$ @Cinode㿐a@ @. &'<ېt "y <`` %ݖ  &ty 0z< ے  @x <`4  yq ` " $`   $`$`$`" ?@.}t yŔ @|T@| @|L* @|  @{@|?x`*  d 0, )? (,&@{x <* @`x@yƔ <<"@HE " ({& $`  4`2 4,`|`~$`$` &㿘!@`  ``,@|``  F@;  2@ "`"`ffsinopl㿈@;<:<:a4\ -<<#`#d#h `#\    㿘`  <P   -0   -0<P !!<<"<N"㿘 eL eP?e8e@e0$ePe, 4!He8  eHeD@"#!H ؔ '''''H*` %s: nonsync dir writeffs_write%s: typeX h' $  <)< )<$<Ā`"= @"@   @"0Ā $2 <<#0cH<<#XcH ( @ D%0 2h%4h ` `@ D      İ `$''` ?Ȁ  @s4 P %< 0 # $`R q< @8  @   <@/@`4` :  P`* : 8 2 08 0  :%8 L @%@@ ;B @ "@&`<`   0 <P!`       XԀ  "  $`2z      x 34x!Ā`4<>'?''''H*` @'   @ b %=@ $<>ؔ '''''H*` ذ㿘  @+ <  $  lfs: ifile read %dlfs_ialloc: inuse inode %d on the free list㿀/<` t "v+ 2t"`  " h@x | @ @ "?   < @w h* @ <*` ` "`<  %  `2ct"<> Ȕ '' 'H* @' @q  @   @C< @ @  |$ $ h@x h%    < `"@"?" ` "<>''' H*` <>c''Pc H*` €谒 t u 0C u D@@ 8   @tUx$|$@*3<`D< @D5ap "$k"@!" 02  0@] "l`%"l 0 # 0  4 24 (-"$`% (lfsinode㿘<"l !5 "!@&/<#5 < 4  tΘ  "  $   $ $   $ $ $ | $ " ?  $ $ 0$ `4 x<  `0  "`0lfs_vfreelfs_vfr1lfs: ifile read: %d㿈 -< t  t <a 0 `?+<%%< "t "1  ` " b `2b  ad b  <! b `0 b V  `` "b` `" b 2  ΐt   `0?$`0   $  " b`0?$`0  $ b`"@w1`h`|`@ @ b?`  "`h<9 @v~%<>*  <* `#` `# ` #`$` '' PH*` € 6 b `"` ``&@v* ``|2@ @ b`? "` <!``&@v* `l < * # '' PH*` € 2`(t t6 `( ?$`(,b$ 㿘 @ cleaner㿘`$@})<`P`D'<@ `0  :  " * `.`D )`2(`P# @ ,!28 b d 0 @v    *@   ,   䀢 8  "`P`P`$`@   2  0 $ 0   2  0 $ 0 " ,"$ ,`$@ $`$<P<Pa `$#a`,+ @ $`$H /*%`P!H `$ @ `$ ?$`$  0  lfs㿘+<PaЀ <ܒaP`( "`()<P! `I'<<D D@ 9%!<ܤ!P/<)-< vl `|'@@q  2@a@`8` " 2@"aА `$", $,@ "$"5"@mD@А!<P!<Pa@Ȑ%%!buffers㿘      2 V " 2R )<"'<P: Ḑ?@4"#<b!<0:  @vB?3<Pa@4""l <"&"t"3<P&"#<!<0"<!P!<`<0$ &$a *r!2": : " Ḑ?4<Pb: : "  @v?a<P㿘 > x +u  @q x  +u $`< `<@q H /*% SH `$  P<`$`0$`H$`L$`$$`,$`D$`($`4㿘H /* % P   TH 0 $@ <vU +& <vQ +<  ,""@Indirect block should not exist@  '@%x 2o` @n 4G D6D D 4` *:  8  2` @8````  `* &$ @M 2=`@uK     = @J <>% c''Pc H*` € D!@X`, T -<> `H`   $b"<< @! ```$` `@u`T@tc d`$@8   $@$ $   % $""$ <@p 0$ 4'' P H*` € 2̰ R ` @m]> I@ E * : ` 2 ` @8`` `  * @ * .` `:`>@ "  *@  2@ ? @ x"' 4``* :  8  2 ` 8````  *   ''$"2P ?24`<! ```$` `@tL`T@s d`$@ `$  "`$  0+  @% $""$`    0@o <"4""H$@<>"H"$X''PX H*` € 0 lfs: ifile read: %dlfs_fragextend㿈&``=`"@ * <! ```$` `@s`T@sI d`$@ ?3 D+<>b` "`H`` " `@s.* ``|2@ @ b?`쒒 "<7"X`H`` " `@s* `l < * c@"'' PcH*` €<  @@,f "a04$ "$`"$V<p ޖ <@ $$```= " `$* " $`$ $@ <Pa"a< @o   㿘!lfs_ifind: dinode %u not found㿘 d*?   ?<!`lfs_update㿐 `D 8`2v   ``` <*  %< o    <*`` ` `<*`В``*" *   * '' 0 ` $   "$   " $   "$  " (`B $ < ($  $ $    `0 "`0 2    @lfs_truncatelfs_truncate: bread: %d lfs_truncate: bwrite: %d lfs: ifile read: %dlfs_truncate: negative bytes: segment %d short by %d lfs_truncate: negative byteslfs_truncate: bread bno %dlfs_truncate: indir bwrite: %d lfs: ifile read %dlfs_truncate: vinvalbuf: %d lfs_truncate: update: %d 'L `'H?@H` h "'( D <```@m (<>`ؖ'`(  8`H'`'d'h'l'p H*` `@D@1H(`@`@(`D8<>`ؐ H `'`'d'h'l'p Hٕ*  !< #[  @ @GB?@jє('<`@CC? @jt D'8@@j  ` 4`*: `8 (2 `( ऐ  * 8` 4`*(: `8 (2`@('4`ऐ  * '4 @(W8`@*I( H?\ <#_\0@(H@n8`` 4`* (:  8 (2 (`ऐ  * \$< @m \@($@`: "@ `\#<>c'`'dPc H*` €` <5 8'0< @?HXT@!7 8@2 ?"#@ ??4',',T 2S?(.```I'X༐"@ @pu* @=8?`P "|=@ @ W <v (lP?`< @*  <`@%<e xP$9<>$#'`'dP#`H* `0= @ '0,,%"* @*` ` 'T<@&@ 4 &@T <@?H\ <  T|(\*  <*`@ @ Y` `K'X༐"@ @o* @>8?`P "|=@ @  < (lP?`< @*  <`@}%<ސ xP$9<>$#'`'dP#`H* €`0= @ '0,|,|T(@*`  p(*  \*<  @kϔ" 9<>\c'`'d Pc`H*` €`  T< 20q\T?􀠠Z'TV<Ȁ S@(* `@`H'X༐"@ @o]* @<7?`P "|=@ @ ? "l<] (P? @<*  ( "%<`@<L x" 9<>#'d'`P#`H* `0= @ '0,,$@<@瀦` <p&@@&<@eH8?`P#<> "|=@ @  < (lP?`< @*  < @%< xP$%c'`'dPc`H* `0=  '0@D@23#<> (`" @nh|@ @ ?\ (<ΐ (\`@nh*  <@*` c " '`'d Pc H*` €` ( 0"@ `/ " `$" / @ $$`H  ````/'\< ?@ 4 D D`D < 66$" 0:@HD@   '\$"+ @ ($$`" `,"@ @+@  ` $,`LD` LL<`?`@4H  ` H 4`<>H'`'d'h'l'p`H*` ` < ˒ <!Œ "lfs_vin2lfs_vinval㿘  `2 ` \ "o`) +<H /* %$ c ݖ H p@ $ $ @"$< Ȗ H p@ Ȥ B$ "$H p@D`@ ` ?@$ "$$@}   $ ?"$$@" $?# @"$ 2```  <*І*` ( "(#d#` d #lfs_vw㿘 D a@   $ 0?$ 0 $ `   ` <h C @ 5 "  $"t D@ @ $"t0\ `` " D @U'<P$ `  '<P`8  D Ѐ " ``<  `"  `<ܒaP`0 "`0  ` @@ 2 `@ 2Ѐ <ܒaP` "``8  `  "` `8 ` "`@ &$"t 㿘 ` + T  ~+z D  0"m X 02d X2 h ` 2] X h X ` ` "O X@  2J X` )<P `"' 0 ``?`  `@ `  ` `` `$` 0 & 0@ 0 "l?&"l 0"l* $ 0@ܐ!̀ @ X@А X?lfs_availlfs writerlfs_segwrite: ifile read㿈!@  `*`b "`b 8`!``%<!<``, 4`}{`@`, "  `䀢``, 耢`` b @ @@b8  bt  +` 8 #`b "b!<b "ޖ 2b bb$b  ? # @3  `J``|`@ C`)<>b`?쀢 "<Ґ"`l  <  ?"`D`l@k`|$ @k* < < `" #?`P#H* @`| :b`2bb "Hb<>x'x' H*` €  <!  `0P  4  4 4    `  @M@ْ ې@ `2b l +l +0'@ $bb? $bb<P!Ѐ`<ܒaP` "`8  `  "` 8 ` "`@W lfs: ifile read %d㿐`( @ `,`@`,` &`, 20@ "`` ` 2``$@ $`"`""`@j h |    ͖? <# h@j1`* @ <*` 1$``8`< ` "t<<Đ@є<P!Ȁ` <"t`8 <Ԑ@< @<H@`@ *  @ &`4 &``,`  &`,2lfs: ifile read: %d㿀  @  2`` M ` I `( @ `, @   H* @"& H   f ` #@`&`&` d  `*`< "  d *``   &`   ,* "@ & , `(`," &`(&`,`$@j' d "@` *`"  <* 0?& 0<* А  *"@ '*`@ *` '  &&&  (`B &&>( && ?&  ? ?& 2 `` x@g  ``$'@i> d <* x@gz   d@i1`$* <@&` `$  "`$*` `2`$ &`$@i d "&`2" 4 H0& 4`""@i h |    ? <# h@h3<>*  <@*`  Hc"'' PcH*` €耤`"G L@ H@ $?"3<> `"  $@ "@ie+   |2   Q? " <o"   $@ @iO*  l < * " $ `?c'' Pc H*` €㿘`, @`(`0@- H 0 @`@Ӓ`"` ``"`   3 `, $`,H /* %& `$ &`$` "`$``D*`#`"`,?$`,`0`("@ $`(㿐 &`H /* %'`   $2  "      H 0 @,&`This is a bad thing lfs_updatemeta: ino %d blk %d has same lbn and daddr lfs_updatemeta: ufs_bmaparray %dlfs_updatemeta: bread bno %d@ @*  4 @"@:`  <!`̀ ˒ @ ,  ??`0 " 3<> 4@ `& 4H" H `D`H 2 <!x 08 #H( @$H@Қ "<R!``*`  , 9" Б* 4"@* ?? <0! $"2` * @$" $*@ " $$`c <* "@''Pc H*` €?"A L$;  `" #@g* |2@ @ ?˘ "<"  * @gɐ" l @  <* 0c@ "@ #@ '' PcH*` €  H& 㿐`D `H `"@ ``* " @b<#`@@`D `$`H` " `@g* $ 0``?*` $ (b` #`` 0`|2@ b@ o` "`l<"  0< * @` ?`H $`H (@ $ (ː `H`` #@gZ*@ $ 0`H`D``"@ " * $ (`H"$`L $$ $ $ $ $b``H   " "@< @cx$  $ $ `Haa $`H`@! " " 2 2  $ " $ 4"  ($ ,>$ (lfs: ifile readlfs_nextseg: no clean segments㿈" `" @  "  "@g*   |2   ? " @< " #<> c "  @f*  l < *  `" # 2 2'' PcH*` €" `?#`"  <ې#`<+<`""& ''`PcH*` €)< @ D & < #@ & D@f*  t@f`@2"c?` "  |<@ "@   " l"  @  <*`    2 t"   &" @g*  <PaА & @<aP "aPlfs_writeseg: copyin failed [1]: ino %d blk %dlfs_writesegdevvp is NULLlfs throttlelfs_writeseg: copyin failed [2]h``" : 2"Ѱ ?  " '`0  |2@ "@   <>"  l<`0` `*   `P `0@ $@` *` `' d @f?@, $@` <*`В`$`4`4` $<>7֐#''P0 #`H*` `- +f| ``L @7<5< $ @  7`P`D $ @2)X H*` '<"`5<P7<P",H@`$$`0`$`8$`$"<ؐ" L "H /* % &" *` 2``H% `*``< @`0?#4`P@  0" y'`$  3?`@o  <4" <@b`0 `0  $`0 $@ ἐ? ,&"@ & $c # $ `$ @`PӐ X 䀦``$""`$ IV$  $ "$:) `& " P ``'"`D D@ `   0 & 0$`@  "2~`0`Pd "dH p@<>$`@X''27<PaЀ <ܖ!P@"""`8   ""`8   ?`"" ː  ` lfs sb㿐"p  !<"p "x~V "p 2"p"&"p #<>` <*cXH*``cX  & P"&!  <@a" $?T$ $ $a<  $ 8$ $$ L$ @''H /* % Pd "dH p@ `$ @`D: 2 㿘`D  `p@ck?`?㿘`D   `p@c]? `?㿘`D   `p@cN? `?㿘 @"? $"7"", H  @ "@, 0`㿘 @bp"bp㿘<PԀ@, @(/`@@$  &@&@@&& &캡`㿘 0!2 ʒ  t@ @ 0" 4t 4( 24<<"L<L"P  4(2 4<<c<c<" Lc< L P L "c<c<" P㿐    @\˔ 4*:  8  2  @8  *  "  ?# " 0  < @#  "@lfs seglock㿘"  <! " `0  "" &"8128#< c| " 2 &"<a  <0 +&" c &"! +c $ 4 8$ :H o*@ e"&"H 0 unlock to 0 with no summarylfs vflushSeglock not held㿘" V " 8      H?& H @ <\  c +c +H * " ?`&"!<"  " !| `2"H 0`&" "( * "( " * 6"(2  ""&"}&" 02?<z!&"lfs_markv: warning: force-writing ino %d lbn %d lfs_markv: attempt to clean pending segment? (#%d) lfs: ifile read %dlfs_markv: wrong da same seg: %x vs %x lfs_markv: %ld > %d (fixed) lfs_markv err2 markvlfs_markv err1 @@g ' '  ' a:@` j ݒ +`/`$, b '`E <ޒ  \'b,'? <" 9<- " ` ``$@aГ* ` `* `@aǐ$2  "  $@ap"   g`  <>''' H*` `'&`4b `"@a`h`|`@ @ b?`|Ē <#@``h* @ <*` `?"ں2?2Ӻ? @Ú  #  ''''"2= "b `"@a;`h`|`@ @ b?`&Ē <D#@``h* @ <*`    `0 %`0 xx?2''<>  ''''' H*` Ȁ 2`@"`` ,@ `@`%$@`2L<#0E`:"H /* %   ' 0@ <t#X0&H 0`@'" H   $b ' < E<  ?< <>'''H*`  8 a + KH #F $ @"$<Ĕ zZ H 0 #x%<薒 '$ @H /* %$`ؠ  H p@Ė`'ay +s0#ao +lfs_bmapv: attempt to clean pending segment? (#%d) lfs_bmapv: numlocked=%d numrefed=%d@ <P 0!:h#!'  $ H  Ґ   +` +` 'a@, ''`~', a@ ' ?",'' . @"    $@_*    * @_"  |`<>''' H*`  '% 4" `"@_ h | @ @ "? wĒ <#@^ h* @ <*` ې`V@K` ('0!2%`<>x'x'H*` €  <>'  ' H*`  ```      `"?%<>a a '''''' H*@ €Ȁ "?%??H`<>''' H*` Ȳw`<#!<#$@^`2 +   #@*`~5`% +lfs: ifile read: %dlfs: ifile read㿀 !:g| @~  ~ 2!@w `   D " @^* ` 2"i `?` #` ` |2@ "@   " l< `? @<*` ` " , E #<>  c* @$ , ` @_2` ` $@ $ $`  &` ''PcH*` €" `?#`"U  <s Ȑ`<""$ ''`PcH*` € y ,segment㿈 !:f W@}  2O  2!@<# `@` 7}o  9 2 H /* * <* А  ?@  ' '?/a ?>ܐH p@< <w!2: @? lfs_fastvget: vnode VXLOCKed for ino %d lfs_fastvget: ino %d inlocked by pid %d lfs_fastvget: dinode copyin failed for ino %d lfs_fastvget: I was fed the wrong inode!lfs_fastvget: bread failed with %d lfs_fastvget: ufs_vinit returned %d for ino %d x@%<>'@ )<>@p %&`0!2<` x''x H*`   %'' Ȑ H*`  @`'@#<ېat "ZӔ Ґܰ at& ZŔ 0`@tat Z  $  x|  < @y_ +<<N!( ?#ذ <!Xܒ@`ܐ 4Z D&<p x@Z z<<!p@)5ܰ $< $ 4ܒ`24&@ $'@ <P # " P<  <P #`"\0 !ܐ 4ZI P&㿘q`<| &`0&`,眐 lfslfsinopl㿈@<:<:a4\ ,<<#`#d#h#a(#\    lfs_mountroot: can't setup bdevvp'sroot_device㿐<! <b!<!Ȱ <?!0/<<! a! '!Ȕ@   @ "@] 0<<#D""#D@ 2##D"#D"`@ @ { p ʢ 8@@"@@`N% 0@. `&`%ʒ` !<= ` 'p't$'|'  H*` p`<> 'p't'x `H*@ p .% `D x @&(&&$&&, |h "ls  #< @(2`@ & ~e `) 8 !<= `%n  'p'x'|'t' H* @p <>00B'p't'xH*` p8@@2`@8  > "l@` Yzl Z$@ @Wؒ @Y: Zz Yl @Wɔ$@  lfs: ifile read: %dH?  7 _ <!Ȁ .   j $`8   <='''ܠ?$?H*`' €ذ  <=HĐ " 'h""+ '''@ @ " ('@T ä `<   < P P@ *!b@2  @@8   a"x  [ @X"!P [  @W/!P$ $@ " $SP'b,'$b$bl4b($bp  <"@ ?$b$b$b$b`,b% ,b$l<` ! &a@&```8`@ &`d&`8&`<$$ $$$(` * $,`p $$ "@ ?l "`  C$b4 `24b`"`` `H`" @Z+ ``|2@ @ b?`| "`<" ` `H`" @Zy* `l < *  <>`" '' P H*` €0( " ``  <= H ''''ȕ*' @ [ [ &a@lfs_unmount: still dirty blocks on ifile vnode 㿀@6`8@`"ה` Z . @`" @  . " E 4!B @ 9"`` <#8 " `lL"% ?" <=༔?''''' H*` gu, @<u)#[ [ 8*$8$@lfs_statfs: magic㿘!@ ab "6@<ʐ! &`  d&`    3&`    $#@3 &` T   @R   d@Q $ # "@ &`  " ;&`  $ d@Z$2 &` ( @" @  &``L @W Z` @W Z `<@U  lfs_dirops㿘@`" " "#<" b`sW " ""` $"  "`$"t"@llfs: ifile read %dlfs_vget: ino %d is type VNON! (ifmt %o) 㿐a@@ - &y `*`4b`"@Y`h`|`@ @ b?` <&#@Xl`h* @ <*` lL  B&`@ $ ?`ݘ JK.&<5 x@V{ ?<<!p@$ 0& h`2  x< < # p2  $  4`2 4&㿘` @ F  2@ "`"`㿘`9  <P   -0. & -0)<P!Ș!w"1<Pw{!Ѐ "!  <ܐaP"aP" 0" " " " " " " " " $" (" ,<ܖPx 4p  `X@8 2`` \@ ``   '`@ b 4^`]  @Q 4 *: 8 2@8  * ` "@*<@: #\  h? &<`4$6`<"ܤ`<l*  G``'܀ "D=D 8@  % `$`$<>ؔ '''''H*` %s: nonsync dir writelfs_write%s: typeP `h  #`  <'< '<"<`"  =`  @"`` @ `  @"`0`$2 `<<!Pah<<!xah` ( `` @ DX 2`h\`h `` ``@ D  2 ` h İ ``$''  t?`@P ` ' "@*d 4̰ Y<` @    @   = @o@o `4* :  8  2 8"   * "@ &`<k)5<>''P H* @  " `  % ``2``        x 35 x `4<>` '?''''`H*` @`& `  @ b %`=``$<>ؔ '''''`H*` а㿀 <>  `ؓ*`''''' H*@ lfs_diroplfs_maxdirop㿘"<p" pR "l $ "<"l!2pH ""`"l 䀢`"  &"&" 㿈 ` Y! 02 0  `l "l 0@"0@) @ . 0"+ S 4 2'  "# R z <>Ȕ ''' H*` 耢 < <>a p''p' H*`  `?" `b q9b ? 㿈 `s Y! 02 01  `l "l 0@"0@ @ . 0"+ S 4 2'  "# R z <>Ȕ ''' H*` 耢 < <>a p''p' H*`  `?" `b pؐb ?߷ 㿈 ` Y! 02 0А  `l "l 0@"0@ @ . 0"+ S 4 2'  "# R z <>Ȕ ''' H*` 耢 < <>a p''p' H*`  `?" `b pwb ?V 㿘 ` * !02 0n  `l "l 0@"0@C `?" `b pEb ?$ 㿈 ` Y! 02 0=  `l "l 0@"0@v @ . 0"+ S 4 2'  "# R z <>Ȕ ''' H*` 耢 < <>a p''p' H*`  `?" `b ob ?Ô 㿈 ` h! `0 ܐ  `l "l `0"`0  0@ @ `l "l  0@" 0@  - 0"* S 4 2&  "" R z <>Ȕ ''' H*` 耢 <! <> p''p' H*`  `?" `b otb ?S 㿈 ` h! `0 l  `l "l `0"`0  0@ @[ `l "l  0@" 0@  - 0"* S 4 2&  "" R z <>Ȕ ''' H*` 耢 <! <> p''p' H*`  `?" `b ob ? 㿘 `> * !02 0  `l "l 0@"0@ `?" `b nҐb ?ݱ 㿈 `  ! `0 ʐ  `l "l `0"`0  0@ @ `l "l  0@" 0@(  - 0"* S 4 2&  "" R z <>Ȕ ''' H*` 耢 <! <> p''p' H*`   - 0@"* S 4 2&  "" R z <>Ȕ ''' H*` 耢 <! <> p''p' H*`  `?" `b n3b ?  ` `# `# `x# S`z# `# `# `# L`; `# ,`# 0`# 4`# 8`# <`# @`# H`# D`h( # (2`D@# (H# (` ( 0 ( ; P`h #`(; X P49<*І*  ((#`#d"`"d" `("d`B ":(`"d" "   0 0 #㿘  @ < z#$  mfsmfs_mountroot: can't setup bdevvp'smfs_root㿐<! <b%<Ȁ <ې# S <<#cH J $ .R <b<.< 4" " H" $ $ $`0$ $ ґ  @"@S? S< .0"<<#D""#D@ 2##D"#D"`" !@ Y `q ԉ @i @e 㿘\FaT 2% 0@@4  eg84 <$T<<.#"@RT"<?+` `?@  `<<"b "4mfs_mount: dup devp x {@8@"<@ NҀ ` @   dNҀ [8@2W.Z b  ɖ| R<?+ @ |?  @  " h ؒ@  " $<n! .Q |" $  0$ $ $$ ђ $?@x !ԐpCx"Ԑ" @Mn @NД Zp3 Yx Z" @M^  |$ mfsidl㿘@  `K# , w 2 N  4 N b?2 #* ` b?  *@, $ `#<Q %< $@ol+ 2 bj  㿘m6@ `<@LU mfs_ioctl not VBLK㿘  h`<!X mfs_strategy: bad dev㿐<  ! A 8 R4 2<! `2 0 H*  $@   <  <@N 0a0 @2@ 0 & k" 㿘 H $* @ @ <o 0& ( <o 0& ( ( "& 4 $(& $7 "    "     2" mfs_close: ref count %d > 1 mfs_close㿘 `$`kz` 2      T4`4<#H4* :  <` <#h?$`kU mfs_inactive: not inactive (mfs_buflist %p)㿈  `<>< @<>'''H*`  㿘 <)<#$<0 #@ :@*` hH /* 'R <0  *@ *@   P .0<)!ȓ+ @ @ "@ " " "H 0&  tag VT_MFS, pid %d, base %p, size %ld 㿘 <`!   = 㿘 "   ` "      @  X`D ``@'@H@I@?"Ȁ "@ .' .`(*@ `&`" `` 4 @6 .` ?.`@,   ``` '@.` ⏐0 Б* @  m'/<>` c _  r $H   $b2( $,@ @$ H$ $X'' PXH*` €<  ,`",  <*$ `"`"  $@@6  <.` ?,@ @  '@$`@@ & < ?  ' "((,@`&?& 㿘 D!@&` ` V   &@ $@F >`  2?@ (??%8  ""@ "&&& ( $$@G    @G$ @Ga  & $$;` @F#   ݦ 2& ufs_hashlock㿘<<!t0  K5 <0a4<* c  <<# "c<*<  ( @22 㿘'<*%< @* @ " @ @2 2  `  0 2  㿘 4 KI  <* <   *@ @ &@ " "@ &     ffs_inactive: pushing activex << c8   T 4 <!(`x J<>T`z 46` D 8`21`@ې <>??@ <>⬔?  '''?'' H*` `<>`x`$``$`4`x"'?'" H*` ` <>''''' H*` <>''' H*` `x` ufs_reclaim: pushing active㿘<<#8`"  V 4 <# j. " $   `"`@ $``  mangled entryi_size too smallP' '  '`''`'' <=''<='''H*` €? * @ D 8`"?   m  @4  944@<>''' H*`   &Ā" @7 ֒ Ā  <> @ <>''' H*`  `@ɰ Ā @ <>''' H*`     'ж  2 D @"D  ?'D@`H'``   `;   `@  $`d.'̤@$$`d ; <>!'?'''!H*@ ఒ <0c$`l ` ̐ `d"`'<b`  '"``aB * 2` @ 2 2* @ `d*    'Ȁ`܀  U`d :<>''<>?''H* @ఒ  `܀2 <?  <@  <R X`@= `<`d@  `d"" @$`dP`%     ?"@`$Ѐ@``d  2? `dЀ&`d  " "  2 @G  2 D <`$  "W $`h $`l`d$`d ` `dk ̀܄ ``'$`d\ ޹ 2b   @ @ 2Z @"VT`z Q<= ''<='''H*` ఒ j``aB * 2` @ 2 2* @ *  $`d$`X !$`d $`X%$`X$`d$`X,`  $`$`\Ēh %<>'''H*` .?@   2 <b` "`   ?` 8< `<`d@  `   <`$` @`d >$``O @J<=''<='''H*` ఒ `d!"$`X$`X``h 2 D4  44   ذ `x""`耢  耢@ Ȑ  Ā5 A< @9<= ''<='''H*` ఒ `h` 2Dz   ذ sĀ (%j <>'''H*` ] @(<>'''H*` D  `h `0AĀ1 @.  *U02`h` 2D4 44   ذ !Ā"<> @2<>'''H*`  @ %s: bad dir ino %d at offset %d: %s bad dir㿘 <`D!8 ~Y  B`<|!`First bad, reclen=%x, DIRSIZ=%lu, namlen=%d, flags=%x entryoffsetinblock=%d Second bad 㿘   a"" @4  D ? @ $  D`8 <!~     <~" @    J@ `@ &J@J   㾐 '/@F`D< < x 2 // @ufs_direnter2: newblkufs_direnter2: frag sizeufs_direnter2: compact1ufs_direnter2: compact20` X  ?`E  d!"<|#x"6`< <=?ؖ ''''''''''В $"?"?H+ ' @D@@ D <{#  aB * 2` @ 2  2*  *  % =  d :    <> (  @ :  d= <> ; H?'?ȗ*' @ y ``  ? X  "@`4`@    ? "  @F" X @  ``@Dؒ`  :6`<{# 6`66`<{x#6`4`@@E<>c''PcH*`   "%  \ ;    <> ; H $?''''*'@ @x`@% `d<> : Hܚؔ?'''+ ' @ _ܐ *<> "c''PHc`X2"`d`d<> : Hܚؔ?'''+ ' @ 8<>"@c''P$c" <> : Hܚؖ?'''+ ' @ <> `n@ 3 ''PH*` `&`x d  :<>?aܘ''''a H* @€ `" D`<<`x 2 *<>c''PcH*`  $ `   2G  (C  ܐ  #\#`#h#d#l  x 21 ܀ 2- ")   `4  L .2 `"  L .2    @  D8 2  8  checkpath: .. not a directory `` ` @>'܀`; h5 6 4'ܔ #\#`#d#h#l     $ 2! ?  2  @߀` Kܔ`D  찒  h`ѐ   2<{#܀ 0undefinedgroupuser㿘  D `!@  @,  " $ $ 2   $@    㿘`"] (  , @" ` 1?`6a[ ``(,&(&(#  6  , 7 5    , @"  @P   ,   , @" 6a! ``(@ 6&(  ,   %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too long㿘.  ( @  " $  2V E 耢 2Q E <R D`<#Hz` A4  $@ ? =<* Da@ 0В@ $ 8 耢 2/  <R` D <<#x`y" <*  8 $   2 E 耢 2 E <R` D<<#`yĖ  4  E 㿘`"] (  , @" ` 1?`6`i ``4,&4&4#ߐ  6  , 7 5    , @"  @B   ,   , @" 6`/ ``4@ 6&4  ,   %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too long㿘.  4 ,@  " 0  2V E 耢 2Q E <R D`<#y `  A4  0@ ? =<* Da@ 8В@ $ < 耢 2/  <R` D <<#x`x@" <*  < $   2 E 耢 2 E <R` D<<#`xX  4  E 8 @'a@.''''ܐ   ~`<>'''H*` h`  @  g [ @^ @  ,`8 @ &`80N &0$ "@ 0 8 2 @ #@&$ @ 2``8 4&`< $@ `" V6 T  2` T@2`D2` 2V6  ?,@㿘a@.@I @ -@`  TS    @"z T@2` D 2 T@R0 $0   %L?$ @ ?-@ .`.`8*@&`8㿐!@ @T   c& @h p!@c  @8Ԁ 6 ^  `` (' 4'   8' <'܀ " (@  $ @ <*. 0@  А '耢 " 4@  0 @ ؙ. 8<*@ А '& & $& (䀢@ & ,& 0& 4& 8& < ?# @6  4 0 ? #ߒ @6 2  $ 2  , 2   2   6 ?# @6  6 @א  p!@b S @Ԁ J6 ]  `` $`" 0 (   <*. 0@  А & 8 0` 4  쀢 . 8<*@ А & <& ( $ & 4 ?# @6  4 0@? #ߒ @6  6 @{  㿘!@  , `   ,  0 `,`D@`T`  ` `,   `"  ` " @q  $``T@ע`2`D 㿘<0a4<` W{ <#"<a"a" dquotfree dquot isn'tX.  @ `<'  c`<<b *  %<! 2   *` 2    ` "` "  "@  4  2 <!؀ %<<0!4<,*` <R<R`l "`l%<<R l,@ !ؐ @ Bǔ  @>g @,$$, !<u,!' D ?@" <u-!` "` "  "@ " "@` @ $@" $@$  .`  4 4 <=4 $ $    l ?''''' '''''"?''lH*` `    @$ $ $$ ($ ,$ 0$ 4$ 8$ <@ <>'''H*`    ] 4 "  " "@@6.' 0 2  $ 2   , 2   2  4   "' 8 2  <<* 0 $ 8 < 2 ' 8<*@А $ <'  2 㿘```6`` @`*`  6`<&`a``&` `""`dqsync: dquotdqsync: fileH`<tP#`2`t ``* @ <t@#` `"`#<>6`[ ``'''` H*` I `* ` ` `  ?6`''''''''+  <=ᘔ''''' H*` ` " `?\*`?# 6`<>''' H*` dqflush: stray dquot㿘<#`<*` %< *`   `sa0"`""`2?: 㿐 `    &@㿘  >`#&2  `   " ` !:I  F``C  ǔ < #.%!" 0.&$ 0&" 0#v` @>諐㿘!@`D  `0`4&& 㿐 ` ` &`x ``@"&R & F 㿘<R`p  "`p?㿘 <<@*` `  @ C 㿘 <<@*`  ` @ 3  ` "`L2" "`h$` ܀     P4G<*І*  ((#`#d 4"`"`(@":(!`""`"d" `("d`B ":(`"d" " #㿘   ``h`<Ȑ#D*` €##h#h###h###`D 8` i 2  ܐ @" x   x o`h  <*Є(  (` (#`#d # `# d#   ` (# d`B # ; (`# d # #  #` #` x#`S z#` #`  #` #`L ;`  #`, #`0 #`4 #`8 #`< #`@ #`H #`D`h( #`(2`D@#`(H#`(  ( 0 ( ;`P`h #@ (;`X#x      ?2  ?2  ?2  (?  L? T? D?" H ?"<`D 8`ް `耢@G!:  2 ``@<;"x`ǰ  H  H?c ?$` H $`` $` H`  ` @  2D ?" D 8`   @ј  ?2h $?"( ,h "  " D  "D  8`s  <>"'?''''"H*` ذ a ,? 4?"K D 8`2T `耢@F!: " , ` F<= '''''H*` ذ 6 ,? D 8@ 2 4` $` 4?<>` $` ,'"ؔ 4 ''''"H*` ذ    D 8`  @㿘  耢@ :F; "* " x h b"  O F 2 xd" x < o @ @$ 4 x 0 b2 @Uߐ chown: lost quota㿘`耦`` 2!:@  !:`쀦 Eے 2 `!:E `w`谒 ` Ő$` 2``$$`$`  ? r`  '   $`$`L 2/$`쀤` $` `$$`$\  2 F  1M  x'   $`$` '` g$` `$`$`$*   0  "`<oɐ"  $` 㿘 h    @2 ` ܒ` "   o  @ z  $ 4 z@0p h  <>D''D'`H*`  `DD@<>D''D'`H*`  @   <>D''D'`H*`  z#<>D''D'`H*` g   @" D''D'`H*` U  <>$ 4 zب '''''H*` а Ô  < z  $ 4 z<#$<0<)#@ :@*`hH /* 'S <0  - *`  =* 0<)!ȓ*@ @ "@ """H 0@ <>'''H*` П$㾐       " D%  "$`< V T -' /  @9? /   * & j $7<#$<0 <)#@ :@*` hH /* 'R <0  *@ *@   < 0<)!ȓ+ @ @ "@ " " "H 0  {& ufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryrename: lost dir entryrename: mangled dir8   D'D  '  0 `D,  !<> D''' DH*` € 燐X " DR D''' DH*` q~@ ` ܒ` а  ܒ` ɀ@ 9 h <> D''D'H*`  GE` ` @&`<m" &@v<=''''H*` 7$  !<>z @<>'''H*` u  @<>  @"x'''H*` ] <  )` `J`.`  <>   " <>''' H*` 3 $  Đ  z9<>`4z$"''''ĪА %" H*` € <>''' H*` ` <= '' %'' H*` €<>''' H*@  @2&$ d`" @  ` @2<l#ᙔ Q  `2J` @<lː#( z@.  `4 z $ "' ''''"H*` € `J   z  $ 4 z"'''''"H*@ `y @<@<l#(`@2 x<ly#8 x""`x  `" `x 耢@"`x`耢 հ `x<    ǰ BT`z À :  `  z  $ 4 z刐`z4`z*` 4`z<l-#P <> ' $  ''''? H*` ``$``` ? &`<l"ྔ   <k#p~ @R<k#p><  z  4 z$  #`#\ #d#h#l   ݖ  %  <?  <̐  ,#`'#\ #d#h#l    Иr 2 ``z`?`4`z$`` ?$` ``"!``  ?$   z`$4z0ufs_mkdir: blksizeH`cz` ` İ <> a"('Ƞ''''"(H*` Ȱ < ` $o$찒 2     " 9d <>Đ'''' H*` t04x $ "h4z ܐ $!<>"''''Ԫ %"H*` €z`4z$''''%"H*` €Ȱ G<R x` x'`'`'` '`''''D < ,//#`#\ #d#h#l   Ֆ  2zD!@@D4<j" "`<$Y "`z $4z " `4z`$<"@<#$<0 <)#@ :@*` hH /* 'R <0  *@ *@   8 0<)!ȓ+ @ @ "@ " " "H 0㺐x   ` ِ㬐J Tz ? B  2 6 B @1  @+ '` z `$ 4 zバz<>4z b $  '''''?b H*`  `db㿀 (  @g (@2 D`<@6  @4  <` $ <   #`#\  #d#h  #l-ufs_readdir: lost in spaceH   ! $"  <= l''''l' H*` €ഒ 2  " < <i! #@"@    @ D  @8#@- (@  <)K"H<)H"h@<)C"<)@" <)9"<)6"耢<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    T6 "H 0< " "@  @ D; @42 8$  ` @  2   @8" "㿀 ``D <@ 2   2  J <= l'''l''`H*` 㿘  3 4㿘  `3 4㿘 `2 4ufs_strategy: spec㿀` P`h? `<h! H D@$<> ' H'' '''`H*` ఒ "  H $h$ $L$ (0  <@1 0 H$ 4<> `l` $ 8#X`H*` € 02 tag VT_UFS, ino %d, on dev %d, %d 㿘   ? 3 <  #iە2 h  4s 4<iА#@ 㿘 D`82<=` "`<=!l<*` 㿘 D`82<=` "`<=!<*` 㿐 R`4 K`<*`В``*" *  * '' `  "9<=  # #  ` (`B # ; (`"%   # " <=  # # #  `  (# B# ; (`" #  # # <= <*` 㿘 <=< `# lbt* @㿘 <=< `# bt* @㿐 R`4 K`<*`В``*" *  * '' `  "9<=  # #  ` (`B # ; (`"%   # " <=  # # #  `  (# B# ; (`" #  # # <= <t*` ` -<ӄ(PPPP$P0P<PHPTPP`Pl` `  ` $`  "`   `  `  `  *   㿐   `0` #\ d 㿘< <<`xbА 2 @`&$ h<Ԑ!*` €QQQQ8Q8QQQQ$ H`b < c& $ H$ =ᆐ$`$ H` 2`( 0 $ 0`(<b@ <`(b@`+  * " *  * " * <`(&x`'<@& @<>"( "(`H'''*'' @ఒ "4  $  `$ 谒 2    " 4  <>ܐ'''' H*` ߫ @ <<$ 4 xbЕ2 @  " h xd4 z ; 2  ;ْ " x ;4 x@ ܐ $ <>آ ''''' H*` ఒ 2E 2>@3<#$<0<)#@ :@*`hH /* 'S <0  ,@ *`  4* 0<)!ȓ*@ @ "@ """H 02ܰ  &4  * 4 z`$ #amap_lookup: offset out of range㿘<  6@ @ @& <e!8.`@amap_lookups: offset out of range㿘< 6@  @  & <e!.` @0$.amap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in use㿘<   6@  <es"(.   2 <ei"H""  <"H €0  @ " <eT"h "@  * "  `$ "amap_unadd: nothing there㿘 @* <e8"(.`@ 2"@ <e0#h   ?@  .` *  ?#  @  * " ?& 㿘 0`  $   $  $``` < `"  2 `@ $`` <`  *      ,# @&㿘 0  ?@03 $    ?$  $``` < `"  2 `@e $`` <`  * ?  ? ,# @amappl㿈<:<:a4\ R<<#`#d#h"a#\ (  _ 㿘< 耠6 6@ @?%< ``А (,` & & && & $& &  R1 &  R1  & 1 R  &  2 R 2 Ras ,` @-y 㿘)<)'< %<0$# :@*` hH /* 'R #<0`  * *`   2b R0<)!ȓ*@ @ "@ " " "H 0 $#@ :* hH /* 'S  ` * *`   23 R0<)!ȓ+ @ @ "@ " " "H 0 $#@ :* hH /* 'S  ` * *`   2 R0<)!ȓ+ @ @ "@ " " "H 0 $`1/$#@ :* hH /* 'S  ` * *`   1ђ R0<)!ȓ+ @ @ "@ " $" $"H 0<"`㿈<`` 6@   ," 2 @ 0@ ''`@  '`$ 4?2@ 0,`  &#`$`$쀣@ 6 "@ *  @ ``$#@ *`*` " ? ""$`  ?+`((   <)K"H<)H"h @<)C"<)@"" !<)9"<)6"耦$<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    R0Y "H 085<$7<0`$9<)# :@*` hH /* 'R ;<0`  * *`   0ے R0<)!ȓ*@ @ "@ "`$"`$"H 0?$`$9<)+`h5<7<0(;<0``  `<)K"H<)H"h`@<)C"<)@"b a<)9"<)6"耦d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '   R/ "H 0h'   <)K"H<)H"h @<)C"<)@"" !<)9"<)6"耦$<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '   R/> "H 0h'   <)K"H<)H"h @<)C"<)@"" !<)9"<)6"耦$<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '   R.Д "H 0``#@ `@+ƕ*` `$`*@+`-`*  @*R`$` `*@+` * @*E`$)$``*@+`* @*6 `$`$@ `<` "@ *  @A ``*`*` % ?%"$` $`$$ :* hH /* 'S  ` * *`  / R0<)!ȓ+ @ @ "@ "$"H 0$&@ :* hH /* 'S  ` * *`  .ܒ R0<)!ȓ+ @ @ "@ "&@"H 0$$ :* hH /* 'S  ` * *`  . R0<)!ȓ+ @ @ "@ "$"H 0 /?-$& :* hH /* 'S  ` * *`  . R0<)!ȓ+ @ @ "@ "&"H 0㿘< 0   ," `2  31<` , @ "    "  0"H€ &` 0 '<`,   ,@ & @6 ` *` `" `0H€`  &`amap_wipeout: corrupt amap㿘  #< ,  *` `@ ?_ڐ` "@@`   & & |& 㿘`0 28 )<` ``"2 ! , @,@-9 @,@-1@`@* ` ` @@ʒ` `&`," &`0` 2` ` ?&`<``" 2 @?9< `[ɐ" (. $ $$ $ $$ $ $  R, $  R,  $ , R  $  - R - R\l" L`0   ` &` $ 0=@6!`,+` @ *`  "  @ `"`@ "@  "@   *#   $ `@&`,?    ? $  ?` `?`,@K# `&`0 ?&`&`,amap_cow_now: non-resident wired page in anon %pcownowcownowpage㿘`0  S?!/< , *``2<ܐ x^ْ $=`, 29`$` ` 4`$ఒ  ^  @<      @+(  `  #<@8@0*` @&$ "`$ @@%6`$  & amap_splitref: split at zero offsetamap_splitref: map size check failed㿘< 6 2 <^v"0" " 4$<^l"X 2&`@   &` "@&@㿘 *h'``  `<)K"H<)H"h`@<)C"<)@"b a<)9"<)6"耢d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '  * R+x & $& $"H 0 $ 2 ?& $ @'*  $  : "`"@amap_pp_adjref: overshot targetamap_pp_adjref: negative reference count㿘<  6  $@*@,`  @ :@&@.` $   $ @"`& $ $ @"`@@ܓ,`@>@<]!0 ` @ :`@$, $   $ @"`& $$"`<]d!P:$ $ @"`2@@@@Ǜ,`㿘 6   6, "   `"+  &% 6"  *@ "@    ?@ +` *  ?#    *`"  ?& ?  @ ΢`uvm_anon_init: can not allocate %d anons uvm_anon_init㿘< ` `: "@<R8, @  <ސ X^<\ @& <.$P "D $T`D"@"D` <."!0uvm_anon_add: can not allocate %d anons uvm_anon_add㿘<R8. @~  <ސ!h^E<\!@%Ȓ <P T@"T"P<.  $ D ""D`<.D <T "D T"" " 㿘    ,  @;   " $ ,$ ?$ ,`<@4 $"H € 0@)@<.D<& ``T"D "`T㿘  @:  & <``H?"`H   ,    *2 *" ,㿘 (>` $@* @  @  2 <* #`XO `&" $& & &   @% @uao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP object㿘`  = <]k <[̐ ` @/ @  `* * @ "@ !  "  ?"  """@<*#`X 0` .`@"@㿘 `@\  (" ,`"< +<* `,  " @9N  H% H  , @Xc`   $<<0#$`$ : <)*`hH /* 'S <0  *@ *@  )| S0<)!ȓ+ @ @ "@ " $" $"H 0K<  < , @ "  @8 `H$`H    , <<0#$`#@ : <)*`hH /* 'S <0  *@ *@   )2 S0<)!ȓ+ @ @ "@ " " "H 0<!lXuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots failed㿘<  `  . 2@ 1<R Ā <Z @<! ? & $ $ $ ` 1<R <`!<Z!  & <!lVג  $ $ $ ``<R 6` @ : ! 8  S   6@   @   `* ` ,`@`2@ $@6  " $ $ ?@А $?cϒ 4 $@&30?! @<d4 $ 0& @ 㿘<"H   0< @2@ `&@@&  `    Ő 㿘x @6 < (< ,udv_attach㿘# @2 * <*aL@ <C!(<C!P"5<1<? ඦ5<(`")<)`@`` `2``"<)`` <`&`x   (`` &``&`@5` ?t&`H /* '   ( T%b "H 0(`@<`@`` `2``5<<0#$`& : <)*`hH /* 'S <0  *@ *@  %ڒ T0<)!ȓ+ @ @ "@ "&"H 0~( <R & &&  & &  & & & (( & ( "`$&(& $ " udv_detach㿘!<)#<  ?L&  ` `&   b   ` $"`$  $" `<?<#$<0`& : * hH /* 'S <0   *@ *@ %c T0<)!ȓ+ @ @ "@ "&"H 0 udv_fault: !PGO_LOCKED fault㿘 ` @\<W    " `   !V > # 2 * @< *` L&@   ' /<܀, <, <@?" @@ <  @ ޢ@    !  udv_put: trying to page out to a device!㿘<V!fltamapcopy㿘  & &       `" @]  "5     "@@ *&       ڔ &   `& %                <@'!         anonget1anonget2flt_noram1㿘-< `"   <a $儐 "<a $刐 "<     ,   % $ @`  4 $`$       h <(   a <8   &    @"j     J <$@'n#H   > p$p @3ٔ   $   ,   @  #    $ 7` $ %?= $ϒ @4 $<"H € 0<`      +$`<&@#I`     cd€ 0@`"   ," 2 ଐ P$଒  Ҕ  fltagain1flt_noram2flt_noram3fltagain2flt_noram4flt_noram5;<``X'L``  "`X.@ `?'H'P'''''   @܀  "@@ *'     ' `'耢    u  P @    h  ( 'LL`L 'LL`2'P P`    G Fؒ`` "`0   H  4  H`#4<Ra* `* `#@2 8  @" 2  ?,@ #@ @     ,$  4 D ' #'<. @ "   "  $ 2  , 2   ( 2  H € 0@P &. `$ `@ ,@  @ @  ,`@``%,@  M ? @ <bԟ€ X8"@ X @/"@"@+ @ `'``, #``$``@F `<ܐ "ؘ@ ` 0 `(  @ ``@@ ` P @#`#\` L؟X ̀  0ɀY2Y'P` 'T $  X $ TP`` 4 @#\#` T7'P3  $?"@'P@%? <`& ؘ` 0  L $ 0$``@@֠ 'PǑ,@L E  <*< [  P ,``? `2; 8`     @ 2     <@$"@ϒ<  "H%?0"  `,?"`, "  `* 2`*$  *? $a 6 $6 *& `J` E`Ȣ`"Ƞ      @   2`   t {`H@@v<`"@$"@x $?! 6 $ܐ ,  킒#@ @<ܘ? $@` <ܒ`"  ؖ@LPܟ 0L` @K $?# @6 $@䀥P?'P  ` ` @ P <a $儐 "<!  !$ e`#e `  $`'T PܞTP"  `   4#\#`  ` <*< В 9g 9` $` Ӕ @ ʔ  `  $`P $@   ,옒"      #P$ "$: P$@ `   # 0P@N P#?`$cϐ 2`$]`  $ `2P , P`     @ #?P$ "$:N P$cϒ @ P@2$  W  <"@#{$ P@a $?! <P6 $"H  0P$ "$:% P$cϒ @ P2$  @ @s'PL      @8   1PP$ #?9 P@ɐ Pc$ 2$   ``H`@@``  n"`&`<`$`@#"F؀?!`В@" #?<P "H0P$ "$9 P$cϒ @ P@2$ Ԑ`@"ܐ ,  #@ <ؖ"@LP 0L`@ *` ? $# @6 $` 2@  $@V $ ?9| $?aϒ 6 $    㿘@@  %<    @@0  uvm_fault_unwire: unwiring non-wired memory㿐@U<#%<'<R<bԐ€ 2<P P@K  ဆ !4 <# :" : +`"@ *` " @  #  `:" : :? **"@  *`*   *  "@b@@ <@ 㿘  < @ !<R:!8 @     !8@9!8  ڔ <R0   < @ <b* @* 㿘  < <!  :`  @ 㿘< @ :`  '@ 㿘< @  :` G@ uvm_fork: uvm_fault_wire failed: %d㿘a$@*<R@ &` <Ra8@  ed<P$#pb &`&`$ $@#D @?  e`@ H@<㿘@S <Ra8@!$㿘  >`0  ;>8  >`  5<>(.@  >P㿘!$<R8@ H * N -  @eʐ ( & (H p@<& pt "tschedulerschedpwait㿘<*   J- 2( 2 p?t* @ "@@ $  2J-` <<< (h 6v <*```2  <*Ho o<@ !xH o@<*㿘<*     / "-<R (  2$  ̀ 2  L -   p( &  4  tp@ @@$`(    2 (`<@* 2@   " @㿘<R!8!$!@  @.H o*@ n ( N - ?`& (@eH 0<& p``x "`xuvm_init: page size not set㿐< `2<.<N   @ l<("@@6@!@@5@ 㿐` ` ?@ ^ ;#@W " -< @  :`   C +<Ra8@    6 3 4 * *) ( $@8/ a8  Ք a8`  #`@ @a8  ǔ $ @ %  a8kmgetwait1uvn_get㿘`@?@  @4 ?!`)<?%@}    @  @ $ @@4 $ @ $@    4 $& `@@մ'@P N  @I ?!)< 2= @8  '<%<@9 2 $   @h 2@t  4 $     4 $& ܐ   @8 $ @4 $& `@@ uvm_km_init: could not reserve space for kernel㿐<' <<R<.a<"aP""" ""< #!<""ؖ""?"" ""#! !<"8"@9 <ې!$"8E& c' @.? "<R<M!P"!8uvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation failed㿘\`@<  c'*@   @? "@<ME"x@&@,  @@ 2 @<M4"@А$@@ N <M$"㿘#<` <R`  & 2  `?*  $@F'<@A ` $`@4 $H € 0`6@ @`@@ 0%  " '<   : $`@4 $H € 0  ~2 @y 2 km_getwait2㿐%<  0 c'.  '@T? ;  <R7@`@2 !8`0*" ?#)<'<   @ `$ 2`$2 `0@` "  &@ߐ㿘< @ :` @"@ 㿐    < & @ :` @ @4   @ uvm_km_alloc1: non-released pagekm_allockm_alloc1w㿐'< <. 0`@ .@ 'hc'@Ø? <RM !8``0>" ?#)<h@E $@<<L#p` 2$ 㘒    "`h   @c $ 2$20<@i#`"   $@@`2h$@ 㿐<`<. 0@ !P.@ 'c'@b?  vallocwait㿐<` 4@  0.@ " @#<. !` h'?@B#'  < 2x  0㿘H *<`?H p@㿘H *<H p   '-<'''''   @܀       "@@ *'     ' `'耢TԨ ,  `5 `S$   ؒ@O `ؒ@  `ؒ@ ?  ?  @Ϡ  ?  * & @  3 2' Ԑ": ` @ @ loanagain㿘"*     <"H €0  &@*"@ [0   "  ?<*< h 1t  ,` `<"H €0,`&,@@ "@@ &@fltagain2㿈 `` `0` @#`#\ '& '      2 w      '`& #\#`    ð?<*<  1  <   $      @ v     $  $   ,C"     W   $ " $27  $@ `0 q @ ?`$#ϔ 2`$g  , 2  ,< 0H€  ,`@8# ,@A"  &@"@`@&@ $5 1  $ " $1  $?#ϒ @3 $    '?&"  ,` < 0H€  ,`@# ,@"@ &@ $` " $1Ð  $?#ϒ @3 $ loanzero1loanzero2㿘k &    <@"<`  $      @      $ `     @ " @ $?! @6$@"@`@&@ I&,G   ~ "@?쯐<@"<`  $   l   @ c     $ `" | "     @g " @R $?! @6$@@"@@ &@㿘`@ ? "@d `uvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!㿘`-%<#< ,` 8H$ ,@] ,`    $ <a`HbH 0€ @< ٲ㿘<)H /* 'Ȁ     "ȑH 0@ &thrd_sleep㿘 ( & l& t& (& ,& |<& 0& 4& & d& h&    : & x& p㿐    & @~   @   l" l㿘 = l? 8& l 0 4@<)<#$<0`& : *`hH /* 'S <0   *@ *@ ) 0<)!ȓ*@ @ "@ "&"H 0mapent_alloc: out of kernel map entries, check MAX_KMAPENT# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpepl㿈<R<!<`"`!0"`"` "`#!"`<<L"L!P"" "#!"<<"!h"`"` "`#!"`<<"!"" "#!"<<"଒a" #!" " " <.8"8<" "`L    L"@ # L` :`6` 2`$.`4*`( &`0 <  <aL  "aL `"`0@`0 D` @$`  h & h@2 ` (@"  @`@2 <` "` <"A , 8H /* '<. L  "LH 0  2 <E , 8@@$ $ $ $  $ $ @  @ $  $ $ $ $ $$ 4@$ (@<  *@  ϔ $ 0$ ,$ 0 d & d$`$ $` " h |@& h`  @:& |    t ( "< @    <଄ "  , ( @  " # t2 "# t 㿐 0\@'H`C 'H 4@`2 H 0@2 H | (`  `&  'H  'H`H@HH 48 *    (@"$ t` 䀤`$ t&㿐 0@* 48@8s   @_& t  | @  (& |'K&'< G    ("    $ (  "  2 @c@<R8 0  "@  G"  $  $  @R  d?& d " " h"@& h$ '2 & 㿘 9<. %< 0 Z      8"  8  `" 8@  8  A;H /* '`L& $`LH 0  2 0㿘<  0@  .@ &`  `?㿐 `2S ` 2O ` 2K `0 E "@& t |  & | ""&"` d?& d& t | 2 d& | d?& d""  8 <"@ƒ  H /* '<.``L# "`LH 0  㿀'L'   ' L ''L  Ѥ@ & 9  '䀏` &@ @ & t  `2o  `'   ' (@`2  ` s        m  C  "'' ` "<"?m , 8H /* '<. L  "LH 0  2 <C , 8 $ $$ ` @" $ ` $  `$ ` "€ `$ $ ``$ ` `$  $ $$ ($ $0 $ 0< 耥,7 @ $ ,  ݡ$ , 4'$ 4$  @   "         D'`2%@  ݔ    &` L@     Ô  ``R `  & t |` & |'耢 3  (/ #" @C"  @) ' d?& d"# " '  ј    m   g  Œ 2+   X &L@  I       ? `7` `L@㿐   ,  &  0@* 48@8 @ v   '    0  2  ""`e"`    㿐   ٔ  &  0@* 48@86 @ #    M   '  (@@`: ` 2; ` 2`@ 2` @*`&` f ` &`&` &`` <  ``` ?c `@2`  l  㿐4D  ?   \  &  0@* 48@8   @  (  (  $ $ 2   $  㿐`   `$``0@ `48@8v     E @[`(" : ( } @:   "u  q 2    (? $ (@ k $ ( 2 `(S @:P@ ( @   @ @      @   z @  c (  @$ (       (?$ ( 2   j U  2 @)<ې!@2` @$`  U   @  (? 2    "  ( ?$ ( 2 @!@2 T`  / `$`  ` ?$`          㿐     0@* 48@8m "   K    F   (   (  " @"   ֔ +  *    &@ @     " @ Ð   @    㿐 @  (@" `@*  ` 2 ` @ ` 㿘< ;z @ 㿘 @F `@} @{  & & "`  "㿘  @Ho o@& @UH p@@0㿘 @`2 0 ^ <04Ho o@X& @)H p@@㿐 ? &       d  &  0 4 [ @|"< ;&fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)㿘 ǔ 04$9 @ ,(2-<`" ` <>Y"( 2$<>S"`"x 42`   z  <": ,`8H /* '<. L``"LH 0 `2 <> ,`8$$ $  $ $ $ $ $  $ $$ $($ (,$ ,0$ 04`$ 4$ (  `"  d` " d€  d ( & d$@ (`$`"`"@ `" @ <":  , 8H /* '<. L  "LH 0  2, 8<= $$ $  $ $ $ $ $  $ $$ $($ (,$ ,0$ 04 $ 4}  `"  ` " €  $ (` $  d ( & d$ (`$ " "@0`"(` (     ݡ 0( `/r," `      `$ @   #@ @C `    2h& h  \7㿘<*@[  2<R<@ <R!p<(2`@t:` %K 㿘<*  J- &  2   8t 82J-<R!t (,@@ h%,` @ c4 & h`"&   <    -0 -0 @ 0<!);"""" """"" "$"(",<*=<(b25J-81<\(pp`<R p2t:2pt: `"222(<  ",   D "  D  "   " "(""" "$ N N N N< ` `  @ ``D ` ` "'t @ð     ; d  `t"  't<@ ` ਐ@t @ *'t@f?  `, @@ 2T 0   `h   `0|` ``l@MZ` B@``h 2`` 2 `     0Z `" <=`'x'|"?''`H*` x C @  0: 06  ` 2 `     @<0`"#\`*   :@  c 2#\ (#\ #\#`@t t&㿐`@K`H  E "< @ @ @ $@ * @ 8`       "@  " , @i "    0   0    㿐< @`   $ ,<@   I  &   :  " 0     㿘< @` @  `   #@  @  7     㿘< @` @   ` #@   @   0   㿘<  @`   $ *  @:   2 8 (  #!: "     㿘< @`   $ * @:  !: "      㿘\ `b < 䀌 2q 2m `2@@ *  &@@ 2b #@@@"h?`. - "l`?@`  @t ` ?Ɩ  `h . , 2/ @/ `-  @     @ "    ڰ 0  <<. 3<(4H(@   2    2  H 0 2 H  (E*" <.  *?# @<2* *!<0 2 <. " <.  *?2* "   (2(((2(<."  "  " <``"`*2*` "` 㿘 *  `"  "`<."  "@ *? <6 * `?"` * ' 0 <<.& <.&! &  ""  *  6 * <`# ਟ€ 0<b  0 ? $# @6 $`*!0 @2 ``<. "`` <. `@ `*? <2`* `("`*  @<.` ` `@ <2`*<. "@ "`" 㿘 $?# @<|6 $ 0㿘`$?# @6`$<*, 0`0 0<<R  < 2@#`: " 8* (@@ " @@  ?: " 8 : ?( #(vm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %d page(s) in init uvm_page_init㿐<. 'D'H  "@" ```<. " "<."`" <.""`<.<#a  "`8"`4""`<" " <.<Rက "a(<8# @ <<R#င  ` @ " <`* @`4., , @@ <Rဪ @ X<<#  ``"@ ,<$9u#8<7֐#`*&@*<  <  *@'&  ?  `" 04 @ <@ '`% @O'<  4<Rဪ`@`<<<`<.D*  ` H+ "( "$uvm_setpagesize: page size not a power of two㿘<`" # <7a"` #   `+ "uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memory㿐+<`)<R!`.!<#<א @`s`  %!`;  $ $`<< "<"<7#8 * " )<'<%<@) "7hᨖ   ` vm_page_physget: called _after_ bootstrapvm_page_physget: out of memory!㿘 <R! #<c<`  %<` `<6̐ @2>c`  :9c *& ` @ #@ @ 2° ! ?6ؚ @$<R!`+ " *+` " * " " @" """   =! @ 7 * &   x ! ?6mؚ @n$<R!`+ " *+` " * " " @" """X ! `r 6L <#<`  :8`*&`"#@@ 23  2?<6 ؚ @ <R!`+ " *+` " * " " @" """   ` vm_page_physload: page size not set!uvm_page_physload: bad free list %d vm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%lx -> 0x%lx vm_page_physload: tried to add RAM after vm_mem_init㿘< ` <5  <R< 5!`  <77!<!P71 0] < # @ 2! `! `?` <5|!  < # @  ( `("!<* c@  + " *+` " *# " " @" """  ` ?  !  `!!@vm_page_physrehash: WARNING: could not grow page hash table 㿘<R!  <#?    "  @ 6,`,`@ &,`,`'  <)K"H<)H"h@<)C"<)@" <)9"<)6"耢<)1#<).#(  <)"#H<)#h<)#<)# @<) #<) #<* <* (H /* '    N& "H 0 <60#0  ""@` H /* '<.  8  4 " <" 4B" 89(<.< ` ` "` $` "@  3<4 *   <3 4 *@ `" 2 < 4 * @"`@2à H 0<ג` @ 1<<0#$` @ : <)*`hH /* 'S <0  *@ *@  = N0<)!ȓ+ @ @ "@ " @"H 0rehash: physical memory config [segs=%d of %d]: 0x%lx->0x%lx [0x%lx->0x%lx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d 㿘'<R<တ 5^ ဢ @ <<# )<  `@5Kက@  <5D <5A!<.< 5<!Huvm_pagealloc_strat: bad strat %d㿘H /* '#<` ,@ <.0@ 4 <.!  ` ?2` ```(4`$`$ ~<<.a x  <./` 4<     ``0c@  @ ] 倧 <"35` "`" "@`"H 0 &"`6 $6 && & & 6 (& ,& :6 * . 6@< 4* H o*@ g&  & ""H p@ &    &  "@ "  $ `@6 $ " 6 *H 0  C $@?<<. 0  < 4(@H(   "`  H 0 "   $?# @2$"&"2&`5<&"2&"<. 0@ <@ 4(@H( "`" ` "`H " "  $@2$ " 㿘 $`@O ,`?# @6 $`@@< !<.   2@  <  4* H o*@ g `  "`  "  "H  `"  "` "`   "@ $?  6 $ ?#  && `6 &`z *`"  * *`?# @6 *l&  *!<. %<`"  "`<."  "@ *? 6 *`?"` *  0  `2   <. " `"  "`<."! "@ *?# @6 *?" ( 6 (` ?"` H /*'&# *  & *  "@* "  6 * "H p@$@@<<. 0  <  4(H(   "  H 0 "   $?# @2$"&"2&uvm_pageratop㿐<b<ې!€ 2<< 18#` <R2 ! <# :" : *"@ *` " @  #  :" : :?*`" +  <** c @ *  㿐<Ra8!<.!D #\ 㕚 <3<< "al"`?$?"  <Ra, @@` @ , pager_map㿐!<)H /* 'h    TB"hH 0 2&g  '<%<3 '.@ ؒ ?D B5< <<0#$`$ : <)*`hH /* '<0S  . *`   T0<)!ȓ+ @ @ "@ "$"H 0!  "a`< ؖ(   `3<ؒ  `0 b ࢤ@㿐< !<3!س.@    !ؒ  # @z<a` !p"a`!ؒ    ߒ 㿐  \  %<*'8'%<`" 2  &f& " 2 * && `@"@?#D3:K` "E``* 2`$ ">``$2`$  2 `$<b €`0 `$ 7`$`$7`$`$ ` $<"H`7`$`0€ `2?&* & &``? * `````uvm_shareprot: non-object attached㿘   < /"   "   %< *  : H€ 0  2 㿐```$  \#\`$&$ &   ` `@ -  2 !  ` @ 0 ` !@`ˀ`㿘 2! ``@  @^`< "R 2 * !`"  " `   2 `$ "`$ `$?`* ?# 2`$<H  0T `  0 #ϐ  2`$<`€0<cd€ 0`$ 2`$`@ `  & &!`* <` "  ``Ҷ2@ pagedaemon: deadlock detected! 㿘 H /* %<.  <a `,< 0 "X<0a : `(<   H p@㿘<`` @ `: @ $`, : $`, , $`,@֒ $`0 $`0` @Β $`8daemon_slp㿘<! <.",H o@'<  +< H /* %T   (  c `T #`ؖ T" $TH 0<  `"@ $`€ 2-  "    @w  0 $ 4`$ 4   4  @(@ 0pagedaemon: invalid nextpg! reverting to queue head x3<``@: * 7``2`*`'D# h# 'h   '  ! H /* '`H 0 0*`  f   ɨ ``< $`'€ 0 " *~``G$``  2 $   ,`?$ ,4 * $ 2 ``  $`쀊  ` )$`` $` $ ` * 0 #<``H "`HbH € 0ܐ``䀥   "` % 0 * @4 * 0   @H  0* 0 #<` @ D@  0    @ Ғ  "  * `   Ԣ2@  * 0 $bH@  04 $ `` 6"` " `  @  %  Ԃ2@ -`` @:@ '@ +  2  $?# @4 $-`& % `  ܓ2@ `  @&''@  "@@ r`7`'' ` $ #\  ` ` $ $ * DU'R'P'"@' $ %? $ϒ @4 $ % <H  0 '#0`' %<`R@ 0 € 0<cd 0 $`4 $耢   *  < -!pD'耤   㿘#<` ܐ $ ܓH o*@ g H 0  0 6    ܆$ @z ܒ    < <.: `<.4! ```܀ 2 `< <.& ` 0䀣@ 4"" D@@ <.H <."# <. Y?<#`4 $`P $H *`    ,`?$ ,4 *27`& *``    ` @ d  "  $ * 4 $`     ϫ2  @ P  $ 4 $$<"H  0€=!`%! 㿐)<     *@ @>@ڒ     H /* '<.' '  *`' <#R @ 3<R a4 ! <# :" : *"@ *` "   #  :" : :??Ґ   a4@ <#:" : @*"@ *`  "   :" : :?@2@ , "* ! < * *  * @ *`  0?@  @ ' 25'<.< `%<* ,  , @@*  " "  "$ 6 $6 *& & 6 (& ,&`& `"@'`Ĕ  $Ā' H 0 ,@ <.0@ 4 <.!%s:%d -- Already 0! /work/tmp/mrg/src/sys/uvm/uvm_pglist.c㿘H /* ' 9 <.< `%<+<)<` "`&  " 4 *$*  $ *  "@* " `$Ā ?c #8+!$ 2H 0%s = %d 㿘<R! #<    `+  2 Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d  fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, swout=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers:  objs(kern/kmem/mb)=%p/%p/%p 㿘<* !< <  ! * < !@   * < ,! 0 4*~ 8< X! \ `*w d< h! l t*p x<*m"(< "@  *f < "p   *^ < "  *W < Đ"   *O <*L#8< ؐ#X  *E < #  *>!< #!*8 L< <# P*2 T< @  D H*+ <*( P<.P<!  h*!!swapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp bufswapinit: pool_create failedswp vnxswp vnd㿈<" ,<"a<<"Hx  ; <<.`D<"Lb| "<<(A""#\  L  <׀ "`(<(1"<"#\#`#d    # < "c <("<##\#`#d    # <ڀ "cD<( "<##\#`#d    " < "b<'"㿘< ,     2 "<$ $  $  $   "` " =$ `,`, $  , "`# ,2$ <0#$`&@ : <)*`hH /* 'S <0  *@ *@  ؒ L0<)!ȓ+ @ @ "@ "&@"H 0 & & 4 & 8 @ 2 $ " 4$ <``< "`<<,*<"! ` 02 4` 4  8" 8 8  4 4 < # <" 2 0 2 㿘< ,    "$  "@ i L 2 swapdrum_add㿀<`(    #`#d#\  "<'#& (& $<,```"`  $& 4 (  4 2 $` `2` minirootswapctl: miniroot copy failedswapctl: copystr@`/<H 5 @  <! & 2<< , 3`"+ <  $? * : $   H@   `  ܐH@ `d 4ݐ 2&ɰ :, 2ĐH`2@<!Ȓ   @ , < $ !<&x @ $a 2H   D'''''\ H@    ( 0~ 2{ `h "`lw < q"`  L    ; [0Q` S  Ȓ L   L  @< Ȗ $ $ 0`h 2?`l $`h %@$   L $ | $   <% А@Q h `h 2     L L0`4 4`4  H # swap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap -<`0Ȁ@`<='x '''|'H*` x h  а # 2 * "<*bd@ `ȟ@?4 `<='x'|"?''H*` x D+ 3`   3   @ D<`H&`<H@   &`@&`@< * 2@ 1<* &` @? h      q  L <R! <#!&aX #\  L v `&`, ?  "` <$!h &` DH@"H"DȀ3<#h `D@ @k:` *  * 2@ $`,<$ڐ!  "` <$А!$ &` H<D@  $H$D!&_<!&[%` &`&`@@"@ Ȁ<=`@  'x?''| H*` x㿘<< " ( T㿘<< " ( H swstrategy: vnode type 0x%x㿐<  H`*` :@ \ 2  0 $ h& (& $<0C $`$h, 9:` <"x$Z H /* %& H  0& 8 8 $ 8 $@ 2 P d`$ d P "& PZ& PH 0<>X''X H*` €0 @sw_reg_strategy: swap to sparse filehH /*%<cD Y H p@ %`%`%` %@%``0. `< &`4'К'̚';<> <'@ꁐВa ''' 0'''a  H* @ ؀?<#Ԑ#"   `& `& x$2#XP`d "`d#X''P#X H*` € x @& `  ?& 㿘 x H /* % 4  0`4""@ $`4 ?$  ( 2$  P << "`4`$($`$ $`(  2x  2 x  2 x<DȒx$xH p@㿀<!`$^ < ,`"Q``"H` <   "= 4   46 4 ,   #`#d #\  2' 4 4@ 8$`"`8 8@ 4"`4$ 4`$ 8`@2`$`" 4$` @$  D % D $ $`2 ` `2` ` & warning: resource shortage: %d slots of swap lost 㿘 $ ,&   <## <"$ D"@"D㿘@?@# 㿘!<  L'D H" H" LD  @     `H "`H㿐< 6.@ >`    H /* %   <<.  ` )<# H p@    `< ($ $$ !P@#!$ \$ $ H$ `$  $<<`@ @$ x$ $$ L$ |$ $ <>X'' PX H*` € !  $$ (2` `H *  P  ]# SH 㿘H /* % P  D<.!<&   x&   ""  Y?ԓH p@㿘'< @:@ *`2``2`*` #   `   ﹐,   $ @       Ւ H(<c H sbrk: grow failed, return = %d sbrk: shrink failed, return = %d 㿐< ``@   *    :`6'3<0$@8;  ``*  * 'c ;? "<0<!( $`  :@  6 @Ô <!H!}  <0 $`  :@ " $  㿘 ଀@<0%  <ࠑ,#@@<0`$ "2 "0 ; @ B  ;`@涔4  2@  $࠰  uvm_coredump: user process with submap?p   ( (  ,] ;# "< !#x "NI <  <0 < *@  *@7  +` #* @ aH ''' #\#`#d#h#l  #`@ D#\#d#h#l    @ D&2uvm_deallocate with null map㿘 <!P < @ :` m@  uvnsync㿘<" 8<<<"`<!0Ȓ  鍘 uvn_attach   `" h%<` &   !  `2`  h 2  l c 2 * "<*bh@ "  " h `` 4 6 4``&  "<88 & $8 $"`("8& ( "y&  `!&  l c 2`*`" <*\ <a  `h   `( @䐔  <! <=@'p H?x'*'t @p " <  "& Q& 6 `  2 <R@ (<R`  <Ra& &  & &    & & & `& <88 & $8 $"`("8& ( "&  4  6 4 " 㿘 ? /&  0  ?`& 0  @ 0 `&   @ۖ     & ""   $` ("`( $ ("  & uvn_termuvm_vnp_terminate: io sync wanted bit set㿘 `<` & `H&   @   " !<  &   "   `2     & <a"" &  $` ("`( $ ("&  uvn_releasepg: kill flag set on referenced object!㿘<"H  € 0`&@ސ `"   " <)#H  b `  $` ("`( $ (" ` "$ U$  uvn_flush: strange, got an out of range flush (fixed) uvn_flush: obj=%p, offset=0x%lx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushx< @:@ *`2` 2 * #h' ' ' '     *   @: @  @<U @ &2  *  `?1  $`+" `%/#`* `:``$ 4`$``2`@/# <`$ 4`$@@ " 㮒 $'@) <`  ``@"`$`$` ``$ *  '` $'  ``* <H €`0`$` <b €`0 ?`$# @4`$`$ 2  4`$`21`$`@Y ?`(2ʢ<H €`0"`$`@4`$<H €`0꫐9<`4`$"H €`0 `&0''#\~      /``&2 @2 `@{u  ,@l `&/`2 @2  `@  2S " $` %? $ϔ @  4 $W =h  4 $<cd€ 0?`()"H € 0H!   $`"@4 $ <` x`'< "H € 0` `ހ"  " !<  &    ј  `2  ! >p   >& uvn_cluster: offset out of range㿘& @ @<#@ &<`  * 8&㿘@ uvn_getpageuvn_get㿐``@/  #  1<? '`$"  `  2`$&`  @ &n l  f  2[<`V< %<#< '    '#$  2$   `.  2$& ې &<  @: $ "$ $?cϔ 2$0?$! @<d2$0&<  @  uvn_asyncget called 㿘<# uvn_iosyncX@6  `#<a&    cHϘ  `    X  2 2  ` &  G %< 'г.   8"@   ?'쀊@'''''' `sJ  <! <=`l l! <=`''$? H*`'' €  @<>  H '*`'' €耦`&@` @@@    @. "@Ԓ d   &  `  㿈  "   ?`&  4&  6 4<>` H`''*' @`  㿘  !<`    @ `    2 & @(&  r & 㿘#<a0 䞔 <א@" "@< 8 "  "  D2 $  2 $ `` 4 4 4$ @@ $ , ,"`# @ $ 䀦 @ !a0  7 1   "  $` ("`( $ ("  }$ 0 , a0 O %s at %s㿘`<!   㿘<0 ` `@`? unsupported iommu_attach: cannot map registers cache-coherence?page-sizebad iommu range: %d : version 0x%x/0x%x, page-size %d, range %dMB iommuiommudvmaiommu: unable to allocate DVMA mapnameregh`<"! ` <!2!0  "#\    <!! 0<!&`,aH@:}&`@#<`| "&`@`@/<0<" <! a`@9`,&`0@ `2`* &`4<`  *&`<@< @9* @j`  `(    Ч@ @%`<* ?`4@ @* ? +? $`, @殑:  0$ $`<<`  `(  @?&`4&`8H` `," `,<ڐ ? "2``, |"`," H p@ `,<!!`42`0 `2t3 $  <!@ђa  $  <!!#\??  / <ۀ "a<!!#<c`x€ /<R!-<!+<!'<!  ???'@8Ւ''''''b @8 o 耢 c滒 c`|€ <`<<2@ *` 8`#@0 <("@ , p" <   0 8< "0 <("@ , " "  㿀<0 $@: @  @ &`O <`  <0 ` H <a   @ #\#d#`H p@ <'a` &`$&`&` &` <۸!1<!<0"Ԓ€o @  ' _bus_dmamap_load: not implemented㿘<#ڐ _bus_dmamap_load_uio: not implemented㿘<#ː! _bus_dmamap_load_raw: not implemented㿘<#!X_bus_dmamap_unload: nsegs = %dwarning: %ld of DVMA space lost 㿘``"<0<#! $` :``$  8H < H p@ <#!&`&`㿀%< @ \.@ `#\#`@3 4H <a`  #`#d#\Қ H p@ ' ' $     0 ' bus_dmamem_free: nsegs = %d㿘`"@<#"#`H < H p@ <#!@3 iommu_dmamem_map: nsegs = %diommu_dmamem_map: size botch㿘`"<<$  < @?  < %< #<R *@ " a8 2@3 ? " a8x@ "'qa8'``" 5<#<!<$2`0 a   @&` _bus_dmamem_mmap: not implemented㿘<$" [%s at %s]??? addr %lx pri %x vec %x㿘`<$<$"Xbh <$ "p <$ " <$" x ` '?' * '`  ' @' <$␁ 㿘 @ 4(@ d4(@ @h@?Ȅ 2h@h@(2h@ @h@2h@%s: parity error (ctrl 0x%x @ 0x%02x%04x) 㿘` @(@" (D<$(D#(F  (Da4(D 㿘 0@1ݔ㿘 0@@1Ք㿘 , ` 0  `"  @  0@ . 2 㿘..2  02  , ` 0  `"  @ 㿐'LL / / 02@ // 02  , ` 0  `"  @ 㿐 @ #\#`` =if_ie: vme_map: memory probe failed multibus/vme㿈<$<$<$<%<%<%<%<%<%#Вc p` 〆l!&a&a$&a &a(&a&a&a&a,&a0&`<&`,`(H@ = <%Y"(?&`@(@ ` *` `@ =`< <%D"( &`0(D?!4(D* 4 * 4'`< 2  `02 ?` &aD#&a<aF&a@F a@`A a<`T pm 2`<<%"80#$|&aH&aL&a@,<R0<%bP0g `@<`@@@` €<0 <<p<<   xddummystrat㿘 0""<<&͐!  H"@T < $& $ $ ?& $%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`""(`?*  * <<&`#`H`@ra0 <&!,`+ `6"@`4`<&!`<&F!6 *24``  64` F4` 3,` / @,`4`"$ (㿘 . b@  3 ? 4  㿐<&#\#`    mxdc: vme_map%s: DMA buffer alloc error %d %s: DMA buffer map error %d xdc malloc%s: DMA buffer map create error %d : couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intr`&``  mԀ "<&ې#`H&`D &`X &`\"@ ?``<0 #\#``  $#   <&#ؒ``&`l ,#И`h   `` (<&#`h @ɔ#&Ȓ !  &`d<&#ؒ @ܼ&Ȩ`  `h, `d"`d =`l@"`-`h@   *`h + `h `_* `d4``#\     آ`8` .a&&` 0.a'.a(.a+.a*.a)&`&`#\#`    @ `2`h<' 0,` S*,`"`d* @` " <'!<'@c 8Ր<'Ґ @a) ` .a)na)a&`.a& `- `d" a&``a&0<'  h a)? .a)Pa)a&,``.a& `- `d"* " a&`2#`?a&#`#\    @ `2a) ? `.a))a),``d"*a&  `.a& `- `d " a&`a&!<' `@f04<&#``0.<-@<'``, € 0 '''    '<0a <4* #H`    xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! p  <R"p>`8>``&`&`8>`0>`@>`H>`P>`X>``>`h>`p>`x>`>`  6`6`&` H&`* "`! H /* %`` !<(` "h .` ``<("xg` 6` `<0 #\#``  $'"    '<&#N` `, "   <&#;` ` (`#\#`   @1  2!) ? `.!)!),  d"*!& `.!& ` ,  d " !&``B!&`B`<("!<("<("`#\#`   @  2!)  ? `.!)!),  d"*!&  `.!& `,  d " !&``p!&`!<("`#\#`   @Ú  ,  h  2!)  ? `.!)M!),  d"*!&  `.!& `,  d " !&``9!&`!<(t" 6`6`6`6`.`.` ``?*2}3`#\#`   @{  2!)  ? `.!) !),  d"*!&  `.!& `,  d " !&``!&`!<(2# `#\#`   @J  2!)  ? `.!)ڐ!),  d"*!&  `.!& `,  d " !&``Ɛ!&` !<(#H`@ `0.`Аɐ  'ܦ`<(#p````@@ &"#\<(#: `#\#`   @  2!)  ? `.!)x!),  d"*!&  `.!& `,  d " !&``d!&`!<(D#` `'``?@ݙ@ݖ@ݑ`#\#`  @  2!)  ? `.!)5!),  d"*!&  `.!& `,  d " !&``!!&` !<(#@ s=?#  2@"`@~@`2  ` ~`} ~<) GH 00#`@)"@m`  ` 0" ` (6`  Ɛ`H p@?  0  <0: `* * @"" `< `@`@ (("`@ (("`<`@ `<"`D%s%c: crash dump not supported (yet) 㿘?2   <0` :  `**# <+#(`Ҕa 㿘?  2  <0` :  `*@` E f@"L  m@"UE e@0 0  h@0 0  n@" E g@L 00 e@w 0 H /*%`@t"H l `@h!f `*# &`*`` &!``@m S` O M4`K  "`` 4`?# @4`2`9 `@mf 2`  4`?`D 2   @ $`D : *  * @  <-``@maH`@`<  $`D !: @㿈?2   <0"` : 6A "`*@ "* `"  ?' F  )   `6! . @ ` "  <  @ @ *@$ @ *@$ < @  < $ D㿘<-< !H ( 㿘<-< !H ( Ӗ 㿘?2    <0"` : 61?"`*@ *"  D*@ 2   { " ?,` `?( @c2` 2  Y ?㿈 8? @2 ` <0` : 6 `* @`   H   ` 0@(  f& (`  ` ?'``  ? 8 @2 `  : * "@ " 0 E& ( 0 D``@l  $> 0H /* %`    @ 2 !& !& 2 !& ` & p& "@"H 00@z H 00 $(& $ 0p& 4㿘 8`@& 8@^ !&   @S !& 2  㿘@ .@@@* `@ .@@  .@.``.`.`  ` `  ` .`X"& 0"7 0` .`  ``0   [`   .` `.` P.`  .`  .` < c.` 0p 02 .` [.` `?.``.` .`  ?6`  .` 0W 02 .`  [.` .` .`  .`  .` "6` .` .`0@` .`  ``0   [`   .` *6`  $2 6` .` ` .`  ,@Ӑ.`  @l @ .`  @d 6`  ,  &` (@`*   = .`xdnfreexdsubwaitxdcmd nfree㿘`  02i !& =? @  2^ !& "0+!&  2!)!<.!& " 2K !& !&!) (!&!<.!) "  2: !) !)!& 2 `ۀ 2?<. " .!& J@ ,  d"* @@. H  # \ # ,#  # # $# ( # # # # # 0@ɒxdc_startbuf freexdc_startbuf bp%s: warning: cannot load DMA map 㿘!& 2?</ Ԑ Ȑ? .!& M ,` d$* @@ 2</  "& ?"8 2` @: *  H@8? @2 `  : *"@H`*     `    4<0 </  ( !&$.!& -  d* " !&` p!& p&& "@7" ``   4$      0& 4 `  : $ $ $ $$ ($ ,$ $ $ $ $ $ 0$@  " `0@  xdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq㿘 D.` d" * `-P2!+a !*@ !+ @S !(.!+  .!(07</0E</0 `@2G   @=  #  =* D2 *` D2 * D2 *` D *  D *` !' .!'0</0P</  `@2   @  @  #㿘!( : D! B   ?  `  ? @ A ``?  @ߘ 2!(/ @!' 8!($ @ !( B!' B.`" d* @!&`    2!& 2 %s: off-line: %s xdc_resetx h =@ '`%'`@'` '`'`'`'`'"`"@"`"`"` "`"`"` h  * h`    +  l D* D2`*  D2`* D2`* D*  D*`  D `  ? 4 D $ h h `"! D h!<0 `#@(   D * @ D ` ͐ ? 4 D 4<0 #( *`  h"""" """"%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE 㿘!&` <1!8 G  D * @ D ` `z `4 D` ? @   d` ``0` `2| !'?.!'"g!*&` h/   + 2`*`  +  d  `` I`0`"`0Y "C!)U  "`(`0 $("$`(`0*` "4 `` `0`4  $@     `` `4 d0 4 00"@ l`0!&`.!& `,@  d" !&`2 d!& `!) .!)` `@&` !?  .!** !( .!(  z 8@+ 2 !(!& "!(<!&!(!'!& !)  ` <1!H    <1 <1!  <1 }!xdc_start㿘`)!( % D ` #<2!*!J@ @ !(.!*.!( P "a !(  D `"!*%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD㿘 D ` @ ` #<2aȤ @ # ?Ϙ <2! <2x" `  *`    d  Ԑ @ѕ-  h @̢ !'?.!' 2  ` `$ $  @* "    @̔  L2K  F  ( $ ,`"$ $$ ,$ :$ (,`$ $ @ ,@ @ @*` `  ,@ *$ 4`  $@Ω4`   $@Τ  @K ,`  $!` a >"@,`  ,$`!* ?  `.!**!(.!( \   ` "H ?`0`P H ?L  0  `$ ($`($`$ (*` $`4$`4 `` "` 4`$       `` € 4 `0 0`4" !&.!& ,  d" !&`!&j|  @$ !)`.!)  @$ !)`.!)  &`8 %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] 㿘 #<3 b8     0 ? 8 2` @<3@ :`*`" `a@ ? @<3  bH<3"X<3"``  ` ` @gِb8!<3 @^"h   2<3<3 "<3Đ"㿘` ``?` ?`@&`!) .!)` ?a&`!)?.!)? X` V `( + `$`,"  @ &`(&`$&`,` `$  @͈ @̓@+ @'@g ?- ` &`  `.2* ࿖ .2  .6` `` ?6 `  ଠ" @U. ` @ . !* 0?. `  `` 7 `&` @2( ``4$ `&` .2`*`  .2  .&`!* ?  .!*!* !(.!(  %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d  WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout 0  H /* % !(!!'!& @!)  ?? !?!'!7/H 0@@@`\ #\<4"   <4"???'7/  -<4 ? @ @ , <4"ࠕ`+<4  @b @, @. ? <3"  %<4 `2  h,  @@ @2 d  3 #\0#`k  `80`<1!_ H /* % d    ` "  @"  `?"` d   "   8 <4#07  ?  H 0<0a <4* #Hx  ` '<5"*` €$$$Dהה$ &  "  s   * t         6?`!a<5#*` €Dؠ$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ Ȱ @Q °  * @ %6   @7 2   0  @(   2  6 `<0` #\#`  $    `,   n `     "   `  0 `X H /* %  #`#\-`,`.  d"* @ `. d . !) ` ,!)쳐!) !& `,!& `*  d"  !&`2줐!&   H 0  ` 0 ` (Software fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown error <88* DP\ht(4@LXdp| $0<HT`lx8<6#x<6#<6#<6#<6#<6#<7 <7 <7 8<7 P<7 h<7 <7 <7| <7y <7v <7s!<7p!0<7m!X<7j!x<7g!<7d!<7a!<7^!<7[!<7X"<7U"<7R"(<7O"8<7L"P<7I"h<7F"x<7C"<7@"<7="<7:"<77"<74"<71#<7.# <7+#0<7(#H<7%#`<7"#<7#<7#<8 <8 H<8 p<8 <8  <8  <8 <8 <8!㿘\ `& & 0& & & & $& (& ,& & & xydummystrat㿘 0""<<:  X"@˖ < $& $ $ ?& $%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`""(`?*  * <<:`#`X`@_;`( <: xn`+ `6"@`4`<: ^`<:F 6 *2S4``  64` F4` 3,` / @/,`4`"$ (㿘А@kb@ @ 㿐<:#\#`    -xyc: vme_map%s: DMA buffer map error %d xyc malloc%s: DMA buffer map create error %d : %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intr`   - "<:!"X`T&`P &`\ &``&`"@ `d #\#` $ H@   <:"hؒ`d&`p , HИ`l   `d (<:"h`l @ H  g  &`h<:" @ `   ,`%@`l@`h"`h`p"`l @  +@`l  (`l +`l (`l @(`l  (`h4`d#\   [` `Ǧ8`h 0`l`p 0&`t&`x&`|#\#`    @t `x2` ``t"```t !<:"@ <:"0Z<: "``"<:<:#<:#" `P!<:# `@ 0@ `2<:#0`<:#X<:#01<:"`0+ <@ @<:ce`8 €'''    '<0a <F*  }`    xyattach%s at %s%s: DMA buffer alloc error %d drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s  (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! p  <R">`8>``&`&`8>`0>`@>`H>`P>`X>``>`h>`p>`x>`>`  `&`6`6`&`&`&`* h" * @&` T&`*`%   'ܑH /* %`` !<<`  X5 t` ``<< h` 6` d<0 #\` #` $'"     << x̒`^ d, "   << x` d (F#\`#`   @ ` t"``D t``<< +!<< 7<< Ȗa8a:?.`6`6`6`6`.` , 2  }2&`#\`#`   @   t"`` t```  &`` !<< `@ dW<<`Q!`0.` Đ ڶ `<<! `@```@#@  &"#\<<!8: *` %<<, "" " `@2  ీ@ )<<`଀@2 ` ఀ@"  )<<!p h`  $ۑ, ` `@`?@@ې @ْܘ`#\#`  @1  t"`` t`!<<*!` ```?@ʸ@ʵ@ʰܘ`#\#`  @   t"``Y t` !<<!@ =?# ` ` 2" `@ ~`2  `  ~   } ~<<!H 00" a0@a"@ZŒ`" 6` d 0" d (6`  `H p@?  0  <0: * * @"" `< `@`@ (("`@ (("`<`@ `<"`D%s%c: crash dump not supported (yet) 㿘?2   <0 :  ‑**# <>"@` a 㿘?  2  <0 :  ‑*@` E f@"L  m@"UE e@0 0  h@0 0  n@" E g@L 00 e@w 0 H /*%a0@Ʈ"H l `@Ƣ!f `*# &`*`` &!``@Z S` O M4`K  "`` 4`?# @4`2`9 `@Z 2`  4`?`D 2   @ $`D : *  * @  <@``@Z```@`<  $`D !:N @ 㿈?2   <0" : 6A "*@ "* `"  ?'   )   `6! . @ ` "  <  @ @ *@$ @ *@$ < @  < $ D㿘<@<  ` ( 㿘<@<  ` (   㿘?2    <0" : 61?"*@ *"  D*@ 2   { " ?,` `?( @ȝ2` 2  Z ?㿈 8? @2 ` <0 : 6 ‑* @`   H   ` 0@6(  B& (`  ` ?'`E`  ? 8 @2 `  : * "@ " 0 !& ( 0  ``@Y  $ 0H /*%``@ H 0 $(& $ 0]t& 4㿘 D`@& D@  㿘   0`@ *`  .`` .`.`` `.`` .`  ` `  .` ` ?*` .`  ` .`` `?.`  $2 6`.``.` *@ƞ.` @7 @Ɩ .` @/ 6` *6`  , 6 6` 6`0 6` 6`.`㿘`   ` ``  xyc_cmd%s: stole control iopb 㿘` t  x`    <@  ` *  ܐ"@<A $  . T   $ \$ $ ,$ $ $$ ($ $ $ $ $ 0Q@ xyc_startbuf null buf%s: warning: cannot load DMA map 㿘`<AĐ!8? @2 `  : *"@H`*     d    4<0 <A >!03  d`   4$      0& 4   : $ $ $ $ $$ ($ ,$ $ $ $ $ 0$@   .`0 xyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed! xyc_submit_iorq wrap upxyc_submit_iorq㿘 P  1P l " @0N<A0"<A0 `2]` @  S` А b@ 2<A<A"А" #@@ 2  P!P"6 <A#  *  P2*` P2*  P2*@ P * "@0<A0P<A `2` @   `@eѐ#H㿘& & `&  h 0 ` l 3`"p`"  |& @ ` *`@` @ & |  ?, " h* @ % ,  l* @ ` ,` " @` ` *`" @  * `2    ` @ Ϡ` `㿘@ `4  PB2a     ? @ј '   ?  @˜ 2@ @x@ ` 2@@9@ `" P`@0 %s: off-line: %s xyc_reset㿀 x '7@7777 7 777777  ,  2 `@ ,   * ߖ ,  ,  ``,`    , t P `* t 2 #  t P `* t 2 #  t P `* t 2 #  t P `* P*` P ` 禐 ? 4 P !<B  " P #@a T P@ ~ 2<B#А *`444444 4 44444%s: soft reset 㿘` <C"@!  P Kb@  ? O    h` ``0` `2[`"V`&` l  *  2 `@ *` ` >`0`"`0>`9 ?:` "(`0$("$`(`0*` "4 d` `0`4  $@     d` `4`0` "  h0 4 00"@ Y`0&`U` ? @&`` 8` @ 㿘`  T, @" Ѐ"   `2  &  ,  P%s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD㿘 P `  <D b ? 5 <D!V<D! ` @ @*` `  *`  - @   "  @"  ` "  ` `2`  `$ $  @  "    @  @2?  :  ( $ ,`"$ $$ ,$ .$ (,`$ $ ` ,` ` ` `*`  ,` *$ 4`   $@4`  $@  @ ,` $` a >"@,` ,2 `4` 4`K   = ?0? : ?;   0`$ ($`($`$ (*` $`4$`4 d`  0 4  $@     d`  4` " `0 0`4ߒ" $ X͐  `@$ 4  @$   D-  %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]㿘 #<E `  _  0 ? 8 2` @<E :`*`" N`a` ? `<E  `<E!<E!` ``6@=1`!<E @4!   2<:<E !0<:#㿘`@``` ?@&``  ?&` R` P  `( + `$`,"  @ &`(&`$&`,` `$!0 @ @ߒ@ @@Uf?' ` &`  `. 2 `@ . .6 ` `` ?6`  ఠ" @.` @W .0'`  ``` A ``&` `@ `` `&` .2 `@ . .&`%s: watchdog timeout 㿘 H /* %  h  @  "  @"  ?" h@  "   8` <F \  ? / H 0<0a <F*  x ,' 6 2  2   `   0   *  }  w  4 d<0` #\#`  $   d d,   S d    "   d  0 d? H /* %ࠢ  #`#\ 2 t   . t . t"`^ t  RH 0  d 0 d (Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown error [<G0* #H#T$#`#l#x##$$#$$##$$$######$$$ $,$8$$D$P$\$h$$$$t$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$#<#0<GU <GR <GO <GL <GI <GF <GC!<G@! <G=!0<G:!P<G7!h<G4!<G1!<G.!<G+!<G("<G%"<G""(<G"@<G"P<G"h<G"x<G"<G"<G "<G "<G"<G"<G# "8   "3   ". 4, @ & 0'% "$ 04"  0" @ ! " `4    0" ` %  0  @ 0 㿘\ `& & 0& & & & $& (& ,& & & 㿘`@`? unsupported &0&(& &interruptcountereepromobioobio on this machine? 㿘` $<I<I+!!<0`  <R&`,&`0"`,<J#  H0<I<R&`,"&`L&`0<I<I$ b8@h!0"@ addr 0x%lx level %d㿘<I #0 <Iߐ#@ 㿐! \ @o 2 ,  ,  " #\  㿘 , `  `" @ h` >< p`<27 < p`<@".  <R'Ȓb` $ $ $ $ $ <Ib8@ 2$  $ $ @  <I5L  㿘<0  & $  "<0`3?. 9? " 2"<0 㿘` ` P  @  ` @ $  P` @L& P㿘<0 ` `@x`?㿘`@o`? unsupported vmevmedvmavme: unable to allocate DVMA map 㿀` <J"0D&`,&`0$  <J@Eb耢  <L$   @&`P<L"&`L<R<S"# <Rc<R"`H  '''&`<&`@<J"#\??  挚 <ڀ "cL<J"<J# <$"ቔ @Ԓ %s: only %d register sets %s: can't map vmebusreg%s: can't map vmebusvec%s: can't map IOC tags%s: can't map IOC flush registersranges%s: can't get ranges property: version 0x%x x` <Jn"0<L&`,#&`L&`0<R<S#<R<L"c" <c"c < '''<K XP`0  `    " #\     <K x`&`4 ` ` `   " #\     <K z`&`8  `    " #\     <K [`&`D  `    " #\     <K <`<K`4&`H$c` `@@0`< <*<K +`<L <*""b|$`D*"@4`4 <K@ #`4! `<$"VME error: AFSR %s bMEbSbERRbWBTOfSZ address: 0x%x%x X<*4!<L <L  X p @<L {  @ 6   <     # < "` 㿈ޘ 2  ,\ `#\#`@ 㿈Ƙ  ,     " #\   㿐  , `  `" @ vme: spurious interrupt 㿘 8*  @   <L" 2  `" @  2 vme: spurious interrupt: SI: 0x%x, VME AFSR: 0x%x, VME AFAR 0x%x 㿘   * `8 H` <! `2a$<0 `  $` H 0 <L類#p ?p`4<L   #02  `" @  2 㿘  k &" " "  vme_addirq㿘`<S t*` <&@&`D&` ,   L 22  A  2"<M "" L""@% 0&` " sparc_vme_unmap㿘<M!sparc_vme_intr_disestablish㿘<M횐!㿀<<L``<0```   *` #`#\#d 8<0 $&`   &`&` &`$ ;<۸a" ` < ;<'<<bԐ€$@ * a   '`  &`  warning: %ld of DVMA space lost 㿘` ?&` <`<0`$< $ ** !@+!<L囖 <M#`&`&`㿀#<` @ \.@ `#\#`@ b 1<cL   #`#d#\|    ''  $  1<!< 0!"   ` ' 㿘< ?`<@@ *@  !@*<L8 <M#`[@ A㿐 0\ #\   㿘c 0 !?  "` 2 # D* @ "@`  㿘` 2 #`$*  H@?"@`  0 D  €㿐 0\ `#\#``$  㿘0 (㿘0 ,auxiliary-io㿘<N@/#`?auxio㿘   <N@#؀`?auxregattach_mainbus: can't map register 㿈 "#\  ?8 ?8<O햐 0 <ܐ `<*"*@6auxregattach_obio: can't map register 㿈` @ "#\   ?8 ?8<Od 0 <* <*b"@ 㿘<OT!<0` <* "?8`**" "?8`**"no aux register㿘<#`<O뙐!H <* ⬒@*@*+@H 0  ⬁㿐  <0 ` <`p? (   #\#`   @  %s: can't map register delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d 㿈<S ` " "#\       <O"ǒ`0R<OÐ#0G<S<0 5< *  *`  *  <("c&y !<S $!h# !h` `$h * * `@ @ ΐc@ `* !h<O`#<O#<O#(} <S`@P <S`@L 㿐  V` <0 `<`p? ( 0 #\#`   @   㿈<PP!`  `` "`#\`  %  <O"7`0<S<S"`"eeprom㿘<P@"8`?clockmatch_obio: attach args mixed up 㿐  <0 <P@s"8`? `<P"h <`p?    #\#`  @  mk48t08㿘<!<!!  <P@Dc0 <0 c  !    model㿈<P @ XcȠ<P@#c0 (     " #\    <O"뤒`0@Z'؁mk48t02㿈 2)<P@ $cȠ<P@c0 (`  @   " #\    <O"'<Q `  "#\  (  <O"S`0b<0@: %s (eeprom) 㿘<Q!@<0 2 `<`p? <S<S "a"`<(` * ` *`` *  <##"atcounter-timer㿘<Q@{"p`?countertimermatch_obio: attach args mixed up 㿐  <0 <Q@a"`? `<Q" <`p?    #\#`  @  㿈 "#\  ? <O"ʒ`0?? @` %s: only %d register sets 㿈 2y<Q#ꭒ`0,`* @@  "#\   ? k<O)<? @F%"'<. Ԡ  <.<. c̚ `* "`2      * "` ` "#\     %$!`@ "<"` `  `` "`#\`    ? ?<O"%`0? ` @delay calibration delay constant %d 㿐#<S $ah% $ah@'&@B d < <R`" @ :  d &ahah<R"<S`@Ð <S`@ <ڐ "㿘Ho o  <`h    "`h `h?"`h`?H 0 <0 <<t <ے !@ #d"" #<<0t`<0 * *  *  *  *  * cannot get %d Hz clock; using 100 Hz cannot get %d Hz statclock; using 100 Hz 㿘<S Ā` d<<0"a|" "@@k d!<!<0"a$ *7 ! *0 ! {*`%<0 b@@  <S V d$ @H d<0"a$#<c  $c @ <S>  d$c  d<"a|@-0<S:  d@ $ !<0`:  "`!<0 <0!$<.`<*  "@ <.#̖ ( *`@ "`!"`@ *`  <0!$?`*` "* " <:  "axֻ ֳ 㿐H <S`Ā  <a '֛֟ 0<0 <"@'? 'H 0ΐ<c @|8  <0 ` ֗ 0p  oldclk statintrnote: counter running! 㿐<S Ā`#<0<T `` !<!<b'<T肐 p!̰ <b "0" ? '(<S`?@<!x @ <!* `" * ?"`  ;Zx0N㿘:(;`; :9 8` / /`+* *`(@ ( `.  .` . .`D @E ` ` 43   F,   2!m!n   1<T!(V? @`4 * (*&@ (.`& +  . (( 㿘<* +T@ےa@ @Ғ , @w &  E& &    <T`?! ,R 6  @& ,* R$ `& & 4& @Ca@.& @;.@ <& @3 <&@ , @* &@{ , @  & @q , @  & @f , @   & @[ , @  & @O , @ & WARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! 㿘<Y`?!at  <U! ư!@ <S Ā`@/<*0(   `@- /<* `-%Ѐ  <U!%Ѐ`$<U@& <UД, "<U@"<U"0<U"8T @aƒ<UÐ"@x<S Ā` <*Ѐ -<!`)@2<* Ѐ`!<!t   ' `,',',',',',',',' ' `,'㿈@@㿈'@B@"<!H  *` @( `! * H <!H  *`*@ `! * H 㿘#T@+a@ђa@$..`@ʒ.@ <.`@Ò < .` @ .`' !lP`2>>!l!m`P`.`<S "ap<S!l@   & !l "  .`.` ` < ``8 ` 4' ` 2!m!n2 8    6 ?<S l   ?@* (*   `(*   `("@㿘<S Ā`Ɛ0:H <*`В`&`& H 0 <ll`<S4<Sll & "? & ?/a `&& l l "㿘<0 ` B  > %"@8@r 31<S %%  - 2 #    , Ɣ   @   @Y㿘!<S ` 2 ) '<S @, %<P@N* :  .@<0 @ 2   :8@ ݴ`   㿘%<S  #<S '<P$` !8 $` 2$` $㿘<S<S `" "c power㿘   <X@ `?%s: cannot map register 㿈` @ "#\    <X @䈒`0<<X",䂐 `㿘<#,`" @ *@ҳ"@㿘`@`?: no SMP support in kernel : mid %d%s @ %s MHz, %s FPU: %s 㿘<`x  <XJ!X0F!<. "`x*  '  Ԗ#<.*$c@Ē 5<<&`,| < < `&c&(&, ԑ*#@ | && &<X!x  @@#<t!<Xb@ꪠ!O<X!@㿘!<!H`@@!\@<S "CPU did not spin up 㿈 ,#<&`@!,<' H<S' 0<S* '<S! "a"!"€ <#h@  #` 쀢  d?2`<X㸐#8<.Ԓ @<.̖<  *`` `  @ *`<.Ԓ @<.̖<  *`` `  @ *`noversion 0x%x㾐'pp:` ``& <Y &  &  @  &  <Y`㢐& %s: no cache %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback, %dK external (%d b/l): cache enabled 㿘 ,<Y!   x x<Ya!` $<Y`<Y!a<Y! `$ <Y`,!: <Y!`<.<Y`D!: (`T`  <Y" ` ӓ:` `T <Y`"8c`l :` <Y"h<Y"p` s `  h⺐ `T`$<Y<Y`\"xⱓ:` <Y⮐"``<Y⨐"<Y"Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %d㿘<Z  p   px""`l0= . 08"x<'"`8"`"` "`"` ""d"l"t+"| "`l"x  "` "`"`"` x("`l"x  "` "`"`"` x("`""`l"x  "` "`"`"` x("`㿘!<#0ʚ  "" 6y # !?00 $}0+!@  d !& t& p& h& 0!& 8!0  "_^ @ !,! & t& p& h& 8& 0b@ !$ @! & @& p& h& 8& 0& 4& tmmu-npmgmmu-nctxclock-frequency㿘@.<Zb@ & <& 8<Zc@ & 0<Zc@ & tvac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-type㿘`? x<Zc$`@h@& x<Zc@b <Zc@\ <Z$`c@U $` `  * & + "@<Z#Ȑ * $`l$`<Z$`c$`@7 ! &!: cache chip bug; trap page uncached㿘! <0(@1 <[j cache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache 㿘` x<[aX@l& <[ah@  2&  & <[!p& @[ {%<[@U v<[ q@ & 4<[a@ & ,`   `  *@` *`<[<[!$<[& 0a@j & 8 4@ 8@ & $@^ & L<[aؐ@X ` & D `  *@` *`"<[<[!<[& Hb@: & P L@o@m P 0& < H 8  ,&  D@ 8  $& 2 <[b @ & <[b0@ & `   `  *@` *`"<[<Z#޳<[& b@@  @.@,&<[bX@ 1@ & d<[bh@ & \`   `  *@` *`"<[<["|<[& `b@” & h d@@ h& T <[" Ƃ(Ģ㿘@ [viking: PCR_TC is off]㿘 փ@<L!  @ & (&!<\ؐ#8 ( &!!&!` (   & p[viking: turn on PCR_TC]㿘 @#<`(  %@2a<\ߴ#a $a@, @ " p Ơ  H8 "!" " 0" p" "!H"!D"!\"!L"!d"!l"!t"!|"!&ĀĠUnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUs㿘  ><]H` b0@”??`4 ` <]bH@?+<0<  +<0` ? ` <]bX@?`4 ` <]bh@?(<T< $ "?b0@??<]< bH@?<]< bX@u?<]bh@o?+<0<T `@2΢`?2Ȣ`?2¢`?2` ?2`& & & & `  2 0@&  0 `& 0 p 2 @& p 䀢 2` `& ` €`"!H t 2!H` <Zc@ & t@@ & t!H 2!D &!H!D 2!\ &!D!\ 2!L &!\!L 2!P &!L!P 2!d $&!P!d 2!l (&!d!l 2!t ,&!l!t 2!| 0&!t!| 2! 4&!|! 2! 8&!! 2! <&!! 2! @&!! 2! D&!! 2  H&!  !d&!`!l!t&!h!|&!p!&!x&! ,B5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5<Tll 2 2   memory-error㿘<_@ `?memregmatch_obio: attach args mixed up 㿘  <0 <_@ϐ  `? `<_ a   memregattach_mainbus: can't map register 㿈<_L! `<  "#\    <_0!0<"#(memregattach_obio: can't map register memregattach㿈 &<$`<)"#(` @ "#\    <_"P<"#(<#(`2<_<_O"x!%ssync mem arr: ser=%s sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%s ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %s ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errorX<_ #`<_#<_#<_  @܊!<_<_#ؐ   @|<("<`!<`<`  0 @k<`̐ `memory fault: type %dbEMbCSbSBf PERRb UCb TOb BEfLVLfATfFTbFAVbOWsfsr=%s sfva=0x%x b SEb UCb TOb BEfAFAbAFO; afsr=%s afva=0x%x%x hard memory errorX<`/!X<` pܳ @<`!"<` Жܥ @<`!2`<`n"HyperSPARC async cache memory failure at phys 0x%x%x 㿐<!P€ <`"2`<Ua <U! @  <U ?<U"#a"store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. 㿘 + <`#ۧ<U +<Ua ""aЃ@$У@0`<`ې#<Ua "a Q 㿐<!P€ ''>eccmemctl㿘<a@Ȑ!@`?memecc_attach: cannot map registers : version 0x%x/0x%x 㿐`0&`, "#\  <a:!p0`0<a@!4  `14  `0"<*<ac<3""!memory error: EFSR: %s bCEbTObUEfDWfSYNDROMEbME MBus transaction: %s fVAHfTYPEfSIZEb Cb LOCKb MBLfVAbSfMID address: 0x%x%x X<*0`!<a``<a"` q @!<a<a"Ȗ e @֐<a# є$`  㿘 4 <ע . @  `@㸐$ ` " slave㿘`@    <b`(@T?V` `?㿐 2 ` @  <b`(@=?V`  `?#\#`   @, zsattach_mainbus㿘&`,<` *&`0@`2 @c $@ @"<bĐ!@3㿘`<ס* @`2@K $@  &`,&`0&`,&`0@ softpri %d broken zs interrupt schemeintrX<b'H"'  <' 4' (<UX ' ' '܆ '؆ p'Ԇ 'І '̆ 'Ȇ 'Đ@ ''  l' | x t X T h d ` \,`, %@<U%%'&@'!$ &<UX& ' '@  <UX       @,$<U!@$<U8 Ԁ` ؐ (((( @ <c 䀤` @ H /* , @w H `P'PP'ܺ`PP'ظ PP'ԶPP'дPP'̠ PP'Ȳ`PP'ĮPP'PP'`P'`h'< < , <cH b `"   `"  H @ <Ua@  <b H "<b<bמ"b8͔ < 4Ho o<UX @  @ H %s: channel %d㿘`"<c"<c " 㿘<0       ,@ @[ " 4 H  $ H 4 8J LJ`L@ @     `<ഀ  <0  "ഀ  0ƚ 㿘<` ( "`H /* & <0c     c . @ " @T  c H 0 㿘@g @c   2 * : @ 㿘`2  .`@{ 4 @t: 2 <`. =. <  H( @ *I@*G *I *G@@   *H*J*K@  @ *H*K*J *J*H*KH  㿘*3<0``"m `` " e  㿘*3<0``"X *``P 㿘<0 `" D  㿘<0* `7 㿘 <0 `" +  㿘 <0* ` stopping on keyboard abort 㿘<.#%<0 @     2<dŐ#<cP㿘Ho o#<0`    `   H 0㿘Ho o#<0`  ϐ  `. ɐ H p@㿘<.cЁ㿘<.ؒ㿘<c 㿘<c(€ttydttycttybttyakeyboard/displaystdin-pathstdout-pathWarning: unparseable %s property @} <e!<e! x@ϖ N`"? N 2 ?x <eN : <eN  ` z4<e?<e!?consinit: cannot convert stdin ihandle keyboarddevice_typeserialconsinit: cannot convert stdout ihandle displaycninit: mismatched PROM output selector inSource=%x; Sink=%x cninit: invalid inSource=0x%x console is %s cninit: zs not mapped. 㿘'< M  ` I`F?``D@ <e<eֱ"?b@  <e@9b<e@c ?] D@ <e<e֒#?b@!<e@c8 <e<."  @c ?: ??@ <eq#@<e#pl`<Y`$<U<ea#P <Y#  !<?*`+ @ @ <Uᜒ@  $$ <Uؗ,` <e>#r ,<e5#0, <ה   " <.<U"#!ԟ@㿘` 5 % ` % `. 5. % % 㿘  Ӓ  p "` 0``㿘 0  <&  4& , 8& $& ( 0ڐ  Ē                                㿘`4 b 8`  8   @     @ `8u 8   @   "  @ 㿘 4  , @J L`"  * L` €   ,  * L * L * L㿘    1.2MB/NEC360KB/x720KB1.44MBfd㿐<0 ` <g@"P   #\#`  @ SUNW,fdtwo㿐  <g @f"       #\@#` drive %d㿘`<g#( 㿘@Ò  @   " d@ @ _@@ %s: cannot map registers 㿈&`, 2&`0     " #\    <g#Ԣ`0/&`0$& <0 `<g<g""P@ 2$@" ``22 @o%s: cannot map control registers 㿈&`,( "$&`0  `    " #\     <h!0C`0&&`0, <0 `<g<g""P@ 2,@" @[version cmd] CFGLOCK: unexpected responseintr softpri %d: chip 8207%c 㿈 P& L & P& l& D D& H<U , ` <s#`"D  `"   @  ,<m`` ```"`   @ 0 7& `& d& h   7 * h @" 2 7+  P & P 0& h`& d& `@   X@i  X x 2 & \<U"`<hӥ" X& \ P` @{ @O <hӔ"<hb& <h4 "ӊ <U,''3<g'c4ÿ   ' @آ fdprobe: %d stati: 0x%x 㿘$ Pf   * h@ * &   & @1 @. # # ` @ Ѐ 2 a"@  <U@  <U x <U c<U"` <i! %  <i%<i x @8& @<i!@   x  `? P   h*@ ǒ : %s %d cyl, %d head, %d sec : density unknown 㿘  <i 8"  ?<i#?&`&` 4,`&`"@ @  @@ `<U`0c0&`8&`Ɖ2&<s#I<k  &`Đ@/fdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld 㿘 8? @2 ` <0@ : 69 @* @"3  H .  0` @*-  ` - @#-  $@N!,#:`   $@ * @e*@ =& 46*  5& (& 0 H`  `@C* @N- <Ub & 4<j 0 KH /* % <k ~9@H 00 $(& $3a㿘 $  D&!&  H &  H"# H@ 㿘 Ȁ` $ А  & &  "`  "`   &  H&  H"@$ H&! &`4& `3*& <0 <k*`  }$ Lfdc reset 㿘 P   h*@ ` *  `*@ P   h*@<U"`<jɐ#X㿘 P " 4 D     4 *` " ` "`+ * ``*` h*0  *` "` 2 ``*`    S㿘H /*%  $ & H p@㿘 $H /* %  ?& D@L @= H 0fdcresult: overrun fdcresult: timeout 㿘a`x" '<k`` `Ѐ``$` ϶ ?`d , m ?2``<kaϦ ?$`?㿘 `a ``  ?S  ` @  $? d *㿘? 2  <0#@ : 6M #@*@ *"   * "@<U*`!@ 2 3  "  " * ? D $ $ $ @>?2 : * &  *@" <  @ @ $ @ $ < @  < $ D?  0   <0@: * * ฐ#  ("฀@ "@"< @@("@("<@ <"D㿘<j<  P ( 㿘<j<  P (  㿘@B%s: %s: state %d (st0 %s cyl %d) invldabnrmlseek_cmpltdrv_chckdrive_rdytop_head (st0 %s st1 %send_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_am st2 %sctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam cyl %d head %d sec %d) X $<l!hL  " x  <i0>" x0;!@08!<l<l! Є @ y0+!<l<l!А v @ y!<l<l! j @ې z!<l<l"0 8^ @ϐ<l }"x { |timeout㿘 DH /* % <lؐ  "& L L & L@H p@㿘H o*@e@wH p@㿘 l 2 & lH /*%@`H p@ fdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interrupt㿐 l <m L! L& l<mx!@ D2& L $Ȁ`"`& H"@$ $@2 < L`<m#8*` €xL4<$4 4& T$ 0 $  H* @ˑ* <k$z˒ & L, 4 * @    z $ $ P `& L<0! <kazi:  ?$Ԑ P "  $@2 4C$ 4@?g  $a  \   & lU    O 2   4@Q( E ? M& L$ & L& `0Bw<`<0a <l#z*0 `'<U $ `@` . @2$8<0`  @(8`$ 0 @ . $@@@% < $ & p @ & t ` `/*`<m !p<m!<m! #\  & L& l`$& ђ M _,` @ `ɐ X ` Ð R `  L ` F >`   怢 " :  ŀ 25  ,`@ ` ,   % `   `   `   `   `z    `t  |& L0<0a <l#yM*g <l#y| P & L<0a !<m `@k 2y8R 0  '<U x   4 y@E( '<U '<m"$ b?8 * ,b`*0<0 `#<* b!?8`, ,bz b `, ,b0<l#y- 00 4q"  `'<U y  x E  " \ @2@ T'<U" ` $@<m!<m!ؐ <m!  t ` y  \ 4 X ?"  & \<m" & X X  & X & L T #<g !<m bP"(@Ɠ*@ ? <iŐ!@& T X??& X \ '<U ?  & \<m"̮ ǐ& X` $"  $ $$@% 4 Dʐ̐ d<0a  2 & L<l& l& #xE:_ <l#xt  & L& l& M    G  P& L<0a <l* x"#< <l#xQ P & L<0a !<m `@@ x '   <U x>?  <U"`<m8 @ D$ " P <mP   hard errorX D& X`` T   6 `0 `0  P   L& LJ& L G& L=#<g !<p bP"@*@   ? x!<l<l!А f @א y!<l<l! Z @ː z!<l<l"0 8N @˿<l {"x |˹ }$ ($$$( T & T? `? 2   <0#@:`+   p@U   u@dL%  p@Z r@X 0]E e@"  m@$ 0S  v@"߀   q@  s@B 0C  t@l E g@9 `@M!3 0 . ``@(q "`#<j`@(`P + "  `D*  `<`@  @ ! &`  *@&` &`@& ` &`(&``&` 0&`4&$``, ",   0 0& & & dL%! @Ͱ  ɳ2 @ǐ h? *@  ,@"`@" `0@ `" ," , "`, `$  $ `"?`: `"` @`"@`?"` `" `"` `@ @2 $ $`"(`"0`$r"42n L%! @2i ``6c ` @&'\\ 'X``,'``  /d`   /e` /f` `3@/ge@ 4 0 @ * `ee@ * &```4e@  @ h ijk.``+ *`( @  ( ` + e@ .`@X ` & $`fdformat: blkno 0x%x count %ld fdform㿘? 2   : <0#@*`  x T  2n 7  &( 2xx @ x$`8$`$$` @@@א `@Ґ   *@ @ː &<U` b* : $`<$`H$`0<r"Pє (H o*@ e`$" %<r!<0! *` * p #`$"! H 0 # *ݐ`$(2`(̐&. Tfloppyfictitiousdefault label㿘?2   <0c@: *   ! @ @" 4  ` .* $( <s`$8  $,  $4 `4H@J$0<s`@E 8 44J@=$ W $4$,$F4<j`P@&  <s`@'    ,  %8@4& ,&,@  ` 4㿘<0   $ ޒ V  ْ 0   P  ? h*G  h *@Insert filesystem floppy and press return.㿘Ր<s"1<i@  !@? @0 `  8("@  ( <U( /<U8=%/<@%@/<UD 4$ 4   93   @2 $ _$ 6@  , ,2 @$ $ +<0``-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +<0``+?P `-`0+-?P%/<U8@̀%s at %s㿘`<t ?!Ё SUNW,xbox㿘 <t@"`?write0-keymodel: model %schild-presenttrue: no sbus devices xboxsbus㿀<t,b0@潔?&`,<tb@@朐<t"H<tbX@攐<t@`bh <t<t"p0!" <t@Qb     <t"??'<t'''''ܒ states->%s%sGOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status->Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating?0x%x?Port DiscoveryWaiting Port Discovery ACKPort LoginWait Port Login ACKProcess LoginWait Process Login ACKLogged InPort UnavailableProcess LogoutWait Process Logout ACKPort LogoutWait Port Logout ACKx0$ COPYRIGHT 1991,1992,1993,1994 QLOGIC CORPORATION ISP1000 Firmware Version 01.31   qp ? pISpP p p?p 10 y5xc/ '  @B Qxx xxO i5@jh< !xlh(hh hhhh#hh' i6  h hhhj-  i6 h7h @hhdpxx8x/:xx32 ppxxxxx2}x}x//xxxxp p z zp@xx0x/ 5h!/xx6x 5o!e@ 5j!!! `x)xx 5o 5i! @- @xx| a`@8|ppppp 8yHVVagDk$2FZ9CJp  8y rq @xsrq @p a` P @|p@x A A Sxppzxxxx ppISpP p p?p yx 10 Y )W Qp ar P @xUqrsp 10@psr Q I4 Ap& IB ANpp q.pp@Bp   B J &Sxp @BHB&Sxp &Sxqp!^ rxppxprstprstҠ@}xrzz{~|vxxxxxxprstprst֠@xz{|xxxxxx 5Y! x 5A! x 5B! x a5@a bx 5E! x 5F! x 5G! x 5H! xyz xqā6jh@kxk xwx kj 'xwx ijk xqġxxqġ 5A"~!xuxq 1 "@#p!xx1~ 5B"!~xxd2K a5@a bp`p`x a5@ap`xq  (@c  2@c  < a5@`~a#xx3xqġ 5G"!~xxqġ 5H"~!xxqrȡ!yx "z xxqā6 rh~&@j @@@@ρ@@xxxxr̂@h@ a5@a(@衆2@<@dHxPHxCHqqrxj hhk qxwx jk phph'xqrs̡xxwx jj 'xwx jj h@Ax 'xwx jj h@Ux 'xw A I Q x 'jxwrswrsxh@'xx |  @x xww A! I Q x a5@`g`x x|wwwwƧ a5@``gxx  A! I Q xph68 |x 9 A! I Qx h i 8ݧ?8? ih0@@hK hH@ p xhK hH@px px y5x a5@```xxhh hF |xx@x`qqyJ|tsrtsr y5 @xo@x?@Zxxx` x 5h  # " $   , .%0~x/eeff`` x|p@xqpyxqq!hx ii -h p@xp@pxqrs!!yp@qrsxp@pppwqx 1&$0$"F 1xxxUUy`qqġybxy`qxyTqqyVyXqqyZy\qqy^xyTqyXqy\qxp @pppqrs 0` Sx ppq1p q p|p @KppFpqrs 0x ppp Zp lq l,Sp|xPe@w,xR c|~ y5xP b,xR| @zR @/  x | 6|x)h**h.h i 5O! h@ ``h~ x ~he@`hxxhhii|e@`` xx!x|`  @h(`h,`|~ q5@p@5- pB|~ q5@ 5r@!H!!tB|x hxe@_x),x`e@_` #`#,( 5O @_hF` `hFhxPdx `dP,h%`x`` xhh | 9 A! I Q x8j?8?j | a`xx|@xyxx` x x xx` x  xx`  xp a` @|,`, cxdxfxhyj@,xyn| ~ a5h- k`d`f`haj@-xan |x@ ~`e@x `xx|xle@ xdxf,xnxj |xeytprТ"3x@exhe @xexo@ez|{x @x?@\xxxxe xxxx xexx`yf|n}nnnn 9xx``x`xxz|x@xnx`x`@x@xxxx|xxnxx|x@xnxg `@ӧ @ 9 @xx- h+h/hh - h pxxx|xm,xx`x,h`x-`x`xxxxx `|.%0a`a@~x/eeff``gx h@? x x xxxy` F`"jh HU@U 9xzxy, he@]aiai!``hh h@@s@h xxxx|`` x xe@`x`x}xx|ypxt xvpx@xh @|h )xle@x@~x(x@ @|{yrpԢ"#|Hף||x `$@ @x@xx xxxx x xxyx xp֠|z{| 5h ~ y 5@ !4 5!4x044xD |~ # q5@ y - +#@Px##S3xCx xx p\xTpxbxxxCxSx 8pG5pC | " x[|  px" |  px! |  px" | "ϡ | ~ a`bc |" ~ a``` |" ~ a`` ` | ~ a``b `c  | ~~h@9 a?xA@' a> ~xA@ `pxx9> q5@p``q` pxx5 q5@``q` px x;   |,@X `` U`U`UxZ`xB| 5A"  ;"@j !!"|~h䠌 @`6p q@ @ 2@x x ?x !p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@ا|-xPxy "%k%%&e&'D S%Jx |pp?p0@ p3p\py*Kqxx Fx$(pxx-^Ipx~xxx x`xx[ x$Ippp35pxx-^oqx~xxyxx`xx[ x$oppp35pxx-^qx~xxyx qyx x`xx[ x$ppp35pxxKx-^p hxox,,Phxn A xx-^xp\ hox,,P`` hx 1 Ax- xt@@5 0qD*H 5!de!qFpp?xv@5qD&xqF%h%Xu>,P`4gw6?@/!@@g @/`g hna@?`HB@BxHp `"g k6 ` HpJ`pN`pR*`xFx-^kpL@s@u@{ {@g xqL@) !H "H  H@z@x-wja >,d@``` ~*``` xx-^*`ay@q. ~qP@ݡ@x*ݡ@x)p`@桍yZix`(xxahhx~~~ ,x Shx~xm}}n~~x0`` x-wxr*xIx-wx;j zZxIx-wr%@;yIp2G``xQ0000QQQxxx ~ y5x@yphpxpwp hhhhhp~ q@ 5+ x 5! 5 5+ ppxpx.  9x+pxp yx !5W$@ƭh "xhox,x(xpT `h`jhhx !?x !5Wx !>x px a6`a``pxpp?x~$@ hh~jhhxx  #|P#x#y&)@/xpppy6>>@t)>t>xwx+wx,`@k !?  x@k~ !>~  x@j pjx[8Fxxwx,`@ !?   x@~ !>~   x@ pxx"yxppx"yxx$p(x(`` x(@(x$@ h-~h@- x "ihhx```` x(|x#y 5xx   0 xIxx전@!y # )  -X-X  /xp@ x"x+xUxx+xxx+xxx+xx _x$py > F S F( H( F Fxqp Qx)x(x(`` x(@(xx   0 nxIxx전@ j!y x -X-X -Pxx+xUxx+xxx+xxx+xx#y xx&ehxy䡄0@&ex전@&ey # ) -0-X-X -PxP x#y """y "xxx H+j+jy +j+j+j+ xy@ @ x+jp x'R+jy!!!!.!0!+j+j!+j+j""+j+j+j"x@!% x:xxh@!,hx-0xii!Jh!Rh!Bh@!xXx@!RxXx`@!@!!`x!z~Znxtzyx!m?k!hk"h@@!~Znp!x/:x0xgxx1jilk"@!""!|{#!@~Znxgxxg"!x0xx1xxjxxXxxx"!i@!ܡi ~pH ````` x"@"i ~pH ````` ,H @"x,x)@"x`(x~X~Z" xUxxix~X"xXxxjxx+px+p y@"xx"D#| @"<H"<x">x!$z">x"* "#@"TH"Tx"#@"hh~X 0~Z`` ~pH `` ,H @"xx,x*x" ~pH `` ,H @"x,x)@"x`(x~Z"xUxxixzx"*#@"H"x"*+vx+px+vx+jxx@"xzx+jy"+j)9+j*g"xx+xix"xx+xixP"x#y""##@"x p:py### # %%0$##x#x.@#xh@#Z#)x(`` x(@#Zx.x#A(#Zx.`` `@#A`@#A@#A`h@hhpT ~ `h` `h-#W``x~x$hh'o@###w`@#wxzh.j*6"#x#" @#h#x$x@#@ih@#p8hix(x(#`` h#x(x#pT `h`xxH#x"y#####xp@#x+xixjxxxy@#x+jxjxhh$x+x$ @$ xx+xixx-wx0$$y||`$)h/h+x$$8hH5$8x.| @$bxЀ$Fx1xx1@@$Ph/h+x$5hH5@$Jp8$\yzi.j*x$5@@$lh/h+x$5hH5@$fp8$zp;yzxЀ$?i.j*!$x$5x1|@$`` hj(i,j:i>h+h/h3 hh py$$$$$$$$$xh$x(x$pT,P `h`*` !5W$@$ x$-" k|wx+x,`@% ~ ? h  !?  x@%~ !>~  x@% p%x$8$xx(x(h'xohx1ʦ@%i ih@%$h !5Wh "j8ix& ?!h- qVn`@'@'hhhx.x'@ @'x1xЀ'xx1yzx'x,x1@'@hxtx-| x-|  '8x-|'3?k!hk"hxx+vp3P'Lx#y'O'R'\'"y'U'Z+v'Z''xp'ix(x.p4` x'np@'cp ? hp>p2"y'x+v'}''}+vxp'x(x.p4` x'p@'p ? hp>p2"y''''''xx+xixp'x(x.p4` x'p@'pzx| i?--qV h@'h@'hx'p ? hp>p2~ / p'x'jhhh#n~Zh @(Ox+x(Op(x(x.p4` x( p@(pzx|yy>--qV h@(*h@(Chx(p ? hp>p2~ / p(;x(4jhhh#n~Zh @(Ox+~Xx(O~6 `pJ`pN`pR`@(klih(t{{||ަ~Zx0x(h!#$@({{||h~Zx1x, j@( i ~Zy-p>6 Hx` @(`"`` p`&|x.hhh@hpy(((((((((xx(x(xxpxhx%h(``|`@((x``` |`@(`|x-whx)&x-whx)&x-whx)&wx,q>-- h)xhr@) hx)h hpx(h)/x(x(hh xx+j}~ii@)i@)H)Z@)Z 1++x,$@)dx*3x)x+ ~)```x*W ii~X~Z)xUxxix ~)```x*W ~X)xXxxjx ~pH `a@)bH)@) &)"0bp()¢) x)Ȣ )  ")"(x+++x,$@)x*3x)x+x*WxXxZ xix ~)``*`))a | 2 x*#bp(** x* *  cH*#@*# xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |+jzii@*i+jx*x*W x,x)@*x`(x~X~Z*xUxxix~X*xXxxjx*@*qH! * x+x*x*WxXxZxix ~~)``  *`@*ᡌax* xxxzhh | ~pH `@* @`xxx`x`` |~p@+x+x+f @+fx@@+fx@+%{?+,@+M+5@+bx1xx1x+f@@+Mx+F?+b~Zyz +Vyyzzx1xgx0^xxgxxjxx+xixx+xixh#x+i ih@+hxix x+  x+ x+  x+  x+ xx~Z|~?;;6 y@+x```88y@@+ϡx```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 5F (@, !,  x, !,  d$@," #p,"x,|~ 5F"2H,8@,< !,v   2x,L(@,D !,  x,J !,  d"@,\H,\ #p,Yx,L|d,expx x전@,s$,s !x,t$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| 6|yzxЀ,?|~ y 5@ !y,,,,,,,,,xxKxH,xKxH,h@hxX@xZx0,,h ,xx,x | ~h6` -.a@-. @- 2@-!x-% x-' ?x-' !` `` |xjxxixxXxxUxxxxxxxxxxxxxpxFx~x0-uxx x전!@-uxx |xx |x0@-|-x|xx x전!@--x~xx |p@- ~-`/hxk-x,h hxX?hh/h+xKx  @ x전@  x+p ~h6 ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I.prr p@.x.p |p/ q.x/x.p @/ p/p.p@/.px/ @/ x1k/@.x/Vp |d$@/0,p 9/5'hh 0h)!@/08'/pu@/0 9/2x/| ~ " y5 qp pp q p pp Ix | I/Vp/pqp/^0@/k0/^p/p /q //Vx/hppp/pqH/xp I|~~~~ "qx/ |r!qp /ꡄ / y/////////xp/ Ix/x1k/x|p/x/x1k/x|px/Vx,h@/h|xxx0Prqp (x@0xx03x0P',X`c ""c!$@0)0) +`x0+`/2=,holkpx/V|8'0D`@0M ` 9/2Q@0Lp| Q|P9'0] 9/8`d0]-`|~ ~ " h `hklW/2~ h@@0y~ yxX@@00pp0p@0x$0x0,X'``~p`p !0Ƞ@0Ȧ0ppvpx`p`pb $pb#pvp+`x08x0x1k0 |~ ~ " pp0p |~ ~ "  I0pp0p@1x~ h@@1h$@1 P 9/5-`x1k1 |~~~ ~ " ~ h@@10 I1h$U@1h-p.` 9/5'hh "hH1UQ1Gx8'1;pu `@1h 9/2x1:" i $"i#1dx q x0 |p@1'!p!p!p!p~ yxX@@11vpx08|~~ ~ " I1 q1h$@1x.x1q1x/x1pq1x/p1p1p I |~~~~ ~ "  I1ʭ 1p h&ppp@1Spp1 Ip |~~ ~ "  I1h `hklW/2~pp2,X'``p`pppvp 1 2,qp 2, H29x/ꤠklp Ip | 2Q2L|~ @2w2wH2j2k2_x2o#2_~2 |~2x2s2 `x x"2x$x" i5@h@2@2h0 @2!@2 @3o a6 `4@2`62`@2xp2x2x2x2x2 |x<x>2x@x>xH@2ӀxJ2x|x4x62x8x6 xD2 xF> @ e@2` @2`"@3(`,@x2|x(x*3'x,x*x03 x26#@3' "@3 3'# x| i5@h@32h<@3o``?````` Bgoxh@3Jhhh h3Txh`/`+,hx i5@ hyD3ji hx | 5O!d ixk`hX?``H``/`+h0@@3hK hH@3p3x3hK hH@3p3x3 p3x3hh hF 5h xLxJ | y5x4x3x3x3x3xGxK|  5F"2@3  "<@3 {*{.| 0 5F"2@3 9"<@3 '{6{:|  5F"<@4  {>{B| / 5F"2@4 9q"<@4 &&{"{&|PTI,ptispptispSUNW,ispQLGC,isp㿘` `@|s < @|m"h < @|g"x < @|a" < @|["   for %s %s: cannot map registers clock-frequency%s: DMA map create error 㿐< Ր#0<U&ec`&e&ec`&e&e&e &e&e&e&e&e &e$&e(&e,&e(`"$&ee  `    " #\     <b#@<&ec`@< " 6e! @@yzb@6e< @{"h " 6e <@{ِ"x 2`6e`e!&` d&`.` &` @{ Ж "$6i6i6i6i6iԑH /* % 1`2` `` H 00Ge`2` `` ܐH p@06<#p1`01ee#\@        e<8!X`e`"  @`2` ``ŦH 02` )̄P `%  2` )P ` %0 xe #\#`'<0 1 $   2+ e ,d    #\1e$d#`  $   2 e ,d    $d%s: bad handle (%d) in isp_sbus_dmasetup %s: dma map already allocated 㿘`,`  6?  * < H %@ "%< xޒ ` `(  &`4  %` ` `  (`,  @`(   @6 `, &$  6& %s: bad handle (%d) in isp_sbus_dmateardown %s: dma map not already allocated 㿘*<! %@2%<! ` `"``  (`,  @%` €㿘 @, @&$ $ espdma㿘` `@z\ < @zV"  %s: cannot map registers burst-sizescable-selectiontpeauidmaX&`,&`0( "$&`4  `    " #\     <#@`0x&`4 H " <c`@T??"  2 &`<` <Uc ! <@$cp`4<@yc  <@yc ,`4"@"  &`@&`@,  <@yϒb ` <#@y 2`t, `t@)@<Z<c x€ 5<`0@' @(l |@ 2`0㿘 @ & l& p<!l , `" @㿘  }  < ,"""""" "" """" 㿘 @, @%$ $ 㿘` @yT`?%s: attach: cannot map registers burst-sizes%s: attach: out of memory : %dK memory X&`,&`0  `    " #\     <+#@&`L`&`P&`D H  <ch@S??&`H&`H`H`4 &`H@(O,    }u  2`P<#x`01<`#c:` `,<&& x&&& &&&&€& '<`0@' @' |@ 2`000<0 3f#!0!㿘` @x`?%s @ sbus: cannot map registers lebufferbusmaster-regval%s: DMA buffer allocation error %d %s: DMA buffer map error %d xa&a&a  `    " #\     <" `0 &aD P<&aL&aH$ TbX@ϓ 6a@ < <T#<bH @wڔ  2  T " L  2<TbD&aa@'|, <0@x#䀢 2aD,@`  2 aD`@2aD"aD 2a<0 #\#``  $   <"p`0Ja ,aD   <"`a (05?*@ &aH&aL6a@ǐa|<U &a(&a,<W#l<W<W<<#Da&a&a0&a&a&a &a&`&`a<R!|`@`" @ 00<0 3f#!0!㿘` @w`?%s @ lebuffer: cannot map registers busmaster-regval㿐a&a&a  `    " #\     " L<"``0U &aD P<&aL&aH& Tb@Ι <T6a@D&a@&a, <0@w?䀢 <V,@2<V ""<V &a(&a,a|&a0<W#l<W<W<<#Db &a&a&a&a &a&`&`Ta<R!|`@`" @ 00<0 3f#!0!㿘! 4@ "" 㿘! 4*@ "" 㿘 `  `       0   Ӑ ې !4  # %"`㿘!# 4@ `€  4!? @"  4 " 4@"@k" 㿘   ```00%s: lost carrier on UTP port, switching to AUI portAUI port, switching to UTP port 㿘<" !4@ "<<" 䒊``2<<"k<" 䒊``2<<א"P<Ґ"㿘` @v.`?%s @ ledma: cannot map registers %s @ ledma: DMA buffer alloc error %d %s @ ledma: DMA buffer map error %d xa&a&a& D  `    " #\     <#`0#&aL<0 #\#``  $@  < r`0u ,aD   < (b` (0`?* <TD&aH6a@&a&a@%a, <0@u䀢 <,@< ""<!8<<Va  &a &a$&a(&a,&a0Āa|<W<W<W<<<<<D#l`Laؘ"&a&a&a&a&a &a&a&a&`&`<R!|`@`"  @¢ptscII㿘` `@uV < @uP#  initiator-idclock-frequencydma espattach: no dma found%s @ sbus: cannot map registers esp㿐<&fcX&f@p &f<ch@j? &f`$ 8&f<`@#x &f" D<#< #( "$&ff  `    " #\     <#`09<zc&f&ff@$/,`" <@tՐ#Ȁ 2 ,@`  2  `@2  @  <@t# 2<V<V``p@{%s @ dma: cannot map registers 㿐< @t# c<&fcX&f@ߔ &f<ch@ٔ?&f&f& D( "$&ff  `    " #\     "<!`0-<z&f&f@#f,`<@tV#Ȁ <V,@`   <V`@2<V @ <V@`pintr㿘&Вb@@q& &ǒ  &&. . . `   € _ " /&&Ȑ . `   .     .    €  && .  @ . `   &&&#@qy&Ȁ`&&``@&@&&& &&@&&Ԓ@qb$&&&&&< 0`&`"  @<c ,<}< န(<V& & 黒`` <6" @n &*` &*`( & &( &4 㿘& `@㿘& h@㿘& d@&4@"@& "H&`4 &HENI-155s㿘 <@sZ"  <0` @  %s: cannot map registers 㿐<#@`` @ "#\   <#Hƒ`0<o ``@`"  @@bP"\&@ @@"`Ȑ㿘 @8 @_$ $ 㿘` @r`?%s: only %d register sets %s: attach: cannot map registers #channels: no channels burst-sizesranges%s: error getting ranges property%s: attach: out of memory : %dK memory X&`8&`<< L`0`L  `    " #\     <[   `     " #\     <A <&`Xa&`\@ɽ??&`P<!0l H " <a @ɭ??&`T&`T`T`, &`T@!<a0 `D@N`@ <!8J`,     v”  2<!`֒`0;<`\<`8$ $ $ a\$$ $ $ &`H<!$ $ $ $ `$c;` @q<cx€ '<`<@ ]` @ ϐ |@ 2`<㿐  D\   @  8   @    " #\ ` %s: warning: no interrupts 㿘` `H`2@<!@V`    `" @㿘 L \@o< P& `$  P \@o5*`& d$ $ $  T @ 2  < @ $㿘 & ( & & ( $& @v& &   ,@t@u$  "@( ?.@ )  ,@t@u$   "@( & 0& ,& (& 4㿘` @qG`?%s: only %d register sets beattach: cannot map registers board-version rev %xchannel#burst-sizes address %s %s: DMA buffer alloc error %d %s: DMA buffer map error %d x`@`<#xa8  `    " #\     3<a4  `     " #\     <a<  `     " #\     "&a,<X#0 L<&a0c@?<#Ȓ J&a@@<cА@??&aD&aD<c@??&aH T&aH T<aHa\ &aH `@  `"  @ar!<#~!&at&ap<0 #\#`` 1 $   < `0~&aT ,aP   < ` (0h@w<<b !< $,$0<<$4 $ aL @ ?a2)`` "  ! "` #  `#!  & `&     `<$``<$``<$`` ?! $`"$` $@$`|$`$`4`0`(  %s: invalid packet size %d; dropping 㿐 0X $@p @'x5<( 9Ԓp@nh* <(`  3< `2= H /* 'T *` ?5   !  0@  4"`4 4 0"0"  al    ( $ t , $ ( ?4 H A@q@H /* 'T *` ?5   !  0@  4"`4 4 0"0"  ral    ( $ t| , $ ( ?4 ^H  2 # 8-# 8 "" ᄐ $ 0$6 0    & & $  ?& 2I ($x㿘a4<S! $"  " ߐ ? $#  # Ӑ ? 㿘H /*&ؐ@H p@%s: device timeout 㿘< a  $ 㿘!0  !8``!4!`@`@Y``@` @:%s: bigmac error %s: bogus tx descriptor %s: tx dma error ( Late Parity Generic ) %s: out of rx descriptors %s: rx descriptor too small %s: rx dma error ( %s: unexpected error interrupt %08x %s: resetting 㿘6` `   ` <"  @<"  @`<"8ْ@   <ѐ"P@<ː"X@@<Ő"`!<"p`<"x  `<"  ` <"  `!<<"P``<"X`<"`"p  `<"Д `<"%s: receive fifo overrun %s: transmit fifo underrun %s: max packet size error 㿘 `  <   ``b<!  X`d<!(  P`  <"Д G` <"A`㿘!4 @b@bDbH bL  T $ T"b@"bD"bH"bL! !| !X* 2&!| 0 L { 4 0$ L !? &!&!|!`"4 . 㿈`'t'-&&<( @?,e < T`H%`Ht@kl* @ H /*'5<( H p@` H /* '``7`H 0  ` 4`$`4`$@$`)  2` ߑ   $`$`$` b'{<(  f БH /*'A H p@` H /* '``6`H 0  `4`$`$@$`4`ݢ   l 1 0H /* '<al  $`   $`H 0` (` $`4`$`($` $`$$`4$`0` 2(8 `@n$` %%  2`D`H %`H %`D`(  ᵒ   * #" - ?&ခ 㿘 H /* & !2  !1b !  !"C 0l 0!5b0 !6^ 0a 0 6 0 `   B0>@]e0P 2        6 6 $6  * * * * *  * @  2 0 0 !6 0  @ߐ@ 0# @Ò @`4 @o  H 0㿘 @!4!8!,H /*'!P2(@@!! *  $#  *`@ $#  *  $#$#L$#H$#D$#@@5 $"P $ $",>!_$!!d$`!\$` !D@p`$` $`$d $`(d $`,$`$`$`$`$`0 $" ($#  0<0@a <5 0! OݒH 㿐!4 @ 0!#  @$# 0V# ?$#  0"?#$#L$#H$#D$#@0I 7777```3?#`@k  " ;n $#L$#H$#D$#@ 0-"# ? @    @23 ``$ @ 22*  * @5 ``Ԑ$#L$#H$#D$#@ 0 =6 0!<   "  "  %s: rev %d PAL not supported. be_tcvr_init: MGMTPAL=%s bDLCLOCKbOENABbEXT_MDIObINT_MDIOEXTERNAL %s: no internal or external transceiver found. X!<Đ!@ < e 0.$`` $`` `!<<  @ ߔP <J ?!L &!L$@@0 ?$@@0<!7 㿘`    !<`*` " *  " ":   @ !<`*` " *  " ":  @ @ !<`*` " *  " ":@   @ !<`*` " *  " ":2 ` !< & & 0  &  &` !< & & 0  &  & `!< & &Ԑ  ` 2` &ː  `2` &*?@` !< & & 0  &  &` !< & & 0  &  &` !< &   &   0  &     &  㿘  * * !<``"` " ";  2   * * !<``"` " ";    @ @ *`*`!<`" " ";``@   @ *`*`!<`" " ";`` !< " "`!< "  " " >  *!< `* " ` "` "> %s: bmcr reset failed 㿘 i d  # i  ֐ ?< <   ( be_statchg: media_active=%x 㿘<!| Ё㿘H /* &!L  @ 0@H 0<0a <! M%㿘  ` @0            㿘!L  @ސ !&`!4&`   a"` @@ 2  & & # #&` ֔  є  `   ?&`100baseTX10baseTauto sense%s: selecting %sfullhalf %s-duplex %s: bmcr unisolate failed 㿘 ` !4a !L @O 2X!b @" $b N   "G  `< c`<<,c #(< #8b "<<#P!#X > $b <#` ; H   N $  ?<  <#pr 㿘` @g`?%s: only %d register sets %s: cannot map registers mace-version rev %xchannel#%s: DMA buffer alloc error %d %s: DMA buffer map error %d address %s x`@<w!`a  `    " #\     <a  `     " #\     <!`0<a@?<! &a &a  L<&aa@?&a T@X&a$<``!```"`   @a`#!&aL&aH<0 #\#`` 1 $   <!`0W&a, ,a(  " `<!` (0@<<}  #   %    ~  `<$``<$``<$`` ?a!ᤔ"$` $@$`|$`$`4`0!<"̐e`(  %s: invalid packet size %d; dropping 㿐 00 $@H @'P5<( 9H@d@* <(`  3< `2= H /* 'T *` ?5   !  0@  4"`4 4 0"0"  al    ( $ k , $ ( ?4 |H A@g@H /* 'T *` ?5   !  0@  4"`4 4 0"0"  Pal    ( $ kZ , $ ( ?4 <H  2 # 8-#  "" \ $\ 0$6 0    & & $  ?& 2I ($P㿘!! ,    ?  $@ @  ? 㿘H /*&ڐ@H p@%s: device timeout 㿘< a̐  $ 㿘aa *`2  a`#߀ @ْ?  @  @*㿘!\ @ !T !0* 2&!T 0 L { 4 0$ L !\? &!\&!T!\`"4 . 㿈8'LX'-&&X<( @?,e <!ޒT`H%`HL@cxD* @ H /*'5<(w H p@` H /* '``7`H 0  ` 4`$`4`$@$`  2` ׀   $`$`$` b'{<(  f БH /*'0 H p@` H /* '``6`H 0  `4`$`$@$`4`Ց   l 1 0H /* '<al  $`  $`H 0` (` $`4`$`($` $`$$`4$`0` 2(8 `@f $` %%  2`D`H %`H %`D`(  w٤   * #" - ?&X %s: excessive tx defers. %s: no carrier, link down? %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... 㿘@@   <#HP P $ P@ <#hE P $ P@ <#: P $ P @ <#. P $ P @@ <#" P $ P  @<# @<# @  T  Pa!$ T$ P@<   @ < 0 P $ P @ < H P $ P @@ < hڒ P $ P @ h T  Ha!$ T$ Hd H !$ Hb H !$ H <  H $ Ha <  H  T $ H$ T``@ H !$ H` H !$ H <  H $ H` <  H $ H ` <  H $ H ` <!v H $ H ` <!(k H $ H  `<!H^`<!pX?㿘 H /* & !2  !1b !  !"C 0l 0!5b0 !6^ 0a 0 6 0 `   B0>@]޻0P 2        6 6 $6  * * * * *  * @  2 0b 0 !6 0  @W@ 0y @ @`4 @u   H 0㿘 @!!! H /* ' (!((!<$ !4$ $ $ $ $$ $ 0$ 4!@f``$ $ $`d $ (`d $ , , ,, ",  `,  \, ,!` ,!`, , , , , ,@ , ,  , 0!  , @0`@ {40H 0㿐! @ 0! [?"  ,`  ,`0M 7777   :  @a   ,`  ,`,` 0"$6 0;n # ?    `@2?3`$ 22*  * @5   ͐ ,` @ ,`$ @ ,`,`   "  #4 ` %`"``  "` "`     "**  0*` *` 0( SUNW,CS4231㿘 <@a `?%s @ sbus: cannot map registers intr㿈<&`|<#`&`&`,&`4&`8&`<( "$'  `    " #\     < Hm`0,&`@4&`0 &``E<_ p`p@< `@`"  @<`xݔ`<V!d! CS4231ACS4231CS4232unknown rev: %x/%x㿘  @   `瀢 "<    T  <!& \<"& \" & \ Td  <b `K `& \㿐 d 2 .   #\#`'   $@   ex   ,     2   ' $  (  e^cs4231_free: rogue pointer 㿘   @2@  0    ( $@e=0@ 2 <#Ё㿘 2  & & & & & & Ȓ f  㿘@@&   㿘<Va4@ak 0 㿘<V"h<Va㿘<V"h<Va micvolumedaclinecdmonitoroutputmuteoffonrecordsourceinputsoutputs 1<(D\4DT4l8 #  ? # $# # <h # # <<ppJ# ( #  ? # $# # <x # # <<pp8# ( #  ? # # # $< # # <#+  #  ? # # # $< 3 # <+  #   ?# $# # < # # <# <pp# (3 ,+ . # ? # $# # < # D  ?# # $# #   ?# # # # $          ?# # # $# < # <+ # (<# @# ,ᰄ 3 D# X|+ F #  ? # $# # < # <3 # <+ !p!p# ( 3 , a+ . #   ?# $# # < # <3 # (+ ᘔ # ,<3 0# @+ 2ah<# D# Xx # \# p<# t# 4+ x # ?# # # $<"Ȅ ?# # # # $< Є ?# # # # $<# #  # ?# # # $<# 3 +   cs4231_trigger_output: already running cs4231_trigger_output: bad addr %p 㿘   <"B   & & Ā &  2& <ڐ"+ & & @& &  "(", " ?# @"D "    {     㿘 ?# @"h ?r &  㿘] ?g &  㿘 @  4€ I    Q  M  8  ($@2    `  &  `(    & $`($`, Ā` @ Ƞ   ` @ Magma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_Sp㿘!?΀@.` && "@*`" * *   @a2`@a@ , (` H(  h(  * H MAGMA_Sp㿘 <@\``?magma_prom softpri %d: %s (unsupported) %s %s @ sbus: cannot map registers intr㿈<@`<Vbp  bp@\Đ << 2< U << M0I!&`&`P0&`  `    " #\     <!)`0  &`&` &`@6N0 @ K```T`\`X ~,` @   $%@ `@%*@   @  `@ @*"@ *`" *  *  &!: !@Yܒ#, `" 0 2 * %`@ ` 0 @`,4 ,`` "0@`,@ q<`T  <b  < `@`"  @<`!`"  @<a0  8㿘P     T g  a 2*` 0@@ `N `   `b *  `# # ;*` *  0@ @  b    # '  ` $* `b*  "  2  "   #  `  # $  `*@ ! 2`*` *  0 `m      `" "  `*@  `&2`*`0     c i`  *@   # ]#   *    S# * *  0@ 7@   c*  *    ?#   c*  *  ` ?#  ,$ , c` 4 , (   # ,`# (`*`* ,퀣`  , "  "     *   ? #  `*@  <0 ` W 00 %s%x: fifo overflow %s%x: ring buffer overflow 㿐   `'`,| `X`D`@`T`P`H`L`8@ p @"d`,(<< <5<   $@ `` h* ޖ H @?%@H 0   << h* D   <ax `r  "`,@ H P"  p<< h $ p* @ @ `,`0 0`0 0000`0 '  ,# 8 0`H  ?$H 0  yV  , `  <T  ```?: %d tty%s s㿘&  ; << cLH840`T%@ `" % "%<$ $ %$ ^K  &$`&@` ` ?@ന  `0  000Ԫ`0< &,< <  @㿘<1  4  *@` `,, *  0@` p @$@$ l`v H /* &@W  t Sؐ #c $ $ $ `   $ ` @  $ `    $  !%$ $ $ ` h@$`$$` `* @   @ , * @   * ` `2 p`  p  ?$ pH 0 `  << h*`( 㿘  <1`*6  . *  0@ << h,* ܐH o*@ f @  p @ @4 H 0 㿘  <1 6 . *@ *`@ `8<< h0* 㿘  <1 6 . *@ *`@ `8<< h4*  <1 2 * *` (8㿘  <1`*6  . *  0 << `h`8* @@ p h ]@W  y@: x@6V  z@& {@"  K   k@"/  j@-  \@"2 :   l@  m@"/ ` `$ ! 0%    @ 0@ 0@{ 0 @v &  &!:d "  $  o<1 0*` ((0H( p 2 # p"H㿘 o<1 `2`* *`@ *  0H o*@ f pc V  H ` & pw Hr  H  H $ , P$ ( p & p H 0   H(  h`( ";``"'`0TD`Q l2 m2@2 2 "@6 "2@00@22 m*2 l(0! @` m * l *0 @` m( l(H 㿈 o<1 `*2` *` *  0`(      2 `$   ܖ耢  H /* &`(   W `(  v r*@ * `$   | x*@ * @)   @& ` @ @ @ @ "2 c!"  " "" *`@   " *@  * @   @ N * * `@2  "  `` * *  ! + H 0 <  ` ``?: %d port%s 㿘 &   < T`0`4  "#@#  `  <"؀&`,< <  ݒ 㿘<1  6  W * @ "R  ,6N * 0H o*@f ` H 08 `$ H p@$$ @3?$ @0 $  "#$ H /* & h*@ @:   @7   * H 0   <12 (@ * " 8 㿘@`㿘@Z㿘 <16 `*  .  0 @@#  @&9   @24 #8/  &+ $$ ' @$ @ $  &@ &@ &H /* &@ h@* @ `o&H 0  mbppdelay㿘 <16   *`.   0`   @ 8  Yٔ 2   `$ `<$ !9` i 5<`` me Y  U` @@ߔ` 2 ` mG ;6 `2 $!`H /* !` $ <! 9]!rӖ H p@ ` 2 `@"`$ H /* !    <!9f   $  <!9\  $ H 0`` @$` &`Yے 㿘  s& 㿘  s& mbpp_send㿘& & H /* &   h*@ r * @ƒ   @Ô   * <!rN  h* * @   @ @   @ H 0 &mbpp_recv㿐& & H /* &1  h*@a" |  x* `  *@* @d   @a H@Z   @W   * <`!q  h* * @>   @; H 0 &㿘  . "* <0 @Qo* 㿘  <0a @XW@Qc#耢 @Q^#㿘@   `@  ( %s at %s slot %d offset 0x%x level %d (ipl %d)㿘`< 7! <!0  @ #'<%< ,` @ !@`&   L.`@@"  `@&  㿘<0 ` `@Sh`?㿘<0 ` `@SZ`?㿘<0 ` `@SL`? unsupported clock-frequency: clock = %s MHz sbus㿘`  <͐#`0&<0&`,`&`0<W"<W"&`L<_^cp@@h!<#@M&`8<<",$c@ %s: no Sbus registers%s: can't map sbusbusreg㿐 &`,&`0 2< ```4  `    " #\     <0< xӒ` `2<W<W""&`L<_^cp@@!<#@&`8X<<<" <##,c@X 㿘 <0&`,`&`0<W"<W"&`L<_^cp@@!<#@&`8+<c@1 burst-sizesranges%s: error getting ranges propertycould not find %s amongst %s devicessbus_attach: %s: incompletenamesbus_attach: %s: incomplete h@Z<bp@ <0` & H & H@RA   <b  D@5 @  <<W"l & @& D") 9<#`x€`*/<-<N $@ '<Ⱂ 0@Y zږ @Ɛ 28)<'<@!"   @Q  2# 0@& <#j #z @#`|€ ΐregdevice_typehierarchicaladdressp<b'@'`'`'` '`'`'`'`'` '`$'`('`, @` 2b` <Ԓa* '`'`'`,'` `@`  2O<a@ 9@ <@Qwa 2=` '! =#c* `* `  2#*` * @ "`` ' `@` <a`$ @>`(   㿘 " V_   "  VX   " $VR  $ "& ,VL & ,&& & & & & & & & & $& (㿐  D\   @  ,   @    " #\ ` 㿘  D  @@  ,@ `  ``  `" @`?sbus_establish: can't find sbus parent for %s㿘`$#<   c<`!<! @P<  2 $& <& $ <reset %s: %s㿘<0#P. @<"8!  < #< `"  @ bH  2 interruptsintr㿐<b' @` !< * T۔  28   .@"#  Up "&b& @7  " 0 .  "    " 0 㿘  T    `6 L .@.`@& &@0@r㿘  Tx  < ,<< D`## # # # # # # #  # # # # sbus error: AFSR %s fPAHbWMf SSIZf SAb FAVb RDb MEf MIDbSfSIZbBERRbTObLEbERR address: 0x%x%x too many SBus errorsX<,4!<<! 0̘ @=<!8 <*<Ḑ"  <a   "a<!В <""$ 㿀&`'?>#`#<!<`,  *䀢@( @" `,'`, '''c x6 ```, "`,`" 0&`"`0`  &`   'OUI 0x%06x model 0x%04x rev %d at %s phy %d㿘`"  < : *` @ #x2 Ø <# 㿘` @ "@  @  (""4 # & 0# &  0 ! A ! # &㿘  & ( & $ <  " , 2 < 㿘    <  , 2 <㿘  & (  & $ <  , 2 <%s%s10baseT, 10baseT-FDX100baseTX100baseTX-FDX100baseT4auto㿘<h!.`#  <<!<%@.`# ! <<!<#@.`& <<!<@.`& ۖ <<!(< @.`(ʖ <<!ϔ8<` .`  <<!H㿘 D ` @> H `0 : $ 4@  @ 0 $ @ 4`  @ `, $ 4 2 tՐ#`a$ @  D`2 ?<0! `<& D 2K:?㿘H /*& D   @& D , 4 $ <  @H 㿘 D !!!  @ 0  $  4%  @ `, $ 4"  8t#``c$ @ 8   D $ @ 0  4 $㿘 @  $`$$`( @ , $ 4 @,  $ 4 " @`$ $`$ @ `, $ 4"`($`$? `( $`(3 2 @`(0  `, $ 4 @,  4 $ "!`( `(    @`( `( @ $`( `(  G $`( :` ( c  : %s, rev. %d ThunderLAN 10baseT media interface%s: %s%s10base2/BNC, 10base5/AUIno media present 㿘 <<`$< `( ` <&`8"&`<&`4&`@ 4`  &`T`@ `,`$`4 &`H&`H`8*``"$\ `T  <`8*`# O < PV``T "  `8*``$? << X` `8*``% 0 << Xx4<p`H> @" `T*`8`H < 2<< < 㿘D `X @&" "` 0 82   82 "`@  , $4@$ 0 4@$0{ 0`h @ݒ 0a 4@  @ 0 $@4@  0$@4as"0I@  0 $4ar"@$4  0@ @  0 $@40,82 28 25 ` 0`/ @`,$4@, $4 2  L  $L$L"@ ?" @P`(@2`4 `4€$`($P %s: AUI selected with no matching media ! 㿘 @  $ $`$$`( @ `, $ 4" @`($`$F  `, $ 4 " @ T  `(  $`(<`( $`(!P/  )`$ %$`$ `, $ 4 @,  4 $ `$ $`$`( $`(`( $`(`( $`(㿘B?    @ 0  4 $0 $ X@㿘 @& X ,  $ 4   @`, $ 4 @,  $ 4  @  @ 0! @  0  4 $ :` ( c  : %s, rev. %d DP83840 10/100 media interfacefxp%s: no media present 㿘 << 0`@  <&`8!&`4&`<&`@ <``@J 2 `8 2`8`D &`D`8*`& e `@ `,`$`4< &`Hha``H> @2`8<X p<-<Q 㿘`"Y 0 82  { 0 82   @ , $4@$ 0 4@$0u` 0`a @`,$4@ " ? 0 $@4  `^ @@ `,$4 R E 0=$U40@ @  0 $@40,82 8 5` 0`0 @`,$4@, $4 2  L  $L$Li  ?" @P`(@2`4 `4€$`($P 㿘 @  $`$$`( @ , $ 4 @,  $ 4 " @`$ $`$ @ `, $ 4"`($`$T `( $`(H 2 @`(E  `, $ 4 .  @`, $ 4 @,  4 $ "!`(* `(    @`( `( @$`( `(   @  , 4 $ @`(   $`( :` (Q c  : %s, rev. %d QS6612 10/100 media interface%s: no media present 㿘 <<"hbx  <&`8#*`&`4&`<`"&`@$ `8+ `&  @`@ `,`$`4< &`Hߒ``H> @2`8<֐"<<ϐ"㿘`"K 0VU 82  O 0] 82  @  ,$4@$ 0 4@$0I` 0`5 A @@ `,$4 5 Ғ 0  $40@ @  0 $@4082  ` 0`@P`(@2`4 `4€$`($P 㿘 @  $`$$`( @ , $ 4 @,  $ 4 " @`$ $`$ @ `, $ 4"`($`$U `( $`(I 2 @`(F  `, $ 4 @,  4 $ ?`/*`<" €```0```````T``` ```<`( `( `( `( @ $`(`( `( Y $`(㿘z @ `0  4 $ *:` ( cP  : %s, rev. %d i82555 10/100 media interfacefxp%s: no media present 㿘 <<#`  <&`8!&`4&`<&`@ <`(@G 2 `D `D &`D`D 2 `8`8*``"$r `8*`& i `@ `,`$`4< &`H0e``H> @2`8<\ 8<1<U P㿘`"K 0ts 82  m 0{ 82  @  ,$4@$ 0 4@$0g` 0`S _ @@ `,$4 S X 0> $g40@ @  0 $@40,82 8 5` 0`0 @`,$4@, $4 2  L  $L$L{ ?" @P`(@2`4 `4€$`($P 㿘 @  $`$$`( @ , $ 4 @,  $ 4 " @`$ $`$ @ `, $ 4"`($`$+ `( $`( 2 @`(   , 4 $```( `(  ` $`(`(  $`(ex㿘 : *  "    < a8@F " : 3Com internal media interface %s: ignoring this PHY, non-zero instance %s: no media present 㿘<1! <&`8cH&`4&`<&`@ "`D<!!`0**`& &`D  @`@ `,`$`4< &`H``H> @2`8<~"<Ӑ<~"exphy_service: can't isolate 3Com PHY㿘` 84  <}D# "`7. 03 0`0   @ @ `, $ 4 20  0*  $ 40@  @  0  $@ 402 ` 0`" s P`(@2`42 `4€ $`(& P 㿘1 @ `0 4  $ :` ( c  : %s, rev. %d LXT970 10/100 media interface%s: no media present 㿘 <<!a(~Y  <&`8"p*`&`4&`<`"&`@$@ `8+ `& 7 `@ `,`$`4< &`HH~3``H> @2`8<~*!P<<~#!h㿘`"K 0ml 82  f 0t 82  @  ,$4@$ 0 4@$0`` 0`L X @@ `,$4 L & 07 $540@ @  0 $@40%82 1 .` 0`) @`,$4 2  L  $L$LP ?" @P`(@2`4 `4€$`($P 㿘 @  $ $$ ( @ , $ 4@ " @ $ $ $ @  , 4 $" ($ $   ( $ (dh (  (  $ (@ ( ѐ $ ( : (}2 #   : %s, rev. %d ICS1890 10/100 media interface%s: no media present 㿘 <<!a}'  <&`8#8*`&`4&`<`"&`@$ `8+ `&  @ܐ`@ `,`$`4< &`H}``H> @2`8<|"<͐<|"0㿘`"K 0VU 82  O 0] 82  @  ,$4@$ 0 4@$0I` 0`5 A @@ `,$4 5  0  $40@ @  0 $@4082  ` 0`@P`(@2`4 `4€$`($P 㿘 @  $ $$ ( @ , $ 4 @ , $ 4`" @ $ $ $ @  , 4 $" ($ $!  ( $ (`2  ( @ (  $ (@ (  $ (㿘ѐ @ `0  4 $ : (2 #0  : %s, rev. %d Seeq 80220 10/100 media interface%s: no media present 㿘 <<"b{  <&`8#*`&`4&`<`"&`@$ޖ `8+ `& Ֆ ~`@ `,`$`4< &`H{ђ``H> @2`8<{Ȑ"<<{"㿘`"K 0ts 82  m 0{ 82  @  ,$4@$ 0 4@$0g` 0`S _ @@ `,$4 S Ē 0> $40@ @  0 $@40,82 8 5` 0`0 @`,$4@, $4 2  L  $L$L ?" @P`(@2`4 `4€$`($P 㿘 @  $`$$`( @ , $ 4 @,  $ 4 " @`$ $`$ @ `, $ 4"`($`$& `( $`( 2 @`(   , 4 $``(  `@ $`(`( \ $`( : Generic IEEE 802.3u media interface %s: OUI 0x%06x, model 0x%04x, rev. %d %s: no media present 㿘<z# `: *  <#2z` <&`8 *`&`4&`<`"&`@$ >`@ `,`$`4< &`Hz`H> @2`8<z#<]<z#㿘`"K 0ts 82  m 0{ 82  @  ,$4@$ 0 4@$0g` 0`S _ @@ `,$4 S  0> $40@ @  0 $@40,82 8 5` 0`0 @`,$4@, $4 2  L  $L$LI ?" ΐP`(@2`4 `4€$`($P ` 8`?  flags 0x%x (console)  h 4,<W`c` <U$`$` &`0a<+ * &`D? @   &`@<#hy`@ " <<y#xg" <Ua" y#P<Ɛ"@<<ǒ`4& & l& & %!<W#&`,*  Ew &`T#&`\`T+ `@ &`P&``&`X&`H.&`L'`'`'БH /* , `1 `,`1H 0& @?ȕH *  @ H 0 @ H /* , ( @ H ?  0 <1?( (@,㿘 0 ,H /* , p `. p@l . v&  @ @ <0<;! ^P  @   `1  ,`1,`! H 0h? <1 2   ?* 6  * @ 2 , `  0`p @$@ ` H /* &@r `t n$`l''' D   @' D @А ' D А ' D  'БH /* , 1 `,1, v$ H 0$`@a @2 $` # %$`$`$`$`$`LHH o*@ l @  \<W$ T T#$ P$ XU p , p@H p@H 0? 2`  @`0 2`p `h<<*`(  2`p  @`t 㿘? 2 <1?* ఓ*`  , p @ h<< ,* h p`@ t ݐ 㿘? 2 <1?ఒ* *` << ,0 h* 㿘? 2 <1?ఒ* *` << ,4 h* 㿘? 2 <1?ఒ* *` << ,8 `h*  0@ 9  H /* , j@u ' y@d !@  !@ x@Y߰  {@< = !@ ]@"9 Dΰ   m@  k@@ !@"E  X@" I   \@ 00 !@"{ |  !@"6 I 0 !@| 01 0- 0& !:KC $ D@ 0@ 0@0@/~&& & & &  t& Q<W# 2l $  $ $  $ $ ", v      , w, x , v  , v, w, x, w, v, x@@`> q 21 h04<W#5&& & & &  & & '&% - 2     , w, x, v& @;Ē#&@Z@` q  h $ l$ h$@Ð0 H 0㿘 l?  2  <1?* ఓ*` `0H /* & p= `s 9V  H 4 P & p], H  H`( P H& H pl$`h$`d p `& p,`q 1`2 `d` ,1,!E `d{ `h`d $`d$`hH 0l? @0 ` <1?((H( p  l hp "pH 㿘 l?  2  <1?* ఓ*` `( 0``$`@" D  D   @  ,   " r 2 H /* , @x `3 `5 ? !   " #" ` `4`@`@ ` `4,`3 `,`5  "`2`,`4& & & `@  q   h$ l$ h$`@<W p$ H $ L p  , p, u,`L p   p `, p@<W#c$ H$ L@c H   s , sɐ@  0 H G@*F v" F I@*F F ? "߄ *?㿘 0 J`` 5 * *5@   q   h& l& h"@G 㿘 0 ?2`  l@" 5    k@" 5@ m@" 5@* } *5@   q   h& l& h"@  0 5 `` `  D`2 @` 2 㿘 l?  2  <1?* ఓ*` 0 K / H /* ,`  p  p ` p  p  *p*u*L p  p `*p@ H 0 㿘 0 K p  5: %  @ % @ *5*% %} 㿘 `T`X ``\  p` 0,,  :`\s ? $`T$`X `p  ,`u. L `p  `H `p`,`p   `p`,`p 1   . 15. !㿘 @  V& @ l$ l$ h h   d[  h d $ d$ h 1` ` . 1. !  q , q , r. L㿐  ` ` @ `B0r2 F D@ F k. D E . E v [ @ w@2+ xT$ * "@*`@ *`$    a $ $ 1Mb  $ $  #'@8 ' |  -$ |@2, F($ * "@*`@ *` $    a $ $ 1Mb  $ $  #'@8 '   $ $  F `@ $ h$ l, t. L%s: %d silo overflow%s, %d ibuf flood%s s㿐H /* , 4& < 8& 4& 8H 0 <ɔ  p< <ɘ `2<<  #\q 㿘  ,H /* & u  . u P/<W h<<ؓ*` X <"   0  ` 8 < `& 8` & <<0a <ɕ*"  * p @ ,@@ ؑ* $@ A5< ` p  @ @ 4 < `& 4` & <<0a *" *ڒ@@@?2` p  ,@@ ؑ* $@   p . p @: \2 `2& PH /* , X& & X X L   p   p `. p 1  -1-! p  p `. p H 0 t / 0. tH /* , E D, EH 0  G@ << h*`D  ` H  . s h<<*`@ 0. s r . r p ` % p % p d H Pz" h<<(*` H 0㿘&  & >D &  @9㿘 > firm_event㿘``a (H /* &@ ` %<9,`!Wv 9@`󀎠`` !`" H 0`2`4`*.Q@ $#$@  `0H 0 #H 00 4`Q.$@㿘H /* & `A  @2 Ғ`` H 0` @?  (console) 㿘 4,  <X` $& & &`,  <.`q#<q H o*@ lN`    @ q  . 1$H p@@`l<0  2  :@6r&`\  M&``.`.`@㿘?<1 2    !  *@ 2 P0  $ P@ؐ $ P @ h `$ <<͐"$E$ h 㿘? 2 <1`*  $ < @$ P㿘?  2 <1 *  @ؔ -㿘?  2 <1 *  @.㿘? <12 `*  b~l@{ &# @"^  Z#@b#@E i  Z#@S #@"K \  "}@"MU   v@"JP #@"/ #@"B  # @"(; 0#@"  # 0# @  0+ 2) 0'&&@P" @!@V &"<&@  .@ *U! 2 " 0"   "      @ 0 @2  *2*2 0@  v2  * 㿘<1 @ `* l` ` %` #  ` `?*H /* &` @- @B@RH 0㿘N@H /* & @ @eH 0 $ <Y4<Yx(@"`"`"` "" `  "  ` #(@@ ??(?@ ?  ?<Y؇(㿘N@*`@: `N@ @[%dz㿈`?<͔`Po㿘?# @c X`l4$"(`0P*0M!"1 $$$0B",$#209  0` @1 . <Y*b8  '  "  ` **@# ` *@# `  *@# @    ? # @  㿘H /* & h    d` <``"$H 0%s: received error indicator %s: code=0x%x with mod=0x%x produced unexpected keysym 0x%x %s: event queue overflow 㿘 l`   ,`@ǐ` "$`,`@ߐz$``~ ~2 <`" <``~< <`2  < $`  a$`>b < (` h <͐"$& hҒ  <`b m) 0@ = & h& d<`\f"$043 D X + ! ? @" 6`<͒c m 0` 2 #`<*`А H#```#` & D|N T`"N U. TU @N U  PJ kbd: magic sequence, but not console 㿘  ! ` p`M 0L  `  , L <k `n:!X `  ` , `*  @, 2  2 0 $ 0$  . L㿘  ( 0 $ 0. L㿘     D  E@ . E. D`0 $`0. L%s: input error (0x%x) %s: input overrun %s: status interrupt? 㿘 H /* , 0 $ 0H 0&  @!'<Ε,`  `* 2`2`   P    l?   Ɛ @ ,` <Βc l. @ʒ @ڐ$  4 $ 4@<Βc0 l . EH 0%s: reset failed %s: no response to get_layout 㿘<1 6V . @ 2 8N   lI H /* & @ @@c<B'<0bX  !R # <ϒ` kϔ  ,` M ``@c @s@D  R! #<ϒ`Ȑ k ,` H 0  $ 8㿘 lSƐ  "  " ,  2,   @*@:, 㿘S kbdout㿘 4  #< 4 4$ 4!bR3  4 %s: output overrun 㿘  * ` `@  <ϒcPkU 0& 㿘 4 ( ,     4  4 4 & 4Sb\  &  4 & 4H * ƒ `H 㿘 l ` `  *` Ð㿘 l @   2*ܓ:` screen-#rowsscreen-#columns㿘 ~<aȰ<<ђa!Ĕ!& & & l $  ($  H$ߔ <b $ ,<Y@["c@[$ 0$ 41<0 ? A  0 2 4<d<@Βa  J  *` + :`* J ?Б*`2 $ 0 4  <d<@a  J  *` + :`* J ?Б*`2 $ 4 <S ` 0 2 4 `Q$ 0 4  `P$ 4<ׁ㿘?2  <K !`,] 2D p @$@ `7 H /* &@  c#  %$ $ $ $ $ $ @g }`2 p4 `6 4 $ pH 0 h<<`(*@ 㿘<! p`@ << h* ,ِ 㿘<<< h0*` 㿘<<< h4*` 㿘<a<< h8* @ 6 Ҙ  `$ `( ` 㿘H /* & p8  H& H<"``& pH 0!@HH pf p ? & p<ѐ#ܔ V  V    p` & pQy H 0㿘@H o*@f p<< h ?& p*`@ H p@X<# H   * * `,€5 ?  㿘<!   p @ << h*`<  㿘 !<א"& & * <א "b㿘<נ"$$a#)<.'?#$#В @ @`0@"$ 0  逢@ * $  *$ 㿘<c(€<׀` ` @?  㿘 4,  <Y#& & <Ґ!jI&`,H o*@l  @   . 1$<H p@?6b<㿘?<1Б2     Б* @ 2"\   2 &"\"L &"H 㿘? 2 <1`Б*  $"H"L$"\㿘?  2 <1 Е* "L -? <1Ѕ0 ( ~@' @ }@  0" v@  @ 0 @ *a\` @  "   㿘?  2 <1 Е* "L"! ms_rint㿘"H ƀ6"< "6"<"< * : `1*`<Ӑ! €OMM0MHMhM>`  .">6"<"@.`: @ "D.`: @ &"D6"<"@.`: @ &"@6"<"D.`: ?6"<&"D<g "P "d+ N">@N"?)"L<Y<<*#Р``И    ?#FL@*`@`@ 3@#``Ѐ #` #` `"d  "@ ""D    ?#!#3@"@<*#``Ѐ #```#` `"d  &"@"D     ?#?#3@"D<*#``Ѐ `#``#`   &"D."?&"Pv"TN"``"N"a."`Ow"LN"a "\D 㿘  8 ͐ p` 0 *  @,` <2 ` 4 2 0 $ 0$ 8 . L㿘  ( 0 $ 0. L㿘    D  E@ . E. D`0 $`0. L%s: input error (0x%x) %s: input overrun %s: transmit interrupt? %s: status interrupt? 㿘 H /* , 0 $ 0H 0& 4 8@'<ԓ,` < `* 2 2 P   f ? 8@ ,`<Ԓa f $ 4<Ԓa f <Ԓa8 f . EH 0㿘': ` ` 2. @2)@/L @/ 2@/A  @/ 2@@/6@ @/@  @@'@̤directsequentialprinterprocessorwormcdromscanneropticalchangercommunicationit8storage arrayenclosure servicesscsipi_dtype: impossible device typeunknown㿘 Q<Ր .  €U UU$U0U<UHUTU`UlUxUUUUUUUUUUUUUUUUUUUUUU<+#<(#<%#<"#<#<#<#<#<#<#<  <  < <e 8<հ ` ""   ""2 \ _`(*  00*  800*  0*\2 `* *`* Ҕ*scxspl㿈<(   "(<<#h!c#\#`#d t  `y getxscannot allocate scsipi xs 㿘H /* %  `#<Հ  $  chL   @?<!ag ` " < ?, H 0 @<f#pH 0 `& &  0 &  0"$ 0& d& h& l& p㿘 `  "`  $ 0  " ,  a ~$ M , < & !a   `,  $ M0  `@ sxdrn㿘H /* % ,  !<  ,&  !K  , 2 H 0 DEFERRED ERROR, key = 0x%x Sense Error Code 0x%x at block no. %d (decimal) 㿘 `<@? @  p qt <€ `<֐"(f ` ` ` `<֐#*` €[T[T[x\\[[\`\h\\\p\h\x0,@I `2F$00D   ?$  @\ ` :  ` "  00N!K  G %  ` )2  ` =?   ?$  4?  0 , 0    ?   @[ 0€ @<֐"He ` @ ` `< *`* @ @ e"`<e}" could not get size p  ? 4"  %/#\h#d7#`    2 <. * *`   @<eK! 㿀 @2 ' 4 ##\#d7/#`    㿀'7 4 c  ,//#\#d#`  , 㿀 @2 '7 4# /#\/#d#`    㿀  "' 7 /`//!0 ##\ 4#d#`    㿘    @  ``XD 0T   Kj0L@ ?2 8 ` "    9 8 8& 4` " $`(`$$`(`0($`$$`4 0$`4  `@   `H /*% H `űscsipi_cmdscsipi_execute_xs: invalid return code㿘 & 4 , ?& & 0. `   `` €`? "9   <04#<01 /?H /* %    !<ؐ !Ix   H 0 8  @ ?" & 4b}!(scbusyunknown error category from scsipi driver 㿘 4`D*`<ؐ" €cc c ddcccDc<  8@?" 4  "   R!"@   # <*<ؐ  I  `   ?& & & 4?  2     <@<c" 㿘 H /* %   $  €  ?$H 0㿘 H /* % ?  " € H 0㿘! T/S  @*!H *<cc &" "c& H 0 㿘H /* % ` "` "H p@ /ɒ TH(<   @  HUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category %d from host adapter code 㿘 8   <@<b"0T 2 !  <@<bِ"0G ,`[ `,`Z 4`5*`<ِ# €ghh$hDhhhhhht 0 ," $`$+,`[ ,`Y `X <@+`( ",`[  `X <,`Y@+`(,`[<@ <b"В ,`[ ,`[  ,`[<€  4<b" ,`[ɐuser_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistr㿈A  <bn Y ` 0  a`<@ <b` K 2 E ( ``<@ <bO!: 2(  #d#\#``4  <` H /* % $"  !<ڐ !Gc  $"H 00 $& (h& $F㿘a 0!   !  !"  !!  0 !"F aY 0z0!v _@* `&    &&&&&>&<ڒ` `&& !` */њ &@&(&,&D&8,0@* `K0< ?`$  $ ``  $ `  @$ )   %$     0& ! & "& #& &  & &    ! & "& #& ReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadyRecovered ErrorNo Additional Sense@(hHpX@p@xP 8       pX@(hP @ (  pP8xX(xPH `8X@  !!"$%p&P&8& &'n(()h*P*8* +~,~,~,~-~X/~00~0}0}0}1}1}h2}@2} 3}6|7|9|:|;|;|P;|(;{;{;{;{;{;{x; {`; {@; { ; z; z;z=z>z`?z0?z?y?y@yAyByXCyHDy0EyFxGxHxIxJxKxhLx@Nx PxPwPwPwQwRwSwSwhSwHTw UwWvXvYvZvpZvHZv(Zv[u[u[u[u\u\ux\uX`uHau0auaubtctdtIllegal Mode For This TrackEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailureSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change Input (Unspecified)Updated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationData Phase ErrorCommand Phase ErrorInvalid Message ErrorINITIATOR DETECTED ERROR Message ReceivedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)INQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTIFY MessageMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Begining Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumPositioning ErrorMedium Not PresentSaving Parameters Not SupportedRounded ParameterRibbon, Ink, or Toner FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorOverwrite Error On Update In PlaceInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectLog Parameters ChangedMode Parameters ChangedParameters ChangedPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Threshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Element AddressLogical Block Address Out of RangeInvalid Command Operation CodeRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With LECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldUncorrected Read Error - Recommend Rewrite the DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block FoundData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retried ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorError Log OverflowSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorLogical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: 0x%02x 㿘!<!@ǒ XN <X!N  ` <!X   , @ <X!  , <!Xڒ    *  *` *  <Xː"  <j"0   *  *` *  <"8X @}  <"XXN `<"pX `@m  <"X<b0X` 8    N    (N (<"X~`'<Xx  Xs ?`%< XhXe?`` `<"X[%s, %sError in %s, Offset %d, bit %dCDBParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %dX` ``` ` `<Y#, 1< "8@s0;`<ےb`1< "8     2 @ @ b  @ 2 b  ` @ <a`X3 "8<a@9"8E`3<ےb`      2 @ @ b  @ 2 b  ` @ <a` W <Y<aW<Y@<Y#,  1<װ"8<aW0WV  RN ?`J< ē*` €؀ 1<<!@"8<!<! *  W )"8<!Ѐ@"8<!<! *  W"81<*"8< a1<*"8<bW Check Condition on CDB: 0x%02x %02x㿘  <@ < W3! 2 `<"T*` €t||      " ?  <%<  W & <W"0 <x  ? 4ab @ //#\#d7#`    㿘d `d $`@Ŕ\$` `$`$$`($`,$`$`$`8`2 "  `  # *` * U?" H /*%$H %s(%s:%d:%d): probe㿘 <怢` ``< p   #V "scsibus at %s channel %d㿘`" <V  <Vy Ё  `   : %d targets, %d luns per target scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links㿘`<<<#`bx.!&4&8&<&`,&<6`8(*`*:`:!X`V-6`:2V`8  * "   &`0<T!V`: V`8  * #< ! `0." `0@  Tma@V`8 $D> `?@C?㿘`  "2  "@ #"@ 㿘?<1`    `.  " @  ` @㿘  <1 6J . @ 2 ,B  `$V 8  `&9 V 8@45 V :  &, V :& Ԑ @4 , @"`4`@o "``@퀦@ ,ٰ %s offlinescsibusprint: impossible qualifiervendor-unique targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixed`<U9!X   `# @ `" `  << < << !`<!h<S}!x<!`a`p  !   A p    <  !#\#``#d<!<!#h #lT 1.07SENA SUN CDL1100 PCMCIA LITRONICV2.1UMAX S-12 V2.0UMAX S-6E V1.2Astra 1220S V2.9Astra 1200S UMAX 1R08IS60 RICOH 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK Python 28454-XXX2.2GVIPER 1500 21247VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 GY-10C EXB-8200 EXABYTE CP150 CALIPER FC-1TEACJ.03ZIP 100IOMEGAjaz 1GBiomega6027MK538FB ST34501FC ST19171ST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S ELS85S QUANTUM 0307D3847 SnapLink MST EV1000MEGADRV LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR MC-DISK- MPL DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID C372CP15CP16DK515CHITACHIA00MD21/S2 ESDIEMULEX RZ55 (C) DEC1.2AAEC-4412BDADAPTEC 3.08OMD-5010 EPSON 2217-15MQ10915011588-15MBSUN0669MICROP 1.55R2626 JVC 1.04CD-ROM DM-3x1SShinaKen1755XM-4101TASUNSLCDTOSHIBA 1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:841CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVISRENO CD-ROMX2A MEDAVIS 1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS C4324/C4325 HP VDRD-25X DENON RRD42 (C) DEC DEC CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON not configured p`0.`.@  @  `,@ @<Z($ , ", #$ , ,$ 05<즒!ò8 @p ,추  ` `* $*  8<א#= * $* 8```2 8` `/'''<Z'/`L'ؐܔ ^ 領` `````  4 `  ` 4 `   4 Ԁ 8  4 8 ` 8  2  4 8  `,     #8  $  #8 @0  `  `0&`0 ` 8   <#A8  <`0@" B0 `<QI"ؒ 㿘?<12     * @ 2 40   v ,  4  $ 4㿘? 2 <1`*   , 4 $ 4㿘?<1 2 `* ,a@ !@aa @" !@2 ?2    `  @h㿐 `  <\a4  豘㿘a  r <@ ` &`㿀'7 @/ B   (/#\#d//#` 4  B 㿀'7` ///* b #\#d#` 4  B P  Ř   /Ք P    ////ʖ P    Ű .@.`.`.`P    @ ``/`///ɐ//˒   㿘&a0&`<\!d& `& .<\!``0`&`&`8CĐ@W<O"cdlck㿘 !<`& !#5/ "   &  㿘 `& & 6y㿘?2   <1  :   *@`2`D0*``" } 2s`D   4h .0bY! ] ꞔ! U30P $  s! 2>`D ` `$ @H . @``' ,@ ` `D" `< `@`@ *@$`@ *@$`<`@`< @ r$`D0  ?$ `D  .!  $ b`D 멐㿘?2   <1: * *# 0 "+"  <  @ @ **@$ @ **@$ < @ < $ D   !  " l  㿘 8? @2 ` : <1 , `  2 `  5& ( 2& ( 0(@   H   $& (%,%  ` @ @J $ 0H /*%Ai`@H p@0 $(& $ 0& 4%s: not queuedp   3` $550 `  "``2 ( $ ( 0$ $$ ($ 4q + H@4  8? 2` @   0: * "@ /*  @  0?@c @ @ `  '7 $  4`4`/////   ?7 $ * (4`4`4`3`/////// BJ <0 0#\#` $( #d4  " BV < hN    2s㿘  8` `4 0`0BA"@ 㿘 8? @2 ` <1`: *  `"    ( 0*"@ 4& 0 `㿘<<## 㿘<<##  㿘? .#@a.@@ca@ K.@\ K. *  ( ` (("  ?j?2   <1 :* *  ] !@"P`'#@"J`!@"D` D#@@#  p@"7` #@2#@ .`0*#  # @"$`  #@"`8 ! !  q@   p@   m@ ` 0!@2`  q o #@"&O#@ ##@"!0 # @"!0!@>`0H#@"!0 #@(#@)`08#@"  #@" #@#@݀`0"#@ #@ p@ꀢ`0  p@"/ #@"!0E e@"U # @~`0E r@o`0 # @"j!0 #@h`0 # @l  m@D`0 E g@ E f@7 #@"_!0  q@`0 #@d  h@`00#@"0#@`00#@[`0@c!  *`& ` &  k  $   @x   ?$ u0@ !0  @;}  v#\@Vl!0  d@_ ,@} Pˑ*   8u   @ <  d  `* 2` 2: ...#.#V@e  2+ ``"  $( ? c " `"?   `* 2` 2 :?  d  `* 2` 2:@?860ϰ ɰ   p @ @  `$txz *   `* 2` 2 :  dpp  `* 2` 2 :p   8 & @ *!0v !0p   !0    !0       \  @ZT !      2   D* A  < @ ;   @ " 03   -    @ ̔    0" ?"@.` 2  踖fictitious㿘 @@!   d&`(&`,&`0 @ d &`4`,@ &`8 @ 2` 6``! @ <c`@  !,`(6`H&`X6`J 2` &`<@u&``( `<&` 2` .`@l&` W &`.`6`&`&@=u6`㿘   @"p (1"(9$   b h? %/#\#d7#`4     # * *` *  aa"$ ($ * *` *    c"$ x  ?76`6`6`6 E/////// Òa@#\#`#d 4    h@& 4$ А@ " 4Ҳ@ &.`.   #\  @  x\  ?7 G/////// '#\#`#d 4    x  ?7 K// '#\#`#d 4    㿈 'Д"#\#d#` 4     x  ? B/耦`7 / 7` @( //#\#d///#` 4  x  ? C/耦`7 / c3 (/#\#d///#` 4  㿘   ٚ 2``#  +    ʚ  㿘ʒ   ? 02009000SPECTRA㿐<\a   %s: waiting %d seconds for changer to settle... %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s s㿈<\&`,a <*" "H"@b``<"Hܒ```*"@ *`" *  7* @˒  `<Hʐ"+`4`H<󀢠"<"P<#(`P <<"P#(`D #\<"P<#(#``L #d<"P<#(#hH`4&`0㿘?<12    ( * @ 2 ,0 `  ͐   ,"4 ,  @p   , ,` ?"`㿘? 2 <1a*   , , ,` ?"`㿘?<12  * c # #  f  #"?D#"54#IP,c"74J, # #":=, # #" 2,@4 0@ ,@ (0" $"?@$4   00" "D"H"L" P"@ @Ēx@ 4N `+ H  D`?@4A * ` ?@4:  T @ :  42     ? `/`@   0*`*2`2`3`2`2//////' / ,ab#\#`#d 4    x@`4l `4h ` +`b  D`?@4[ *` ?@4T + `?@4M  X @ : "G  @ :  4@ `  ? '` ` /`*` @ 0**``222`3 222`///////`/ /` / ,ab#\#`#d 4    x@ * 1  D `  (  6  `?@  0*`2`` +22`/////퀋`7 / ,ab#\#`#d 4    %s: warning, READ ELEMENT STATUS avail != count 㿘D.`  T $  4@ @J$ <` ` ` *  @ /  ~ @@0 "` ` `*  <#F e ` , `@1`  x  ?'6`63 3  //////// ,ab(#\#d#` 4  㿀 HI D# L  P  *@ *`@ *`@ *`"@  ,*`@ ' /#\7#`#d 4    %s: could not sense element address page %s: could not sense capabilities page h'7#p,`   h  //???//#\#`#d 4    <F"'ߣ,`@, ( +(+   +`*@ , 7$<$L$@$P$4$D$8$H    ////???#\#d#` 4    <"E0$T$X TX @ + * $ , ` "`㿐<\a& `  e` & `ߘ㿐 `  <\aܔ  L㿘  .a0a1   <` &`@a4㿀 @ ʔ , 'p7   //#\/#d#` 4  , P"&`  ߲  'cp7  ? ///#\#d#` 4  ,   ʑ* *`ː  &` &`  @ &@&`@A(&`&` %s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry h.&`!0`Ȑ  , ו**є ґ* ؓ*` Ӑ ِ &`&@@&` = 2 "&`  2@`&`@ @M&` O " ґ* *` ӕ*ِ &` ؔ &`  &@@e&`@c`  &`` ) "&&`  ` @2 ` <<#0Dc <#XD^ <D[#x  6  @ "&`&@&`&`&`  %s: WARNING: cache synchronization failed x  #!a  ba? 5/#\#d7#`4      <!D 0  @&  %s: %ldMB, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %ld sectorsdrive offlineunformatted media%s: WARNING: unable to establish shutdown hook 㿐&aD&`<\"4`& `& .<\"0`0`&`&`87@'7<Cΐ` ϔ!   aD <"C <  " 0<0!<"@@#\C0"#CC<## &aH<# Csdlck㿘 !<`& ! ( "   &  㿘 `& & *㿘?2   <1! :  !*@ 2 D0* `"ߏ  2v D`  7k 10e! ` ,! X60S`$` ! 2A D`  $`!D  . @ `' ,@ `  D"  <  @ @ *@$ @ *@$ < @ < @ o$ D0` ?$` D  ݹ!` $`_ D 4㿘?2   <1:!* *# - "7"  <  @ @ **@$ @ **@$ < @ < $ D  !D € 4  !@m   "*   㿘 8? @2 ` : <1!, `  2 `  5& ( 2& ( 0(@    H   $& (%,%  ` @ @ɐ $ 0H /*%4`@H p@0 $(& $ 0\& 4%s: not queued, error %d p   ` $(0 `  "``2 ( $ ( 0$ $$ ($ 41| ) H@ ?4  8? 2` @   0: * "@ /:*  @  0?@ '# @ @ `  '7 $@  4`4`/////   ?7 $@ * (4`4`4`3`/////// 5Ɛ $ 2 <  &  <` 0#\#` $ ( #d4  " 5ʒ <"hA   2h㿘  ` @ ?"` 8 `0 4 05"@ 㿘 8? @2 ` <1a: *  `"    ( 0*"@ 4& 0 `㿘<<!!X e㿘<<!!X Y 㿘?  2 <1!:* *  1  !@"$` !@"`8 p !  q@   p@   m@ ` 0!@2`       p@"E e@")  p@`0E r@  m@Y`0  h@"   q@[`0# E`g@ E f@ 0@ ! *`& ` & } # x $   @ 2 `g@2 #?  2` @  : *  * @  <  @a  $ 0K 2G    ?$ >  @ O 6 3  2   D* )  < @ # 7 @ " 0 `   F @  `   ' fictitious㿘 @! &`( &`0 &`, @ &`4&`8 @ 2` 6``!1@ <b@`@   &`< `(6`H6`J2` &`X@ &` W &`6`&`.`&@26`%s: %s 㿘   @t" 82  d$ 8 ?*  * < a@ <#(?ϒ 㿘  !D € x  ?'6`6`6`  //////7/ c#\#d#` 4   %s: ..is spinning up...waiting %s: removable disk stopped- not restarting %s: respinning up disk %s: respin of disk failed-%d 㿘  <`?  ` < ? ( ;?  7 3  < ?Z -#@%?$  ` ` < ?G  <  ?@  @  < ?5 ? 㿘?2    <1! : 66?!*@ *"  D*@ 2    " ? `,`  `?( @ 2` 2  1 ?㿈'<܀ 2u ? 2   $ܒ <1a:` +   " a+ @`"_ ` `2`X  (@ q O @ .` @.  @   @ << #h6@   ?6`6` *76`6/////// @ t  & ` #  & & & & & $@ j & ,& 0& (& 4& 8@  $ܰ T4000s HP 03590IBMSD-39490STK263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 4200 TDC 3800 TDC 3600 TANDBERG 㿐<]cĔ  ɘ %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled㿘<]&`H# $ , $ &`,@D<=#`T<``#<#<# = R  <@V <<=#```=#`\`<<=#`,=|#`,<`#<#< =p `&`&a&`㿐<\bH  LM` & T& d& 0@& <㿘 T   h p l @&&` /  d &@.@@ ` .@.@`@ %s: already open 㿘? 2 <1  a  :L a + @`2`H0D:  ` <"`=`9 G 44`D4`F  ׭ !  $ T`F 2`@ `@  2`,@ `,( @n$`@@ݒ ;  $ 㿐?  2 <1a : * ` ,  a` `  `  @F   " H   % H  H0 `     , $@d? @{  H @ H"  H H` ?"`%s: cannot set selected mode 㿘? 2`  @<1:` * :` , `( H` ,` @$ ,*` h  d  $ 0@ O  0@ D@̒ ?@ :  *  p, 8 `, 8 , $ ,   @F  0*  l@$ 4$ ,@  < !@ , $ , $!@; 㿐 ,( H @ @ @є @ ʔ!@` @ @ , 7& ,  $ L" 8P2 8,"4E%<(PP|||||||||PPPP,\",""4""4`",0 \2,\,",\"4,"4", 8 4 ,&,,,", %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d 㿘 8? @ `2  <1 : * @ 0`"H& 4 H 6`, <& (  `4@ڒ <!@`;2 ,& (`L@ & `P`P  @ `P<!p; ` & (H /*%& `` & `"@"`H p@0 $ 0(& $& 45%s: not queued 㿀 H `  `` $`!0  ` "`&  " ,h"`` `` $` $$ ( 0$ $$ 4t `%`"$ , $@  @ " , $h$ $$ (\ ` $$ ( 0 7$ $$ 4 , & ,O ` , "' 0$ 4 , ? $$ (($ $ ,cߒ & ,Ð7 `7 $@'  /& ,% /( ,  `/ 0@i 42  02 2 /// <  0#\#d#``4  " `<#:V  ` 2d` 8 $`,`,"`,㿘? 2` @<1 :`*` <`H!`P 㿘? 2` @<1 :`*` <`H!` 9 㿐? 2` @<1 :`* :` 4 ` 8 ! !M!  H !! H ! !"AV H@ * &&&&&& &$&(&,&06&&& &4 4& 8& l& x& &  &$ p&( |&, &0 &4 , ( 6 ,(" D 6 D6 F64 F4 D`< ̓*` €  0 , p l  h H  4`@ Ѱ  @  &@  @`   @   @? ] 0 @   @  @ۖ  є  ,*@Z$ , , U$ ,@ `2 L , ?`@  P  @ u  P@$ ,o  , $ , ,$ 4 2$ ,`d -, 8@F]` , V$ , ,*@Q$ , @K  @4A  Hϖ7@ڒ <!@8ϒ , 8$ 4 , &$ , , ?"$ ,   V,`0,` 4@*` l"    * 8* * p `* 㿀2 ,1  '/`7 4 `/@: 22///66/// Hc #\#d#` 4  x H % a0h' /#\#d7#`4      *`*  *  $ P$ L0 H <a0'7  h/#\#d/#` 4   &***`* @  @  & X& \. ` ,  , ?& , < @   $ 0 < 0 ` H7 ' 7// @r  ,3 8 /// /"  < 42 2 /// < @!0#\#d#`4  xp`H @< '  7 ///'(  @. 0#\#`#d`4    逢  /ꀢ j //     ? 2  `2  * *@ ` ** *   `ϐ *** ***** * * * @ @ 2`,0 @,,  , ,  '7  /`//, , , ,  0#\#d#``4     ? ~/㿀' /`7 6/b # / H#\#d#` 4    㿀") , >`0N ,"0@H`?!< @B`    " ,Q ,b?( }#+ @`  ` ߀`` ߒ& ,` & ,b` }& ,` ,@*@'& ,`  & ," ` & ,`6 H'76`6` ///#\//#d#` 4     㿀`+ `2  , ,!"! ?& , ,?!?!˒ @& , H'76`6` ///#\/#d#` 4    㿘 , %$"  %  & &` 2  @ x`  ٖ 2! 0  `2 @  H6'7 /#\/#d#` 4    x  ? , Ha' & , /`7/!06"#\#d#`4     ` W   /  ?А 4/Ѐ`7??' / Ha0( #\#d#` 4Д       * *` *  &x    !  ? +/耦`7 /6 H2`2`2`////#\#`#d 4    %s: block wrong size, %d blocks residual %s: %d-byte tape record too big for %d-byte user buffer 㿘 < <   ?2` ` 8?  `  ? ? *  *` *    ,  4 F4 D 2 ,?`"X  4@$& 0 `@ ,@` $ ,@$ , 0$4    , $ , 0$4    , $ , 0$4 "  0  2 0< 5  0 "  , 2 , 4>$ 4 , ;  0@7  ,  V .2$4P @ @@$ ,  " & 02 `      ,< ! 4Ŕ" & 02$4  " ` 0 "  , 2 , 4> $ 4& `"$ , ,& 0$4 `` 㿘$ Tw  6 O '$$`4$ 'bd2`,`,    ?$`,w ˖  S  T0 2`4 T  C5110A C1130A C2500A C1750A HP 㿐<]c  MUSTEK㿘`,<] &`,&`0c " *"< b@@͔  <@< b@”  2`,@S`,`x ?&`,&`|&`&`x%s: already open 㿘?2 <1 !0` :) !0*@`2`00!   <"3ޒ` $ `!!Ό " =  $   $ 㿘? 2`  @<10:`* ` ܀ "  , `" ,@  ,$ L ?$ , 0P  0 0` ?"`㿘 8? 2` @<10:`*`  0` ܀  €㿘? 2  <1: 0*  ,`<  ܀ "  , `" ,@  , $ ,< < !  }㿘 8? @ `2  <1: 0*  H`  $ ( 0& $$& ( 0 L& 0"& 4H /*%&  `` & ` "@"`H p@0& 4P㿘  0` $ 0 x```"& |`" ܀ "  " €  2 㿘? 2 <1 a0: *  c #( 7  # 0  ܀ 4 - `0@ + 4@ (0& ܀ # -€ ܀  - `@ " ,0 ? $ ," 0 Џ %s: MFS-06000CXMustek 6000CX Flatbed 3-pass color scanner, 3 - 600 dpi MFS-12000CXMustek 12000CX Flatbed 3-pass color scanner, 6 - 1200 dpi 㿘<  . Z2h < ``@ 2` < . Z2[ `< `@  2<^ < . Z2N!<^ x d$ c & & 86 >. K. H& 46 <& @& D. I@*. J 㿘, "` @c `  @Ր`$&` @ϒ @$@&`@ɒ `$&@@Ò $@ ^&` #؀@X`V!@8l `!,  @* 2 $` !,6`  @* 2 $`* 2 "U06` *`2 F ` @|?$? ``H!.`` @r?$? ``.`` @t $? ``P .``   i   g6 Z  Z@.`&$4` $8`$<` $@`$D`$H`$L`$P` $T`$@$X㿘 T@~ X`02 @>$&`0P 0@x @ 'ج  7?Ȕ ////@ƒ  D @  4 @  8 @ @)2 44`4 #///#\#d/////#`4ؔ Ș   2 <  '7  ? ////,7 @ /@֒ d / I @&? J /@   K / @n/? p#//#\#d/#`4    2@ < '7Ĕ /!,/Đ / H " h" i g # # #\ @ H PĐ X/Đ##\#`#d4     2  <@u   㿀 L  0c'7 /#\/#`#d4       %s: not queued 㿀 T ' 0 X/@7`02 @ c44(//#\#d/#``<`4   <  00 0 P"& P`0 L"@ & L mtkrdymustek: lines actual(%d) != computed(%ld) mustek: win-size actual(%d) != computed(%ld) x 0 '7 //'%< #< ㈒(#\#d#` 4    23耢    <0a p |a㈀* *` * P@  <  !@  L@ < !@0 0耠`  㿘 H "  i   6 X4 4 g 6 X 4@ <@G$ X`& T  ?  ?& T 8@ >@8$ T X @& P@̓2`& L %s: C1750AHP ScanJet IIcC2500AHP ScanJet IIcxC1130AHP ScanJet 4pC5110AHP ScanJet 5p set_window failed  compute_sizes failed 㿘< #x. Z/ < `c@`  <  < . Z/#< `c@S  <  < . Z/#< `c@F  2` < . Z/#`< c@9  2<^ < . Z/~#<^  d$  & & 8. J. K. H& 46 <6 >& @& D. I@2 <  #@ < #<  /[ %s: set_window failed %s: compute_sizes failed 㿘@(`  @ #؀@8J ``@ !@8@ `?* 2 !,89 ` c !83 `   " Z)  Z@.`&$ 4`$ 8`$ <` $ @`$ D`$ H`$ L`$ P` $ T`$@$ X <  !@ <  !.W *f0S%s: trigger_scanner failed 㿀@ < !@ < !< #(#('@7@6 <  #0.%`%s: not queued 㿀' 0a`073 3  (///#\#d/#``< 4   < #. 0`0 L" & L 㿀 , 2 0a' 766 ///#\#d/#` 4  㿀 , 2 0a'766 ///#\#d/#` 4  *f%ldP*f%ldQ*f%ldX*f%ldY*a%dR*a%dS*a0T*a0I*a3T*a4T*a1I*a5T*u2T*a%dG*a%dL*a%dK 4x<a.x2 8<a.q2 @<a.j2 D<a.c2< <.]a< >.Wa H`&``" < X4`"J<} X 6 X ` , `,  `,  `,  `, @;, <a X a6 X< ` , `,  `,  `,  `, @$, <a A a< 6 X ` , `,  `,  `,  `, @ , <a ) aؐ 6 X ` , `,  `,  `,  `, @, <a  a, ,  ,  ,  , @, <a  a, ,  ,  ,  , @,  X<-ǒa I<a- J<b-x$ ؖ %s: interrogate write failed %s: interrogate read failed %s: bad data returned *s1025E*s1024E*s1026Eh`4`8` `H   ?$`4$`8 0 < < /?@s <^FȐ  <<^@㫒 d @ ?А  K*  @ *`В@  `H $`T*$`T<!! ?@9/S <^ Ȑ g <^,9`0)@m d 2 <^,.` ?А  J,  @*`В@ `T$`P`X@ @2`$`L  %s: unknown device 㿘<^&`,` <*"  H,"< P,`%s: already open 㿘?<1@2     @* @`2`,0  < ,r`  ȸ    $ 㿘? 2 <1a@*   , , ,` ?"`㿘? @ `2 <1@ * `,4㿐    #\#`  @Hܚ  dmaattach_obio: cannot map registers 㿐`4&`,&`0`  `` "`#\`     <,"H0 &`@㿐    #\#`  @H  dma espattach: no dma found%s @ obio: cannot map registers espintr㿐[&f <`&f&f&f@6ѐ#H &f" D<+#P<*#Xf`  `` "`#\`     <#p+`0 !<^<@c !<^?2 f`@2f @0 !<^f!<Вb@@y&`fǒ  &f.`.`.`   `€ _ "`/&fȐ .``  `.`  ` .`  `€  &f`.` @`.``   &ff#@0fȀ`&f``@f@f&f &f@&fԒ@$&f&ff< 0``"  @<c`,<}< န(<^&`&`hra, <6" @0% &*` &*`( &4 㿘& `@㿘& h@㿘& d@&4@"@& "H&`4 &Haudio㿘<0 `<@ `? 㿘 <@  `?%s: cannot map registers 㿈&`,  "#\    < h*`0&`0@1㿈&`,` @ "#\    < h*[`0&`0@  softpri %d intr㿘<!*F <<<bȐ" ,& p& t& x <* <"`"  `"    @  ,<``#```"`   @<a <^!  *`*2*`" " " " " " 㿘xn`8 @ `0 !* *  #`8@ #`#`#`#` `8 @ `0 !* *  #`8@ #`#`#`#` 㿘  H /* %  @(  `" H 0  @ H o*@e    ` H 0  @ 0H 0 @``2+ `2'  <(M0M<M<MHMTMl ` *j ` *k ` *l`    `  ` *m @``2% `2!  <(N NNN$N0N8 j*` k *` l *` "` m"`  micvolumespeakerheadphonesmonitorsourceoutputinputsoutputsrecord  <؇(OODOxOPHPQ,QTQ|Q # ? # $# # <X # # <<``># ( # ? # # $# <h # *h # ? # # $# <p # p<# b`3  # <+ b`# (3 , + . # ? # # $# < # # <# <``# (3 ,m+ . # ? # # # $<<# 3 # (+ bX# @X# , # ? # # # $< # <3 <+ # (hh# ,# @# 0"p"p# D # H 3 L # X4+ N # ?# # # $< ?# # # # $< # ?# # # $<# 3 +  ?# # # # $<# #   /<^%/<@%@/<*$%$   ,%+<0``+?P `-`0+-?P% ,%+<0``+?P `-`0+-?P%/<^@̀㿘` @U`?㿐 <c#\ #`   @D  㿘@ E"`4 @" `4  ?  `@ &` %s: cannot map control registers model%s: cannot map pixels 㿈`8 &`@&` $` &` #$ ,$ @? `    " #\      <F#)<.&` $ 0 &`܀  <Y# @ <`@E<<aD!&`&`(`$&`T*`,`T &`, @= `܄`  @   " #\     < '7`0&`T`, ؐ @ܖ`?bwtwo/p4%s: cannot map pfour register bwtwo㿈<S `8`a0 &`&` ` &` $ ,$ $@ɖ# ,`2  `  <Y# @ @8<"X`  "#\     <d"h$ 0&` 0@2  E" E@2  @ E &`ܐ (&` $&`#&`  @  "#\     <-#<&`$ 0 &`<<!Xa&`䀤`#&` @t  ` `   " #\     < &p`0&`T@ : %s, %d x %d (console)  cgfourcgeightunknown%s: %s overlay plane 㿘 8<^`"(`  $`$$`$`($`@+<$`` !`&;  "<<&1!p`,@@  @@`,&"!`,@@   <!<!<!<!&  @`,@  @?<1 P0 ` 6  P*     㿘?<1aP2  * b@ "@ 0  "@ 0<&@&D&H& L&P &@ & €  㿘 € 㿘3bwtwommap㿐?<1aP2  <0* $@ <# P@ Ѐ``" @  ?? 2  㿘 d@@@6  @5 8` @(㿘 d@@@$ 80 `Њ@ Ъ@0Њ@ ?Ъ@㿐`   &`@#\#`` =@ : %s, %d x %dcgtwo: vme_map statuscgtwo: vme_map cmapcgtwo: vme_map pixels (console)  㿐<^`,&`&`Ȑ"T $`$`$$`(` <S  `$`,$` $@#!<0  A!!@@$`@ <$`` "h`$ߒ  $&`@   =  <#1"x @`&`̒@ # = "<#"`&` `  <Y# @ `@  = <#"<$`$"@<$"А@?<1 `0 ` 6  `*     㿘?<1a`2  * b@ , "@G"@ 0P "@9  "@< 0D "@( 0>0&4&8&<& @&D1&0?&&0&4& 8&<&@&D& &0&(&$0&L&H @&@n `  &  `  *  㿘2 (㼘@` $ A ,    @+  ` Аb@  @+  ` Аd@  @+  ``k ` c  `[  㼘@``@!B `@ 2;` @8 23`@0 " ),`   2@ ` А" @ 2@ ` А$ @ 2@ ` cgtwommap㿐?<1a`2  <0* $@ <!!P`D@?`Ĕ }``Ȓ@@ <!!P㿘` @`?㿐    #\#`  @?՚ ` @`?%s: cannot map control registers model%s: cannot map pixels 㿈<^`8&`@ &` `&`$ $$ (`   $ ,$ $ $#@ `    " #\      <="x)<.  ؀&`<Y# @ <b@AY(`$$ `*`,  &`, @ `    @   " #\     <""`0$ `,G ؐ @`?cgthree㿈 `8q0a<^&`&` "&`$ $$ (`  `  $ ,$ $  $@0# `  "#\     <("x<Y#< @ ؀ #&` @'    `    " #\     <""#`0&`T@ : %s, %d x %d setting video ctrl (console)  㿘 8`` @<$`` ! ` !<^"  <  p 2!b` * `` ` .`! !$` ؔ $ ܓ* " @  $ s$  $ $ " <<!"@!"Ȁ@?<1 p0 ` 6  p*     㿘?<1ap2  * b@ , "@P"@ 0T "@: "@D 0H "@( 0B <& @& D& H&  L& P5& <?&& <& @&  D& H& L& P& & <&(&$ <&L&H @! @! @-  @$&@  㿘/#㿘@ ` @( 2  @ :`:(* ؆ * ܒ # #  cgthreemmap㿐?<1ap2  <0* $@ <E# `+#@? @#@?@ P@ Ԙ@Ѐ` `" @  ??㿐 <`#\ #`   @=N  㿘@U @`?%s: cannot map control registers : cgfour/p4, %d x %d 㿈`,&`&` &``  `` "`#\`     2I<<^" $ $$ 0$ ($ ` @ `@ $ ,$  $@#!< $  $  J <0  <S "<Y  2<Y# @ ?  @  "#\     <  `0`&`" `2 *`"""?"<  @?<1 0 ` 6  *     㿘?<1a2  * b@ , "@P"@ 0T "@: "@D 0H "@( 0B 0& 4& 8& <&  @& D5& 0?&& 0& 4&  8& <& @& D& & 0&(&$ 0&L&H @ ! @ 6! @u  @f&@f  㿘-tcgfourmap㿐?<1a2  <0* $@ <Ő! `5#@?@`8`4@<@:&@#@ #@ `D@@`` ```" @  ??㿘@  㿘@ ,㿘 ,@@ :`:(* ̒  *`* # # (# (# (# : %s, %d x %d, rev %d (console) 㿘 8 <^`#` !$`$$`$`0@Ɛ<$`` #֒ <#(:  6 @$ "2 *@` h$"h" <<#8<^c "<@<#H@ ?<1 0 ` 6  *    㿘?  <12` @!*` @@ 㿐?<1 a2 *  b@ "@"4 < "@b"@ 0"@0 "@"W   "@="  "@ "@8  "@0 "@M  & @& D& H&  L& P& <?&& <& @&  D& H& L& P& & <&(&$ <&L&H@ !ư@ ! 2@ V & "V @= 2   6  ;" 6 6 6 6 6 6  6  $ 6"V *!|| 2(u 2   !@ ;  y0x &t& V  ! '"'@ ]  2f   8_ "* 2 ` : W $˖ (ː  H   6  6 6 6  6 @]&!@&"`(  6 "6 V" *@!(@Y$@U!|@T  6  66 @16   66 㿘+G?? "" " R耢 4 @ @"@"@`"`R쀠R?R#RR (??#(R ?28 !|  *`` #@`#@*`@ :`:(* ؒ  *`* # # (# (# (#  @"@!"` *"` *"` "@*"` "*"` "` R ꀠ 2  cgsixmmap㿐?<1a2  <0* $@ <   <^# ` *?  @ *  &@ P@  Ԙ@ ̔ ``" @  0 ݒ` ?㿘` @`?%s: cannot map brooktree registers %s: cannot map FHC registers %s: cannot map THC registers %s: cannot map TEC registers model%s: cannot map pixels 㿈`8&`  &` &`$$`$`(` # `$`,@ $` `    " #\      < !@ &` `    " #\     < v!h &` `    " #\  *  < X!&` `    " #\     < 9!`,&`d< a@:>)<. ؀ <Y# @ )<^#`& `@` `    @   " #\     < !y`0 &`T ؐ `?㿐 <! a  #\#`   @8  㿘@  ``?%s: cannot map brooktree registers %s: cannot map FHC registers %s: cannot map THC registers %s: cannot map TEC registers cgsix/p4cgsix%s: cannot map pixels 㿈<S `8`<^c0 &`&`  &`$ $ (`   $ ,$ $@ ɖ# `  "#\     <!! &` `  "#\     <!}! &` `  "#\  *  <!a"&` `  "#\     <!E"(`@ G&`䀢 ` <! ,@ <!$ ,H"X ,@@  <Y   <Y# @ '<^#`$ @O    `    " #\     <!"`K`0&`T[ 㿐 <"b@#\ #`   @6ޚ  㿘@  E`?%s: cannot map pfour register : cgeight/p4, %d x %d%s: cannot map control registers 㿈`,&`&` &``  `` "`#\`     <"J"`<^#Ĕ $ $ 0$ $$ (` @`   $ ,$  $@#!&`@&`D <" ϐ"<0  <S "<Y  2<Y# @ ?  @  "#\     <""`0 &`"`Г*#  " s" " "<""`,@?<1 0 ` 6  *     㿘?<1a2  * b@ , "@P"@ 0T "@: "@D 0H "@( 0B 0& 4& 8& <&  @& D5& 0?&& 0& 4&  8& <& @& D& & 0&(&$ 0&L&H @! @! @  @&@  㿘&cgeightmap㿐? <1a2  <0* $@ <#K#`Y#@?@`8`4@Ò* @@ :&@ 2@#@+@#@ $@`D@@#@  @ <0   @ 2*   @ @!@@&@ "   `` ```" @  ??㿘@  㿘@[ ,㿘 ,@Z@ :`:(* ̆ * В # #  SUNW,tcx㿘 <$@ߺax`?tcx-24-bittcx-8-bit: %s, %d x %d%s: only %d register sets tcxattach: cannot map thc registers tcxattach: cannot map bt registers , id %d, rev %d, sense %d (console)  㿈<^&``8#$ $$ (` <$a $ ,@7y  <$a@7r $ $#@ @ !<$$ <$ $  aax $  <$!`0z`@Ҕ a(a@  &a(&a@` a<`` "`#\`  *  <$Đ!0V&apa0`a4 "#\    <$" 0:%<. ؀@&al<Y# @ ap<$"H2`22  @Ԑ$ ax 2 *@`aph$"h<$"h<$"xw`,*؀@ `8@r?<1 0 ` 6  *    㿘?  <12` @!*` @ 㿘?<1a2  * b@ , "@R"@ 0m "@< "@E 0a "@* 0[ <& @& D& H&  L& PN& <?&& < & @&  D& H& L& P& & <&(&$ <&P&H4&L!x@c!/!x@! )@7# T!t& "T!t@K  !p 4!t ;"!p@ "!p@ "  㿘$!l"@`"`@ :`:(*!l  *`* x# # (# (# (# Rtp2t(("(p@h("hp("(tcxmmap㿐?<12  a* <0`$@<&͐!<_  .?  @ *$ &@ P@  @*` * ̔@ ``" @  0 ْ` ?㿘   <0 `"`0 @݊`?%s: only %d register sets %s: cannot map control registers : cgthree emulated at %dx%dx8bpp (console)  㿈<_`,&` $`$$`(`  `  $`,$`$``<$#@`!<0@`  ?@ڐ @ !$`$`*<&"h`Ք 0i *@޾`?#@@"  "#\  <&"`0@ <     &j&j&k&k&k&k &k&k`<&` "@, k`ܔ *"#<.`؀ <Y# @ <&"<&"r`؀`,@p㿘<1? !2`  @! *`@  ` H <_ `"H 0  @  㿘?2  <1a* H` <_? "" H 0 `@  㿐?<1 a2 *  b@ "@"4 0 "@b"@  0 "@0 "@"X  "@=   "@ "@8  "@u0 "@@  & 4& 8& <&  @& D& && 0?& 4&  8& <& @& D& & 0&(&$ 0&L&H@k!@! 2@ @W&@8 6$6$6$6$6$6 $6 $$ 6"V$*%l 2($쀢 2   %@-  ~0} &y& V  % '%'@O  2k   8d "* 2 ` : \ $8 (2  M   6$ 6$6$6$ 6$@a&%@&%`-$ 6$"6$V" *@ۙ %l @۔ (@$@@O $6$ 66$@06$  66 㿘@ cgfourteenmmap㿐?<1 a2 <0* $@ <(4#``.#@? @#@?@  D@ߥ < & : @  ` `" @  ??㿘!* ! **`@#@ * ``*` A(*) % *A** **a++*" @ *@ *` *  A  @   **2  㿘@ @( + )  #   ,`  @   ` * @ `* @ *   ` 㿘@ @( -      ,`  @``  +  +   @ +@.@` ` *`+`ܒ "@ `R$܀*` *a$$* 2a$$* 0R$怠?28*%l $*`` "@`#@*`*%"a%* 㿘@ @( + y  s  m ,`  @`@ `*@  * @ *@   ` 㿘@ @( + C  =  7 ,`  @`  .@ ` +?  @ +   㿘<#  $@ (%s: /dev/fb already full %s: forcefully replacing %s %s: replacing %s %s: attached to /dev/fb 㿘#<c쀢  !<# <* (E"$c , !<# "   ( (<*"` <$c$#+"c耦`# " < ( (<*"Ȓ`Δ<א "c<c耢  # <* (""c# " $# ( (<*"Ȓ`$##<*("`㿘<#$ 㿘<c$㿘<c$ @㿘<c$㿘<#`$?widthheightlinebytes㿘<+ah@0& <+ap@0 <+& ax @2 &@/:& fb_setsize_eeprom: not sun4 㿐<0 <S`<+-!0e ,@@& :&  0`"U @'2  E"N 2  E"H 2  E2  `"= 2  `6<+"*` €$0$"#$$%$"!"  "$   $   %  #&@%& & %& &  @ܶ & : & J  * ( 8(Ё㿘   ^ screen-#columnsscreen-#rows㿘  4$` %<0$`  <{ & 4$`  $``$`\<S `2 `P P "$`$` `Q$` `!<<, d@/ `X P$` d<,@/`h "$``` @D`$ <,$`$$` <,`4$`@w3<b<;""< H< L#``#dd "d `?"0 d0E Ed0# 02   0`#dd2 #!0!0!0!㿐    #\#`  @,  %s @ obio: cannot map registers %s @ obio: DMA memory allocation error %s @ obio: DMA memory map error xa&a&a`  `` "`#\`     <,##  <0@䀢  `@""a<0 #\#``  $   <,#8`0Ia ,aD   <,#``a (04?*@<`  &aH&aL6a@&a(&a,`a|%&a0<W#l<W<W<,<,#Db&a&a&a&a &a&`&`$a<R!|``" @ 㿘 @ d, , @ ( ( @(㿘 0@)t㿘 0@@)l 0 * 0* *0 00 # +f +g 0f0 +d+e 0d 0#㿐    #\#`  @+  %s: cannot map registers %s @ obio: DMA memory allocation error ie pmap_extract: memory probe failed onboardiep<-<-<-<-<-<-<-<-!aؔ4"bTp@&a$&`,&a&a&a&a &a(&a,&a0&`<`  `` "`#\`     <-#(ܒ&`@ #\#`$ `<@   <-#H`0s`< @(&`8`8<<۠!Ԓ &`0 2<<- ِ#p<  :`   <0 &aD$?#@ aF&a<&a@; a@`?a<a@`9 <0 `<&aH"@ h&aL <-A#0+$<$<-c$_ <!``"  @ <-c@Ձ `@"&㿐< p`     #\#`  @* 㿐<0 `< p`#\#`    = #\#` (  =`? %s: vme_bus_map pri %d 㿐 ( =&d   "<<.# !`<1!0c<2&`&`&`<2<0 c<<&d$&d8&`&d(" <0 d<. # =* &d,@d8<1<1c#&`&`Đ @ %s: cannot map registers sw㿈&d `  `` "`#\`   (  </  ^`0R<!4<3<3<4<3<3aD bL"p&d(&`&`&d$&d8&`&`&`&`<0#<׀"c & <0``"d```"`   @<. (#</a@Ԅ ? `@ @= @, @7 si: dma handle malloc failed %s: DMA buffer map create error %s: options=%s RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p P` ` 2&d8d$<Y<0<<W<X<1<1<1d8"8aД<ܘ! `,? `l&`p&`t&`H.`P&`@&`8&`&`&`&`&`&`&`&`&`&`&`&`&`D&``&`̐ &`Ѐ` `̐ &`&`ؐ!@ ؄   &d0</ "</" `0C  d0@"d0 d #\     `` d8 :!</</#(  @` n<!(`</#@ e<!,<`0@ #€&`0(2(b<ܒ , si_minphys len = 0x%x. 㿘 0!8 <!(`<0! <& 0ۈsi_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC 㿘$( $$  `` "<0  " <0@  "0` # ܀  & ܠ! #  ( <0 "Hsi_reset_adapter 㿘<!(`$$<0 #(4 !  4  4 4 4 4 4 $.4 4  @sw_reset_adapter 㿘<!(`$$<0 Ð#$   $ $ $   `$  si_dma_alloc: misaligned. si_dma_alloc: xlen=0x%x si: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO 㿘 $8 N 䀍` 耍  <1  (0B4$0<1 H ܒ   `` <1 ΐ h $$`$`@"$  $$  `   <1`` N $$  `   ` @% si_dma_free: free while in progress㿘  ܀ ` <1 ""$` $  `  `    @$  € $$` %s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x 㿘  '$$0#cP )<1 "  $% d$( @@"?<!(`<1" Ғ㿘@$$ `4 $$? 0$$?`2``? 2`` 2`` 2`2`2` 2` 2`2` 2`si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x 㿘  ` $$<2 `֒ )<!(  &$4<2  e ?# 4  `4    4  ?# @4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  <2   2   *@  *@  *   *  @*  * *@  4  !(` & <2  ؁si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! 㿘   `$$<2 Đ"0 & `?# 4``@" `<2 # "4 ܐ`&  ܀ q``  '<$4& '<$4(`"<2#  4  <2#H  ܔO& ܀ $ <2#`"@(& 䀊& <2# t :` 5<2  h#`` `'?`  @0`? 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` `* *㿘@ $$ `$ $$ $$   si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d 㿘  `` $$<2 `Q +<a( &$4<2 @     ?%   a(  <3"˒ <$` % $% @   *` #<3"Ж     *@  *   *@ ` $(<3"   *@  * *@  %  a(` & <2} ؁sw: DMA error, csr=0x%x, reset sw: short transfer 㿘    `$$<2a"0 &   ?$  @  <4 S! "4 ܐ`_&  ܀ W<!( ` $<2#=`4  <47!0 ܒ`C& ܀@ $ <2#`"@& &  5    "<)a&< ?2 + 2+` < @ 2`+`!t #!t <2`+ 2 +`x` "x <2 +|`"|a "a$ $  < * *@( <2#㿘<U!Ԁ<+  $ $` ~#2 * <a,*@ 㿐<U!Ԁ`!<+ $ `$ $     #2 * <*a0@ 㿘<!` <U!Ԁ    <U!Ԁ  c 2`*` <4*  㿘<!` <U!Ԁ "`l  <U`l!Ԁ 2  # 2 * <*a8@  㿘  b@1<!    / 2)&!& <!` <U!Ԁ "`l  <U`l!Ԁ 2  #2 * <*a<@ @㿘<!` <U!Ԁ "`l  <U`l!Ԁ 2  # 2 * <*aH@  㿘<U!Ԁ` ``@㿘!<U!Ԁ   € !Ԓ  €㿘<U!Ԁ !<<a?"a!  € ! $!fpu_cleanup 1fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3 `: `:*`<6!p €ؤ<6 h<<6 xa? @  %`` " <6 <6 !<6 0` <6 0  ?C&`<6!* <6! 7'<!#<6, `@2`2` ??̀ ('va @( " `  "`<6 <60  ᱒  ` ᫔ `V!0 ё, &`㿈@<62 ! #HJ22:   ` ? <  @ &  4& <6#̓,  €ܠܬޜޜޜޜޜޜޜޜޜޜޜޜ 8|ݰޜޜޜޜސސޜޜޜޜޜޜޜޜޜޜޜޜޜޜޜޜޜޜޜޜޜؑ, ,  , * - $  $ @@ɐ| @ ,@ @ ,@ 0 & 0@` @ؔ ,@Ӕ@S @˔ ,@Ɣ@eF @@ ,   @@ , @  `  p. $O "K$`G @ @ ,@ ` @ @c ` >  @ <!J p.  @ $ *`@$- `$ * ` $ * $ *`$  㿘  ,@,``2   @@I {` 2    q&   m&  i "L  @L$`$` 6$` $`  @" $`  $`  @ 2    $`   $`   $`  @ #7$`@h `0$`  @  @  @  c@#   `?$`$@$` @  @ `#$`$`$`$`@y㿘   , ,` & : 2"5 2, 2) &" b        ( & 㿘  `,, `,@`2 `@@a   $`,  " 2` " "``   ` @`  ` " $``  ?" $` @ @@`&3 3$`  @ @@`&3 3$`  @ @@`&3 3$`  @ @@`&3 3   $`$` 㿘`  & `&  & & & @h&  㿘?.@6`2 `*  ?  & & & & @Q&  `2  2&  & & &  ?& & & & &  㿘?.@*626`@.g<  & & & & @ &  g 2&  & & &  ?|& & & & &  㿘?#@#66/ + 6`..7  @ ?#  & & & & & @ @ ? 2&  & & &  ? @ & & & & &  fpu_explode㿘.2`&`&` <:0 <:08Hp   ؀2 &@` 2&@  &`& ?&@㿘````(``) ` * 0`1 6`@12 ``0*"`"`! ` `'`  '``2'` @  @ B '`'`'`'` '`'`'`'`  0    `?㿘@ ` "`` 4` r"@@֐ "`` $``  2 0`1 ? #$`㿘@`* @ [F >2`E  Z"@@[  `@2 1@   @& `$@@ Y@ @`@"   & | "1 1 @4@`, 1?@*@㿘@`* @^ >M'@2`&J  ="@@I  `@2 @ 5&  @& ! @. < `@"'  & ! ?1@&1 & 4@`, &`1?@*㿘@`* @ Q@2`&<#@  "@@ @`@2 %@   @& $  `@" #  &  1@&& &?1 &4@& &`?&`, &`& `@  fpu_implode㿘 <<<<& &&t&ڐ 㿘   ,@ ,   2@  %  2   $       (`) , 30`1  @ @4 @D   @ (`) , 30`1  @ @4 @D   @ (`) , 30`1  @ @4 @D    (`) , 30`1  @ @4 @D(  c  (`) , 30`1  @ @4  $ $$ $$$$㿘 `  `@B @ B : "$ @ B  *" @ @ B 2 $   b`   @ B @ b`* @@ @ B 2@ $   @ b`  `@ B  @ b`* @ @ B 2 $   @b@ B `&    @b`* @ @ B 2   $$ 㿘``r`` ` "` "`"`"`"`2 `_ `   `?  `$` ` 0)+(3/@7@@1"`"`"`"`"` 㿘`      8"  @ 0`  6` (@+32*@@(` .   132+*@)"@"""""?   LL     %s: WARNING: matchbyname 㿘`<>N!   9 Ff  (  9F<("@/obio/interruptbootstrap: could not get interrupt node from promaddressbootstrap: could not get interrupt propertiesbootstrap: cannot handle %d interrupt regs bootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt registerh@!<<0 <"aL $   8'<0 0@0; 4_<>bH@  <c€ 2<>"X ''̐ <>b @Ȁ <>"@  (<>"@ ?P%<>#?Pȓ,  0Ђ` ` @P  @?P<"ȓ,  0Ђ` ` <>Ր#@@Po?p6 ?p"` <b<=@!?P   ?P(kernel has no debugger unknown option `%c' 㿘+<cP @ϔ!)<#`#`G`` A@0=< 9'<*L /4 L" ** L @ /`*L @2? ̒L`,  Ē : \ L?$` $@\`  $\ ̤ ,@cP#` ` 1L - #<(%<? L b  d ! a <?*` s<?*`c $cc $cǐ c $c!:`ڠ twas brillig.. vmex%ccx%cobio%c%csiswespbootpath_fake: unknown system type %dfdsbuslecd㿀!<0 2N`<@ 0z' (''`:J`,2   3J`,2  , N@ x1@#<*<@ ?c\&& `& & $c\ <@N``(@ëc\?& & & $c\N`<@ `0@Úc\& $c\& /&  i l%*`N` e!*`<@ 8!<*& 8 ?. #\&  $#\& & N`<@N@ `@d@o#\& $#\& :  sN` d t r< p "<@   <T<@7 O<<@ ?&& & & <@`H #<*c\6`H ` $c\. c\& `3& <@ 8?& 8 <@. & & & `P #<*c\6`P ` $c\. c\& `& <@ 8?& 8 #<*. & & & <@ X c\&`$c\& & `& $c\ <@p  `<#`1 :  : N`<@N@`@ݐ@c\& & $c\~&  f@N` d*`<@ <* 6 . \ "\& & f& *`:  l#*`N` e*`<@ ?& & . & & <@  <*\ 6 `"\. \&  "\& @& :  s<N` d t r4<@ #<*& ?. c\& & & <@ X $c\&& & & $c\N`r <@`h<@N@`@a@kc\& & $c\& bootpath: /%s%x/%s@%x,%x:%c 㿘<A"N`!<A )<A'<A%<A ?2"@@``a N ` <Aِ"<؀  <؀  WARNING: %s map is bogus, using default x<0 `/ <#`+ <d@J "<A@  <A#  "?@` &` &@L *?Ѐ &@ $L 0 "?sd-targets㿘!<!Ѐ  <<B<ؐ ` $!<ؐ .  st-targets㿘!<!Ԁ  <<B<ؐ!@`0 $!<ؐ 0.  configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU) mainbusmainbus not configuredp#<0` < p`=<0`   <B!<"#( @S<Ba@ <B@oaЀ <B!i<."`<X<C!<   ` <B繐 <B"O 2<0<BJ" @k&DH <0"`device_register boot device mismatch bootdv=%s NOT FOUND altbootdev=%s RETURN to continue 㿘<*#\`<*`#0@ ` `` `#<cx+<B#<B c <B# cx<B`#`<B# <B#ʐ 0<A  <A}" <5ڬЁPROM sync command㿘<Cΐ!(%d㿘@[#<آ`P<CP@T#@#耢  #@ .,%s at %s %saddr 0x%lxio ipl %d㿘`" <C 1! "  <C`!<C!<C"!  `<C"  XP@0(virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error8(SUNW,sx: SUN-4/%d series : %s namecpu missingobio missingfbno options in OPENPROMcould not find %s in OPENPROM 0;<0` !<C<<Ch #@#+<Cc@@ 9<#P ͒` = <  "<B<<C?آb"?Р'???''Ԑ迖 2<@<Cݐ#<@ 8''''讖 <@<C̐#<@ ''''蝖 0(<C<C#h"@``2%<`x€ C<B!<<b")<B'<C!@ٖ @   ?????''?ؐДh `|€ 0`-<  )<<B"!??<C''''ܔ???G @C5<`<Cc@ <." x@<C@Fb<݀ "`d<CP#L M+<C-<)<7<C@2 2<D ؒ:  ?В"?????c@e ''ܐ@  2!'''@A쀢 2@V 2#P' 2L `e+<B` 2 )<Ca@, <B@aЀ O)<C#@!  @ߒ    28  <<"?''Ԓ#????@ ''ܐ@ 2'''@ؒ쀢 @  #P<C'| `|€ `findzs: unknown zs device %dfindzs: can't map zs%d registersfindzs: no obio nodezsslavefindzs: zs%d not mapped by PROMfindzs: cannot find zs%d`!<0 2)? <  <E "(<E"(<@8R< p`<0<*`   ~̀ "K<E"H? A<E@%<`x@ <@@`8 2`x<E)"p@"#<Eb@l?`|€Д ''<>b @ Ā <E" @b <E<E"pre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 /memorymakememarr: cannot find "memory" nodemakememarr: limited to %d availableregmakememarr: cannot get propertymakememarr: no memory foundmakememarr: WARNING: lost some memory 0!<#`A<F"*` €h ?"$@ <F$@  $`% r <*"" <F w _ a<F $@$``R <F @;# x€<C@Jc<F@D! `<FO!<F!8 Ȳ Ȁ<F0<F!X<F!h;  ''  @/ "<F+!p   <F   $@$`` <F!!hierarchicalp<Fah'А @а  <Ba@. <G@`P &`&@&`  В  &@ &` &`intr㿐<Ga' @И   &@    &@㿐<>b' @   &@   &@' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !0!<# #` @4<G<Gab(V&@&#`T€` @  config_attach: device name too longx<*#0<CaP2@6@3 <GE" @/@P```@5؀ 2`lebufferledmaispespdmadmaxboxiommu㿘 $< a  ,`@ `@<0 ` " 㿘ߐ "`  " ```@ `     @  device_register: already got a boot device: %s㿘<#x`""#x<H!@`  xdcxycsdSCSI disk bootpath component not accepted: target %u; lun %u xdxy㿘 f  ` #<G@c耢 <Gc@ <@`8@~ I<@` @x C<H`@r =<@`@l 7<Gc@f 1<Gc@` +<Gc@Z %<Gc@T c@O <@`X@I <Gc@C <Ha@= <Ha@7  <@3 g  0c`@' U<Ha@! <@`@ 7<H@ $`<0<H!Ȓ 0B  L s   `0@   2 `"L s2`"  `" "`#0"@ <H"@ڒ  @@ 0Д <0 <x< l @<x <ې @  آ@@@ @ ċ@ī@< " |<x<0$(<< l"` ă ڣF2 أ ģ@ "|"ฝ㿘!< @  @ Ȗ*<0 $* <<"#l" Ѓ"!  ڣڣF!2#  أFأ# У@ ( $ `$ | ̀  p"Л@p `bл@@!$ Д$!cache_enable: can't handle 4M with hw-flush cache㿘<`x `<0 $?*@ <<<"#l"! "` Ģ @Z :<䀢 !$ ࠀ `"|<I #h<. Ԁ`  㿘%<@@Ȗ*<0 $* <<"#l" ԃԣ  6 < آ <    6 < آ < "`|<x<0$(<< l"` ƃ  6 < ؠ < 䀠 ƣ " |DVMA coherent 㿘%<@*@&Ȗ*<0 $* <<"#l" փ  6 < آ <    6  آ  ֣&҃@<J"< "`|<L <`  <0`x<0: `  ֢0 ``x8 ` ֢<cL`<0"`* * 8<x8  ֢@@ <L<0"* *`* 8*`<`"`<0`x<0: `  آ0 `x8 ` آ<L< L` آ0 <0 :?  آ?㿘#<`䀢 ><0 $<L '<0 %<0`x  2 @K"@`  . #  Ģ0`" .@ ` Ģ0c  2 `6 6 z `?07<<#L  x:@  "  ڢ` <cL`<0"`* * 8<x8  ֢B@@ <L<0"* *`* 8*`<x8  آB @ 㿘9<7<3<0#L` > '#L ަ㿘㿘<0 @ <? @  ?2 ? C @  ĢB?@ 0<<0 $<<0L  @ %<@ x2@"@ ,@$.? " ĢB?@ 0c @  2  ?4`4` `?0c @  2  _4`0H Ġ Ġ Ơ㿘9z<<x8   <! o< "! o @@ Ģ<@ @0  ? @0 `$  <@ @0  ? @0 ` `?<< @ 06?<H(? @ `2 (* @  @ @?㿘@2  ?6` " ` @&@&`<* & 㿀`Z   2`  2`< ?b0  @`d 2  ' 4`H*  '* ?4  2 *: '2   '쀢 4`H*  '* ?   @['4 ,2 , *  `=' * 8"2   ' 4`H*   '* ? ۔  ``2    " 4`H*  "* ?پ  q`  ٴc`٥  Y" 7 *  67?7ٖ I4 `2 , | "2   * ,"@ܔ,022   * *  " `H  o  `2    4* * ` " `H  S  㿈D  2 2  2z V2   ' 4`H*  '* ?% _ 2 *: '2   '쀢 4`H*  '* ?   7 2  ?`; *< `€( % d씒  2   * *  " `H ϔ  `     ?#`` "@   ="@ 2     * `,+?%  $(,048< @?܀        "2   * ` k``# 2 * #2   8"  stray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%s EC EFSPSETcrazy interruptsX!<O <O !  H @O<*<"  <a   "a<O룐!XВ <""㿘<#` !<* #X#X 6L#X -#XH <(b"bH 0  ,#X-  @B @  6 #X#XJ` *` CPU%d: held NMI: system interrupts: %s fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAAsync registers: afsr=%s; afva=0x%x%x b SEb UCb TOb BEfAFAbAFOnmiP< ` < `< < <O쩐#0<x <* \`d@ ?p )<'<$% x!<O<O#@ ` @슐  <3! " < "@ <*"| "@ < "<@<aP€ <*!<O<O# ؖ٘ @ F2<*$" \`% x<Pꡐ intr_establish: level %d interrupt tied to fast vector㿘H <a : <<P"~. "D@@2"@&`H 0 intr_fasttrap: already handling level %d interrupts㿘<0 (. ac6` Ho o)<! :  <P<"D.  <P">#<!<۠!a  %<@ @ q8% (R$$a @ !  *%! H p@setrunqueue㿘! `2 <Q 8<"x+`&< & * @""#remrunqueue㿘!<2`8 2 <Q <bx"  ( #&   *(#real mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cachedvmamap24unable to allocate DVMA mapavail mem = %ld using %d buffers containing %d bytes of memory 㿈9<<"!?H    <0` ?H?L (< "<b'<0<Q!8*  @;<`-<R@ 8*@ * <QW!H@"<QO!h7<3<* * 8` ? <Q=!`<b'⌐@Ȓ<0$@@ :@ @ < b@@] 15<0``,@  @ )<Q     q 8!8  0 " `ࢤ@⌤ `8#\  <0`<"b<Q!#\??  B < "a<Qΐ"8#\ j <<0c<a<< "  "ਐ   "  `c, "?`<Q" C*@ <b!<Q @&"89G @:㿘<0!P<0<<0!\< "#*`+`@  <"#* *@ "@ <*" *`+`@  <*"#T*@ <* " @1<<0a ?@a<)`" p` @ `<*"#<*+`+ @ <* @ ""**`@ @ <""!h*`)@ <0 $<0`<0 4 @@@)<ܡ2  @ϒ <b &"4&"<0 `<"  $<⌀  <" "⌐ "<  ⌓2  :  ?!"!"<ڱ* &. "b@setreg: own FPU on module %d; fix this㿘!0!( ?&!0!,` `%<$2!4$$"?<S h?&!4  *&!, @ P;$$ `D ? $ H$ $ `  -X<!  $(c  H.`* `@  cc@''''c   ' ''''@q' ' '' ' 0'@?  @  k c@ `$ H$ $ $ c  $c hӼ@? T @ 0Ӕ "` +` !($ `<*@  #` # `# `# `# 0`# HȀ  $c  c ?"c `  8 ?WARNING: powerdown failed! halted rebooting 㿘<0 `" ֍<( "#<  <a < ("a g&"H/` /!@(( <S艐#Ȁ "<S<S胐#@#`#<N@  @ #<@a(@[  ,a(  @a( s*@  da(*@   La( a( -,a(*@,a(@ِa(㿘<"## 2 * "<*bd@ `@ @9.<0`<ܔܒ *@ * $ $<<"b"<   dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable %d device bad device not ready area improper i/o error succeeded error %d 㿘<ma4@<?<"`'<<⤀`?c 2 <T "xƓ2`0 # 2  <T"2`繖 << 2*"@ P*` €<T稐"Ȁ?<<T碐"0 @2`*`" * @8@8<ah< GЀ`E``@ <0 <`  @ :0#1<9<7<T"@ 8`@i4`!@"E <!ƀ!!@#@`2 @4 @ ڨ ``"@`2<U!-` €VVVVVVVTVVVVVVVVdVVVVVVVVt<T%"0<T!#0<T#0 <T#(0 <T#80<T#HFrame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p 㿈A<U"<U"؀ %<U<0 4@ 4 @  0 <  $ ( ,#\ 4#` 8#d 8#h 8 <0 curproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace 㿈<! `<V<U`0怐#<| <X<Vd #\\%<0l`oh"?<V Pi  @ <V pa  <V!<V 0  <  $ ( ,#\ 4#` 8#d 8J#h 8   ? " 0<V< g0 panicw: case 4 w: unknown case %ld w: arg not allowed 㿘N@  t<V"H``"<V<V<Vv"" "00 0warning: ldcontrolb called in sun4m 㿘<0 `<V" H/` /< `2a$<0 ` $` H p@` * ( 22#  *@ `   `" *`0*@2@  `  *@㿘*` *  , Uu` @ \"&& & & & & &   㿘  U_bus_dmamap_load: not implemented㿘<W̐! _bus_dmamap_load_uio: not implemented㿘<W㽐!X_bus_dmamap_load_raw: not implemented㿘<W㯐!㿐<<  <c@  `.@ "     2&@ &`#\ `#`' '  bus_dmamem_free: nsegs = %d㿘`<Wu"x,`` 㿘< <R . 8@ _bus_dmamem_mmap: not implemented㿘<WT#bus_dmamap_load: boundaries not implementedsun4_dmamap_load: not implemented㿘@&` ` "<<W0#8a`€  <W`  <W &`$&`&` &` #h_bus_dmamap_unload: nsegs = %d㿘``"&`<X  &`㿀` \<Ra8<.!P 6 <0Q  $<0@ @4,2@ '' '  C$#\#`4 #<6<`` И   @;`*#\J J ' ' $  1<!< 0!"   ` ' warning: %ld of DVMA space lost 㿘`  <`<R` * @8E@ 0`<`  * @! <X!<ې!@ h@sun4_dmamem_map: nsegs = %dsun4_dmamem_map: size botch㿘`"`<XX"Ȁ 5<@ +' <R *@ 8{ 2' ``" #<!<9<X2`07"b!   @&` sparc_bus_map: zero size sparc_bus_map: iobase=0x%lx㿘< !<?x" `:  `<X㠐#,  @ ?@"<Y <0`$ \"@<0  . .`#<;<۔ba     㿘<`<ۘ: @ !@@  @ # <02 *`# 㿈 \  "#\ ?@  @@: @ ``@   " 㿘    2&   &0㿘!(@ P 㿘!(!< P*@@@<!(  "@ `  !( !(`  㿘!,<# @Ȕ! 㿘!, @!    mmrw㿘?  2 ԰ #<b( %<Y"("($"(! "( "( $b(  `?&@ &`<Y#? 2 ` <Z ȓ*` €hijkDkDkDkDkDkDkDkDjj` @ b 2`   <<%<'<'<0!<0   a",@   $`  `"@ @ 8   @@ f`` ?G#@!<0 ?H @ <"@ <!@ : @` 2 @"@ @ 8  @@ `  @? @  H +` A ?&`<0 `& "` #<&`/ `  !<0  T  $`@ ` @ 8  `  "A@? 2  !<"( "({ $"(?Operation not implemented on ROM version %d X<#<Zc<0` <*?`\€ 0" `  `€0   㿘%< € & @3 "  2  k    @h`'@i& 㿘<ؐ8@ 㿐'L' L 2'L*@L㿈 '' 쀢 X L?@vN`E<# x@ N/ N /*`:   : * : ``/`@:    * *   *:  / *  : @K "?N 2 x WARNING: opennode not valid on PROM version %d 㿘<##`<[א#@   0@   D@no PROM root device㿘1<"X 2 &"X<c|€ 2&"X<[#Ёnamex <#!<\ 0A @  `|@  㿘<c€: @ PROM exit failed㿘!<# X€  H@PROM boot failed㿘!<# X€  L@㿘<ؠ"`'L'H'P'T'X!ՖH <#O` (@ (@ &O㿘<*b@ |€obp_v0_read: unimplemented read from %d 㿘<# <\!?obp_v0_write: unimplemented write on %d 㿘<# <\"H<*b`?㿐<# 8   2 8O  / . > 㿐<8  O ?  / . > 㿘<*"`   <<<J-2    J?   J <@㿘<#`v2_bootargs too long 㿘N< '` "%*@`<]*:  @  -`` 2 *@ "*@N?  " *@*@ N`  **@`㿘<#`㿘< <<*x"@<`/chosenno CHOSEN node㿘1<# 2 &#<]@! 2&#<]ݢ!bootpath㿐<]b''  1<]"bootargs㿐<]bh'' w 1<]J"㿐<]bh'' b 1<]^"opf_nextprop not implemented yet 㿘<]#  OBP version %d, revision %d.%d (plugin rev %x) stdinstdout㿘<0 `;<*-?L<"#J@#(<\"  <\,"  @c <\" c<]<'\8`" " " \" " " (" " $" ," L" P" H" `" X̀" d<V"\"@A @2<_`<`   t` t  < @⠄` <] `t<] H`d! L`l Pa X d \`p `` x |   `9 ``"`H0"*a0<\J<\ `L<\J# `    `T<\ (`P<\ `X<\ $``" ,`$t 0`( T 4 8 < ha la pa t⠐`<]@<]" `<]@,!<@`" " " " " `|<_<\<\<]`!\" $" ," T" (" `<\" 0`l" 4`<[" 8`!" @" <`?" " D` <] `#``u20^< !<`c c<aaT$ <<_b$$ D<a<a<a<b<a<b<]<]#<]%<_'<_)<_+<_-<]/<_1<_3<\5<\7<`9<`;<a <a<`btc0 tcЄȤx("bDX b8#`!`4$ $ H$ L$ P$ T$ X$ \$ $ $ x$ |$ $ $ $ $ ($ $ $$ 0$ 4$ 8$ @E$ <]c @ <]c @ 㿐< / < peer㿀<_! <* 'b'''? child㿀<_!p<* 'b'''? parent㿀<_!<* 'b'''? instance-to-package㿘<_<ِ"<*8"8 b$ $ $ ?? getproplen㿀<_"x<*  'b''''??getpropx<0 4?<_"<*  'b''''''؀??setpropx<0 4?<_#P<*  'b''''''؀??nextpropx<_#<*  'b'''''؀??finddevice㿀<` (<* 'b'''??instance-to-pathx<0 4?<` <*  'b'''''؀ ?package-to-pathx<0 4?<`!<*  'b'''''؀ ?call-method@'T  'X+ <`!x '?'' ? T`?&<*b€ ?, ? `+ ?   `? "@ 8'P'T''X <`.!x''''' P"<*b€ ? @ ?* @?open㿀@7<0` 6?<`#0<* 'b'''??close㿈<`#<* 'b'''test㿀<`#<* 'b'''??test-method㿀<a 0<*  'b''''readx<a   ?'''耦 %<0#<* b'@؀?? 2  & writeOF_write() > 1024 x<a!8  '?''耦 <a!@!<03<*  'b@؀??&seekx<*⠐ <a  ''''''@؀??OF_bootbootOF_boot failed㿈@e<0` &<a<av"`"h<* 'b'''<ai"penter㿈<a"<*'b''€exitOF_exit failed㿈<a#<*'b''€<aH# SUNW,power-offOF_poweroff failed㿈<a#h<*'b''€<a1#xset-callback㿀<a#<* 'b'''? set-symbol-lookup㿀<b <* 'b''''interpret㿀<b h<* 'b'''milliseconds㿈<b <* 'b''<0   㿘 " #< c x@ " | @  㿘#  T7 &, ?㿈#@2< d &`1< X@< d@ 0Ho ofH p@ " & X0#''@Ȱ   #@T0#@ 0#@0#@r 0ڀ` H <c'H p@   &  T 'H  ,H p@ W쀎p`r\  U |H <c 'H p@ 2b aC`E/ 2VH <cH p@@ ''& 4"> H <c|H p@<ـ`& " H <cxH p@<" X& " T쀢  TVA2PA: Asked to translate unmapped VA %psetpte4m: user context㿘< !@㿘<Ra8<.!P <a :0Ԃ`#Ҁ   * /$ $ڠ`Ԃ` `2  ?Ԃ` `2 ?*`.@Ԃ` `2<c * "h+<0 @ @(_㿘<R8pmap_bootstrap: no memory?!㿘!< А ` %<$h@& Ѐ<d (h`?*  @ <@ <"(`"<0<0 $`ܒ@2@  "㿘 @   @  $@ `@ $@ * @`$ $ @<P<'""@㿘< <b  <` 24 <!4)<!h @< <`  `@  !h 2@2ؖ !h`@ <h<  * @  mmu_reservemon4_4c called on Sun4M machine㿘5<0  <dR"<#?<+?"b"!2 <#?<+?"b"!@L@<۶!3</<ړ4`*` $* `@`Д@`<c &< 0?  <# d? 4 db耤2 @4`  ,  2x @ *`x? @<0 Є@ Ф@?@ @*4`''@<(  Ƃ@ Ģ@ЂƢ@0Ђmmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry type㿘<?<?""!Ѓ*  ```<e0 <e0 <`D<e"ՙ!<eՖ!H@0Ց!xmmu_setup4m_L1: unknown pagetable entry type㿘?. 'H#IJ +LH$@  "e *i` d<e? ?c# )<,`,`   ,  @`@,  ,`{ p 26  0Ԃ`#҃@   *` /%@$ģ@`Ԃ` ` *` @Ԃ` ` *` @Ԃ` `<c *  "h !€   ?, ``?$`@` "H `mmu_setup4m_L2: unknown pagetable entry type㿘?#.  @,   "Y *] X<f?? c '<,  ` @, @ ,` {p`26  0Ԃ`#Ҁ   *  /% $ڠ`Ԃ` ` *   Ԃ` ` *   Ԃ` `<c *  "hԙ ሟ€   ?, @#Ԋ x? mmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry type㿘??#c.  v `"I<f*K `2F<f`, @` .` z<`p`2;  ԃ`#Ҁ   *  % $Ơ`!Ԃ` `" *   Ԃ` `# *   Ԃ` `<c *  "h a€  "p" ? me_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptes㿐<!(!( ` "`" "$ $  "& <!耤 !<g H `2<<gӹ h!@2<gӲ ` "`" "$ $  "&  +  `$* @`2 <gӗ *@@ '<gӎ @@ +`<<0 ``"¡  ©@  <ap € <0 2   *`* #@ * : *` <0<0 ` "¡<0 ©@<0   Ш@`  б` <#xc<?? c-#+ )<'<<0؃@    ܑ* ㌐"  ; <0` <2 #*`   " & @  @  ` < < * : *` ª`<܀`"  *`*   * : *` Ȳ`<"0` ` "` $`  "@ @$ ` $ `"&``$/ * /` @ 2`$ 4 4 me_free: no segments in pmap㿘<ڑ.``"* @ *  $* `<0 `2  ** @*: *` <0 `  Э`  е` < <<0c< <<0c!# <xc Ԃ 2` * " 2* : ` " ` ` "` &   "@`2 <hb!H<ܓ*`<ے@ ! 2``2   < ""D`"  "`<"! "@# #<!( #  "" 㿘;#@ 0 6`+`  $* 6` `?*; `<"耢  3 І@ ".?0,?@ H /* ' <!   <0` Ԯ@`<0Զ@`<0 <cxĦ@? @ H 0 㿘)<0    0 4H /* '<T`  P @#@"T+: X\@0@"X??"\"X`< "\"X<`X`P, "`  @ `   `0&`4@4 #@& B& - 䭀@H 0<!@ $   2 ,`,`: $@*` *  t <0  ?< `b``Ъ`b``в`?հ 0U S!<! ,, D:``{ p 5" 0Ԃ`#҅   *  /$ $`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h !€ "䥀<!@ #`H 0ctx_free㿘#<0<j ` &"< @<`䀢 )`a <,`  "𢀀<@<!@`  #Ԣ`  "Ԣ.< Ԫ@*<  a    "𢀀 @ #Ԣ` <`  "Ԣ< Ԫ@<`T$"`Tpv_changepte: no segmentspv_changepte: pte == NULL㿘H /* '    H 00 ꈀ@  -<4`*`  $* 4` `?<jV"H* `耢@ <0><jH"h 2<` <`  |  \$ 2  <.  \@ *  `@*L  ڨ@@<ah€>  ڨ@<0<0 >ҫ@`  Ұ` 2<` <`     ?* @  <  @&  @ <0 `2<` <`  | "@    $ " ?$ 2z @@H 0pv_syncflags: no segments㿘H /* '   H 0b  @ S??#-<4`*` $* 4` `?<kϜ!@*  耢 "7  ګ@@@<ah€ ګ@<0` <0ԫ@`  Գ`` 2<` <`   ?* @"  6<   @2$  @@H 0pv_unlink㿘 " <`h  "`h<&  l &   & &    !&  &  ?<& %<h`  "`<k#@ 2 2<$@ l% `   <#l     2  &  q㿘 ` ` <ے`h` "` & & 9& 6& <ے`h` "` ` !!& H <<#l 2 ! 2`2 <ِ l """ " " &pv_changepte: invalid PTE for 0x%x 㿘H /* '    H 00"耀 "``4 * @$*` 24 <jp"H !` <.  \ * `*g@"Ơ<ah€ 0 Ƣ@`<  @  <l"P@: @&  *{<`p` 4 0Ԃ`#Ҁ   *  /$ $Ơ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h  a€ `  $` "@` ?$` @`2|`"H 0㿘;H /* '   H 0 "򀀀 z  4*` $* 4  `?<k!@,``b < "Ơ  Ƣ`< `?* @ `2Q `"N<    @<ah€  Ģ@` `?@*  ?{<`p 25 0Ԃ`#Ҁ   *  /$ $Ġ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h` a€  2 % "򠀀H 0㿘 " <`h  "`h<&  l &   & &    !&  &  ?<& %<h`  "`<k#@ 2 2<$@ l% `   <#l     2  `&  Y 㿘 ` ` <ے`h` "` & & :& 7& <ې h `"    &   0 <<#l` "  ` @`2` <ِ l "@"`"` "` "` &㿘H /* '  `0#<0`  "%<@%<@ ` `"֣h ֫@h€ ``2  0֢` 2 `  "0@H 0pv_table_map: sva(0x%lx)HLL<;*"@ <ړ*`"#`@ @v %<D$P%(` <!("!("`<"" <b@"b@" <0 <0`$?(* ! <0` <"bb"`#<<'"c$b<( < b "@  2@ *`@<*@#c<ۨ<a%@"`P0<'?` "c  $T `%@0 & #?  <0  %@<?2 "\"X=  = ? <;<cxa $< b@@)<   ;<ڴ`? D5  ` D 6%<# d'D%$"@&$ $ "'  <ے h`(<ې "`(a$4`4@``? ?%@6@* @ 2` cx@` * ` `.`  `<0 cx*   <0   ȥ D  ?#<0< @2ª@`@ Ȳ@`@ @ D L<<<ۖ!(`h2%""@" $L # $ < 0 - < @ Ԥ <0<܀ =   )8  ?b2­` ȵ` 怣   ©@<0 (<c+  #<0 Ѕ Х 9rp->rg_segmap == NULL! 㿘<ےa !<"` "<#< c a <%<!#|<'<y a <*)<{#!"<* ad <+<<<!!``"|X<<<<<<-</<<"`$l tc܆㸞p%d%"`,"`(c1<*3<5<7<9<;<&#,&b&& ' 'bH @Ô < # @<c"`  "" ?+` * $><<;#0"P <ۓ*`!!@$@ <0` )<0 $?* ]! ? 2*< <<ۖ !" `" Ԃ`#ҁ   $* $¡`Ԃ` `  ?Ԃ` ` ?*`,@Ԃ` `<c * "h-'<0<@$ "b , @@# $H$D$!<$"L < b$  <<0!"H`   $?"L* <ۢ<! "a4" (ԃ`#Ҁ@   *  $ $Ƞ@`!Ԃ` `"  ?Ԃ` `# ?**`@Ԃ` `<c *  "hĒ < <`D:!" ,`{`p 5 ? 0Ԃ`#Ҁ@   *  /$ $Ƞ@`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "hȉ a€ ?# +@< <b$!, $@ 0ԃ`#Ҁ@   *  /' $Ƞ@`!Ԃ` ` " #*   Ԃ` `# *   Ԃ` `<c * "hH<ۂa`(,2` `#{<`p 8 0Ԃ`#ҁ   *  /' $¡`Ԃ` `  c*   Ԃ` ` *   Ԃ` `<c *  "h a€ $<" L 2 <qɔ < , #@$?# ,c-<c < , "H*` ,` 0ԃ`#Ҁ@   *  /$ $Ƞ@`!Ԃ` `2" *   Ԃ` `2# *    Ԃ` `2h * Dz2 ,` `{<`p 25` 0Ԃ`#ҁ   *  /$ $¡`Ԃ` ` *   Ԃ` ` *    Ԃ` `h *  x a€ ``?% <ۢa <0 <$ <'"c"<`$c +` `2*` * 2 a :  ` << <a(<"<" 2 *  * #ca &@<<" P 0<'?` "@  # T`&@ 0`@ &&@<?!<"`\}"`X<ۦ!<b 4  <  h4 * $@*` 4  ! <`*! 2`<0<0 * ( ( <# `` <  |< @z<`p 5 <0 ԃ`#Ҁ@   *  $ $Ƞ@`!Ԃ` `2"  ?Ԃ` `# ?*`*@Ԃ` `<c *  "hƥ a€ <0  <<!`3Ԃ`#Ҁ@   * $ $Ƞ@`Ԃ` `2  ?Ԃ` `2 ?*`.@Ԃ` `2<c * "hi'@<㿘 "Ԣ!D $ $Ԣ`<ٔ!Ԃ H"c|2  ?!Т $Ԣ` $Ƣ`<|!Ƣ $Ƣ`pmap_alloc_cpu: no memory㿈! '' 0< <㌐ + #\@ #` /<R<t#8zG <t# 0 & H3<%<0+<ܨa 0b     @8 y <t#d@% d eԄ`#҆   *  $ $`!Ԃ` `"  ?Ԃ` `# ?*`,@Ԃ` `<c * "hŵ<02` `& L  a $ pk@k@փ`#ԇ   *  o$ $`!ւ` `2"  ?ւ` `2# ?*`,@@ւ` `2<c * "hy2  }< p`5a Ԃ`#҆   *  $ $`Ԃ` `2  ?Ԃ` ` ?*`-@Ԃ` `<c * "hB!€a($ԅ`#҇   *  $ $`!Ԃ` `2"  ?Ԃ` `2# ?*`,@Ԃ` `2<c * "h 2  * `{<`p 25` 0Ԃ`#҆   *  /$ $`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "hҒ a€ `! Ԃ`#҇   *  $ $`Ԃ` `2  ?Ԃ` `2 ?*`,@Ԃ` `2<c * "hĜ2  * `{<`p 25 0Ԃ`#҆   *  /$ $`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "hb a€ @!0Ԃ`#҇   * /$ $`Ԃ` `2  ?Ԃ` `2 ?*`.@Ԃ` `2<c * "h,2 -@ {<`p`25& D 0Ԃ`#҆   *  /$ $`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h a€ & Dpmap_init: CLSIZE!=1pvtablepmapplL1 pagetableL2/L3 pagetable㿈<<0` !<<wА "} <"<(<"@ " <<w l`#\#`#d#h    <:a\ "<:4#d#h<<w#`"`#\ @  ՘ <0 !<c#<d"`<<w!0`#\;`#h$$  <<w;`!a#\#h!!  㿘<@ %<#<a  @@ 㿘   <ِ"  @@ @㿘+@ "۔ & C+@<0 & & $`&  & &  & 4<ِ!0  0& (Ԃ`#Ҁ   *  /$ $ڠ`Ԃ` `  ?Ԃ` ` ?,*`@Ԃ` `<c * "h?#c& , #< (,   {`p`26  0Ԃ`#҃@   *  /% $ģ@`Ԃ` ` *   Ԃ` ` *   Ԃ` `<c *  "hӒ a€   $ (?#c %<#<(,  (c#@ {`p 26  0Ԃ`#Ҁ   *  /% $ڠ`Ԃ` ` *   Ԃ` ` *   Ԃ` `<c *  "hˆ a€   㿘   ? & @<ِ"pmap_release: segment list not emptypmap_release: releasing kernel㿘H /* '!<0    "<xG"Ѐ     <x>"B   <  <x-"1< (?!0& (& ,H 0 G "  " 㿘 S<ې!<*"T<*!d'<0  "@0@@H /* '@( 6` $ ?`6` * ** :`* @ ** *  `"@@ H 0` "@0@@㿐'D/` $* @@'T /  } ' ګ@9<0 &2  <!p T€@<` @ @91<0@ 0 2)'#<)< +<`<ah€`   ܗ*@ c" @< 2@ c*  <  @ " D ئ@ @@ ̀*-<0 `TT/`+`/`: +  < 0 <0< b ֫@@ 2@@خ@`ڶ@` Dh . 㿘'D. $* @@ /   ` "Ġ;<0`&2  <`䀢   ap€@` @ @x`1<0>` ?*  `i <2%p#<%<'< <ah€` 4 ܓ*@ ㌒"@ @`<2@ *  <  @ " Dp Ƣ` ?*`@  {<`p 4 0Ԃ`#Ҁ  $ *  /# Ơ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h a€  @@ >` `-<0 `../  : /  . ! Ƣ`<`P@ :-X!pmap_rmu: no segmentspmap_rmu: no pages㿈'P.`$* ' 'L`('T T<zI"+` '  <z;"<`耣@M'<0 `2>` >`  | L@ +<#`9<0#<  2?<  <*@ " ㌀ <03c* ?& L@@ ߶쀎 +`& " ` ? +` @ " @ L-<0#@2 ` ī@@  <!p P€T%<` @   ī@@)<0`  ī@`  ij@`` -<0>`  >`  ?*  L@E9<0@ : ()<0'%<+< /<<ah€  `ܑ*@ " ㌀@<2@ c*  <  @ " 3? Ĥ@ 2<` <`  | " L@@ @쀎 @(!<0 PTP+`(T+`: ( @   <<bڮ@`Ķ@`v "~#@ ( h "#@  P`0@"'`0`4P@"'`4㿐'P. $*  `W'L 2/ <z"/ 'I2<z" " ڠ<䀢 <0L #@2@ ` pP€L  L@:}>` ?*  `2n<0<2&#<%<'< <ah€` 4 ܓ*@ ㌒"@ @<0 <2@ c*  <  @ " n p Ģ` ?*  |#<`p 6<0 0Ԃ`#҃@   *  /$ $ģ@`Ԃ` `  ?Ԃ` ` ?*`,@Ԃ` `<c * "hza€<0 L@@ >` 􀍠(<0 `/ /  P +` !Ģ`/   !< p 26!<ٖ0Ԃ`#҃@   * /$ $ģ@`Ԃ` `2  ?Ԃ` `2 ?*`/@Ԃ` `2<c * "h#!€!<ْ3!  ? M.  P+`" Ģ`P (+` ~< p 250Ԃ`#Ҁ   * /$ $ڠ`Ԃ` `2  ?Ԃ` ` ?*`.@Ԃ` `<c * "hҒ!€ "!&pmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%x㿐 !!< <c& ``<0 <`&2 *   0 <0& <2@ #*` H /* '` 'H 0 0 Ĉ@ ' ?9<`4-`$* @ 4  `?<}V!p@, @  2?<}L!?,"耢@2@  <0 `@< Q |N< @d "&@ ? . @[ "%@   `ڨ@<!h@0 ڨ@<0  ҫ@` Ұ` <0<0< ` <  ?* `<}`!>`  @ ڤZ<0 `2< <  | O"<ې!@2@< 0 <0< b Ԩ@ 2@@ڬ`Ĵ`   -. " <0 `""ڬ`Ĵ` "$ . ْ "&<0 ` `0@"$`0`4"$`4<ِ l`.& && ڨ@H 0 pmap_protect: last segment㿘 d0 @H /* '@ -<0//6`+ @  $*`6`  ?`+ + `:`* @ <~G"x8 "m+`  <db耢2  >`  |>` @S<0 " @ @H@ #  ƨ@@@@<ۢ h+<0'%@` @ $`` <!h`$` €Ҧ@` @@퀦@0# ƨ@ <0֨`  ְ` `>`  >` ?@ * <0 Ђ@ Т@@ @@ @ v6`H 0 @pmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! 㿘<0 <ے  @  55`  6`6` `?H /* '+  $  *  ` 2<!`<<! 0uh+` " <`"耢@  <0 ` >`  |>` @ O*D"@@ "  @@଀@;h )<ah€#% Ƭ@<0 2 Ҩ` Ҵ` <0>`   `>`   `?*@ @ @h.@% ଀@H 00 h `" H pmap_page_protect !PG_V㿈!< <c& `I`<0 <`&2 *  T 0{ <0 & <2@ *` H /* '   'H 0 0_"ƀ ?';<c#c'` 4 - $*  ` 4   `?<}!p , `2<}!-  " Ơ<ah€ 0 Ƣ@`<   `< X:  `''  {<`p 2 0Ԃ`#Ҁ  1 $Ġ`Ԃ` `5Ԃ` `:Ԃ` `@ bhc <ې!2B-, ! Ģ` {<`p 2 0Ԃ`#Ҁ  $ *  /# Ġ`Ԃ` ` *   Ԃ` ` *    Ԃ` `bh *  # a€  !<ّ-, ! Ģ``, {<`p 25 0Ԃ`#Ҁ   *  /$ $Ġ`Ԃ` ` *   Ԃ` ` *    Ԃ` `bh *  ݒ a€ !% ` ? K-`  -" Ģ` (- {<`p 25@ 0Ԃ`#Ҁ   *  /$ $Ġ`Ԃ` ` *   Ԃ` ` *    Ԃ` `bh *   a€ @ "`!%@<ِ l`&& &"ƠH 0㿘 U0"H /* '@ <ۦ h6`<0`+   $* 6` `?`+ + `:`* @`@<~7"x8 +` 2j <0 "Ơ`$@2 @^$< c)<0>`  @ M   $ `<ah€p Ƣ@`{<`p 7 0Ԃ`#Ҁ   *  /& $Ơ`Ԃ` ` *   Ԃ` ` ?*`+@Ԃ` `<c *  "hɒ a€  @@ >` @ p6`H 0"㿘<0 <ے  @     <ۘ`h  # H o*@ g6`*`   $* 6` a>`  ?*  @2  U#  ?"  Ơ<  p<ah€p Ƣ`"⠀ ?*  @{<`p 3 0Ԃ`#Ҁ   *  /$ $Ġ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h- a€ H 0㿘 A< Ԁ`>`  8*    < <&  <0`<3* @ < ?6 *@   @<ې!  @  @ @㿘6`, $* 6` `?, H /* '+<`b耢@> @ 6; `#@   H 00g) < ?<, <*@ #"@  <0`<2* H   Ĩ@<ah€ ` ,` @ 葔@b` *<"@㒖 <04` < - `0`? Ш@Ү@`?Ҷ@`? <0<` ?#x@  Ƣ@? @ @H 0pmap_enter: segment filled during sleep pmap_enter: pte filled during sleep 㿘}6`+   $* 6` `?H /* ')<0   0 4" 2  :  & & 4    & 0 2" "}  <#p  "ڒ"<, "$ ?4`?`, @-<@2`<#x "*V @ <j# "@ ,`$@  , 耢   2>` >`  | &    Ĩ@@<` @  Ĩ@  Ԩ` ԰` <0`>`  `>` ?* 6B `#@  H 0Ė < m& <?j& <, < <?, <*@ #"@  <0`<2c*   <ah€  ,` < & < @ O@`耢!    Ĩ@0 Ĩ@ <0Ԩ`  ԰` 2>` >` ` ` ?* @ 2>` >`  | $H 0㿘 8 @?x * @` <@ < <&  <0`<3* @ <`耎6* @`"􀀀<ې!@`"@"pmap_enk4m: missing kernel region table for va 0x%lx㿘6`* @ $*` 6` ! @H /* '  <!h>` @ ?*` 26  ?@<H 0Ԗ0s% < <2`<*@ #"@  <0`<2* !   "Ġ<ah€  ,  7` l/@p Ģ@` ?*  {<`p 2 0Ԃ`#Ҁ  $ *  /# Ġ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h a€ H 0㿐_'T6`-` $* 6` `?H /* '' 2" "w  "ؒ"$, $ 2<٠a+ `?#c$ )< | p 26 0Ԃ`#Ҁ@   *  /% $Ơ@`Ԃ` ` *   Ԃ` ` *   Ԃ` `<c * "h!€?Š  pԂ`#Ҁ   *  o$ $ `Ԃ` `2  ?Ԃ` `2 ?,@*`@Ԃ` `2<c * "hb (2 -`@  {<`p`25 0Ԃ`#Ҁ@   *  /$ $Ơ@`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h( a€ / @`2<٢ae ` <#' ,$ `?#,  )< ~ p 26`Ԃ`#Ҁ   * % $ `Ԃ` ` *  Ԃ` ` *  Ԃ` `<c * "hʒ!€``?Ŵ 0Ԃ`#Ҁ@   *  /$ $Ơ@`Ԃ` `2  ?Ԃ` `2 ?,*`@Ԃ` `2<c * "h2 / @  {<`p`T 0Ԃ`#Ҁ   *  /$ $ `Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "hZ a€ \T >`  " p ¢`>` @ `2D  ?@<H 0 < & <?& </T< <2`<*@ #"@ <0 <2 c*  <  ` " ” <ah€ T , < & <T` >` 7` /@  "Ơ@p Ƣ` ?*  {<`p 3 0Ԃ`#Ҁ@   *  /$ $Ơ@`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h a€ H 0<ۆh 㿘 r6`*`  $* 6`i `?*`  <" @ E ∀@ ` @<0 ` "Ơ0 ƨ@؆@* <0<0 ` "Ơ  ƨ@ <0` 2  ب` ذ`` <0 >`  ` >` `?*@ ؂ @  <0 `2>` >`  |  6  <0<0`?$+ +@    $ 2((  2:  2  <<0` ( ?* <0 $Т@`㿘 < <&  <0 <6 *`  $ 㿘 2 < <& <0`<6*  `   " 0 㿘 < <&  <0 <6 *` ސ $ 㿘 2 < <& <0`<6*  `   " 0 㿘 {< <&  <0 <6 *` ㄐ $ 㿘 {2 < <& <0`<6*  `  g " 0 㿘 {< <&  <0 <6 *` M $ 㿘 {2 < <& <0`<6*  `  0 " 0 㿘 << <&  <0`<2* `@<`?6* << "֤<0 ސ ڤ㿘!< %<& < 䀢` '<<0`<2* 9@'< # ܕ6 &@ c (  < 䀢` <0`<3* @`c6@< "< "Ф@<0 <h@ ڤڤ@㿘 {<< <&  < 䀢` <0`<2* @< <6 a*` ``<!<"#{`p 5<0 0Ԃ`#Ҁ   *  /$ $Ơ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "hJ a€ <0 00 Ƣ`# {<`p 2 0Ԃ`#Ҁ  $ *  /# Ơ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h  a€ 㿘#<`%<& < 䀢` !<<0`<2* R@!<  `ܓ6 &@ *``< 䀢` <0`<2* ;@  <6@ a*` ``<"#<" c{`p 5c 0Ԃ`#Ҁ   *  /$ $Ơ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h a€ c {<`p 5<0 0Ԃ`#Ҁ   *  /$ $Ġ`Ԃ` `2  ?Ԃ` `2 ?*`+@Ԃ` `2<c *  "h\ a€ <0` 91<!h€p Ģ@`c { p 5 0Ԃ`#Ҁ  $ *  /# Ġ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h !€  Ģ`c` {<`p 3 0Ԃ`#Ҁ   *  /$ $Ġ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "hے a€ kvm_uncache: table entry not ptekvm_uncache !pg_v㿘<0 `2"ꀀ Ơ ~<ۮ!)<'<0-<0`  "<<!8 <ah€  4 `*@ < <"  <0 2*  ?"Ѐ 6 <c"*` $* 6  a Ĥ` >  {<`p 4 0Ԃ`#Ҁ  $ *  /# Ġ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "hC a€  "ꠀ02 1)<'<0-#+<%<  ,`  *@ < <"  <02c* ݘ  <ah€ ذkvm_iocache: 4m iocache not implementedkvm_iocache !pg_v㿘<0 `2< p  <0< І  Ц <ۖ2$$ @  ((@ "8<Ԁ@:88<" "@㿘<0 <<ې!디 㿘 @H /* '#<a   2a۩0 <0` "֣0 ֫@H 0㿘<!h<0*``( <b<x@z * !> 㽀9<0   "@"  ƨ@@"#ʠ'׬/<h* ? + $ ` '< $#`#` #`#`#`<"` ` * h#`#` '` < ж`'<- @  ?? $  ✒ƀ" j``4h - < ##'<$  ✒ƀ" N``4 <7< @. ;<ڀ  `cx`cx/<Ƅ' $  ✒ƀ" $``4<0 ?  `@  ¨` °`耤 < ƀ"㿘H /* ' <0 $<. ` 3<0` "ꀀ`@`  "Ġ` Ĩ@` ` ` `  `H 00Ą"Ѐ <c^"7<ۧ4`$,4*  ?*` ƥ`<  ?*  {<`p 24. 0Ԃ`#Ҁ  $ *  /# Ơ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h a€ ."Ѐ <c ",$*  ?*` ĥ` ?*  {<`p 4` 0Ԃ`#Ҁ  $ *  /# Ġ`Ԃ` `2  ?Ԃ` ` ?*`+@Ԃ` `<c *  "h˒ a€ ` <℀` H 00@ऀ.⤀<a` ` "ꠀ0@H 0㿘~< p 30Ԃ`#Ҁ   * /$ $ڠ`Ԃ` `2  ?Ԃ` ` ?*`.@Ԃ` `<c * "hk!€㿘"Ѐ 6 <c]"*`<ې ̑* 6  0 Ƣ@`> @  ~< p 20Ԃ`#Ҁ  $ * /# Ơ`Ԃ` `2  ?Ԃ` ` ?*`.@Ԃ` `<c * "h!€㿘6`* @ $*`6` !>` `@ ~@< p 3pԂ`#Ҁ   * o$ $ڠ`Ԃ` `2  ?Ԃ` ` ?*`.@@Ԃ` `<c * "hՒ!€ svr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallcp exceptioncp disabledlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%s EC EFSPSETown FPU on module %d fix thistrap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF X<``\`@ *"`\  <0 `&&!<< H>`xט @E < .  < '< 2< ($( !$% "0 "x, a o 0;  ̀ 05 $<   0+ %K * 0%  < <   0   0 *  0"??"  <#X`!<< H>`xb @Д L@C L  &&j L  2! *v <c@s!$ $,耢 2   +L$ 4!,$?"a4  @< < *<` "a$$4 &@  L <  <Ð H  @    "z$ < @ΐ  H ݔ @   X `Ԕ @    ?< U$  c "km $< ,$$,_ s!Z W &&  +LD]! @<X!0&&; 0 $0&&G!@&&  LL  ΐ < ,   (@ "*@$(Ԑ4<"쀢`"%(H 0.D "DH o@LWL   ( " <*c <!$@ *&㿘!$` ` 2 x  x @ 2??  @$` 㿘!$" text fault: pc=0x%x ser=%s WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%s UVM: pid %d (%s), uid %d killed: out of swap X< \< ` " \< (  < Ԁ`>    @ @    @7. 2!$H !<<!>` @<Q! "<0 <(!@Y<0 `2V!$;#@ <R8Qڔ G!$$!(  @    5 q Q  @ ! <#@ ` <  4"@ @ ``<0 $<<0@ "@ 2@ @8& `" ` Ծ @ $`!$   ``H !<<!>` @q<Ґ!'`z'` < 0"! ? 2 [   _L L  @ < !,!    (@ "*@ $ (Ԑ<"쀢`"% (H 0.y D  "DH o@L L    (  "w !<*c@ <!$@ *'@text fault: pc=0x%x sfsr=%s sfva=0x%x bEMbCSbSBf PERRb UCb TOb BEfLVLfATfFTbFAVbOWdata fault: pc=0x%x addr=0x%x sfsr=%s X<`\<   "`\< ( +  `` `Ȁ@ŀ`    <\y "\dЂ@`  r@#Ѐ0 `@.  `` `@2d!$`  @  8 2!$H !<<#0 X @c<Đ! "<0 <(!@7<0 `24!$;#@ <R8PN &!$$!( PC  @ ``<0 $<<0@ "@ 2@ @8& `" `A@@%`!$    H !<<# X @<g! &z& < 0"! ? 2   @_L L  Ԑ < !,!    (@ "*@ $ (Ԑ:<"쀢`"% (H 0.  D "DH o@L ]L    (  "  !<*c <!$@ *&syscall nargsp<  l< `" l`$a(,``0` 3`  0`0`4  <8#@   `8  . `* )T2` < `H$ؓ, \ ݕ* `  @`2E`T`e6>`Р, p`  @`2`4`Te#`4''؟Ъ 0`2`Ѐ&`0 &`4  `     @*@`&@ &`&`` `-`@`@ @&@&`&`0&`L`  ې < a,a   `(@ "*@`$`(ԐA<"쀢`"%`(H 0.`D "DH o@L`dL`   `( `" a<*c`  2@`e|@<!$@*&@㿘!( /N  n <!.!    (@ "*@ & (Ԑ<"쀢`"% (H 0. D 8"DH o@N N  6  (  !<*c      (   B e  pagemove 1pagemove 2㿘<0  < @ i"!<ۢ!+<%<)<'<bԐ€ Y☒ H"   @vmapbufvmapbuf: null page frame㿘 $@2 <<3#p'<& @ )<R: $@ @ !8Wo@<& <`䀢 a`€ -<!8+< )<@Ԑ€   #xb   @@vunmapbuf㿘 $@2<<  <R <; "  a8V  @& @& <FPU on module %d; fix this㿘%< !$a$ H$`@mT" !,`"&a,$2!4 !!<! *p5 &a,!,@m;!c? &a4@ &a(@m/ P   & <& 4& 0cP $  "` <(!P $ $ $$ !$P" <(!P  """"㿘!,  #<a$2$a$p *ɐ"!G 8 !X&66&(!(@l P!,<!$  s !, @lՔ!( @ki!("!H''   '#\#`#d#h#l 68  #\ #`#d#l#h 6'!X  &sdcdxdxy㿘 Ӓ X`< (@j   < 0@j  .<<0 `$   N` s   0@   2 0N` s20 0*, "< < 8@jh   < @@ja  ` @ @jV  $ disk label read errorNetBSD disk label corruptedno disk label㿘< 2#&<   `6#&&($ 8$ H$ 4(`$ 0$ $@  <@k"`$ $ 1<$! !W@ 1<!ؐ@k! 6"@ @js"1<!@㿘`8 "; `( !25 @, !W@2- ` 2) Ő "  `* @ .*  @ `2  @   @j ?@k! 㿘 @j$!$@k!@͒ o( <@ky"$ 8$ H$ 4($ 0$ $@2㿘 ; *  @ H 0 @  :`  $@  $ ( $`8 #@ $ 4 *   $ ($ 0 H`8@m $ 4  $?($ $SunOS disk label, bad checksum㿘"  @`@ *  1<Z"!W&`&@"&`  &` &`  &`(&`$!&`,!&`0!&`4!@m!&`8@m!&`<!6`B! &`D!<6`H!!`6`J6`&`&``````!`@m֒$@`$ , ` ,$$ - 5@`   `6`ɐ6` 㿘 ("" I  &@ &` &` $&`  H6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`@m6a a a@lG Ր@l$@`$ ``6"b6a @ 6a@`@ 6a **`@ @    *(@  ?}*?㿈\`d @< `#h*` 66  4"@ 4"@`    @ 4"@  4"@& $#\#`#d@&"`?  @ 4"@  4"@  @O㿀\` ``d `<` @lҐ  * @@l̒ ``: *  @l * @@l ``` ``;`+` ; ":`+ *`" "" #\#d#h#`#l#p 2 ?` " , , @, @    @l * @@l ``:`*`@ @l{*  @lu * @@lo  & : * @Τ@-< < ``0 ?K?k/`!((?@ < +`@ + @   `` (H G/`!((@  +`@ + @   `` ($ $/`!(( @ +`@ + @   `` (  /`@/ @ I `2F   " @?@kՐ  * @@kϒ  & : *  @kƐ * @@k  &``.( `*`;`+` ; ":`+ *`" "" #\#d#h#`#l#p @ 㿘 ``ǐ @k * @@k ```@ : ,"@"@< ,  `@@kv* .<<.`.`( @ @g:`"``"^?" Z?  +   $ * 値`H <<(`.`.@ 8;:,``"``"*?" &?  +   $ `"``? ?"2": "2  ?"2"`"``"?" ?  +@ @" @" * ,ΰ `2˰  @jƒ * @@j  & : * ?``" `..`@  : ,, , " , "   @j* -<<.`.`( @ @:`"``"?" ?  +   * 怤`u <<(.``.@ ;h:,``"``"W?" S?  +  `"``??;?"2": "22"`"``"?" ?  " +@ @" * , 㿐`'L &l \dp@i * ` @'@i*  '/ @ @@ h-@@+h/ -? ?''@  @ @ @ :@?,&@ '@i* @@i*   `Rh:``<<.`(-@  @@; "@ ?0?0@-`@+@ -`@  @ @-  '@@-`@  '@- @@ں@ݰ << (`-. ; @ ? @̰ h-@?`!"@ "@?"@?@ +@ @  @ @'@@  '@``" ??:   2" ?0j?0g ,    @    @ -`@- @@ M @I h`-'@ !"@ "@4?"@0?@ , @   @ '@@  @'@" ??`: ``  ` 2`" ?0?0 +@   @ @   -`@- @@ ɰ  q"hn`<<.(਑- L 1; @ "@ ?0?0@-`@*@ +@  '@-`@ * @-`@* @ @'@- @@ٺ@ @ "@ ?0w?0t@-`@2@ +@  '@-`@ 2 @-`@2 @ @'@- @@ٺ@V `<< (`-. ; @ ? @D h-L@`@`* 2?`+" "&?""?@0 @ +@@'@@0    '@@0  '@(`" ?(?'0: (0 ( 0 (2$" ?0?02, @  2 2  @ -`@- @d@  @ h-'@@2 `2 +" "?"?@(, @ '@@(   @  '@@(  '@0" Z?(V?'`(: 0``( 0 `( 02`$" ?0#?0 * @ +@@ * *  -`@- @e@  㿐@a#\@㿈   \%`@ 8%`,= ` @fl 45    0 .  +@*` *   `, `,  4    $`  ``  ܨ 0@*` *    ```  #\#`#d 6`? #\#`,#d & ?``  Ԩ  㿐 <<<b c/ @Q0H /* & p#  H 00= & pH 0 HP d<@)H *  p  H ? & p!& p<b#`E  HV   p` & p_А H 0㿈 (   P   #\#`#dC   $ PH/` / 0 & 0 & 0H 0 0& ,H 0  € <0a !<!4@^m E:㿘H/` / ,  0& ,?& 0H 0  @ <0a !<!4 & ,H 0  € <0a !<!4 @^6Ercons_init: linebytes assumption botched (0x%x) 㿘<& P" <#  "#  `<"0c:`#  #  \& X @^  4& @^ 4& )<Y #2 2 2 2 \ @dސ$2  :  ?& H @d  "2 :& L@dː & @  ?@$& @ \ @d & D $ 2 (<ْ#<ٔ"#& & $"㤐@ @# & (#<""`ȁ㿘 (&       "? `  `  @֐@] ( F @    3& (& 86& <@Ð1 ( ?@? ^ # $ "@ @4  6@ ^( (  &@@?&@@L (` @㿐 \ $@d"  H @d  ( 2 L     "  P " P  P#\ $  $  & " @ "@   @Ғ 㿘`B<#*` €D`|8 $3" $ .?,&  '?%&  $"@@]"0  "  @@ 00  $` "  $ &㿘`[`; ( 7$5& ( ( ;(.& (   ($! >& (& 8 8*` * ?А& 8(" =& (& < <*` * ?А & < @ɐ@ ( & (㿘`3<!0*` €,Lx0<HXhxԐ@ 80|  8" "  $ 8 " $  $ 8" " $`&d"0b $"  8 "  @ VT"@ < $?"@ $@6 "@?"@ 8 ?"@ `6 :"@7?5"@t01@0.@ 80*@" 80&@ 80" (a2& 8 8 `& ( & (  (!2& 8 8 & 4 (& 4 `& ( @$㿈 \ $@@@b ` H@b  L P  #\#`#dD  ( & (㿈 ( `2 P0` P   #\#`#d)  X (8 & (& X㿈 $` `   P  X#\#`#d @  \@@bI  L D  X  P#\ H#` @#d㿈 \ $@@b3`  H@b* P L @  X"#\#`#d㿈 @4 "@" &" \@b  L P  H#d D #\ @##`  D L#\  X" P#` H#d @㿈 $ " @4 \@@@aޒ@aِ  `@aӒ@aϐ H P  L#` @@ #\ "#dx  \ @#\ H"@ L@ X@  P#`i#d㿈  @" @4 \`@a@@a @a L P  H#d D #\ @@ ##`A  D L" X P#\ H#` @4#d㿈 $ " @4 \@@@ak@af  `@a` H  P#` L  @@#\" #d   \ H L @ @aF P \ X#\#`#d㿈  @" @4 \`@a,@@a'  L  P#d H  D#\ @#@ #`њ  \ L  P H@a @ X#\#`#d㿘3  㿐N < @Jv $  a T<"&`T'  &<h*            ? ` ` ` ``  @`@@`2 @2 a2"b2$d2(h2 ` ` ` `` @ @@2 @2 ` b2!d2"h2$ @2(R "  "2@?? 2@ 2` "` "` "` "`S@  " 3  ??3   3 `3 ` :;` :; `# R  " 2??  22:":"R  " 2 ??2  22::"svr4_fcntl(F_REVOKE) `@.`@@ 2R    < C# `@.`@@ 2T F  `h 2 = <=@'h'p't'l'x`H*` h 2+V    "  "    B@ B  B4 2?@ (? '!+㿀@I '`" '<@  <@ @H`@'' ! @2 ! `2  ( 2  @* R `2   `a  㿘㿀@I '@< @H@&`?'}㿘㿀` :` @8 `  @ '?'.㿈@IY '@< @Hp@`''W㿀` ``: @'''?^㿀``?@'`?P㿀` ``: @'''?㿀``?@'`?`@`' ` '< h*` € 44PPP`''`'@  & '@t̰ ` `@''''@c@H'Ȑ@H `'| $ |  @D谒 쀢 |ܔ  Ғ`p $`?`<"4*` €44444444444444444444   `@''?Ȕ ] Z&x`| $ R`@@@HM'Đ@HQ 0`'| 0 =ђ|  3?Ւ谒 -쀢 *|m  $` 0|i`|\ 0 А@ݖ @ N㿐 ! `"{)& "" 07"" 0 "~, "| (` @ !*@` @ ?*@|  2 "|@  |  㿘 @`@ `@+`@`"; ` ?5 # @"/  #@@<$ !@<"@< @2 < ##0<" @" `@ "`  2` 2` 2@ 2` 2` 2`  "` "@ "`"` "`  "` "`㿘 &`, 6`0 &`4 &`8 &`< $&`@㿘Β 06` 4&` 8&` <&`  @&`$㿘@G0 &@{m @G ` 'T``` ''< *` €4444 ` "' 'y`T’ 2v 'k`T 2i '^`T 2\ 'Q T'@F̒ 8'PP 2HN AXPz 8 29\`z T/ T'T'@F 8'PiP 2` Tzϒ 2XJPzʔ 8 2  㿈` `'`''㿈` `'`''$㿘@ 0  0 ( 㿘ݒ &`, &`0 &`4 &`8 &`< $&`@ (&`D ,&`H 0&`L 4&`P 8&`T <&`X @&`\ D6`` F6`b㿘 ,&` 0&` 4&` 8&` <&`  @&`$ D&`( H&`, L&`0 P&`4 T&`8 X&`< \&`@ `6`D b6`F㿈`'`` '`''㿀`'``'`'` ''(㿐``''㾸@E `'`''@Eƒ T`` *'C` ` 2@  'L耢 7 y T 2/xe` y p%`  x' p`  px'y 2 nyʔ T 2  㿘@ 0 o z 㿘 6`4&`, &`8 &`< ,&`0V &`D&`@ &`L&`H $&`T&`P (&`\&`X㿘ɒ ,&` 8&` <&` 0&`, B6` H&`  P&`$ X&`(㿈` `'`''O㿐`' 㿈` `'`''@D `'D` `&'D@D 0`` '`` 4`` &`H` y% p 2^y  0 "`Q'`` J <!4*` €<<<<<\ 'y耢 2` , x 0 %HQ` x p '쀣   " ' 2  ''I 㿘@ N0   N0M V [d㿀@' '@DT '@DX '?'IK 7x  0     <* c @  ? ` 2&3   <* c @ ? * '&@`  x_   㿀@D  '@< @C#@`'''CI㿀@C '@< @C @`'`''C1㿐ې@` x &svr4_getdents64: bad reclen('D'H 'L@'l ` 2`   h  H@8 TY8 `"+DВ ''''''''?<='''?'' H*` € G<>H;`1`"@<{!2 `@  ?6   ??7Ȑ@TQ`w &@%@`4`H"D: L"@ <>''' H*`  "Yf TYc Tsvr4_getdents: bad reclensvr4_getdents0'H'D@'L ' ` 2`   h   0<c@C$z H@8 TX~ `!qDВ ''''''''?<='''?'' H*` € G<>H;1`"<#=  @`2 `@  ?6''7Ȑ@S`vޔ &@%4`H"D: L"@ <>''' H*`  "X TX Tx`2) `2`# `  `: <@ ( ?'''''`* `@*'ؐNذx`2' ` 2` ! <` `(@' '`''?'`@*@ `@*'ؐMذx @B 'L'<LܘL@A" < L'''0L''N㿘`# @ # ?  ` `@Β㿘` ?+@3`c+ * ?  ```  @!^<l(Ɣ 0L@LXXƔƔƔƔdƔƔtƄƔƔƔƜƨƸ 6"<002"<08."„*"<0 &" #" < " "<0"<0`"<0|""  "<"<"  sbrk: grow failed, return = %d sbrk: shrink failed, return = %d 㿐< ``@    *  > 6'#<0$@;  ``* @ * 'c B͘? "<0<" $`  :@  6 iU <#  <0 $`  :@ " $  (@@ '@@ H''aޔ bu$ H [#<0'@Vma a @Ow@@Os a '@V_ a @Oi@@Oe ?''a 6t H 0@VCa a @OM@@OI a '@V5 a @O?@@O; '@V&a a @O0@@O, &@tΔ x@    "  [ A "O U   . aF . 6`  > >&#:&@@] 'ܐ@@a `*   :? ?t  2. ''_ " " &#&  $ # @<&#&   &#&㿘ZI <" "   0  2 0 㿐@`B< \*` € ť  \#!` "! ") !  ` #&[ ` " ! 2! !`  &``''[ 㿀` " ` N А"@&  ` @''`'s 㿘@ 0   0 Nx @P  'x 'N - 0`'!<  ''``6`  ''|` 6` ` <# *` '    <# *` '`  '|xs svr4_wait㿘@ " !  " Pǰ ?ð ` &`&` P  `" L - 0  ! @ 2 HL - l -` `h&!8` 2` 2  (("4!8 D 0 T "4!8Y' <"DȐ (F* $ ( D$ Td  Do1 0x !<_ H<.!<#Y ` "`   " H` L"`L H L" XY? ?  " \@< ݐ#8 Ā "<8<ܐ" Ӓ<;а ?>"Б*:  2 H ( 2 H(` ` " H`2& $ (&!8*`` `  2f`2`  @2 &<P! me "Q P `   㿘 &@ &` &` &`  &` &` &` &` &`  <&`$ @&`( D&`, H&`4&`0    &`4   `4 &`4 &`8 <`\&`< @ &`@ D @&`D H&`H L&`L P&`P T&`T X@O]&`X㿘 &@ &`  ;`>` 8>` : >` : >`   ; >`(  ; >`0 &`8 <&`< @&`@ D&`D H&`L&`H    &`L   `L &`L &`P <`t&`T @ &`X D @&`\ H&`` L&`d P&`h T&`l X@O&`p@= РL'L@=ڒ!@< @<@''  q!  PN`q @= 'LL@=!@''  q۔!  P+`qה @= Р4'4@=!@< @<@'' Ò q!  8@`q @=\ '44@=`!@'' ’ q!  8`q p@=9 Р'Ԑ@=< @=8 @''''qo  2'ܐ''u> qX     ' &㿐@   @qC 㿘"` N 0  0`q-  㿘 㿈`?`%<! *` €8ِِdِِ` @'`?Im` @'`?H - N㿈@'''[T 2 Z  H@(''''' ?`p` &<)<#$<0#@ :@*` hH /* 'R <0  *@ *@   R 0<)!ȓ+ @ @ "@ """H 0 㿈X ?o  2  ?`B<#*` €dtttttttttttttttt4$tttttt$DTT                   @8'% -6 ]찒 2<bȔ  2 2 " @b"  &X*`6" 㿘 @ R 1)㿀 @; '@; ? <<<"c'''' ,, o 2&  "    L  % XL  N 2 ?" 㿘  R " 0 <b"  1P  ?@" "" " $ 㿀@`<#*` €$,4<DLT          ?2 p (  ? ?#@  <0!8 :`?# '䀢#@#@#@'#'# 쀢%'#@#@#@'  쀢@2##'`o 㿀@`<!\*` €x          ??2 W ,  `nޔ  2Nc #??  #    `#@?c #??  #    `#@?Yx@`<#L*` €hpx          ?2  (  ? ?#@ ? <0!8 :`?@  ???#?@??? 2 ????  쀢???,?؀@쀢?쀢?쀢?2쀢?  쀢@???ؐ???`m x@`<!*` € $,4<          ??2 f ,  `m  2]  䀢?#? ?#@ 2䀢?䀢? ` 䀢?@?؀  ܀?#? ?#@ 2܀?؀܀? ` ܀?@?Xg<"@"`"`"`   8(@*+ @ ?0( +@ "@ < "@"`"`"`   0(@*+ @ ?8( +@ "@ 㿘  &@`&`` &```` &```` &``@` &`@@` &`@` &`㿘 &``&@    &@   @ &@   @ &@   @ &@  @ &@svr4_to_native_sigaltstack: extra bits ignored 㿘&@ &`&`    &`  ?` &` ?<""@ "`"`  "` `"`(` ؐ lp 2(Z`@<#*`  `  Y `  r`lQ  X@  l= 2#@  `  \ `  ؐ`l#  X@< c* @  s b"/3  h`a"`g N"E d.3 ^ N@"H Y N "3 ` ''''''Y Ȁ GȰ C&*''''  * @"  *''''  * @"  Z "' '''''X 3  ؗ*' ' '' @  *+ [$"@ X@    `  `   `  -   kv  2$`  `  Z4 `  ؐ&`k[   x@``  0*Zؐ `<#''''  *`" : * +@@# *`k$ x@  k   @  Z㿘Z 㿐`<c*@ @''[㿘` @Gٔ!`(@ܔ!? &`&`$ $ `@&@㿈@@`( "`&!@   $`c@  `e Y ?&@  "`  N8 `j! 8:4   Nj! "` < ( <ن  # ( < "  2  | t 2 | x ""  | 2 㿘` <(  `<ْ#"#"`  "(<##2| 2||`"`"|" L1 T02㿐<(   <ْ#"#"` "(  TKn $ x$ t$$   hiӖ L  T0 ` , , <`$ | |"` |"$ " 㿘`?`<!*` € &`  &`  &` &` &` R 2 2 2  2 @2 @2 2!2" 2(H 0 a H&!W  0Q0!K <*!p' ` '` `'2  iy 2*ؐ@EÔ @ W7Ȑ igiZ  2 @  unknown㿘 @F5 ?  2` @ 2  @*  &@ <&` 0 @? &` <&` (&` &`     2 2` @ *  @  &`$ <&`0 &`8 &`< $&`@ (&`D ,&`H 0&`L H&`P D&`T(&`X &`\㿘 @E ? # 2 # 2 * &@ < >` 0 @ ?  &` <&` &`  &`$    22 *   &`( 8>`8 &`@ &`D $&`H (&`L ,&`P 0&`T H&`X @>`` (>`h㿈@ `'''@㿈@ `'''@M㿈@ `'''@|㾘@4D Р'`<` @3Z`'@4= h'| 2"hl h < 0 2``)`h[  㾘@4 Р'`<` @3`'@4 h'^ 2"h0 h < 0 2```h  㾘@3 `''@3Β h', g h 2`g  㾈@3 Р'@< @2@'@3 h'ݒ 2"g͔ h ʒ< 0 2`@`g  㾈@3i Р'@< @2@'@3b h' 2"g h < 0 2`@N`g  㾈@3- @''@3/ h',X g^ h 2\`gY  㿀  `??'gI   㺐 @D'%<ah@C!<ܒb/@C~!<ap/@Cx!<b/@Cr!<Sa/@Cl!@/g%0SUNW,SPARCstation-10unsupported㾈@ 5`! "(<  . <z N"!<S4!<S<"4  ! " <!"" g N"<."<_ N*"(!p&"$!"!<!<!h !!0!:P  2C  '!:P 2: '5 "@C[ ''``f "/` f  `!fG 2 #\  dg &㿐`  N@'0 @`''p@2 Р'<@@1. `@`'ؐ fI  ''''@2 f?   ''ܐ؁㿐@1 '@< @0?Bb<($,4<DLT\ttd||||||||||||||||||||||||||||||||||||||||||||||||||||||l               ?㿐@1m '@< @0`?&` & & ڔ㿘w`?&` & & *@15 '|@B( |@15@11 h'en x%' 2 eW h 2 <  2 2  't耢    `2`2`" ` ` 2 `* (   (*  ` "" @*" " `* `2 `" 㿘` i@  @A j``. ` *`  .   * *` ".㿘/  &@R@`"  ``" &` &`  &` &`&`&`&`h  " /  d 2(ΒȀ   N '؀ 'ܐ  '' @'''ܐ ''' ''dذ㿈 d 㾈ː   d 2.  ( '',쀢 " &  '   N  ( ''x'|'td\  h ," / dF , 2)T耢    N ''̀'Ȑ '' 'В @''''''' 'd# ,㿈   d  2'㿘?"@` 0<Ð!|*` €    ˔UD  h   ?????'c "  2  ? ?  ,'' ''''&'''''c ,  ڐ  x c 2Vx "@P   K N耢 1 ]0x ( jcOz!z 21'@/'dd@/"c_ !'h'l'ph`   x @@5!` '|' 'x cAx  㿘       Q S   'pc {@  u N'Pؐ j'Ph@.`РT'TP@.@. Pb  2\ "'X "'XO N I E N0D'\'`|X  P:'\'`ͥX b 2,Pb  2%@   NhgP'hjhP'phbP  b  㿐 b'    &&bu ` 2 % ?  b] $ 2 ''̒%t 2 ''* 2?& & 㿈''U㿐'`㿈b(  2%?c @ @    0 ז b  㿀A  ''%S䀢 2,` 䀏| @'# & & ?'@ ` ''%6 `2`0   ''%'㿘`    a   㿘? `(&<Ő"ԓ*` €TTTTTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT$<%*x$Ք &$K O  @`*@@ 2`  `k "`y?'`  `^ l?' ܀`L 2\  2V N܀ P  ܀ &D @ @    jX j@+ '$$@+` 2(؀ $  N@'L'H'PyHH '0'4'L` @'(','H'8'@(&㽨@ *@` @<͔!@ *@`2`Z _̔ "`0P?''` _ 0C?'' : ?Ȁ?4 N  .  j@+[Р ' @+^@+Z '_  `" @4 ``  @ Q @Bְ   '?''' $''''N _^      '''''  2԰ N'  (`'  (?''$'   ?''''$'@''ؐ'ܒ $_   '''  2 N ('Ȑϒ' '=6@"` '''''Ȓ?'̐ $Y' $ # $'^ o  i NАДȐ ''''@''''( L^ F '  2? N'v `'x0 N''$)$` "`^ `^ ``^  ` `^  &ntp_adjtimentp_gettime#247 (unimplemented sockconfig)setsockoptgetsockoptgetsocknamegetpeernamesendtosendmsgsendrecvmsgrecvfromrecvshutdownconnectacceptlistenbindsocketpairsocket#229 (unimplemented)#228 (unimplemented)#227 (unimplemented)#226 (unimplemented rpcsys)open64creat64pwrite64pread64getrlimit64setrlimit64fstatvfs64statvfs64fstat64lstat64stat64mmap64getdents64#212 (unimplemented lwp_alarm)#211 (unimplemented lwp_sigredirect)#210 (unimplemented signotifywait)resolvepath#208 (unimplemented)#207 (unimplemented pset)#206 (unimplemented schedctl)#205 (unimplemented signotify)#204 (unimplemented install_utrap)setregidsetreuid#201 (unimplemented door)faclnanosleep#198 (unimplemented timer_getoverrun)#197 (unimplemented timer_gettime)#196 (unimplemented timer_settime)#195 (unimplemented timer_delete)#194 (unimplemented timer_create)#193 (unimplemented clock_getres)#192 (unimplemented clock_settime)#191 (unimplemented clock_gettime)#190 (unimplemented sigqueue)#189 (unimplemented p_online)#188 (unimplemented processor_info)#187 (unimplemented processor_bind)auditsysacl#184 (unimplemented tsolsys)#183 (unimplemented)#182 (unimplemented)#181 (unimplemented)#180 (unimplemented)#179 (unimplemented)#178 (unimplemented kaio)#177 (unimplemented)#176 (unimplemented inst_sync)llseekpwritepread#172 (unimplemented lwp_cond_broadcast)#171 (unimplemented lwp_cond_signal)#170 (unimplemented lwp_cond_wait)#169 (unimplemented lwp_mutex_lock)#168 (unimplemented lwp_mutex_unlock)#167 (unimplemented lwp_wait)#166 (unimplemented lwp_setprivate)#165 (unimplemented lwp_getprivate)#164 (unimplemented lwp_self)#163 (unimplemented lwp_kill)#162 (unimplemented lwp_continue)#161 (unimplemented lwp_suspend)#160 (unimplemented lwp_exit)#159 (unimplemented lwp_create)setitimergetitimergettimeofdayvhanguputimesfchroot#152 (unimplemented modctl)#151 (unimplemented)#150 (unimplemented)#149 (unimplemented lwp_sema_trywait)#148 (unimplemented lwp_sema_post)#147 (unimplemented lwp_sema_wait)#146 (unimplemented yield)#145 (unimplemented lwp_info)#144 (unimplemented sigtimedwait)fork1#142 (unimplemented vtrace)seteuid#140 (unimplemented)systeminfoadjtimesysconfigsetegidunamerename#133 (unimplemented putpmsg)#132 (unimplemented getpmsg)memcntllchowngetrlimitsetrlimit#127 (unimplemented clocal)xmknodfxstatlxstatxstatwritevreadvfchdirvforkfpathconfmunmapmprotectmmap#114 (unimplemented mincore)pathconf#112 (unimplemented priocntlsys)#111 (unimplemented async)#110 (unimplemented acancel)hrtsys#108 (unimplemented sigsendsys)waitsys#106 (unimplemented nfssvc)#105 (unimplemented)fstatvfsstatvfs#102 (unimplemented evtrapret)#101 (unimplemented evsys)contextsigpendingsigactionsigaltstacksigsuspendsigprocmaskfchownfchmodsetgroupsgetgroupsreadlinksymlinklstatpollputmsggetmsg#84 (unimplemented sysfs)#83 (obsolete libdetach)#82 (obsolete libattach)getdentsmkdirrmdir#78 (unimplemented rfsys)#77 (obsolete rfstop)#76 (obsolete rdebug)#75 (obsolete sigret)#74 (obsolete rfstart)#73 (obsolete rumount)#72 (obsolete rmount)#71 (obsolete unadvfs)#70 (obsolete advfs)#69 (unimplemented reserved for unix/pc)#68 (unimplemented reserved for unix/pc)#67 (unimplemented reserved for unix/pc)#66 (unimplemented reserved for unix/pc)#65 (unimplemented reserved for unix/pc)#64 (unimplemented reserved for unix/pc)ulimitfcntlchrootumaskexecvefsyncutssys#56 (unimplemented exch)#55 (unimplemented uadmin)ioctlsemsysshmsys#51 (unimplemented acct)sysarchmsgsyssignalgetgidsetgid#45 (unimplemented plock)#44 (unimplemented profil)timespipedup#40 (unimplemented xenix)pgrpsys#38 (unimplemented fstatfs)killsync#35 (unimplemented statfs)niceaccess#32 (unimplemented was gtty)#31 (unimplemented was stty)utimepausefstatalarm#26 (unimplemented ptrace)#25 (unimplemented stime)getuidsetuid#22 (unimplemented System V umount)#21 (unimplemented old_mount)getpidlseekstatbreakchownchmodmknodtimechdirexecvunlinklinkcreatwaitcloseopenwritereadforkexitsyscall"X"` n"` 2  "` '%"`8` 2``* ` 2``2  A<̈́(788 888$8,848<8D8L8T8\88h8t888) ' 2% K# n!   !,"X$')`" #% "8!p" !㿘  " .`   " .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&` Ȓ `&`( &`  0`" # ` `@!"&` @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` v&`$ ``  ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘 ` 2.`.` ! ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&``  &` (` &`  a"   bc0  &` ` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&``* &` $`&` `   ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&`  "@ `"`  "` "` * $   2@ ` 2`  2` *`2` * $   `   "      gx  1` h `@   ????'  UG UB $ȟ@ 2z  #    U $ 2c U  2Y` R ޒ? `<Ґ!d*` €IIIIIIIIIIIIIII      @&`h@ Tؔ T̔  2 `g@ *@ *` *` *` *` *` *@ *` *` *` *` *` *@ *` *` *` 2` *@ *` *` *`R "` *@ *` *` *` *` *` *@ *` *` *` *` *`  ?`#`wQ&<Ґ#ܓ*` €NLNNQQQQQQO<NQMNN8QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQOOQQQQQQPPXPXPX`w@ 2ʰSߔ  2ðSє  2 `vx`c`@ $o ؐS  2      `@ |ȐE S  2lŒ `]`t@ X! S^  2Hђ `u9`|@ 4 SH-S<  2& ~  }     }   ~@ 㿘~ݔ㿘S$!( F &@ &` &` &`  &` &` &` &` $&`  (&`$ ,&`( 0&`, 4&`0 8&`4 <&`8 @&`< D&`@ H&`D L&`H & Hpc or npc are not multiples of 4! 㿘R F| ": `` !(<h"/ @<*@  &`& `& ` & `& `& `& `& ` & $`$& (`(& ,`,& 0`0& 4`4& 8`8& <`<& @`@& D`D& H`H& L <*` "@"` "`"`<Ԅ*UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU  "`  "` "` "`"`H<!  $(c H.`* `@  cc@= ?ϒ5xx!В ''''Q'$ ?Q"P  ?Rے "c@ET c@ `$H$$$c  $c T_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR 㿀<`А"@a(} ?``8y <Ր#*` €WWWWX X WtY(<f*#(b`<f%#8]`@Y%`0<f#HU`  :`4, ,@b2`* @ *`b2*@ *@B2`* @ *`b2*@*@ < c 3`+  (0+`@ (D@b2`*  *`@C3`+ 4`, +`,` B?%`0 Ő%`0*" *  * %`4` `%`%`(sparc) svr4_sysarch(%d) 㿘@<fU!p 㿘` `   `!" ! ! 0  {  y <#&`T       @  " $ "@  2 "` 0"! @0 0@0 "#@2$2(  @ <"`("`$"`( (!   2 @2 2 2 @2 2  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " ` *`"  `*`   `*`!㿘       @     &@  &`  !"   0 "#0   02@2222 2@ &` 2  2 2@&2@2 22 &` < (wb & ` &`    .`    .`    .`    .`    .`    .`    .`.`    .`    .`    .`    .`    .`    .`    .`    .`  "   .`! !2.` .` !.`.` 2@ 2` 2` 2` *` *` *` *` *` *` *` *` *`"@ "` "` "` *` *` *` *` *` *` *` *` *`8 @` *@@`7 ` 2`1  `a &   "EP &# "` !#  y $!t    d 8'"X ْ  JҒ   "  "!!w !0  !"    e    9  %  &Ր0!"67 !, - !"֠  ! !{ !" r !)n !(  g    !2_ !1 [ -0^0!"&0!P 0! :0!JE0!"f80!ݐ80!m10!/0!-0!0!0 !0!! &``Mb     '   `Ā`MK `'MJ  ' `bĀ`hĀ ے`M+   77`gĀʰ`hĀఒ '`'M  v&``wĀ  ` ``h `l c 2  " 0`L  a&` `Ā `2 `h`LΔ sLɔ $nh`L  f8 `Ā ]Ւ`` ĀJ`L $ BВ``  Ā5`L  - `fĀ%`Lt  `_Ā`Ld Ā `L] x`LP Ā `LI X`L<  aĀ߰`L. 0a~Ā А`L& ˰`L 0a#Ā `L `L  aĀ`K 0aĀ `K `K  aĀ`KԔ ~0aĀ v`K̔ qx`K i aĀb`K  [Ā T`K O"aĀ F 'h'l'p't'x'| ''''' '$'(','0''T'@''X'8'4'<'H'D'L'\'P'`'//'''''''hKX `KL ?'h'l'p't'x'|'''' ''''' ''$''(','0''4'8'<'''@`D'H'L'' `/2   /H`O `/2   /0"ahĀ G"0aĀ  '`Jݔ `` '``"'    ' ' `Āg   '` - b}ĀX`eȟĀ P `@' &`2`2`2`2 `2 ` 2`2`@ -2 `* ** * * * * * * * * * `hĀ  8`@*|  "8@+`$`@" jR "  "2@?? 2@ 2` "` "` 2`2` S@  " 3  ??3   3 `3 ` :;` :; S` # X`?` Z<ݐ!$*` €uLvlvluuuvdvdvdvd<"`  *` @* *`9&`@`'@''@ `'ȒI  ;АIݔ  1 0 +Ā (IȔ  "r`IŔ  - `<" *` . *`㿀@[ '@I  '@V  ''I  Lz㿘@ ?"@7㿀@0 '@< @G@&`'''㿐@ '@< @/㿐@ '@< @@ \㿐@ '@< @ @ l㿀@ '@< @@`'''㿀@ '@< @@`'`''㿈``'@''!]㿐@''4.2ffsnfs`@ Ѐ 'D    ` @@&`@ H 2~<ޒaА@%%  <ސD@y <ސ!ؒ &@H  "ega@%  \` H 8 2YH  2RD?H ?P/H@N H &` 'X@H <c     'd'\'`'h'l'p't *  t 't*'xt`'|@'t'ĐH''\'HY  2` XHR H 2ݓ㿐 '')ْ㿀7@'H4 㿈@''''7sunos_getdents0'D'H 'L@| ` 2`   h  0`@ H@8 T)B `5DВ ''''''''?<='''?'' H*` € O<>HC`9`"<[ ؒ : 2<@ 2 `  @` ?@ `   7''7Ȑ@$S`G &@@%@`4`H"D: L"@ <>''' H*` )k T)h Tx`?2H ` ` B @*@'䀊`'؀` <  @*@ @*'` :`?' ``''`+ @@`R` ` `h `ll}`  ?''ذ㿘`  㿐 @d =`2` Y   "@$  `( 2 ``<#*` &`` l `  9 `  F` "`ߐ0 $ ` `` 10<ah   ah?? < / </ / / / / ///??????????'// <//ap @ ap// <S@/ / / / / / / / / / ////a/ ` a///// `/ `/ `/ `/ ` e/ `@/F[/㿘`  @ 0.0.%㿐@ ` '  K 2 2 2 " <@ <@ @&`Δ `! ` (  @* R ` `a  N㿀  `??'E    㿈!  `* `` `|  6˔  u   <= ''' H*`   "&  &  X $  ? ? ? ? ? ' ' ''''''ؒ???'E @H@B '@< @Y@ @'''''< Ҳ D  @`  :4``㿐 @ `  D  @  :4 ` 㿐@ '<@@ `< ߆0C@)<(,8DT`h"<00" <" "<08 "  ""„"  㿘@   "@@"㿘@   "@@3㿈@<#쀢 6 <#* " '` `'`''hp  @.!: <&c @  c@"``@`@  p` DN  ''Iz H` D{ 2)?# @ `@  `  1 `  ؐ@ ْ`D[  "@"@"` "`"`h<!  $( `H.`* @ `@?Р ? ''''  `'ز@’'`?'`'@'`'`0D1' D 0 ?EB 7  $`H$``$`  $ 㿘@hDӐ 7 @ Cߒ "` /` !(( `<*@  #` # `# `# `# 0`# H؀  $c  c ?"c Ȑ`@M 2 ?㿘  m? `j? "b?@#. . 06 `&@&`t&@?,I #``@. . . . . . . . . 06 4&. . . . . . . . . 06 4&  ?` , #``@. . . . . 06 4&?`  р?@?`. ɀ??  #``. . . . . . . . . 06 4&. . . . . . . . . 06 4&@........(004&...... ..(004&  ?` ,1 #``. . . . . 06 4&@..@..(004&`?׺`  .`?@. .`.?. @(. 06 #4&`? c. . 06 c4&c" . 6 X@  @`#'``" `8 %`".`2 `'` ''@ ̒ ` 'B nQ` `'`?ؔoɒ` `'`?Ȕpm'm+`@``` 0*` 0%` `'`?r` `'`?ؔs<`'r ` `'`?teX@``` 04`# 0/` `'`?h&``''i|`'`` '`''Ԕj<`'``'`'` ''ky"` "@"`"`"@㿘 &@` &`㿘 &@` &`"@ "` "`"@ "` "`X@  A5 2#@  `  0 `  ؐג`A  H`  A 2$`@  `  .3 `  ؐ`@  p`'Ԑs@/ mа &㿀0*`& 㿀@'O0<㿈@ '''-㿈` @''' "" c2 (2 2 " """ "$" ("$,"(0",8:0@:8H"@L"DP"H㿀 @ `  `'``#\#` i` @R & 㾈@ D''' ''谒 霒I  0`@, `㾈@ ''' ''谒 z'  0t`@  `compat_12_sys_fstatД@`*@@ 2R  ``"   < K e S!X 0@`?֔ `㿘 !:)( @ln 㿈` ''@#\  = 㿈 !:)     '`#\@ = sparc<ahX@ <ܒbx@ <ap@ܔ <Jb׀  bJ@ (`J@  (` @* :  ` @**:    )   :  # *` @ 2* *:  `J@*  : <X*b@ @?I < "x`< ( `J '@'`'` `''` `  '䀊`  '` a '䀊h '``: '?؁ 2@ "` 2` 2`  2`  2` 2` 8? <"` "` $"`  ,"`( H"`0 D"`4 L"`8 P"`<㾨@ D'0'',' '4à :  PĒ`>ʔ @@@ '''''~ D`h ˿ ˸ %0+˭ ˨0(ˡ (*@ 4'`'h??Рr`>x @ofstat@`*@@ 2R  ``"   < 缒dTR#PC `>G @㿈`@: '?8㿈`@: '?༒x`@: `'?'ۢ &㿈`&@'''Œ N㾰'L@d ` 2`  h  ``' ''`'''''#'<=?D'`< 5<>'''''''H*` :` ؞???`?'''h-<)+<)<0(/<0``  `<)K"H<)H"h`@<)C"<)@"b a<)9"<)6"耢d<)1#<).#( @@ @<)"#H<)#h@<)#<)#@ @@<) #<) #@<* <* (H /* '   ` T "H 0' ''#''''H*`  :``Ȓ"@   ]* * 2 ذc$ $ :*hH /* 'S   * *`   T0<)!ȓ+ @ @ "@ "$"H 0'''H*` € {`@V<!DH@ 2O`0 <=` '''''H*` h` ͐ 0<= ' '''' H*` ''' H*@  Ր03  " : = (h`耢@2` 0 "` D`8 `   4`44:ɮ" xh` ! l" ` * $, :`$ >! `@"    * ?*  @ @ ? @"  "`"@"`"`  x@`` ` " "*@*" " @2 wh(0*   `  "` ` `"`"@"`"` "` "@"`"`"@㿘 &@` &`㿘 &@` &`("@"`"`  "`"@  "`"`p@'ԐŒؐ &$ а &p@'Ԑؐ &  а &h@  7(  2#@  `  & `  `7   H`  6 2$i`@  `  $& `  ؐ]`6ߔ  㿘`` @'=  㿐@` *` '#' '#'`6 㿀@`6     ;`; ??! <088" <( "㿈` ''@#\  4[ ` 6h  @?# @c"K ea"3`b`* -0% -0/ fd) -02!@: -0` ` ` ''''`#\'  ߚ ð ` ` ?'`#\  '`#\     '`#\  3 `X<@!h<@"Ȑ X<@ap<S@!<@"<@" '~ $'<S!$5 }<ڤ $'"Ȓ$5 q<<0`<"ܒ +   ($'''<''!h''$5 V< $'!p$5w Jä”aa$'''<"$5e 8< <a|  <0` P! $  @'''<''''''ؐ"5E$ $'5w X 0  &``5i 㿘 !: @<("# 㿈 !:    '`#\@ 3* 㿀@ В?''''@ ' 5( $ Tl '*`  , `*` ,@$@$` " 4|4| L@ / L` .`L` .`L` / `|` '|@:f|@J?`/?N /2. @ ''''' j /C. @ ''?' \''l'h''|h O5<= ''$?'' H*` € 9x @''$?'' H*` € )@@! ``x`|'@ "@8 '4u  'a T  xX T  ? @  *@ @ 2"  ,; 0` `  "%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program 㿘 D<`G < Hג J " *`:`J   Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*㿐"@`?` `[` `*q@"=N@l& m k  "g c&N@ 2 ( "& N 2 & ˔ " &@  ݰ?0F&N    <&&9   ^`?@`@`]`2@`-N [ N@ ]@  `?` `?@```@ ?"  &@2 & 㾰<قcȒ@a @  '@ ;<cȑ5- !'@  @4 ,  @  c`6 .  '5-@  ;<ق@c`0`(` '@ @@ @ 6.' <ِ@c` 7`/` (`0`@ ' @ @ ;<4 cȕ, `(`0`@  @'@ <٬ c`5 -  4 , @  `6 .@ 'd@5- @ <ٺ@ c`7`/`'   @'6.@ ;<ْ@ c` @@0`(`/`7` ' @ @ <4 cȕ, `$ /`7`@  ' ;<٬@c`(5 -@ @4 ,  @  `,6 .  5-@  <ٺ@c`07`/` '@ @@ @ 6.' ;<ِ@c`4 0`(` /`7`@ '@ @  <٠c`84 , @/` 7`@ @  '5-;<ٔ cȒ@`<4 ,  @@@   7 6 ./  @ '`5- @  @7 7`/` /   @'\@6.  @@ 5`0`(`-`@ @ /`@7``'X @@  @'@ 5`'\-`@ 4 , @ @ d@@/`7` 'T' 3 + 5X-z#@   @ 'P4 ,   5`6T.-`@ @  @d@'L@5-@  5`0`(`-`@ P ' @'H6.@  @0`'5`(`L-``@ @ @ @@(`0`3 + 'D''@@ H4 \, @  (`0` ' 35-+ @  X@@@4 ,  '< 36@.T+   @'8 5-@  '0`3(`<+P  @ @@@'46.@  '@7`3/`8+L @  /`7`  @3` 4'H+`@ 4 , @ @ @ @`7`/` '0',' 3`5-+`@    \4 ,  '(3`@,+`@@  @6X.  @ @`'$5-@  '0`3`(`(+`<@ @T \'  6.@  '@7`3`/`$+`8@ @ @ @ @P/`7`X' @3` '4+`@ 4 , @   7`L/` ''T 3`5-+`@ @  H@ @@P4 ,  ' 3`6.,+`@   @ L'ܖ5-@  '0`3`(`+`(@ @@ H@'ؐ @ @6.@  '@7`/`3`ܟ+`$ @  </`7`  3`4 , +` '@ @7`/`ؔ @ '''@8@   @3`5-+` @ #`ܘ44 ,   <@'̒@  06.(  @ 0 5- @  8@'0`(`̒ @0(@ @ @ ,6. 4 @@@ '@7`0/`( @ܔ @(`0` ( 0@   '04 , (  @@0`(`ؒ@ ''' '' @$ , 0 5-(  @@ 4 ,  (' @@  0  6.(   @5-@ $'0(  ' @ @'7`/`@ ̔@6. @ @ @ 5 0`(`-  '@@ @/`7`   @@ ' @ @ 5 '4 , -   7`/` @''@ @ܐ @@   5 5--  @ ؐ 4 ,  @@ '  @5  6.-  @  @5-  ܒ@'@@ '7`5 /` -   @ @6. ؖ'@  @5 7`/`-   '@@(`0` @@  @ @@ @ @ '34 , + @ /`7`   @@  0(   ''''5- @ @ 4 ,   @@ 0  6.(  @ @ 5-  @''0`(`0 @( @   @6. @@ 1 7`/`)  @ '@(`@0`  @ @  @ '@ 4 ,  00`' @( @  @@/`  '7 5-/ %2ָ  4 ,   3 6.+  @ @ @@@5-@  6`7`/`'.`@  @ ''6. 3 @7`/`+  @'|@ @ 0`@/` ' @4 , 3  7`+  @ (`'x  '3 5|-+  @ @ @@'t4 ,   3 6x.+   @5-@  3 t+  7`'/` @@@@6.@  3 @0`(`+  'p'l' ' /`7`  ' @64 , .  @@@/`7` ' 5|5--  @@4 ,   5`6x.-`@ @ @@5-@  5 t'0`(`-   6.@  4@7`/`,'  @p@@(`0`@@ @ '@4`4 , ,`@ l (`0`   '35-+ @  @@4 ,   06.( | @ 5-@  07`/`( ' @@@x@ '6. @7`/``;<'c\c'`X'`T3 '` P+ '`L '`H '`D'`@'` < '`$8'`(4'`,0 '`0,, '`4t0`(;<ٺc'`8$'`<;<'cc'`'`'` '`'`'`'`'` '`$'`('`,'`0'`4|/`;<'cc'`8 ''`<'`('`'`0'`'` '`'`'`'`'` '`$'`,'`4'`8<ْ@|c `<x2 @t* `p `l `< `  ` ` ` ` ` `$ `( `, `0 `4 `84 @@ 0`(`  '@    @ & && & & H;j&. 0㉒`v"" " " " " " 㿘 . &  6  & 2 ?`? @"@  @ }  ?  @  @ ? @  & @ f@㿐`  (  * @ *`2 + <a  `  !<!( `      @# *`2 .      ` )@ 0*@ +@ @`(@``  㿘  ```+ .`@@(. "@``   H;j&. cv" "" " " " 㿘 . 2  ?&   &  6 @"@   &  @@4  ?@0 @ ? @  & @@㿐` `2 ?7 x 8" <a n  @( XP   @ 'y'5ک/@   x@ 0`(`@ @/@:1 #V@ 7`/` @ @)@   ۔ 7 / @ Ē(@0os " 1 ) @ /@ =_ #@ 0`(`@ @̒/@ "*@ 7`/` @ @В)@*  " 7 / @ Ԓ(@?Q ! 1 ) @ ؒ/@ `&  ؐ@ 0`(`@ @ܒ/@"= #@ 7`/` @ @)@?֔ # 7 / @ (@"W5 # 1 ) @ /@  !"@ 0`(`@ @/@?f !@ 7`/` @ @?` @@)P # 7 / @ ?  m  ! 1 ) @   =@ !b@@ 0`(` @ @0,@ #@@@ 7`/`  @(@@  "Q 7 / @ /@:m # 1 ) @ / 5Ĕ  ]@ 0`(`@ @)@  S@ 7`/` @ @(@@6(y " 7 / @ /@9 #Ȕ 1 ) @ / xs !@ 0`(`@ @)@0 #֔@ 7`/` @ @(@@=5C ! 7 / @ /@V   1 ) @ / *x !@ 0`(`@ @)@?; #@ 7`/` @ @(@@ "ِ 7 / @ /@#J   1 ) @ ?!B@ 0`(`@ @@!}"@ 7`/` @ @@gX!" 7 / @ ?yN  1 ) @ )/"D@ 0`(`@ @@#@ 7`/` @ @@=Ҕ#` 7 / @ / p 1 ) @  &ߔ"Ɛ@ 0`(`@ @@:I#@ 7`/` @ @@5;̔  7 / @ "! 1 ) @ 6u4 9@ 0`(`@ @@9!@ 7`/` @ @@蟔  7 / @ 1+"e 1 ) @ 1= H "D@ 0`(`@ @0@ʿ #@ 7`/` @ @7@*@ # 7 / @ 7?$@  9 1 ) @ 1V֔ !Ô@ 0`(`@ @0@#3  @ 7`/` @ @7@?@  } 7 / @ 7!a@ !ѐ 1 ) @ 1 "O@ 0`(`@ @0@?9 "@ 7`/` @ @7@(P@ # 7 / @ 7@ ! 1 ) @ 1=ߔ "@ 0`(`@ @0@/N "5@ 7`/` @ @7@ "@  7 / @ :ᴐ7@ ) 1 @      & @&& & ???????? 㿐@㿘@  *  @    "@ @b  8:` b   㿘  `  `  @/# @*   & &@&& @@ "   ` 㿘?#@6 6`@ܒ `@  & $ $&@`@@2  ` *  , "@@ 4 "  "  , @@ 4    ,@@ 4  @@*  㿐   `  ` @  `? 2  *2@ 2  *@  2@* *@  㿘   `  `  @  ` &  4 @    : : *2@ :  *@  2@* *@    B @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  'D'H'L'P'T'X/*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@; a<aX """"""""""""""""@2?# * 2  aXc  @ aX?* ?*    *  @@ @   `@ @ "`"  @ @(*`*2 J@ ""  J@J`   * ( @ @ `` `z  `@Z 2" 2۔  J " @( *` @ (*     J@*8 ` "JJ2 @(*`  #*0 ` + +    "*2"*" @ ` ?  2  "  `  ?2  < "2 J "2 J   "2 J  J  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J  "  JJ@ ` 㿐?@  @ '$ * ? ?* 2 c  2 * 0* * 2  8 * 8 * 4 & 4 &kernel %sassertion "%s" failed: file "%s", line %d 㿘<"H5zY V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*@ 'T<`@  <:?T  `2;@  0-4`444`4`4`ؗ445`5`'75`5`@ ڮ27```@Ē`@"`*  @@`*  @@`*  @T` @T ;@-`-2 ,`- ؓ2`@ Ū`` "` '`` ';`   đ. ?3@ "@ `*`# @ 'Ā@ .`@`` @@`@`` 7`' `'- @@ @, @E@ * 2 5@?c +`@ϑ2 . 2, @ ? ?@c. @ , @'@?""6`4@"  @"6``4@  *. @?@ @ @ 4@ 6`@4@Ĩ 3@`'`' T`%`@ .  "@?:@* @2 . 4@*  *`T@ ;@̑* Τ Г*`@  +     @( 82 `+ ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@sun4c compatiblespurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'( $  <<d d@@((X (08@HX`hpx (08@HPX`hpx@ED-|5wHI @u1v@HGF  0 0   0(H@`XhIJKLM67892345>?@QBCD>?;<GHEFBCO RAENd:\ThyhȒhy|ƈjWƈLƐȪǰWƈjX$ȢhX|hWƈLX$ȂhX|hXƈL,hIȒhJ ȒhK 0ȒhK40Ȗh@ƘȪǰ@ƠȪǰJ4@DdǠJ4@PdǠJ4@ dǠJ4@dǠJHPdǠJHPdǠJHPtdǠJHPhdǠJ\`T8 Jxp\dǠJxp,dǠJ€TpLȒhLƈȪǰM ȒhM, ƈȪǰM,  ȪǰL°(ȪǰL°0ȪǰM@ȒhMTƈȪǰMT8ȪǰM ȪǰM@ȪǰMƈȪǰMȒhTȒhTƈȪǰTHȪǰTPȪǰU ȒhUh ȒhU| ƈȪǰU| XȪǰU| ƨȪǰUh ȒhU| ƈȪǰU| ưȪǰU| ƸȪǰU| ȪǰV0ȒhV0ƈȪǰW@vh^0PȒh^DPȖh^XPȞhWH`ƈLypȪǰWpƈjWpƈLWÀƈjWÀƈLWÐƈLWÐƈLyàȪǰX8àƈjXLàȈhX8àƈLXLà\hXðƈLXȦhYȦhY ƈj]ƈL^Țh^Țh_ TȎǘ_0TȎǘ_0@TȎǘ_HPTȎǘ_``TȎǘ_xpTȎǘ_ĀTȎǘ_ĐTȎǘ_ĠTȎǘ_İdBǼ_İ`BǼ_İdȲǼ_İ`ȲǼ`d.Ǽg`.Ǽh8Tq ƈȮnjqxƈȮnjqȮnjqȮnjqȮnjqȮnjqƈȮnjw ƈȮnjw0ƈȮnjx@ƈȮnjzPƈjzPȪǰzPȪǰzPȪǰzPƈLz@`dǠzppƈLzppƈLzŀȪǰzŀȪǰ{ŐƈL{ŐȪǰ{ŐȪǰ{ŐƈL{ŠȪǰ{ŠȪǰ{ŰƈL{ŰƈL|ƈȪǰL8dǠ`ƀȪǰ 0   &0 ; d֬ 0 =58F B xp hHXamd7930xaudioamdU U3#f#UfD"D"31####$$$""3""""3DDa#!!1111(DA<<<IV"k}3 D 2( @0 @HPX*H+ TF0X1PN1RR2CE2ST3NM-/\CL/0PL/0RE0D@RR2CE2ST3SL+lRR2CE2ST3ER3CE2ST3(:<,CdClDD`DhDEDKD!Kh;EX 8r`dr`rPrPKpK@alN`r`srpprHPtrPqr`^@8r`dr`r`^R|[Dq4p#$8^^ X_@L`tx``rX! (r`rPr`rPll̸` x8r@dr@ՈKpK@al@HrPdXrHr@t߼rPr@r@8r@dr@r@r@r@r@Dr@p#$8^^ hXL`tx`Lr@(r@r@rPrPll K( gX8r@dr@ghn4KpK@aljkrPlm,rHr@trPr@r@r@8r@dr@r@r@r@r@Dr@p#$8^^ mXr@L`tx`p,rXr@(r@r@rPrPll 0@x c4r Y netbsdMh*@@jL44wCopyright (c) 1996, 1997, 1998, 1999 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. netbsdMh*@L44XH8qۀ  X  HH q|  !il x :p>;;,0 ; 2H; ,x H H(| xX]:TXF<Xh ;E$E`8d (5 P  |5ØX0qqpxlklP < qq < A:< `h\ q " q+ G +H /$ E D +EX,8q P8h  tqPEq  x$ !8>@,d` 1E$013$q dH@ <D qqqq#Lqq"qqqAHqqqq'(qqqq@@>  Dl`qM|I@ q')d$x%H;X  '  \ \ \ \ \ \ \ \ \ \N T WdJx :=$@XE a$ cP` h8(qqqqqt+qqqqqqqqqqqqqqqqqqqqqqqqqqqq, P 5L p "H% p]\P !h " "; qh UP[@ ZP\pN8@"0"(" """!!!!!!!!!!!!!!!!x!p!`!P!H!8!(!!!           x p ` P @ 0   p`PH@0 xhXH@80(B@ נX11235ttyclsttyopnttybgttyinttyout@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@k(lx ( ( ( (( ( (k(lx ( ( ( (( ( ( ' )( ( ( ) 6 , } 4 X H d X ( ( ( (( ( (  QMDQMD < Zc8netionetconnetclsj 2lockf@` <DDܸܰܨܠܘܐ܈܀xph`XPH@80( @\A|DFGG(G0 G@0 GP\ G` Gp G G G8 GdGGG GH@ HlH H0 H@ HP$ H`\ Hp H H H H<HhHHHI IDI pI0I@IPI`  IpLIxIII I(ITI|X 8d@lHt8dDp Lx(T0 I8r@dr@JrPrhrh@rhlJJlJJrPHr@trPrPr@r@8r@dr@r@r@rhrhDr@prPrPKhrP KXJLLXxrPrhrhr@(r@r@rPrPrP`pLLNNNNNOOOOOOO R8r`dr`V,rPrPXX@Zplccd dPrHr`trPqr`f8r`dr`r`g[Tc,Dq4pdds|s r@Xr@LfxserXr`(r`rPr`rPr`R@ RP R` RpRH gX8r@dr@ghn4rhrh@rhljkrPlm,rHr@trPr@r@r@8r@dr@r@r@r@r@Dr@pmrPs|s mXr@Loxsp,rXr@(r@r@rPrPrPtfifou0u8vvw w@wHwwwwt0ww0xmxmxx G $ xh($xX/xP $xH5$x@Y$x0$x(r$x :G$x(G$x$x:$ z8r`dr`rPrP}d}@<lDrpprHr`trPrPr`8r`dr`r`<`r`Dq4ps|s r@Xr@LxsrXr`(r`rPr`rPr`p\d4 HX`P| 4@tp8tLLX$d T\x  h8r`dr`rPrP@lr`r`rpr`rHr`trPqr`x8r`dr`r`4r`Dq4p<xs|s r@Xr@L`xsr@r@(r`rPr`r`r`DD0( 0(      xph`XPH@8 L4d,4<DT\dL¸̤°¨( ˜ˆ € x tp   8r`dr`Üɤƀ@ɜlrpprHr`trPrPr`8r`dr`r`ԤDq4p(Ġs|s Xr@LŜxsĴrXr`(r`rPr`rPoddevopndeviodevwaitdevindevoutdeviocdevcls x8r@dr@Ոrhrh@rhl@HrPdXrHr@t߼rPr@r@8r@dr@r@r@r@r@Dr@p,rPs|s hXLPxsLr@(r@r@rPrPll  Dx htp<xL\8X@ TXHP@   8#t0$dd$%'()$@*l+-.d../0H/t0 11x385d7\8:(:;DD<p<=t=>T >XAL?x@@AD !#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~pL8@PXXP| . ..  t88dp@hlsrpppHtpq(8d`ĠxθDq4p[LZ (XϸLx Ѽ|Tϔllo`( 20123456789abcdef^^0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef  P < ˈ  h|,20123456789abcdef< g F W@ Xx d<  t  h < d D 8 <  < ;   D<   x  `< A, 1 !`<P $D (< <   h 8hh< $ %(i}E#(D@X2(@AAA==(A* 8@8@ @@@@@@@@@8<lpt$$NetBSD: ip_auth.c,v 1.11 1999/02/02 19:57:31 cjs Exp $ X$NetBSD: ip_fil.c,v 1.34 1999/02/02 19:57:31 cjs Exp $ $NetBSD: fil.c,v 1.27 1999/02/02 19:57:30 cjs Exp $    D@R @=Zf @$NetBSD: ip_nat.c,v 1.25 1999/03/05 07:27:09 mycroft Exp $$NetBSD: ip_frag.c,v 1.14 1999/02/02 19:57:32 cjs Exp $x$NetBSD: ip_proxy.c,v 1.17 1999/02/02 19:57:32 cjs Exp $ftp u {L zL$NetBSD: ip_state.c,v 1.17 1999/02/02 19:57:32 cjs Exp $ /<xxx0123456789abcdef2$x<<@  " 8" 4  d " 0 h p ""  "#  "$  D P" A, 4$ 1 !` P!x" $0      + +#### b b b b b bx bh bP b8 d d d dp dX d@ d0 d d d c c c c c c c cp cX cH c0 c c b b       !"#$%&'()*+,-./0123456781>6  7   7 &    .. 89A(A ,, ,IEDH @    (P Xhd  (P Xhd  (hXd  ((PxhhXd  `  0 @ ׸  h A F Jt L @` D ݄ 4 L \  h ) , 0 0T ( p ,,,255@A3A==(.p L f.p k O Ql.p P  \.p P 4.p K, L O T@.p L k O T@ -8.p $           @@@@@@@dT<' @t/(4E(8R\nd(<@Bnu{hL@      ?BEFF'' EF''' ?F''F'' F''' F''' EF''' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''3<3@3L3f3z3333334484N4l4444445@7x8:XHh]De@aceHHc|dde(e8`dlUe05 8dkneoD@t8lt DrPrpprH$t,q\ L8DdNm8.wDq4p  s|s (XLxsr`(r`Tr`rP6 x8r@dr@Ո4oD@t8ldrPdXrHr@t,rPr@r@8r@dr@r@r@r@r@Dr@p  s|s hXLxsLr@(r@Tr@r@rPll 7 gX8r@dr@gh4oD@t8l4rPlm,rHr@t,r@r@r@8r@dr@r@r@r@r@Dr@p  s|s mXr@Lxsp,rXr@(r@Tr@r@rPll 80123456789abcdef?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@:::;>@8A\) L*,-0$0x01< 8 014d !!##@%l37dsrpprH-ttpq-|.083d>BD<E,HDq4pH<|II XILKDxIOPX(TLLllt`=X x8r@dr@ՈLl##@%lKLrPdXrHr@tprPr@r@8r@dr@r@r@r@r@Dr@pH<|II hXLKDxILr@(r@Tr@LrPllt> gX8r@dr@ghNX##@%lMNrPlm,rHr@tpr@r@r@8r@dr@r@r@r@r@Dr@pH<|II mXr@LKDxIp,rXr@(r@Tr@LrPllj@@CE(F hL,lL\4A 8<0dȸ!#@%lsrpprH-tt q ь8Td̈4E,HDq4pHII XILKDxIOP(=AY,UE lBX x8r@dr@ՈLl#@%lKLrPdXrHr@t߼rPr@r@8r@dr@r@r@r@r@Dr@pHII hXLKDxILr@(r@ArPUE ̴C gX8r@dr@ghNX#@%lMNrPlm,rHr@trPr@r@r@8r@dr@r@r@r@r@Dr@pHII mXr@LKDxIp,rXr@(r@ArPUE mpE0HP٬) L,-0$0x1F  r@8r@dr@ltr@r@@r@lr@r@rpr@rHr@t߼r@r@r@8r@dr@r@r@r@r@Dr@pls|s XݰLxsr@r@r@(r@r@r@r@llF  ...@ .D`0\HHImq$q4t|0|X|+.Ds|D\]x H^D$`0H4@H0( `T%&X'( T*x+$T*- -= m}M1152X456 *\]6]D]]798 9 ;l^_$9]9]D]]:;d:;@;l^_$ ,;x?`O\P,A(A,B@C,BD,FGt,FH ,``dsparcsparc0a0ahihm %h-H,,$++$888k(km %h-H,,$++$888nr%@\1H8888881Xn(t ///..X88/nr(t\///..X2$8/snsPs&h\888881888tPntp',///..X2$d1pn)d,///..X2$81txnt*\///..X2$8/vN<vN<vN<vNvNvN uNuOluPuPP uPP uPPuPPuPPupPupPuPOu@Ou0Nu(O u OuOuM|(|{{{{{{{{{{{{p{{{ {,|},} ~ޭޭ4LK %%%%Fh P0|( `(08T`UxpTT$lP @H *PP@ *P(85tM(PD,P0 Ҡ"#$#L$&6$ &'&'X++%-.#282#% 78P;;;=ABB8BLBhBBBBBB(B8BLBhBBBB:hCCdhDEKPL@hq8r$cs4231xaudiopxH 4\ @     xh@`XH @`8  @`  @` @` @`xh@`XH@`8(@80TpT¸àTĔT(  \ܤTT(TTT<TlT4TXTx3 8  "X!%P+, 9::|;H       !"#$%&'(1234567890-=` qwertyuiop[]asdfghjkl;'\  zxcvbnm,./   !"#$%&'(!@#$%^&*()_+~ QWERTYUIOP{}ASDFGHJKL:"|  ZXCVBNM<>?   !)"*#+$%&'(1234567890-=`<9 qwertyuiop[]>asdfghjkl;'\ :7 zxcvbnm,./  = !)"*#+$%&'(!@#$%^&*()_+~<9 QWERTYUIOP{}>ASDFGHJKL:"| :7 ZXCVBNM<>?  =     =/*789456123 !"#$%&'()*+,-./012345608. ;<+-?`8a8b8c8`8a8d8e8gXgXghghH<HDH|I<IXhIxIOPP`QPnnpn`nPn@n0n nnmmmmmmm<`h`P`@(``xp`H`8 ````xhP`h8`h `h`x`XH80 ``ph@@P`@( !````````p``H``0``````````````@h`PH8 `8`8`8`8``p`X`@`(` `@`@x`@`@P`pX`H0`h`hhh`p`XP8`(`(`phX@8X XX`h` ph8xdp,PPPh`XKP<|000000000000P80    pX@ ( xph`P8EEEEX\L ""H&"""""""!""!""!""!"*,*,0@/57L58=H=h=0@@@d0@@@dtBBpCCGG(G<GPGlGGGGHHHDI,d4<KKlLMN$ST8S<V\D[[d[l\`\^^b`aabe\effhndl8llnHo,@+ + + + p0pvTrsDsLuu,x\xx}p`ppppp p@0pP 0p`$Hx,4x|D (08pp p@ p p p  DL|p |?? }XU@*U@*U@*U@*U@*U@ }DDD|DDD ~8|@@x@@@ ~8D@@@D8  @ @@@@@@| #aaq:  hDddTLLD DDD(( H  (   x  X  8     h xx Hpp ?111` (@ 0`@  000>|? ?1  x  X 000` 3ff 8?ff`f>``f`? 8`DDE9  2 2 a >wc`aaa?`     h0  0 f`vvf` H    (   ` 00` x00000000 6? X?a@ 0   @````@``@? 8 !?  ?1```@```0  00`gop``````p@? ?`@@ 000  000 h ``````p?```<    H    `xx` ( `88` 9  x?0```g ollg`0?  ? @@`@` X````a`````````` ` `````` 0 @ 8a``````````````````@a 0@0@000?00000 0  0@0@000?000000x ` ````a`` `0`` `````````````````````` h 80 Hacflxx|ngca`p x00000000000 0  (p`pppY`Y`Y`M`N`N`D`D` p` p x X L F G C A@@@`0  ````````````` @0@ x00`0`0`07000000x  `````````````0@8@# Xa````|ngca`p 0`` ` p<@`@`` 8F  p` ` ` ` ` ` ` ` ` ` p@? `@000  f f f v w@3@7@;; p` 0@8   @` hp` 0@  ?   ? H ``00  (|| || 1`  x 0009 X ```gop````````p`xO 1 ````p@0 8`````1 ````````p9`p 0``````0`     1```1?`? `@ @ ? 0p00790000000y h  08 H````acf|x|ngc  (nf`f`f`f`f`f`f`p 'y0000000y  ````````p@8 xq``````````@p````   ````````p`8```` Xs48000000x 00@8 0? 8  @ y00000009` p` 0@0@  pf f f 7@;@;@ p@8  h` 0@0@  xp `A8 p` H  (8    8  >`6gC UPUPUPUPUPUPUPUPUPUPUP x  X  8     h  H  (   x  X  8     h  H  (   x  X7%dlhx90  000>|? ?1 8` w@;008.@` Ĩp` 0@ ??  ň`0 8 1`p`8A@a  h @/@YYX X YY/@ @ 1?? H @3 ` Ǹ```` ( Ș @?@YY_[ [ Y9 @ ?? x#aaq:  X   8 ˨y00000009>`0000` >~~~> ̈   h  008? Hf3 "D θ88 `?@ 2dG (0pp0 0`013`2``A Ϙ8|L  `L};@ 2dG  000@9 x ? @@`@`  ? @@`@` X ? @@`@`  3 ? @@`@` 8 ? @@`@` Ҩ ? @@`@`   @'&@>&FFF ӈ` `````` 0 @  0@0@000?00000 0  h0@0@000?00000 0  0@0@000?00000 0  H0@0@000?00000 0  ո ( ֘  xa````````````````@a  3p` p x X L F G C A@@@`0 X ````````````` @0@  ````````````` @0@ 8 ````````````` @0@ ٨ 3 ````````````` @0@  ````````````` @0@ ڈ``00`` `!!c`c`f`l`l`x`8@0@8o hp` ` ` ` ` ` ` ` ` ` p@? p` ` ` ` ` ` ` ` ` ` p@? Hp` ` ` ` ` ` ` ` ` ` p@? ܸp` ` ` ` ` ` ` ` ` ` p@? (p` 0@  ݘx00?00`0`0`0`0?00x 1136663104`6`w x0009 0009 X0009  30009 80009 0009 6@&``?fffg`? 1 ````p@0  0``````0` h0``````0` 0``````0` H0``````0`  (   x01 ``````p@8  3'y0000000y X ````````p@8  ````````p@8 8 ````````p@8  3 ````````p@8  ````````p@8  !c`f`f`l`x@8 hy00000009` y00000009` Hy00000009` y00000009` (` 0@0@  xp ````oq``````````@p```` ` 0@0@  xp x }@ } ~ ~  p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @     p  P  0     `  @ ð  Đ  p  P  0 Ǡ  Ȁ  `  @ ʰ  ː  p  P  0 Π  π  `  @ Ѱ  Ґ  p  P  0 ՠ  ր  `  @ ذ  ِ  p  P  0 ܠ  ݀  `  @ ߰    p  P  0     `  @     p  P  0     `  #$<< ,  8 X  ( ( ( ( ( ( ( ( ( ( ( ( ( ( (`hd ( (Z ( ( 0 0 0 0 0 ( ( ( ( (p4H8`P @,HPLt ! ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (HPTLD ( ( ( ( (|H@ x ( ( ( ( x ( ( ( ( x ( ( ( ( x ( ( ( ( x ( ( ( ( x ( ( ( ( 0 0 0 0 0x԰@ (CDDDEEHEC8 (( Pˌ@ P (gggg ( (*k ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( P PZZH ( ( ( ( ( ( ( ( ( (* (4 (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( 4(  (JPJK (KX (LD ( ( ( ( ( ( (* ( ( ( ( ( ( (* (Tx ( ( (p4 (* (t  X  (* (ЄT ( (Ѩ ( ( (8TlP (H P (L ( ( ( | (* ( ( ( ( ( ( ( ( & '( 'T ( | P ( ( ( ( ( ( ( (* ([[d ( ([l (\`\ ( ( ( ( ( (* (-,-.$ (. (.l ( ( ( ( ( ( (* (`a ( (a (be\ ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* (rsD ( (sL (uu, ( ( ( ( ( (* ( ( ( ( ( ( (* ( (* (8 ( ( ( ( P ( ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* (H$T (* (l8l ( (l (nHo, ( ( ( ( ( (* ( ( ( ( ( ( (* (| (* (# #$ ('4 P* (@A` ( (A ( ( ( 0 0 0 0 0 (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* (, ( (4 ( ( ( ( ( ( (* ( ( ( ( ( ( (* (x\x ( (x (} ( ( ( ( ( (* (d, P ( ( ( P ( ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* (L ( ( (|pl<(X ( <Tl P ( ( ( ( ( ( (* ( ( ( ( ( ( (* ( ( ( ( ( ( (* (TL ( ( ( ( ( ( ( (* ( 0 0 0 0 0 P 0 ( ( ( ( ( ( (* (D ( ( (` @ (* ( f f qx t n ( y ( ( (( ( ( ( x ( ( ( ( (* ( x ( ( ( ( (* ( x ( ( ( ( (* ( x ( ( ( ( (* ( x ( ( ( ( (* ( x ( ( ( ( (* ( 0 0 0 0 0 ( 0 (h ( ( ( ( ( 0 0 0 0 0 (* (z >8\]_]D]]`@]`lbc^_$d,e,e`fepftkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkktrapD@D0DDCCCCCCCCxChCXCHC8C(CCBBBBBBBBBxBpB`BPB@B0B BAAAAAAAAAxAhAPޭ @ @ @ @ ???? -  !" _`abcxyz{|}~ZN]Y^YBYYYYY.YYYY$#/emul/svr4svr4!8U($0Q481123/dev/ptyXXpqrstuvwxyzPQRST0123456789abcdef   6666666666666x6p6h6`6X6P6H6@6865555555555`5@585055544444444`4X4P4H4@4844443333333333X3(2222h2P282 21111111x1h1H1(11000000000000p0`0P0H0(00///////h/H/ /..............`.P.@.8.0.----------p-h-@- -,,,,p,X,8,0,(, ,,+++++`+@+ *****`*8*)))))))x)`)H)0))(((((x(X(8(''''p'H' &&&&&&&x&X&8&&%%%%%p%h%`%X%P%@%0% %%$$$$$$$$x$h$`$X$P$H$8$0$ $$$$#######qۀ  X    | Ĝ !h$ :qq>;qqXHqq٤qX`q 4qXFpqq@;xYqH pqqt+ h5 (@qqqqqqqqqqqqqqq31 qqq` '  P < A8 " D tqqՐqq\qqqqq¤ <P 0  x ,   q4 "qq,d@D <q>qqqqqqqqqq8<0h qqqqqqqqqqqqqq0qqqqqqqqqqqqqqqqqqqqqtpq>@qqqqq qqq $ \$td qqqq p0 +,8  /$E$D   t1 d EEXq'(/emul/sunossunos@0(L44qۀ  X  `wLw| x|q X !ilq :qq>;v qqqqqqwqqX]x$qxlXFqXq@;qqqq bq P  y5qX yp0qqpxklP < q < A:  qh\ q t" q+ G +H /$ E Dq + ,8q L8|  tqPEq  x$ !8>@,d`q1E$013$ dHq qqq qq ' q4y|P"`qPy8q |<8qqqqq|xq<`D2Kn,X  `  % K2Kn,X `%K@  @@ @  !"#K%  `   X,nK22Kn,X `%KNetBSD1.4.1@(#)NetBSD 1.4.1 (GENERIC_SCSI3) #1: Mon Aug 9 02:34:40 PDT 1999 mrg@sun4690:/work/tmp/mrg/src/sys/arch/sparc/compile/GENERIC_SCSI3 NetBSD 1.4.1 (GENERIC_SCSI3) #1: Mon Aug 9 02:34:40 PDT 1999 mrg@sun4690:/work/tmp/mrg/src/sys/arch/sparc/compile/GENERIC_SCSI3  + h2w?DPL4U!x\TdXu it|m( . H_1 ix4 i^A30;DHW_dts j jV j jK,t  [.=;B jLVQ]kD`| FHh8@W3T j- XP j(3B jNZ2fÐs jxl4 &ld0( j5 0T* ,9 jFxWgp|  jsZpp80(| j\@]]L*; k,K q\[ $ir Ƽϔa7L,t '\Sl4$+2A-O_e qxiX8H|zQPDH&2Cu \_et(}l$ 4\N k0A Lנ1./A1HR k4` An<@5_ 8JJP  t  #c -q <q K@ U h k8 u   <  ] : k< 8  m ` 1 D ' 6 > K^ Z m } p  Ä hl  A $ k@  ( p < I L + kD 9t8 I PP| _ kH q ~<   kL N     , L kP $8  kX  ' 3> @ T l < { ,   H  k`  ]|   p B   ` Wd  .d $.D 3 A jp MM [ @ dEx s^X kh p n  kx  @ ( K | MJ( k1 $D;HJClZcq8ly( l8ĸO,8 _ [.{TGV_ܤl&{< 0U\  i m^H x _,4tBtQ XkHz< lH̔lt(4/(̈́#/<; lFQ^q`j l q l`x<@$pH lh lMp l$0&Mh/h8AUHO lY Lh u}<%| 5Pil> P 7P&|4l? SN +[ lk|H\hp, mhth ml`/0L#`-5 8:dJ)S*jBHz mp ot o`ih<($$2 l> (LX]Xm\v(Y48H`HM ( )3@BOP[IdMr ~ mt9h4 \mp#0 m* `4D (L"`jw mpl lZe0 gh$0L=LDEQ [`fE`t kltP m QpJ/ِ?x$O[xi}AI0 `: m mZnTwH$ (4HBX'n}-|  mKPxa$԰"A1 aB Kh\s wL n nD |hD  $?%6.?CN [hoyat TU1x`3-(   -lx78AO,laKoy nՈ֬ d pxW8 XFh#8=L,\Dd b@ndxPȸX3. o\ o` od oh  +TD<  F0H:lH[klKiY$PAH|YD Q  h 8 A5 U"H _r4 j y5 [@  m  ol   op q8 A i!g4!$!5!J ;!UT!g4!z qP! q!!!W!Ì! r!!M!!(! W("" r "!;"/x">"Kf"\"m r"u" " r" "rX""h"0" (0"# # <#'#:#K#Tl#b8#o`##&@#xx# # # #l#"## ^@# $  t$$' r$7I$L$V <$b r$k$ $t$$$p$$5$ $ $$%Ө%=t%(^%28%C(%T%f a\%sH%5d%% r%!(%%a%j% %%]$& I&&%|&4&F&P^&`P&s &L&&H&&LP&D&T&'''3$'J'_l'u ' i'd')$'K'$'' r'0'0' z4( P(ZP("m,(- r(; r(F(TUP(g($0(((((((w((V(E))#%)= r)K:)W)c()t r)~)eH))J)MT)@)) ) s*x**$|*0 H*; l*G *W*a*j s*u*A*ń* 'T* t**J* t*l* t++ L++*+7+@(+L+Z }T+i)+w++)X+L++ 8+ t + t+L+ t +,6, )0,0,9L,D P,O t(,\HD,nˌ,{a8,,;,P,@,$,,,-- -! t8-*"H-6T-D 3-WN-gu-r-E-a --q4--@-}(-- X- . t<.L.%b./.<.E%|.Q p.`.s .L. t`.4.Kh.j. td.*. . 4$. th/ X/(/#rl/, /5  /A/L/Y/h8/u ,/(/p/d/8/ /\000)!h0<80M `0V 0a ]0lI80x |00q80 0 0 $0000000T1*1G01!1.*1Aqd1L41^1m1x 1y|131 1^l1KH1L1 1 1uh2t222F2Q<2`<2qo2};2 02`2p22,2JH2L23@3  )33#X31r@3>rP3Ld3j\3{P3w3 83P3A`33(33 3r334 @4 4+4; @4K D4],4s 4 H4I4 )4 @44 4:P42444$44a$55 x5  !5- |5:5D 5S 45_ 5o5h55٬55 ̀55 ̐585+5p56 p6 6* ̔64 x6B6P|6]6n q6 6<,66 6I6 ̘6 \6L67T7 ̜77'D71777@7R7b 37o7|&(77$7!7Ll77`7k77,7x88hL8 8- 8?)8H׌8^e8jD8wc8rh8|888899&9<9S09j ̠9wt9#9 9>T9p999%H9<(9 9 ̤:1: :D:+ڀ:4q:> k:NMP:Zh:q:<:V:@:5:P: 8::;G;;'W;4 ̨;>;H7 ;];fd;uh;; ͌; ; h; ;;,8;o;\`;-H< ̬<I< v <- ̰> >!A>0>9>J >[ >j p>x O > D> p> (> > >>/> >? (?{?+?:p?E?T(?^ ?k ˈ?y d??Ø??? ?<?k? @ P@ 5@4@  @0 @9 X@B@U@aZ@i p@u H@ @ @U$@ h@@@N<@\@@@@{A AkAlA-A;FAGm\ARʠAc(8Ar A~ A AJxAAAA AuAAB\B$B9BO|B^BrB`B BBadBBBm`CoDCC' \C7 HCA>CMaCZdCj LCwC:C C ChC CC CCClD DDD'eD> DF DRD] DjDwPD,DrD4DD WDDDEPEE)E7EE@EN;EXEeEoxEyDEEEbEgE`E EEzE8E4FF F!8F3@@F?FNFf8FwMhFAF/F F F FFdF\F G  |dG G/ GC #pGW}dGfDGs`GŀGPGcPGGGG,G HM|H@H(H18HE/H^,Hv<HH8H \HyH:H HHάHH `II XII-z@I7# I? IN IZIg~I|II\IdI^8I /pI`IlIIJXJe(J J) J; tJMC`J]E0Jq@@J 0J J J0J ELJ JpJ  JdJXKwKBK K+ K< KL8KWtKe KpK tK@KKKݬK5KK  KL xLL6LL8LU7XL^.XLz+$LQL ÌLXL(L4LLL MrpM $M$ (M1hM>s|MLMW ,MbMuM 0MLM5MdMnMBM `M(MSHNL`N NN&(N3N;dNC”NMOlN[0HNfNr\N~NZNĠNN_NLN LNtOO  OO. O: 4OL`O\LOf 8OrOOOO/0O }OĐOqOO OOPtP "P! P2_PDPV/8Ph`PuPPz|PP P PPP^PHPQdQ=Q%2Q;QJҌQ\ [Qn@Q4QpQ QVQ/4Q Q QRRHR R%xR3RNTRbRnR}RR RdR RjR |RLRF`RR RS S DSYS8WSPcSdJSm 3|S{ S`S#SS SSxS -S HTPT TT3FTHCT\BXTq>T=XT8T7T6T(T U TU+ UAUYDUqdUUUU`UUUV`V&xV=VTVaVv 1VV0V lV V yVchV pV tVWĠW xW"$W4W=WVWoW<W@WWWWWXXSTXX  X+ |X7DXFXPX\ XiXsxX| X X`X XX XX X XXY oYxYY1 TY<$YK Y[YjwYy)YYDYY14YlYY!Y0Y 5YfZ,ZZ*Z7XZG`$ZRrZ`"pZoZ~ DZ 1<Z ZKZdZZZ Z|Z [-,[  [ [,<[<4[K<[X[iƀ[y3[[ [ &0[ [[[ +[ [ [ \ \ |\$ \3\AX\I\[  \r9p\}(\\\\\ \\ \,] ]ܬ]#H]/EX]?#]O&]gT]w>]`]0$] qx]]D]<] L]] 4]]^:^E,^ - ^-#^:^N8^[ (^f^q ,^{,^ 5d^̀^#<^^R\^Y^ ڀ^ X^(_[<_  _ 0_"; _.R_?h_M._[L_w _h______4` 4`d`*ZH`3I@`B`[ 4`l}`| <`v`:`<`d``*` 8`[` ` a aa*~$aBsLaOa[ajxa{w@a;axaala a %a ga ab bbob,`b< ]XbL#b[ŜbibuXbbEbb @blbdbZPbcPc  CTc Fcc-xc: DcK HcU qTc`nclc|c} cc1c1pc/c1Xd  d d&)dd5`dNsdaT4dl ud{d Ld0dO\dNddpddde gLe pe%! e6 te@eMe\2ej xewe`e$e 4eeeee e |f,f,f2 fF@fVbfb<|fo0@f|e(f>ffff ffH(f"gM@gg!ddg+g5gA gLtgWgdgw-gTgtg5Lg,g_gg gDg h,xh hyph'h8$hD hQ hcDhyhHh|h8h h h h,hUh 8h Xxiki) i( i6 iGiY ilizNiXi!Xitii iihi`8iIjj j!(j+j:4jH{TjYjbtjlju$j j jjj5jij v@j<j8kk-k<k* k3#tkA@\kJTkStk[wkhm ku5kkkҠkJpk  kFk k Dkll $l% $l0 (l<8lK lUcl_:(lnl|PlTll lhl l l l l Yxl=m"Dmm7$mV mb mm(mw|m m`m m3mmm(m m m  n n _n n+n= }nFMnOxnYnanj<n|n.n8n nn>n8nqtnn ,nnoooqo*To=LoP o^ Dok <oyooo.o+o'o o ;p pXp!Xp*p= |pL,pVpeJ4pppzp&ppp4pphp pq8pPPqLjq^qq5 qD]qV q` Uqj(qsq{ q@q`qqqhq(q qq rhr r Hr$ r.r7Hr@ RrIrW ra<rjzryPrr hr TrrrDr(ra0r|r!Ts !Ps s's6sDsasnoXs|s_s s sssts Hs,s Hstt#t Pt)/t5<tC_tN\t\to 3`t|ttt _t tt;tt tFtĀuu uu"u4 uAuNu[uh 0ux u}uu u:uuHuuu0uvv v(v& dv3 v=vJvZjvfvtv3vlv@v v vkvWvvv vdw xwV`w w-w8ÀwB wFwRwcwpwwswwӤww wDww\x x @x|x*M,x99xKxYxgxs^x{x xXxˌxx\xxUx xy yc,y)y:yKրyW1yq2$y yEyByyy ;ylyy4ylz$z8z Lz0\z>PzJz\zotxzc|z hzLzzlz zzz Lz "z${<{]D{P{(9l{4{;{F{VW{c4{q ,{V{{{@X{{ k{{{P| &|!|2+|> |VA|f |nK |~z| 5| | f| |=|/|||}} }\}) .}3rD}F(}Qx}Z}h }r }~}x},}#} }}} } s`}}@~8~  fT~ t~! ~1 ~;4~Hb~Q (~` ~j,~u`~ ~~~~ l~T~ ~ x -)28FN ^ n R8w P_l0GgxxX , W@9F S `jTw  D<  .pll $8HV^/z,$tTLX̸)9\DW 8f5w;@[d   +\@ DO l-:`IQ gwI H$$ LL LD& , & d0 9θKԤ\h`w `D]l d  h|$\6 BR̀[Tfrz2|>| lsD<u| 0"{; lHTP([/@n8| Lx {% P(~3 <IÜWb 4m_w { 8 T ŰTeX ` BH  HYX(=$4İ>m G`Q^xl٤{HFA!`!TWo#X+\? <L @Y/teBo H L P T۠ð|xD_ 8:,HU0`goxPxD 4^h,mB2UUcsPrP\ 'E$_`8h)4Kp'/D4 {F JtY#e 0wxt`PKL   hLH ,_@=^0NM`mpbL ` pCdT =4H t+4 x8wJ xVD_ 9m |R |pb:g {p l P  P#l4t8A O¤^ gQv `ۀJU M{nd" 2EzpV|y,z {( ]xP O&60E VHa.p.,,,, TPu ȸ _D:B$O Z 2k*0uP\  Jx\)WH2L@N 1([ gHpp|pA ܐ T \H   `4.EH7<EPp_`lr} &tgl28``t X& 45`<F W j wLyh Q 0XK,0< JY߀a dp }NW0O|m8dP ``A ?+48@ I@V_\<j|  (x + x!*2$> HWdr n| 3  4 @IL JHPE(2CH@8]>s:X87xpX  L%>Unp  ( 4 @-NH?ĔR^ i vlXLW  h&Kh3/(BhSK_ɜo,{0>5h8  #X8  \ z/ 49 AE$QTa6p ~  VUhPcH4 I( T0= O X$e;XrpXH 8P ' ) 81g? JZbnVy 0,Q\d &h  Th)94GxtYbrct{|Y$8 <`j$   K, 6:`D LP _ov }, (@ьhRL=ٌ8 p8& `5BT[l`\is ||: uBY,Oa 0+tx X -, @#^05BT0dtL ` d<,$fR U$ ^@ 3xCP$a ,r D" T%12H>;KyXy`k z% d  # _t hPo l L\ *= pL_rǠǘ T ~ b1:XkX( ݄: )tJhU takt~ x X, \ P< n !#$/,<<L _ rzX( 44k!\&LdX E (d@$P \nx|dx 4L:y L) :J0Z\foc]f0Ǵ"e@  $ ,) %8KK TVDd8o PRDI|DP `d)5Bf8T[\o vHàd, e0 IP&' 3< LA|Vl``kluxjxMA@gX  ! $ 8< NdIP/a`k } !.HI( !+ǬLp@5&A8`F |,XaoLrZ8ppZ[_xdd0 p @``#vx2C Oɤ^ (eAv p(pYPs  x  't h"H7 lFU dcB0q 0z 4 8!` e  0w|D#J5B Qp`P|gd @E D h] H*8pALH LSat ~hxɐ $ ,Q1p 4@(k<K@V`g:tX  @s  U\ U$0p. 9f@BYcàks4|I%$ $/<:l (D ++6JDCNXR0H`Po<| x f}+ , H V, L!3<`GSxfvǰt \ 1 0(x `ބp0xt/y9CM(`m\y @%$J(X d h"f\p%_0/sBNZ7hm<wI M l@b\ pX  [!4T?J Wbp(~'  H zTR  f oX4-;ŐE ZDc `q t| (<1  *H4'4x/"% .u? #NV<h s zDRx>`4 #E @h!=,R,>LxUv`jdy  H_4h   $,e5BKbĠl s l _ ,8N (O68E DP ] iDx Έ|J Ĝ!T- >8Xcpv4 ! f #€@b |I$)7lA.O zL]oFyDh1t2.0x| X@T f(& "0;J+\[olqw.l€Ӽ dŸ "² h¼0( #| # DD-D5_G $U4gPr À ÍÙêO  '7PX l&<U<FNR G`,iIs|'Č`ĝıĺ lhk@ D#x/ G8fEdP`Uot{ Ŏ ~8ŜhŬź G JL pN2HDYf'4p{*ƆƐƟ$Ʋ 07d XL!f80 < G FjV^{j^s&|LjǘjǢ DzǼ[TKhy8 dT"Š.7@?HUgpt G(ȁ<Ȏwȕ+Ȧ-tȰ G,Ȼ X,|]\H$A4BO Zmp,Ɂo,Ɏ.$ɗ#ɦ ɱɻ0H G0x GP# 06OFPوd kXy -ʄ Iʏ,0ʛʱʽ  84sJ\ 2! ".8 D`M Y !`c$8o|v@˄+Hˏ`˖ HP˥ h˴p @ dYLs HX9l#,[8xEaDQ`_Hi| ̌I̟;̯T. H` g5e\%Q,7J^ shibXvŴ́0@͋h͓ ͢.ͯ۔ͺY=l, Hx H H%T5 H>F28Qx`LmXΈΑΤη mKD, H@(,̤>wEV@b nG|wϒiϩ[ H0d ) 0 H9 ID 6hQ ]ho 7< Ћ @К IСxЬкlBZTI, h4`D P d_(m`t.dсcюјRѦѰ¸T{ I I` *$A`S ^2ix F҅ғPҝAҬҹx{FNP/@TlxlӐӛ$өӵ(d I׌EX  L 4) I3y<< IEP._ Js J~ԉqԔ JԛԨԲBԽ ׸$ J hr+D8 JFOLZxi u JՍp՛"զ\հ Kտ :\L KLND+6 K?P^: m1z օ$֑X֟! ֨وֺtD` K # /d?WLpZwcqH׃ }<ב K$לרM׷5׾nj DŽl1$>:F T`ip}~؇\ؐh(؞(ئ= ز K(T858  )2ZEMOYff@ntpمrٕv٥pٲ 4\ K,  K0! L, ވ;dVHg|(ڋ"ږHڝ#ڱe8ڿQ  ,\" lH(5BDK S4b{ۅ+ے;۟ L۰۸0]D  h|PrH2hLGhT=`g&Lܓטܥܯܶ2D לj(N`$0|7}xAPu,\b8j !4}XX݌ݙݢݫTݴ'p 6 Owc \,x9l8FW7oz3ޅގ ޚXޤޱ޻hdH L  T@g$ , 70 D8O@Yis| ߇XߗPߤּ߫cߺhg, 24U 0  *P6EMr`_ f u(/DlqIx |E +8?NMbr<} 8P|` HKlKX K, `T L&9 F6PLdqF,(  xmxP % 4i:3G-V b 1p|D1  D  8 $\ +'> xI Qal `| %(7\l,duv840KP+ 5A IaYѴ_#fsG 5 Lzt" D"0T>HgRan4m߼ygUU8.TD_ $]2 F=/$J_Tb ow `@1,popd8  % 4 <<IFl_h p0zXcd h ؀EL}  *5<hKEXZ\ft h08$Myrc8Ip: d$2?pGWPalrz 0u8 l@ ps] H (C09BTK tU adk[L}(U|\ ͤ bL(<+CN" Z\dRt H*xkA0L \7 ` $5LIX kTw\L l@0  $l-̈8p?|W^wixw ~  JXDzU  '( 6l<\" ̰3<DKDO^ k(uK4Z  NX$d  @ X )P9J Vwc4sqq4 L< Py -9D QlP A,[iDr|} *Kx+ 1xLX ,OT>E W(gxuA,X 8)<C8 ȸ%428; G9xMX @bsmXhjp'^D% d !(9pBt0O!Zhkt4CD "h Đ_H H& - > EM7Vmxaq- P$Y *)d'&h/%A VxdwP JlH ` t@d/eLd d@,46 I$U[xb:ktx h X,p)A , A  $||#)2>KU kc Pq  l1 p<M5Bp T( x5<@Svd(t x | 8D`qx `p e0#H- 8 hBKV(_ ky| *     l&~5WB2xL[Lmv }LZ*4H\ Tpp+wL6FJA^<r5  05KgoѨˤrT )(, & 2=>8K YDk_$} ` aPtt  0L8 F N*]PlLw!8S@t<   ;pO $#1bC <O 5\ (s°~L@xD ,  07$, <N [m,y ^cU 8 LOCg  0# <, ? KUbCr @| THKX X^ X$H# {L0 hA PI V \a4ndlz B48iL $P0O d!3$:'XRp`dn ` < WnHl h $1ݰI ' @6pE (U^ެk q|T< ,~ hw 0 8g8|'l3L\jKy @c 4td H P v|% 1=*MWL_Єg wv 80h x1 (lc W"}-u95C _@Secxn v ^ MD @wHP  e "` . ? J  T  Y  h r |        p < T J e8 T Ș  H 4 ' . =r0 I U ` g4 w    Z   U  ސ     P  @ 8  (  5-0 Dw  Q 0 _  fJP nZ vh b @ u %4      K    . X X d  & $ 2p G Vz` c s  < 4  ( T WD *   X  ! ;D  #  - 9W Aa K [ | j  v | LX WX  .  ^  N [H L -P# @1 |;\\L>Xx`jPy L 2T g H C U  ($x,4 DwScu},p`p l&Q/7a0BN1Z g q| bl m| 0@:A < lL(L<,5M`H O \9xe l@,x } gx\ OcP@28 h84H!$.D;(ElMiVQd8td$  80. |\T '71C )TP Up[~ LThѼĴ@w] (RX/ D@Q@@ZCi՜w $ r| ( ,yx>s4 x" ,ϸ>FQ pH^hq@., D )\ #w( H% 1::C'T[li{ P  h xnjXHtPHX  h"(D14:NE@^ d 8n v`(t%h 2 V, d d1 *? NJYftZ|Tt! 0WBT {l8 xpKP("P5 iC|LZme{dD   p61 R/+H; H 0R 0gr,zx|wL x R| 0x-8L $r.AghL_Y˼jHlxtHaH   vl0 k(4+U 2 U> PH Q^ f@o!({!,!4!  @L#,4PCR|\`k4zLlx$\(T\($/8L\\s\~xLtT'04@MZf\n(z@,x`x   & 5 G L P Y h z   0 0 0 : : (   ! ͠!!/!;<!L@!X!i!|!!!@!#!ش!ظ!.!/" /"/"*;"2;":"C4"K3"W8P"b7"l:4""Ex"Ex"Ex"O8"O8"O8"]"]"_#_#_#)#6m#H#Yi#hh(#vqT#yH#t#|#}##L#$$ $$,$:6$HX$T($a$k,$u$$$8$$ $D$8$$$$8%8%8%'9%8:%J+LKp+[Kp+jKp+|c+c+c+j+j+j+j+j+j,w,vD,0w,Bw,Qw,cx,qx,x,,,,,,,,- --'0-2-@-O-a-m-|----<-<-<-X-X-X.Đ.Đ."Đ.4ۀ.@ۀ.Oۀ.a.m.|.<......./ //(/:/E/T/f/m/x,/Ax/</ /(//H/0/0/0//0 0A0-'0<'0K'0]+x0k+x0z+x00H00H00H0:X0:0:0:0E1E1E1!Q1,Q1;Q1Mq81Yq81hq81zB11<11l11X1X1X112 2B(2(242C2U2^B82l 2w 2 222222233 33.363D3S3e3tBH3|@333P3P3P4@4@4@404A4QBX4YC4bh4s4848484444X4X4X4 5 5 5" (5- (5< (5N X5\ X5k X5}5,05,05,051515156565667(67(6)7(6;96HH6SH6bH6t^h6^h6^h6^h6_P6_6d6e7j7j7$j76`7@7I7R7[<7i(7t(7(7070707777C(7(7(8 (8̀8)̀88̀8JҘ8VҘ8eҘ8w888888080809+H9+H9#+H95K9CK9RK9de9ne9}e9x9x9x99999:: :):::I:T:c:uH:H:H::p:p:p:@:@:@; C<;C8;'P;1;D4;Vh;i;x;;;;#;%;,;7X;7X;7X< G(<G(<$G(<6Ix> >.>=>Oh>\h>kh>}x>x>x>>>>@>4>$? ??)?;?E?O?_?n?????????@ (@(@((@:@@J@@Y@@k@|@@@@@CX@C\@X@X@XApA pA/pAAAPAXxAexAtxAAAAAXAAAABBB,B>BKBZBlChBtCB~B<B B8BBBB(C(C(C#(C0PC?B0CNB0C]B0CoCyCCPpCPpCPpCQCQCRC\@C\@D \@D\@D&fD0t8DAt8DPt8DbDsDDDDDDҨDҨDҨDҨEդEE0E(DhE0 E9EELEPE_@ElLEvEEEEE@E@E@EE pE pF pF F) F8 FJFRDxF_ Fi Fx F "F "F "F &(F &(F &(F 'F 4F ;F ;G ;G FG% WTG5 MDGB cGL SGU Y GaGl dGu dG dG hG zG zG zG zGExG {G |H }H  }H }H. H= HK H[ <Hd HqHy XHH H LH H H H H8H HEIDIEI I- I@EIJ IS Ib It I I I I I IPI ˈI ˈI ˈJ րJ HJ J  J- J< JN JW Jf Jx JJJEJJ J 0J |J(J ,J K KEKEKEK' 0K0 0K? 0KQ@K^ xKe xKt xKFK K K K K KFK ((K ((K ((KGL 8hL" 8hL1 8hLC 8xLL 8xL[ 8xLm 8xLw 8xL 8xL|LLL D`LL F|L FL FL FM ^dMGM$ gM0 gM? gMQ q|Mc Mq hMz hM hM M M M (M (M (M ̀N ̀N ̀N# (N. (N= (NO 8N[ 8Nj 8N|N N N N@N hN hN hN ,O O O O/XO6 O? ON O`OgGOqGO O !8O lO O .PO .PO .POO .PO 2O CP FHP  FHP FHP+P2 OPB PPQ M P] QXPj kPt kP kP P kP n,P uP uP uP`P {P Q Q Q"Q) Q9 QI QY Qf Qu Q PQGQ 8Q 8Q 8Q ~Q Q Q R R R R/ R> RM R_ Rm R| R R R R R 0R 0R 0R S S S! S. S= SO 8S] 8Sl 8S~ S S S PS PS PS!S S S T  T T$ T6HTDITN (TT (Tc (Tu 6(T 6(T 6(T @HT @HT @HT PT PT PT QU QU QU(#4U-#TU2#tU7#U<#UF#USI(U] ZUrI>Uz b8U b8U b8U dU dU dU dU dU dV$V &V gTV% |V3&V8*VH (VR (Va (Vs V} V V V V V*V V*V ׸W ׸W ׸W!*W' W1 W@ WR W^ Wm W W W W,W W W W W W X /`X /`X( /`X: 6hXE 6hXT 6hXf 6hXr 6hX 6hX K X K X K X UX UX UX aX aY aY fY fY- fY?,YH shYP shY_ shYq shY} shY shY uY uY uY Y Y Y Z Z Z! Z. Z= ZO Z[ Zj Z| Z/ Z Z Z Z 0Z 0Z 0Z Z |[ ߠ[ [# `[3 `[B `[T P[_ ([k [v [ [ `[ `[ `[(([(([(([`[`\`\ /\'0 \40D\Bʠ\Qʠ\`ʠ\r1\ \ \ \1\2\3<\3@\3L\3f] 3z]3].3]=3]M3]^3]n3]4]48]4N]4l]4]4]4]4^ 4^4^.5^?5 ^OIX^Y5h^`"^o"^~"^5^5^5^>^Ih^Ul^Hh^Hh^Hh_W_eP_&eP_5eP_GU_T:h_^_j_y__τ__h_߰_̈_L_h`````-`?`K`Z`l`|X`X`X``````a3a3a3a1<a=<aL<a^E ahE awE aL@aL@aL@aU aU aU aU`aU`aU`bU`bU`b,U`b>hbMjb[jbjjb|Abbbbbbb b c c c,c;cMƐc\cicxcUcXcXcXcccc0c0d 0d(d'(d6(dHdUdddvdddH`ddddHpd d e e*e)e*Hxe:U8eEU8eTU8efxXeqxXexXe|e|e|e@eeee|f~0f Uf"Hf3V f=VfQV$f``fm`f|`f`fff0ffffV(fV,fggg!Ig,g?gJgYgkgxgggHgHgHggggI<hhVh!Vh2V8hDhOh^hpth~¤hƼhXhXhXhVhhhiIti `ii$pi/pi>piPPi[PijPi|\ i\i\iIi'`i'`i'`i2Xi2Xj2Xj 3j,<$j85jM>jZ>ji>j{DjDjDjJxjJxjJxj\,j\(jLjN|k O<kOk(P k9V kBIkM\ k^`km`k{dkh@kgki(ki(ki(kmPkmPkmPlmlmlml1ml;q$lJq4lVtla|lj0lx|Xl|ls|l\8l\<lTl\@llllXlXmXmm%m4mFJ0mMmZmhmsmmmm0m\Hmmmmm(n\Xnn%n %n/%nA%nL&XnXJnh'nw(nJn%n(Hn'Ln*n*n*n*xn+$o*o- o01oA1oP5oa2Xox4o5o6 o*o6o7p9p&8 p?9 pW;lpm9p9p:p;dp:p;@q2q0q.1q@LtqP;qY;qh;qz;qxq>xq>xrLr >xr?`r$Lr-Lr6LrCLrRMr`A(rnAr}B@rCrBrDrFrGtrFsH sC8s Es-Js:\hsGXsVXseYsr[8s}Z sYsMls\lsMs_`s^xs_s`s`s`t`t`dt'a0t-a0t<a0tNatZ\xtg\|tw|@tSlt|t|t|t|t}t} t~u$uUuUu*Uu3@u<@uK@u]LukuzuuuuU@uUXu\u0uu|vvUvv'@v2\v?\vL\vXpvfvpvx\vvv v0v8vTvUvv`v`w `ww*w8wFwV(w[(wj(w|XwwW8www$wѰww w|wwwwӨxӨxӨx!\x*\x36xBW`xI"xZ#$xk#Lx|$x&xxx&x&x&x*xx*y *y*y+-y3-yB-yTWy]-yf-yo1y1y1yXy1y2 y4y4y4yXy4y4z5z6Lz6z(;z3;zB;zTX`zbXpzqAzBzB8zBLzBhzBzBzBzBzX{B{B({?{)B{1B{@B{RC{aCd{qD`{wD`{D`{D{E{D`{H{I\{KP{KP{KP{f |i|l|+dH|8l@|Fq8|Kq8|Zq8|l|z||||Yd|Y|Zh||||Zp}} }}*^}<^}NѸ}ZА}m}|D}}}]}]}x}x}x}}~~ (~-(~<(~N~V~e~w~~~(~(~(~~~~8~8 8$3EN]oXwXXxxx 8 8 8_ 8 @4$/90F R_l,y"X%P !$)X)X)X+++ +, "6$.1=0L2Y>g?ds?@`44X4@7>\>9:|:&;H3A@AOAagXlghwA|AA]EE^GGH<HDH|I<IX^Ix!Ix0IxBIxLIWgcLnLxOP`PQPRRRWWW^(e(#e(2e(DmUmdmvgn^8_8$)8JPOP^Pp0z00ߘL_'_h+808?8Q!V!e!w(((3x3x3xxxx@@@@@@B$B3BECPC_Cqy,y<GG(G<GPGlGGGGH"H1HCRQyXS`SoSST8S<Vz(\DS]D]%Y2]XH]^^f^u^^^zTbeeeeff"h6zGndWjfn|ynnp0p0p0p0pzvTpv"vl4vFwNw]wo{}}~T~{ H-H<HNHZxgx{@)x/x>xPZ|e{s(|     |Dh*|6AM\k}$XXX__%_5<4E|Y}@f}Xz}}~ ~8~~p ,@PMhan0H( 0`>xSav@X 8%p3HVkPyh0H((=K``nx@X 82@UpcxPh0H'5(JXm{`x@X *8?MbppPh0H4BWe(z`x@X)7L Z8o}pP h,A0OHdr(`x!6@DXYg| 8p+P9hN\q0H(  `.xCQf@tX 8p'=LbPqh0H(*@Oe`tx@X 8-CRhpwPh0 H!0FU(kz`x@X$3I X8n}pPh'6L0[Hq(`x*9O@^Xt 8p-<RPahw0H( 0?U`dxz@Xð 8ĐĨ3BXpgň}Ph0HǠ Ǹ6E([ȀjȘ`x@Xʰ#9 H8^ːm˨p̈Ph&<0KHaΠpθ(πϘ`x)?@NXdѰs 8ҐҨpӈ,BPQhgv0Hՠո(ր ֘ /E`Txjy@Xذ 8ِ ٨#2HpWڈm|Ph0Hܠܸ&5(K݀Zݘp`x@X߰) 88N]spPh,0;HQ`v(`x /@>XTcy 8p 2PAhWf|0H(5`DxZiv$ 0,?<GQ\f q<_d`xxxhhh(5@JYk(y((hhh#*1(;(J(\ g v `"` ,6`LV`0lv`Ph `  !!p/%h7%hF%hXab28i28x28H3`3`3`3`0:P:P:P==='a5a@8Ia RD8\D8kD8}E8E8E8a(aad,e,e`ep ft+f>fPf_fqgwggb(kkkkb8mbXb`q(r5rtCrSsdslqsssst,t@c`txu<u\%u7uBcRvcvttvwD|} } } d8 %dX/h6hEhWcsDxdl<dh!5g|BfRe0[eeAHsAHAHAPAPAP\^^^d(d(d(%j ;kQ`^mxjmxymxh ( !(zhhh g(64EgSg[gc p  HHH)H:M`<s$ @@@ppp$/>Pf|’X¨·|X x#0$=SliuÁÎPÛçö TLҨӬ60A0P0b"oDď"Ĝ"Ĭ#ļ 8*898K$(XgcqŀŒť(ű((0dhh,h>hJ`bzƒ ƪ Ƴ $  0   D( <#/X=KRX\Df#v#Dž#Ǘ6ǥ6Ǵ66666 7p81?FF^FvJxȃJxȒJxȤJxȿJJK K8-KlJQYQhQzSHɋYɘYɧYɹZHZHZHZHZHZH66'ZH4]Ab$MbYt mtpʁ6ʒvʟvʮv7 7777 @@,@>Ras~ˍ˟˭˻(`X@ (6@I X`gu(̿######_nfs_readlinkrpc_nfs_boot_setrecvtimo_eonif_kernfs_sync_log_copyin_sdioctl_isosw_addlog_proc_trampoline_dmmax_isbad_ffs_oldfscompat_spptimers_ipintr_ncr5380_pio_out_nv3tov_type_nfsm_srvpostopattr_nfs_iodwant_doforce_namecache_pool_vndread_mtty_ca_iommu_attach_locked_queue_count_cdevvp_remrunqueue_cd9660_vfsops_nswbuf_max_sw_3_leftover_kernel_iopte_table_pa_kmem_object_fdc_obio_ca_ie_obio_ca_timerok_ffs_fifoop_p_unp_output_ttychars_doshutdownhooks_mtty_cd_isp_cd_cold_tp_init_rt_timer_init_cd9660_readlink_i82586_intr_htonl_reginval_ctx_free_dayyr_nfsspec_read_nfs_getnickauth_fix_outcksum_sys_shmget_spec_read_lebuffer_ca_cd_get_parms_cdlock_kbd_code_to_keysym_devctty_sunos_sys_reboot_union_write_devopn_iso_uiodir_isohash_fdcattach_xdc_error_nfsspec_close_tp_refinfo_spec_close_isp_attach_lebuffer_cd_buf_bootstrap_getidprom_native_sigaction_to_sigaction13_fdprint_iplopen_tcp_syn_cache_limit_bgetvp_rcons_esc_uvm_pager_dropcluster_nfsd_head_flag_sys_revoke_in_pcbdetach_in_pcbconnect_zeroin_addr_msdosfs_symlink_procfs_symlink_vndsize_audiowrite_htons_arp_allocated_genfs_nounlock_fdesc_setattr_ccpu_ttydebug_si_debug_cdioctl_umapfs_sysctl_cpu_model_uvm_map_protect_getfp_scsipi_test_unit_ready_eeprom_uio_ffs_reallocblks_nfsnodehashtbl_idp_undo_route_ap_fixseqack_fr_pass_rt_timer_queue_create_msdosfs_reallocblks_nprocs_cgtwoclose_scanjet_trigger_scanner_mustek_trigger_scanner_mfs_close_nfs_readdirplusrpc_send_reset_unp_detach_ttyclose_finit_le_cd_scsibusattach_lematch_sbus_uvm_map_submap_catq_dofileread_ffree_fork1_i82586_init_esp_sbus_ca_MD5Update_sw_1_leftover_cgthree_obio_ca_iso_shipdirfuibytelshldi3.o_sunos_sys_uname_rcons_invert_cs4231_halt_output_sbus_establish_null_fsync_vfs_setpublicfs_mountroothook_establish_vmapbuf_shutdownhook_establish_mmu_reservemon4m_mbpp_recv_mbpp_send_in_pcblookup_connect_kernfs_print_fdesc_statfs_needbuffer_spec_strategy_cnrom_uvm_map_clean_idp_drop_cnputc_viking_cache_flush_srmmu_cache_flush_ms1_cache_flush_mfs_rootsize_fr_findgroup_vnode_free_list_vattr_null_m_copym_sys_setgid_sys_umask_zstty_rbuf_size_fr_check_dead_poll_getsock_bdevsw_acct_process_sys_readv_vop_symlink_desc_vop_fsync_descmax.o_unp_scan_sd_scsibus_ca_cd_scsibus_ca_intstack_cd_scsibus_getvol_cons_ocount_lfs_rmdir_encode_comp_t_vop_ioctl_desc_exphymatch_ns_ifscrub_isofntrans_ccd_softc_svr4_find_socket_svr4_sys_context_getpropint_regyear_soo_write_compat_43_sys_quota_vop_lock_desc_cnstop_sys_munlock_cd9660_unlock_altbootpath_store_bootpath_store.rem_fbpoll_ffs_realloccg_writedisklabel_change_sign8_ukioctl_sys_settimeofday_cd9660_ihash_slockmin.o_fpu_compare_cgfourteenmmap_mttyread_semlock_pv_unlink4_4c_vndxfer_pool_msdosfs_lookupmd5c.o_fdesc_allocvp_kinfo_vgetfailed_sysctl_file_sys_getgroups_bdevvp___adddi3_vme_dvmamap_ufsfifo_write_tp_local_credit_rtrequest_slstart_tablefull_tickdelta_cd9660_reclaim_region_freelist_vfs_unmountall_fill_eproc_sys_seteuid_compat_43_sys_stat_native_to_sunos_sigset_fr_tcptimeout_ips_num_net_sysctl_compat_10_sys_semsys_sys_wait4.urem_mmusegments_ns_ifinit_umapfs_vptofh_devin_groupmember_cpu_hatch_devio_sys_semop_eintstack_kbdwrite_uvm_shareprot_nfs_mknodrpc_ip_natsync_cpu_hatch_sc_tp_emit_am7990_config_sbus_xbox_ca_calltodo_svr4_sys_times_nfsrv_statfs_sorflush_nptesg_enosys_sys_ntp_adjtime_cd9660_getattr_cgfourteen_ca_cpu_hatchstack_am7930_sparc_onopen_tcp_do_rfc1323_eonstat_eoninput_vop_mmap_desc_cd9660_unmount_ccddump_uiomove_ad1848_mute_channel_copystr_unavail_gap_start_OF_open_fpu_implode_si_dma_alloc_arpt_down_fdesc_sysctlbswap16.obswap32.o_si_dma_free_sqphy_status_beioctl_snpac_ioctl_spec_pathconf_ad1848_set_channel_gain_cgfourteen_cdmemset.o_tlphyattach_dmamatch_sbus_nfsrv_slpderef_devioc_ptyattach_beintr_in_getnetaddr_ip_natexpire_ipfr_nat_newfrag__bus_dmamem_unmap_ttymalloc_compat_43_sys_gethostid_sys_getfsstat_snpac_rtrequest_ipauth_null_reclaim_sys_nanosleep_uvm_page_lookup_freelist_uvm_deviceops_audio_free_ring_cache_alias_dist_cddump_cd_read_subchannel_getprop_pmap_pageable_nqnfsrv_getlease_nfs_boot_bootparam_fae_list_umapfs_init_reassignbuf_mb_map_pfctlinput_inetdomain_tp_unique_kthread_q_lfs_segwait_cddkdriver_nspcb_acctp_svr4_sys_systeminfo_OF_boot_cnwrite_fdwrite_amap_cow_now_bcopy_pmap_stats_moduleerr_handler_am7930_get_port_lxtphy_service_sbuserr_handler_ipaddr_lf_findoverlap_sendsig_copyout_xyc_cmd_lfs_sb_cksum_spp_debx_iso_pcbdetach_rclnp_proto_ipopts_kernfs_symlink_sbflush_switchexit_cgfourteenpoll_in_pcblookup_bind_sys_obreak_cddone_ufs_mkdir_umap_bug_bypass_ttyflushmuldi3.o_eonoutput_ncr53c9x_readregs_tlphy_status_mttyclose_iso_setmcasts_iso_control_syn_cache_pool_kernfs_pathconf_donice_semexit_fifo_pathconf_msqids_native_sigset_to_sigset13_cnpoll_time_adj_ad1848_from_vol_pager_map_wanted_lock_doscheckpath_union_revoke_spec_advlock_vndclose_fkbyte.mul_svr4_sys_uname_ev_read_dmabus_intr_establish_intr_establish_lfs_fifoop_p_ipfr_nat_knownfrag_ipfr_knownfrag_compat_43_sys_wait_chainlength_union_abortop_kernfs_write_sysctl_struct_sys_mincore_svr4_sys_statvfs_pmap_rmu4m_pmap_collect_tp_pcbbind_mbufchainlen_acctresume.div_le_lebuffer_ca_seminfo_sunos_to_native_sigset_svr4_to_native_sigset_cs4231_device_ffs_clusteracct_union_start___divdi3_ttylclose_extent_free_calcrulshrdi3.o_iplinit_procfs_dostatus_safepri_vndclear_stackgap_init_fdesc_vptofh_mi_switch_seminit_ufsfifo_read_in_getsufxnotdi2.o_ufs_hashlock_fr_flags_ostype_xywrite_ie_vme_write16_portal_statfs_uvm_deallocate_finishdup_sys_nfssvc_sys_vforksaveregs.o_unp_gcing_nfs_invaldircache_tp_stash_dosdirtemplate_enodev_sys___posix_fchown_me_alloc_mbpp_hztoms_doreallocblks_in_ifaddrentries_si_obio_intr_off_icsphy_status_ie_vme_write24_cltp_input_ipacct_unp_shutdown_be_tcvr_init_xycattach_ufs_mknod_process_read_fpregs_iftovt_tab_pv_unlink4m_mspoll_nfs_update_eonioctl_fc_lookup_sys_setlogin_cpu_rootconf_cd_scsibus_set_pa_immed_sys_ovadvise_audio_init_play_am7930_halt_output_sunos_sys_exportfs_iommu_dvmamap_llc_rtrequest_link_rtrequest_dead_ioctl_config_deactivate_spurious_intrs_sunos_sys_stat_ststrategy_sys_fchflags_write_user_windows_cnrint_readbuffers_nat_outlookup_union_readdir_kernel_pmap_store_ipintrq___muldi3_kthread_create_lance_watchdog_getcacheinfo_obp_vfs_detach_amap_wiperange_ipfr_fastroute_evcnt_attach_compat_10_sys_shmsys_pmap_is_referenced4m_ukphy_service_qsphy_service_iommu_remove_ufs_remove_igmp_fasttimo_rttimer_pool_mswrite_iommu_dmamap_load_sys_shmat_cnread_fdread_lfs_vunref_null_getattr_mbpp_timeout_debug_cleaner_nat_lookupmapip_timeout_svr4_sys_execve_pmap_page_protect4_4c_ippr_ftp_portmsg_ip_forwsrcrt_portal_checkexp_getdevvp_unp_defer_logsoftc_compat_43_sys_recv_compat_43_sys_send_sys_execve_spec_bmap_tcxopen_rn_inithead_union_print_ipcperm_OF_set_callback_espmatch_obio_mbpp_mstohz_tcp_syn_cache_size_sbappend_trapsignal_ad1848_to_vol_ie_obio_read16_lfs_update_union_remove_sys_shmdt_sys_rmdirbswap64.o_ns_hold_output_rtable_init_rcons_cursor_zsioctl_qeioctl_esis_insert_addr_ttyinput_vsprintf_ienab_bic_4m_pmap_copy_page4m_ufsspec_read_icmpmask_null_lock_filedesc0_spec_open_vop_getattr_desc_bpfilterattach_ip_sysctl_portal_sysctl_getblk_time_offset_mixer_channel_info_stackdump_roundrobin_cpu_startup_swap_bytes_change_sign16_change_sign16_svr4_sys_xstat_fdsize_ns_error_unp_mark_sys_swapctl_sys_fstatfs_cfdata_mttystop_ufs_rename_sanames_syn_cache_count_msdosfs_vnodeop_p_procfs_vnodeop_p_rootvnode_syn_cache_init_ev_poll_ufs_symlink_iso_pcbconnect_pdevinit_cgthreeioctl_fd_mountroot_hook_union_vn_close_lsi64854_enet_intr_msread_postsig_svr4_sys_sysarch_ifa_ifwithdstaddr_socantrcvmore_sys_sysarch_sunos_sys_sigsuspend_svr4_sys_sigsuspend_beeint_uipc_ctloutput_ptcwrite_compat_13_sys_sigsuspend_ccdopen_scanjet_get_params_ssattach_sd_switch_fdcmatch_obio_union_rename_sys___sigpending14_ipfr_newfrag_ttclos_cache_alias_bits_findzs_xdc_startbuf_tp_stat_ipfgroups_sys_setgroups_bounds_check_with_label_process_sstep_mainbus_dma_tag_linear8_to_linear16_pppattach_uvm_map_pageable_uvm_map_checkprot_lfs_stats_argo_debug_umapfs_vget_ptytty_execsigs_vfs_getvfs_pidhashtbl_mixer_open_eeprom_ca_cdopen_sbus_match_xbox_snpac_add_pool_sethardlimit_proc_pool_sys_recvfrom_uk_scsibus_ca_matchbyname_kbd_numlock_map_nfs_sillyrename_tk_nin_procfs_vfsops_tcp_established_nfssvc_sockhead_flag_sys_mkfifo_genfs_einval_eeprom_cd_cd_scsibus_setchan_uao_dropswap_in_pcbinit_intrnames_sbus_print_clnp_insert_frag_svr4_sys_auditsys_si_obio_dma_eop_mttytty_amap_wipeout_union_rmdir_null_bug_bypass_vflushbuf_selscan_mustek_special_tp_sbdrop_eoniphdr_fr_addstate_elf32_load_psection.umul_lxtphy_status_snpac_age_tcp_ctloutput_ip_ctloutput_portal_vptofh_spechash_slock_am7930_sparc_attach_mttyopen_fr_newauth_physmem_ad1848_get_rec_port.udiv_svr4_sys_pread64_null_access_vndopen_ad1848_get_mic_gainucmpdi2.o_pmap_prefer_cltp_output_in_setmaxmtu_compat_43_sys_sethostid_mii_print_union_reclaim_pagemove_config_activate_vop_valloc_desc_rcons_insertline_snpac_addrt_nullfs_fhtovp_soo_stat_bt_getcmap_region_lru_uvm_pagerealloc_ttymodem_cgtwoioctl_scsipi_do_ioctl_rip_input_svr4_sys_resolvepath_scsipi_size_ufs_islocked_nfsrv_dorec_shortcorename_vop_readdir_desc___anddi3_scsipi_prevent_module_hypersparc_clnp_update_srcrt_udbhashsize_ttopen_svr4_sys_pause_icsphymatch_winChkName_umapfs_root_vop_strategy_vp_offsets_vop_reclaim_vp_offsets_vop_readlink_vp_offsets_vop_symlink_vp_offsets_vop_rename_vp_offsets_vop_link_vp_offsets_vop_fsync_vp_offsets_tcp_mss_from_peer_tun_ioctl_ifa_ifwithaddr_union_getattr_dead_bmap_soqinsque_vfsinit_seginval_si_options_nfs_initdircache_ip_setmoptions_union_unmount_unp_drop_fifo_poll_nfs_cltpsock_dehashtbl_proc_isunder_sys___sigaction14_compat_43_sys_sigstack_svr4_syscallnames_qsphy_status_ukphy_status_vfs_opv_init_default_endtrapcode_rcons_insertchar_st_switch_xdread_detrunc_sys_getpriority_am7930_set_params_pmap_clear_reference4_4c_pmap_enter_p_fragtbl124_ffs_update_nfsrvw_coalesce_hostname_compat_09_sys_uname_nfs_quotactl_nullfs_quotactl_dead_open_timer_obio_ca_lfs_vcreate_nfs_cookieheuristic_rtalloc1_exec_maxhdrsz_scsi_print_addr_sdstrategy_lfs_gather_spp_reass_ipl_enable_ether_ifattachstrncpy.o_sdclose_auxio_reg_ufs_ihashlookup_locked_queue_bytes_getnewvnode_iplread_numvnodes_lkmdispatch_xydkdriver_ffs_specop_p_cluster_collectbufs_schedhz_ienab_bic_si_obio_intr_on_umapfs_start_au_set_port_OF_read_qsphymatch_ie_vme_match_pfil_hook_get_sbdroprecord_audio_calcwater_eintrnames_ev_init_xdsize_nfsrv_fhtovp_cltp_init_rttimer_queue_head_contsigmask_lfs_countlocked_shm_committed_pmap_protect4_4c_pmap_dumpsize_nfssvc_addsock_OF_test_eeprom_va_krpc_call_sigcantmask_am7930match_sbus_cd_play_msf_keymap_control_cs4231_getdev_espmatch_sbus___ashldi3_lsi64854_setup_pp_ssread_nfs_getattrcache_nfs_loadattrcache_nfs_getreq_nfsm_loadattrcache_tcp_respond_selwait_sys_lchown_xyc_startbuf_in_pcblookup_port_fdesc_quotactl_getnewbuf_sysctl_string_sys_getsockopt_ncr5380_pio_in_tcp_keepintvl_genfs_abortop_vndattach_kernel_text_OF_peer_cdclose_xdr_string_encode_clnp_echoreply_udpstat_semundo_adjust_cpu_exit_emul_netbsd_OF_seek_xyc_rqinit_uvm_page_init_sunos_sys_fstatfs_clnp_freefrags_lsi64854_pp_intr_ffs_vnodeop_p_nfsfifo_read_dead_lock_fifo_read_optionsnode_lebufprint_spp_fasttimo_tp_fasttimo_tcp_debug_inpcb_pool_msdosfs_remove_geteblk_domains_ns_zeronet_ienab_bis_magma_match_zsc_intr_soft_nfs_receive_clnp_route_vop_whiteout_vp_offsets_vop_islocked_vp_offsets_vop_read_vp_offsets_vop_setattr_vp_offsets_vop_getattr_vp_offsets_vop_mknod_vp_offsets_socketops_ktrsetchildren_sys___posix_chown_vop_create_desc_tp_send_tcp_close_ip_rtaddr_kernel_map_tcp_setpersist_vop_pathconf_desc_qematch_tcp_template_union_checkexp_rtstat_audiosetinfo_tsleep_nsphy_status_fd_motor_on_vn_isunder_seltrue_svr4_term_ioctl_OF_nextprop_mustek_set_params_cd_switch_cluster_callback_uvm_km_alloc1_vndiodone_union_vfsops_audioamd_sbus_ca_soo_poll_stread_sbus_translations_vmebus_translations_ufs_quotactl_clnp_ypocb_ip_allowsrcrt_mountroothook_disestablish_shutdownhook_disestablish_uvm_pagedeactivate_lfs_write_umap_inactive_portal_inactive_fifo_print_vn_writechk_allevents_vunmapbuf_vop_inactive_desc_vop_seek_desc_am7930_open_xdc_ca_sunos_sys_sigvec_scsipi_print_sense_data_xdattach_in_pcbbind_soreserve_sigprocmask1_genfs_badop_genfs_nullop_hypersparc_pure_vcache_flush_svr4_sys_mmap64_cpu_conf_nfs_readdir_nfsrvhashtbl_xdc_cd_ukclose_ch_ielem_mttyioctl_nfs_removeit_clnp_comp_pdu_ureadc_elf32_probe_funcs_nqnfsrv_vacated_ip_protox_igmp_leavegroup_msdosfs_rename_umap_vnodeop_p_portal_vnodeop_p_OF_set_symbol_lookup_cs4231_set_port_nat_stats_dead_lookup_sltioctl_vndioctl_ccdread_cltp_cksum_in_cksum_chrtoblk_strcat_dkcksum_pgofset_MD5Final_cpu_fork_portal_fhtovp_nmisync2_tp_indicate_hostnamelen___subdi3_netaddr_match_tp_freeref_rt_timer_timer_sunos_sys_sysconf_me_free_inphy_status_mfs_mount_uvm_meter_averunnable_svr4_sys_statvfs64_nmisync1_sowakeup_sys_fdatasync_cgthree_cd_uvm_page_physget_tpiso_abort_rt_missmsg_tk_cancc_tp_tselinuse_sys_quotactl_cache_enter_svr4_setcontext_ns_watch_output_rip_connect_cd9660_mount_svr4_sys_llseek_mmu_reservemon4_4c_ufs_unlock_rpc_msgdenied_clnp_reass_rwindow_save_zs_read_reg_union_diruncache_kmemlimit_ccdsize_intrhandffs.omoddi3.o_svr4_sys_fstat64_nfs_ispublicfh_in_rtchange_nullfs_init_reallochtonl.o_svr4_sys_getdents64_pmap_change_wiring_ufsspec_close_ap_proxies_clrbits_ttylopen_kthread_exit_vnddump_strcmp_zs_read_csr_nfsrv_commit_clnp_fragment_msdosfs_islocked_ev_fini_uvm_map_lookup_entry_nfs_access_sbinsertoob_ncr5380_reset_scsibus_genfs_ebadf_vop_bwrite_vp_offsets_vop_update_vp_offsets_vop_truncate_vp_offsets_vop_advlock_vp_offsets_vop_unlock_vp_offsets_vop_lock_vp_offsets_vop_write_vp_offsets_vop_access_vp_offsets_vop_create_vp_offsets_nswitchexit_pmap_enter4m_all_es_snpa_fr_auth_ioctl_union_unlock_union_freevp_umapfs_sync_ptsclose_sys_futimes_vn_close_ip_getmoptions_MPFail_soo_read_pool_drain_vop_abortop_desc_m_freem_chquirks_ipfr_fragstats_cpu_sysctl_exec_aout_prep_omagic_ad1848_commit_settings_am7930_commit_settings_deupdat_cs4231_trigger_input_nfsd_waiting_strchr_in_pcbrtentry_resetpriority_sys___fstat13_sys_setpriority_ad1848_set_params_isp_sbus_ca_callfree_ipfilter_cd9660_rrip_analyze_tcxpoll_mp_pause_cpus_xyc_startscanc.o_tcp_output_rt_maskedcopy_devwait_sosetopt_scsi_probedev_sys_listen_raster_op_noclip_bwtwopoll_sun4_cache_flush_dvma_cachealign_uvm_vnodeops_ipf_ftp_atoi_kernel_iopte_table_null_open_sys_lchmod_strlen_ch_usergetelemstatus_unp_bind_config_rootsearch_strcpy_pool_page_alloc_nointr_lfs_specop_p_ns_err_x_tp_attach_in_pcballoc_uniqdosname_cd9660_vnodeop_p_tickadj_tcp_optlen_unp_ino_time_phase_ad1848_get_rec_gain_ukphymatch_amap_alloc_tunctl_dos2unixfn_umap_open_nfs_null_nfs_readdirrpc_unix2dosfn_dosetrlimit_filehead_ether_sprintf_callout_svr4_sys_fstatvfs_si_dma_intr_timo_module_turbosparc_ktrcanset_vop_lookup_desc_verbose_debugrandom.o_si_vme_intr_off_ufs_ihash_slock_spp_ctloutput_idp_do_route_idp_ctloutput_tp_packetize_rclnp_ctloutput_clnp_ctloutput_tp_ctloutput_msdosfs_ihash_slock_cs4231_close_NspcbSize_idrp_input_fr_authstart_au_check_ports_cgsix_sbus_ca_ufs_checkpath_print_rbd_ie_obio_match_nfs_bmap_nfs_udpsock_route_usrreq_ppptioctl_pool_head_compat_43_sys_getkerninfo_isp_restart_nfsfifo_write_sl_compress_tcp_union_inactive_fifo_write_nfs_reclaim_idrp_init_enterpgrp_inferior_ipfilterattach_whichqs_stwrite_scsi_probe_busses_magma_hard_swread_tpin_abort_fr_icmptimeout_tickfix_ms_softc_bewatchdog_fr_auth_msdosfs_readdir_procfs_readdir_module_sun4_pfslowtimo_suword_waittime_qe_rint_mfs_vnodeop_p_nfs_open_freeclusterchain_filedescopen_mfs_vfsops_amap_copy_nfsrv_initcache_nfsrv3_access_ipfr_stats_dupfdopen_savacctp_sys_semconfig_sb_max_sunos_sys_nfssvc_svr4_sys_acl_pv_table_findchosen_vop_readdir_vp_offsets_vop_rmdir_vp_offsets_vop_mkdir_vp_offsets_vop_poll_vp_offsets_vop_ioctl_vp_offsets_mclpool_alloc_etherbroadcastaddr_compat_09_sys_setdomainname_compat_09_sys_getdomainname_fr_authstats_tprintf_close_pgsignal_ncr53c9x_scsi_reset_ienab_bis_4m_getpropstringA_nfs_getattr_nfs_searchdircache_spp_setpersist_nwindows_soft01intr_nfs_unmount_nullfs_unmount_socket_pool_cnpollc_dumpspec_plimit_pool_xbox_match_uvm_map_clip_start_igmp_joingroup_socreate_eintrcnt_mmu_pagein_ch_get_params_lfs_writevnodes_iso_ifaddr_fdunshare_fdshare_exec_aout_prep_nmagic_uvmexp_idp_droute_umap_lock_nqtimerhead_am7930_init_msdosfs_quotactl_procfs_quotactl_exec_elf32_makecmds_xyc_rqtopb_nfs_renameit_ppppktin_scsibusprint_mii_media_from_bmcr_mfs_reclaim_compat_43_sys_sigvec_ncr53c9x_msgin_pcache_flush_kdwrite_zs_set_speed_fragtbl8_nfs_readrpc_cttypoll_ktrwrite_schedclock_en_dumpmem_memreg_cd_cgtwogetcmap_fbconstty_nullcnpollc_uvm_amap_pool_fr_authused_cgfour_ca_svr4_esigcode_esigcode_st_mode_sense_pmap_extract_p_uvm_map_clip_end_nfssvc_iod_proc_reparent_compat_43_sys_recvfrom_vop_rename_desc_timerblurb_doclusterread_SppcbSize_tp_driver_dead_vnodeop_p_nfsv2_vnodeop_p_msdosfs_vfsops_svr4_sys_creat64_cs4231_get_props_vndbuf_pool_ns_setsockaddr_iso_recycle_tsuffix_in_recycle_tsuffix_tp_recycle_tsuffix_kernfs_access_pffindproto_ncr53c9x_debug_cgfour_cd_fpu_execute_cpu_spinup_audio_silence_copyout_sunos_sys_getrlimit_svr4_sys_getrlimit_nsintr_swtch_rn_delete_sys_getrlimit_compat_43_sys_getrlimit_sprintf_sunos_sys_auditsys_srmmu_vcache_flush_page_sun4_vcache_flush_page_fragtbl_ttpoll_ttyrub_sys_lkmnosys_sunos_sys_execve_pmap_writetext_igmp_timers_are_running_subyte_xdc_perror_ad_read_ip_forward_nullfs_mount_pppread_ad1848_set_rec_port_cgtwo_ca_ssopen_xyc_piodriver_rtredirect_audioattach_ad1848_set_mic_gain___xordi3_mtty_start_fd_dev_to_type_ufs_bmaparray_scsipi_inquire_tp_timerinit_cgtwo_cd_cgthreeclose_exphy_reset_lfs_reclaim_nfs_decode_args_nfs_fhtovp_bufqueues_lfs_match_dindir_union_mkwhiteout_uvm_pglistfree_lfs_fifoop_entries_ffs_fifoop_entries_tp_euntimeout_esis_ctlinput_nullfs_vget_cd9660_fifoop_entries_frflush_tcp_debx_genfs_fsync_stathz_isp_reset_strncasecmp_ss_switch_nfs_getauth_ipq_locked_fdesc_vnodeop_p_spec_vnodeop_p_pool_init_OF_interpret_XDC_DELAY_tcp_maxpersistidle_tunwrite_sysent_vop_poll_desc_ad1848_mixer_get_port_pool_get_nfs_defect_nqsrv_waitfor_expiry_lastdtime_vop_lease_vp_offsets_vop_vfree_vp_offsets_vop_revoke_vp_offsets_vop_close_vp_offsets_ptsopen_vn_open_srmmu_vcache_flush_context_sun4_vcache_flush_context_chiptotime_rtinit_unp_connect2_cd9660_tstamp_conv7_ttcompatsetflags_lfs_getattr_tcp_do_win_scale_rtfree_genfs_enoioctl_in_ifaddrhash_par_err_reg_lfs_unmount_genfs_nolock_fdcresult_power_reg_iommu_dmamap_sync_sys_minherit_nswitchdiff_fpu_newnan_scanjet_set_params_uvm_unmap_detach_nfs_close_nfsrv_readdirplus_nfs_doio_char_type_timetochip_lfs_balloc_cttyread_config_attach_nullcnprobe_xdopen_vprint_fdcretry_module_swift_proclists_cdstrategy_lfs_fhtovp_msdosfs_unlock_msdosfs_reclaim_procfs_reclaim_printf_sqphy_ca_sparc_vme4_dma_tag_nfs_boot_enbroadcast_tcp_syn_cache_intervalbcmp.o_MD5Init_native_sigset13_to_sigset_fr_tcp_age_fc_largedistance_kernfs_readdir_vfs_list_pcred_pool_time_maxerror_pool_putmul.o_scsi_change_def_nqnfsstarttime_ap_check_sqphy_cd_ch_patterns_ipl_frouteok_null_vnodeop_p_ttread_cpu_switch_b_to_q_sys___posix_lchown_svr4_sys_fxstat_sun4_dmamap_load_cd1400_write_reg_nqsrv_writeslack_anonportmin_portal_open_tprintf_open_qe_tint_lfs_seglock_nfs_boot_flushrt_idrp_isop_nullfs_root_vfs_busy_cd9660_symlink_aobj_pager_vfinddev_am7930_close_scanjet_compute_sizes_mustek_compute_sizes_ufs_dirremove_nfsrv_cleancache_nat_icmpinlookup_msdosfs_unmount_procfs_unmount_prom_node_has_property_pmap_is_referenced_p_amap_add_nqsrv_clockskew_clnp_newpkt_savefpstate_svr4_sys_sigprocmask_find_cpus_uvm_io_tty_pool_sys_undelete_compat_13_sys_sigprocmask_fb_pfour_get_video_magma_soft_uvmspace_fork_nfs_adv_fr_defnatage_tcp_rmx_rtt_anonportmax_raw_attach_clusteralloc_profhz_vop_print_desc_vn_lock_mclbytes_nfs_nget_routedomain_pgrp_pool_tk_nout_exec_sunos_aout_makecmds_cpu_exec_aout_makecmds_exec_aout_makecmds_obio_ca_iso_localifa_sl_uncompress_tcp_config_defer_cd9660_inactiveulmax.o___builtin_saveregs_ststart_nfs_connect_tp0_openflow_swap_syscall_lock_ad1848_set_speed_obio_cd_cd_scsibus_load_unload_mfs_vnodeop_entries_lfs_specop_entries_lfs_vnodeop_entries_ffs_specop_entries_ffs_vnodeop_entries_fifo_nfsv2nodeop_entries_spec_nfsv2nodeop_entries_nfsv2_vnodeop_entries_msdosfs_vnodeop_entries_union_vnodeop_entries_umap_vnodeop_entries_spec_vnodeop_entries_procfs_vnodeop_entries_portal_vnodeop_entries_null_vnodeop_entries_kernfs_vnodeop_entries_fifo_vnodeop_entries_fdesc_vnodeop_entries_dead_vnodeop_entries_ttyretype_nfs_init_cd9660_specop_entries_cd9660_vnodeop_entries_ad1848_query_encoding_am7930_query_encoding_initfpstate_scsipi_decode_sense_iso_ifinit_procfs_docmdline_extent_create_lfs_vnodeop_p_nfsrv_getstream_tunpoll_clusterfree_kernfs_vnodeop_p_fifo_vnodeop_p_au_portof_msdosfs_rmdir_nextvnodeid_am7930_get_propsxordi3.o_vop_blkatoff_vp_offsets_vop_pathconf_vp_offsets_vop_bmap_vp_offsets_vop_abortop_vp_offsets_vop_mmap_vp_offsets_vop_lookup_vp_offsets_cd9660_lookup_ncr53c9x_msgout_ncr53c9x_get_ecb_umap_fsynculmin.o_dumpsys_nfs_msg_tcp_drain_swapdev_vp_cd9660_fhtovp_dumpsize_bpf_filter_avail_start_kmem_map_zs_putc_nfs_pub_nchstats_itimerdecr_vmspace0_bitmask_snprintf_region_locked_nfs_commit_frcache_pfil_out_list_time_state_nfsrv_mkdir_ipfr_forget_portal_link_uvm_km_valloc_wait_clockfreq_lfs_segunlock_tcp_disconnect_procfs_statfs_kernfs_fhtovp_cd9660_tstamp_conv17_ccdstrategy_msf2lba_fd_motor_off_ufs_whiteout_audio_attach_mi_susword_stdump_ffs_init_tp_cuntimeout_process_read_regs_mustek_minphys_ip_defttl_au_set_gain_oldmon_w_trace_zsops_kbd_swift_hotfix_nfsrv_setcred_tcp_mss_ifmtu_tcp_init_in_setsockaddr_sysctl_rtable_unp_setsockaddr_vop_mkdir_desc___ashrdi3_procfs_start_nqfhhash_uvm_fault_unwire_nfs_hash_ns_copy_output_rttrash_domainname_vmcmd_map_zero_nfsrv_setattr_nfs_request_msdosfs_getattr_procfs_getattr_ncr53c9x_abort_bpfattach_vm_object_cached_slattach_stdone_mii_phy_auto_timeout_nfs_flush_tp0_stash_idrp_pcb_root_device_ffs_alloc_nfs_false_xdr_string_decode_rip_ctloutput_time_reftime_rqinit_compat_offseterr_deferred_config_queue_osrelease_strrchr_vndshutdown_ad1848_reset_lfs_supercallback_ffs_balloc_fr_checkstate_sunos_sys_quotactl_sunos_sys_setsockopt_cgeightclose_mbppclose_uvm_map_replace_lf_advlock_sys_setsockopt_pmap_extract4m_pmap_is_referenced4_4c_memreg_obio_ca_setpte4m_fdcpseudointr_ffs_fhtovp_tunread_kernfs_reclaim_vn_ioctl_ncallout_nfs_link_nfsrv_mknod_spp_usrreq_sp_vttoif_tab_sys_chroot_sys_getpid_ufs_readdir_nfssvc_nfsd_iso_systype_pool_inactive_time_fdcloseexec_avail_end_uvm_fault_numdquot_nfs_fsync_tp_ctimeout_MIN_domaininit_cd9660_ihashrem_ad1848_open_reserve_dumppages_amap_init_rt_ifmsg_pppstart_svr4_sysent_amap_free_tcp_drop_tcp_delacks_sys_getsid_scsipi_inqmatch_zs_write_reg_sppconsdebug_vop_reallocblks_vp_offsets_vop_valloc_vp_offsets_vop_inactive_vp_offsets_vop_remove_vp_offsets_vop_seek_vp_offsets_tty_inithtons.o_sunos_sys_setrlimit_svr4_sys_setrlimit_unavail_gap_end_fdc_reset_swwrite_sys_setrlimit_compat_43_sys_setrlimit_fr_tcpclosewait_kernfs_getattr_fr_stateunload_kernfs_unmount_dumpdev_nchrdev_procfs_sysctl_procfs_rw_mustek_get_params_file_pool_bwtwoopen_krpc_portmap_dump_inaddr_rcons_pctrl_OF_milliseconds_OF_instance_to_package_cgfourioctl_bt_putcmap_uvm_map_setup_umapfs_quotactl_kernfs_quotactl_sys_getuid_exec_script_makecmds_dumpmag_fd_do_eject_in_putnetaddr_tp_mask_to_num_ip_output_ppp_softc_socantsendmore_ttcompat_st_cmprss_lfs_segwrite_nfs_disconnect_snpac_logdefis_all_l2is_snpa_procfs_print_m_copyback_uvm_map_reserve_lfs_whiteout_nfs_savenickauth_autoconf_nzs_TPNagle2_st_check_eod_ch_getelemstatus_sys___sigprocmask14_uvmspace_init_xddump_icmp_send_ip_init_uvmspace_free_portal_init_union_vnodeop_p_TPNagle1_ip_optlen_uvn_attach_vop_rmdir_desc_audio_alloc_ring_ad1848_set_rec_gainimax.o_cypress_cache_flush_all_hypersparc_cache_flush_all_srmmu_cache_flush_all_ms1_cache_flush_all_esis_ishinput_in_ifscrub_sys_ftruncate_compat_43_sys_ftruncate_genfs_lease_check_lance_put_ippr_ftp_init_nullfs_sync_session0_ccdattach_clockintr_nfs_mkdir_union_dircache_genfs_poll_svr4_to_native_sigaction_uvm_swapout_threads_ttspeedtab_process_set_pc_uihashtbl_cd9660_blkatoff_clockreg_fr_authsize_xdc_piodriver_nfsv3_procid_arp_intimer_cd_scsibus_set_mode_cd1400_write_ccr_nfs_mmap_nfs_boot_cleanupimin.o_svr4_getcontext_pmap_pa_exists_nfs_advlock_esis_dl_vnd_softc_hypersparc_get_asyncflt_cypress_get_asyncflt_srmmu_get_asyncflt_svr4_fil_ioctl_be_mcreset_ffs_reclaim_mustek_read_si_get_uvm_pglistalloc_unpdg_recvspace_unpdg_sendspace_sb_lock_ttyout_compat_43_sys_getsockname_sys_getsockname_cd9660_ihashins_timer_mainbus_castrncmp.o_nfs_vgetashrdi3.o_xdc_rqinit_tcp_freeq_checkdirs_sys_madvise_svr4_sys_getdents_idpprintfs_procfs_vptofh_kinfo_vdebug_sys_getdents_ccdiodone_tlphy_ca_ttcompatsetlflags_scsi_probe_bus_dos2unixtime_m_copydata_sys_accept_strncpy_sunos_sys_omsync_svr4_sys_access_tp_sstring_fr_authpkts_arcbroadcastaddr_vop_print_vp_offsets_vop_open_vp_offsets_uvm_vnp_sync_sys_access_disk_init_revarpwhoarewe_nfs_reqq_tlphy_cd_rcons_scroll_zsops_null_icmp_error_ip_drain_amap_share_protect_ffs_unmount_tp_listeners_ip_freemoptions_sysctl_clockrate_pmap_changeprot4m_console_font_module_sun4c_amap_ref_iso_interfaces_disk_busy_isp_control_prom_vstart_ie_obio_attach_fb_pfour_set_video_keymap_release_uvmpagerops_nfs_mknod_eonprotoinit_cttyopen_nfs_removerpc_nfsrv_access_lfs_gatherblock_bswap64_pmap_map_fpu_add_ufs_reclaim_spp_disconnect_tp_intercepts_umapfs_fhtovp_m_reclaim_pmap_redzone_scsistrategy_ns_pcbbind_tcp_recvspace_tcp_sendspace_ifaof_ifpforaddr_ffs_vget_nfsrv_rmdir_max_hdr_union_create_vn_read_ptsread_stopen_st_patterns_sun4_hotfix_nuidhash_max_sbrelease_sys___getcwd_xbox_attach_xddkdriver_pmap_is_modified_p_mfs_pri_tcp_attach_raw_setsockaddr_lsi64854_attach_fdesc_vfsops_kernel_segtable_store_tp_netcmd_tcpcb_pool_msdosfs_start_initproc_nfs_root_union_symlink_ttycheckoutq_bwtwo_cd_ffs_isblock_portal_setattr_zombproc_st_erase_spp_template_ns_pexseq_in_putsufx_tcp_dooptions_ip_dooptions_union_lock_cd9660_ihashget_native_sigaction13_to_sigaction_compat_43_sigvec_to_sigaction_timerreg4m_speclisth_trapbase_zsc_intr_hard_has_iocache_uvm_page_physdump_lastddate_union_link_en_reset_bswap32_bswap16_xyattach_nfsrvhash_cd9660_node_pool_masterpaddr_zsops_tty_esis_holding_time_fr_defnaticmpage_pppopen_machine_suswintrntohl.oadddi3.o_sd_scsibus_match_cd_scsibus_match_spp_use_delack_null_inactive_rminit_soinit_setpgt4m_setuse_extendfile_sofree_rmfree_ktrsysret_nfs_readlink_nullmodem_uvmspace_exec_genfs_seek_memreg_mainbus_ca_auxreg_mainbus_ca_mmu_has_hole_nfs_bioread_raw_ctlinput_sysctl_rdstringumoddi3.o_svr4_sys_getmsg_srmmu_vcache_flush_region_sun4_vcache_flush_region_nqsrv_locklease_tp_consistency_icmp_input_tcp_input_config_detach_sys_dup_mainbus_space_tag_nfs_boot_init_idpcksum_vfs_mountedon_ie_vme_ca_snapshot_mmu_install_tables_ssstart_nfs_send_svr4_sys_open64_ie_obio_memcopyout_zs_loadchannelregs_xydump_psratio_prom_printf_module_cypress_vwakeup_mountnfs_native_to_svr4_sigaction_vm_first_phys__bus_dmamap_sync_ihashtbl_ip_freef_fpu_mul_zsread_map_forwmerge_ad_write_en_intr_svr4_sock_ioctl_pmap_release_scsibusclose_nfs_sndunlock_nfs_node_pool_portal_pathconf_unp_rights_fpu_div_tcp_notify_pppwrite_fdexpandiordi3.o_cd_size_nat_new_arpinit_done_pt_softc_vn_rdwr_bwtwo_obio_ca_xyc_reset_nfs_safedisconnect_raw_disconnect_rn_addmask_msdosfs_print_vgonel_sodisconnect_solisten_gsignal_nfs_rcvlock_idrp_recvspace_idrp_sendspace_fr_checkauth_umap_strategy_vfs_op_descs_compat_43_sigmask_to_sigset_fr_authnext_fillinusemap_ttywflush_lance_copytobuf_contig_igmp_input_raw_detach_portal_vget_sbwait_nfs_read_clnl_protox_nsqmaxlen_nfsd_head_qe_eint_portal_mount_ufs_getattr_eon_llinfo_union_mmap_uvm_vsunlock_icsphy_ca_child_return_uvm_page_physload_iso_ck_addr_strncmp_zs_getc_nfs_sigintr_nat_inlookup_tcp_mtudisc_ip_mtudisc_sys_getgid_iommu_dmamem_alloc_PStat_Junk_vn_poll_icsphy_cdntohs.o_SHA1Init_vfs_findname_svr4_elf32_probe_ether_input_pv_link4_4c_ufs_getlbns_uvm_useracc_iso_cmpnetaddr_tregion_uao_set_swslot_mfs_statfs_idrp_output_scanjet_set_window_mii_submatch_ufs_readlink_union_init_en_dump_vme_cd_setquota_lfs_newseg_untimeout_ffs_clrblock_rn_walktree_nselcoll_sys_pwritev_lfs_writesuper_lfs_imtime_procfs_domem_scsiprint_ffs_read_nfs_nameistart_cltp_usrreq_pmap_changeprot_p_uvm_coredump_ledma_ca_tcp_iss_seq_procfs_doctl_portal_root_nchinit_lkmenodev_inittodr_nfs_boot_setaddress_soqremque_ledma_cd_i7_nfs_create_sysctl_rdstruct_audioamd_cd_mtty_modem_control_cs4231_halt_input_lfs_writefile_vfs_shutdown_mclpool_release_xdwrite_TPNagled_soisconnected_svr4_sys_hrtsys_cd_play_esis_config_fr_tcpsum_msdosfs_advlock_clock_obio_ca_scanjet_ctl_read_zs_read_data_zs_write_csr_xdc_rqtopb__bus_dmamem_free_common_uvm_anon_lockloanpg_rip_disconnect_msdosfs_statfs_cttywrite_vcount_vrecyclerem.o_consdev_tty_esis_pcb_rip_recvspace_rip_sendspace_fdesc_readlink_unpst_recvspace_unpst_sendspace_ispscsicmd_viking_pcache_flush_line_srmmu_pcache_flush_line_idpstat_sys_msgrcv_vn_stat_mtty_param_nfs_lookitup_m_datalen_uvmspace_unshare_lfs_segclean_cgeightioctl_mbppioctl_pmap_copy_lf_setlock_tcp_pulloutofband_nullfs_start_initmsgbuf_pv_changepte4_4c_fb_setsize_eeprom_cpumatch_turbosparc_nfs_sync_tpip_mtu_procfs_domap_ttyprintf_lo_microtime_fc_bmapcalls_u0_fpu_shr_ap_match_ifmedia_init_svr4_sys_getrlimit64_lfs_create_nfs_mount_ptsstop_isp_uninitlmax.o_xyc_error_uvm_fault_wire_dma_sbus_ca_icsphyattach_nqsrv_cmpnam_lance_readcmpdi2.o_sdread_sys_msgsnd_openpromopen_tun_output_msdosfs_write_compat_43_sigset_to_sigmask_compat_43_sigaction_to_sigvec_pmap_is_modified4m_scsibussubmatch_lebufmatch_uvm_pglistalloc_npages_union_strategy_rootvp_vme_mainbus_ca_cg3_videoctrl_dump_isoaddr_ap_sess_tab_tunopen_tcp_canceltimers_vn_readdir_emul_sunos_pool_setlowat_lsi64854_resetlmin.o_xdcattach_svr4_sys_memcntl_bwtwommap_Dump_buf_uvm_vnp_terminate_nullioctl_ttioctl_scsibusmatch_nfs_prog_max_keylenmemmove.o_svr4_sys_msgsys_ffs_sync_all_is_snpa_MCFail_xyopen_xyc_unbusy_nfs_ticks_ip_optcopy_umapfs_unmount_cluster_rbuild_sdsize_ip_natin_rn_refines_msdosfs_sysctl_deadproc_kvm_iocache_sc_err1_esis_rdoutput_clock_cd_SHA1Final_scsi_scsipi_cmd_msdosfs_denode_pool_extent_print_vndsetcred_sqphyattach_tp_soisdisconnected_soisdisconnected_esis_init_ns_thishost_cs4231_malloc_spp_output_nsctlerrmap_ndflush_audio_calc_blksize_setjmp_cltp_recvspace_cltp_sendspace_pppintr_sys_readlink_copywords_vpage_pte_ip_mtudisc_timeout_q_sys_getrusage_lance_zerobuf_contig_sparc_interrupt4m_kd_input_keyboards_zsstop_qestop_uvm_map_create_tcp_slowtimo_ip_slowtimo_acctsuspend_ns_broadnet_vm_num_phys_zs_abort_nfs_sndlock_tcbtable_rt_timer_queue_destroy_vdevgone_vm_object_list_cd_play_tracks_ip_nhops_union_lookup_nsdomain_vn_bwrite_vop_default_desc_tlphymatch_numcache_doingcache_scsipi_print_sense_uvm_unloananon_union_fhtovp_vflush_srmmu_vcache_flush_segment_sun4_vcache_flush_segment_svr4_sys_sigaction_fdcstart_sobind_compat_12_sys_getdirentries_compat_43_sys_getdirentries_compat_13_sys_sigaction_sdminphys_fdgetdisklabel_xdgetdisklabel_ffs_mount_nfsrv_updatecache_fr_tcplastack_pmap_count_ptes_vop_vfree_desc_cd9660_mountroot_vndgetdisklabel_bwtwoclose_lfs_inode_pool_ffs_inode_pool_pk_flowcontrol_union_pathconf_umap_node_hash_fdesc_sync_evcnt_detach_kill_vmcmds_qsphyattach_ie_vme_attach_unputc_compat_43_sys_killpg_lsi64854_setup_qec_init_pmap_virtual_space_nfs_true_tp_estring_arpresolve_auxreg_obio_ca_map_backmerge_nfs_dirhash_sbappendrecord_mountlist_dmaprint_sbus_fdattach_tp_headersize_clnlintr_arpintr_msdosfs_readlink_procfs_readlink_mainbus_ca_svr4_sys_kill_xdc_cmd_syn_hash1_compat_12_sys_stat_sys_kill_vop_read_desc_ncr53c9x_reselect_svr4_sys_lxstat_uvm_kernacc_syn_hash2_union_mkshadow_bufhashtbl_sunos_sys_getdents_pv_syncflags4_4c_nfs_nhinit_msdosfs_vptofh_memmove_disk_find_mainbus_cd_pmatch_fpu_explode_nfs_renamerpc_nfsv2_procid_tcp_do_timestamps_union_bmap_sys_fchdir_wakeup_mclpool_cgfourclose_st_rdpos_amap_pp_adjref_rootfs_vfs_export_lookup_cgsix_use_rasterconsole_isis_output_vclean_copyright_nqsrv_maxnumlease_m_copypacket_atm_input_uvm_anon_init_bpf_validate_disk_unbusy_tpclnp_ctlinput1_portal_sync_hw_sysctl_audio_mmap_audio_blk_ms_tcx_ca_union_open_sys_munmap_nblkdev_ad1848_mute_monitor_quotaon_tcp_backoff_procfs_close_vsnprintf_timedelta_zstty_ca_hz_rpc_vers_tp_rtt_rtv_sys_link_tcx_cd_mtty_match_fpu_init_amap_unref_nfs_timer_iso_putnetaddr_fr_delgroup_ifqmaxlen_fpu_ftoi_ufs_root_udp_output_unp_disconnect_sys_msgget_zstty_cd_be_tick_fdcstate_lfs_fakebuf_pool_reclaim_svr4_sys_nice_dqflush_lfs_fifoop_opv_desc_ffs_fifoop_opv_desc_zeroiso_addr_bpf_tap_sys_fchown_cd9660_fifoop_opv_desc_fpu_ftod_scsipi_get_xs_prom_findroot_memname_ttywait_qec_ca__bus_dmamap_create_mask_rnhead_segm_locked_getphysbuf_nmi_soft_kernel_pagtable_store_kernel_regtable_store_ffs_blkfree_numnfsrvcache_zerons_addr_pool_destroy_qec_cd_sunos_sys_sigpending_svr4_sys_sigpending_uvm_pageunwire_killpg1_compat_13_sys_sigpending_zs_set_modes_nfs_rephead_nfsm_reqh_fdesc_symlink_lockmgr_mii_anar_audio_open_native_to_svr4_sigset_cgsixioctl_sd_reassign_blocks_procfs_findtextvp_svr4_sys_setrlimit64_uvm_pagezero_uvm_pagealloc_strat_amap_extend_kern_targets_be_internal_phy_auto_leattach_lebuffer_consdev_prom_viking_hotfix_procfs_control_vfs_opv_init_explicit_soshutdown_slopen_sys_shutdown_exphy_ca_magma_attach_vfs_attach_sys_ktrace__main.o_fpu_norm_uvm_pagermapin_cd9660_access_fpu_ftox_nqnfs_piggy_ns_pcbdisconnect_iso_pcbdisconnect_blank_siso_in_pcbdisconnect_mountcompatnames_nmountcompatnames_exphy_cd_ienab_bic_4_4c_sparc_vme_chipset_tag_ffs_vfree_esis_recvspace_esis_sendspace_udp_init_raw_recvspace_raw_sendspace_initclocks_cd9660_strategy_sbus_mainbus_ca_clock_mainbus_ca_rcons_doesc_srmmu_restore_prom_ctx_fpu_dtof_cgtwopoll_statvar_ns_hostmask_fdfinish_nfsrv_readdir_TPNagleok_cd9660_start_cd_reset_pppdealloc_scanjet_attach_scsibusioctl_xdc_tick_invalhash_logopen_qs_sunos_sys_access_altbootdev_swapdev_iso_gen_csum_fr_authunload_lance_stop_kernel_object_fpu_ftos_xyc_submit_iorq_cpu_coredump_sys_msgctl_mmclose_rom_console_input_uvm_anon_dropswap_nfs_vinvalbuf_winSlotCnt_sys_symlink_uvm_init_limits_nfs_setattr_free_msghdrs_svr4_sys_mmap_stioctl_ufs_makeinode_ns_iaonnetof_sys_mmap_sys_exit_lfs_newbuf_ffs_mountroot_nfs_mountroot_in_interfaces_time_status_vfs_mountroot_am7990_start_chkdqchg_nfsrv_pathconf_nfsrv_write_fr_state_ioctl_ad1848_halt_input_cgthree_sbus_ca_compat_43_sigstack_to_sigaltstack_native_sigaltstack13_to_sigaltstack_uvm_anfree_lfs_callback_pfil_add_hook_curpriority_magma_ca_fusword_sw_2_leftover_ufs_advlock_nfs_lookup_clnp_hexp_fdesc_vget_pv_syncflags4m_nonidempotent_rpc_msgaccepted_copyinstr_spp_recvspace_spp_sendspace_idp_recvspace_idp_sendspace_tp_recvspace_tp_sendspace_clnp_init_udp_recvspace_udp_sendspace_magma_cd_nfsrv_fsinfo_rt_timer_add_sonewconn1_checkalias_lance_copyfrombuf_contig_sdlock_cs4231match_fdhashtbl_in_pcbnotifyall_pollscan_cpu_reboot_pool_page_free_nointr_ncr53c9x_reset_pmap_init_lfs_allclean_wakeup_tcp_mssdflt_lastday_ncr53c9x_attach_xyc_ca_SHA1Update_pmap_destroy_nfs_reply_umap_bwrite_xbox_ca_ffs_truncate_nfs_truncate_iso_ifscrub_rip_usrreq_ptcopen_memerr4_4c_xyc_cd_svr4_sys_open_clean_inlocked_nqnfs_clientd_nfs_boot_sobind_ipport_tpiso_decbit_clnp_dooptions_pool_sethiwat_sys_open_uvm_map_loopattach_xbox_cd_desiredvnodes_kdioctl_sys_mprotect_audiommap_svr4_sys_facl_sun4_dmamem_alloc_cdminphys_xygetdisklabel_tp_mss_setdisklabel_lematch_lebuffer_if_index_cd9660_pathconf_cd9660_print_svr4_sys_fstatvfs64_nqsrv_addhost_union_removed_upper_sw_0_leftover_igmp_sendpkt_pgfind_disksort_ufs_dirbadentry_nfs_boot_ifupdown_tpiso_reset_tcp_init_win_null_strategy_cpu_initclocks_sys_fork_audioamd_mainbus_ca_semmap__insque_st_mode_select_limfree_statclock_vfs_export_atm_ifattach_fb_unblank_am7930swintr_soisconnecting_free_msgmaps_time_esterror_reaper_clnp_slowtimo_in_socktrim_fdesc_root_fddkdriver_module_viking_soaccept_nfs_rmdir_fdesc_poll_tty_count_bpf_mtap_st_mount_tape_ch_get_quirks_lxtphymatch_uvm_unmap_lfs_dostats_icmp_reflect_lkmopen_sys_fchmod_utsname_nmbclusters_ttypend_microtime_vop_advlock_desc_known_is_tcp_reass_sbreserve_configure_audioopen_sys_bind_ncr53c9x_scsi_cmd_cd_pause_ns_interfaces_mmuregions_uvm_pagewire_msdosfs_close_union_updatevp_sbcreatecontrol_sysctl_int_zeropage_union_newsize_nfsm_srvwcc_tcp_keepidle_tunioctl_slpque_le_obio_ca_fixalign_zsopen_clnp_output_ipf_cksum_iommu_ca_st_read_block_limits_uvm_vmspace_pool_dead_strategy_sys_statfs_mfs_vnodeop_opv_desc_lfs_specop_opv_desc_lfs_vnodeop_opv_desc_ffs_specop_opv_desc_ffs_vnodeop_opv_desc_fifo_nfsv2nodeop_opv_desc_spec_nfsv2nodeop_opv_desc_nfsv2_vnodeop_opv_desc_msdosfs_vnodeop_opv_desc_union_vnodeop_opv_desc_umapfs_vnodeop_opv_desc_procfs_vnodeop_opv_desc_portal_vnodeop_opv_desc_null_vnodeop_opv_desc_kernfs_vnodeop_opv_desc_fdesc_vnodeop_opv_desc_spec_vnodeop_opv_desc_fifo_vnodeop_opv_desc_dead_vnodeop_opv_desc_pfslowtimo_now_cd9660_specop_opv_desc_cd9660_vnodeop_opv_desc_lfs_init_iommu_cd_pool_create_mem_access_fault_sbus_attach_iommu_xbox_print_arp_inuse_max_datalen_lockmgr_printinfo_sys_acct_ignore_bogus_trapssubdi3.o_am7930_set_port_inphymatch_amap_unadd_sl_compress_init_union_sync_svr4_add_socket_clnp_ours_m_pullup_Lfsbail_clk_wenable_nfsrv_getattr_msdosfs_setattr_unix2winfn_procfs_setattr_st_unmount_nfs_enterdircache_recvit_sendit_sparc_noop_clnp_badmtu_ktrnamei_profprocs_ssclose_scsipi_free_xs_unixsw_nfsrv_rcv_nfs_iodmount_in_cmpnetaddr_rn_insert_kernfs_lookup_pppclose_uihash_sys___getlogin_ncr53c9x_sense_pmap_activate_eonrtrequest_tk_rawcc_ad1848_close_fdc_mainbus_ca_zs_mainbus_ca_uvm_map_findspace_fdesc_read_sddump_nqnfs_serverd_nqnfs_getlease_portal_readdir_pool_prime_maxdmap_ncr53c9x_sched_pmap_create_in_ifaddrhashtbl_ifafree_if_slowtimo_sys_getpgid_i82586_mediastatus_svr4_stream_ioctl_nqnfs_vacated_secopt_syn_cache_add_compat_43_sys_accept_leattach_ledma_sys_dup2_auxreg_cd_ie_memcopyout_ncvhash_sys_truncate_xdcintr_random_kbd_max_type_tcp_trace_si_vme_dma_eop_sddone_fdctimeout_fdc_debug_xdc_e2str_lfs_fastvget_tp_etimeout_insmntque_limcopy_ncr5380_cmd_timeout_ether_delmulti_st_loadquirks_msdosfs_mountroot_sbdrop_shm_nused_sys___sysctl_scsipi_dtype_nfsrv_wakenfsd_nfs_writerpc_count_lock_queue_vprintf_vop_close_desc_psignal_m_free_am7930_halt_input_qe_ca_native_to_svr4_sigaltstack_nqnfs_callback_pppalloc_chainalloc_scsipi_xfer_pool_tcp_cwm_burstsize_bpf_dtab_rtioctl_am7930_start_output_iommu_sc_nfs_numasync_idp_output_syn_cache_get_procfs_allocvp_qe_cd_zs_cd_tp_bound_pcbs_rcons_clear2eop_segm_freelist_ukopen_lfs_link_umap_bypass_lf_wakelock_sigaction1_espattach_dma_sdebug_scanjet_read_prom_findnode_nfsrv_create_igmp_slowtimo_useloopback_ncr53c9x_dequeue_bwtwoioctl_stmatch_nat_list_rn_init_doasyncfree_ns_pcballoc_suser_lfs_truncate_fdesc_init_unp_gc_uvn_sync_lock_union_read_sogetopt_sys_sstk_vop_unlock_desc_pfil_in_list_kbdopen_iso_putsufx_cd9660_lock_ncr53c9x_timeout_svr4_sys_lstat64_sdgetdisklabel_cdgetdisklabel_xyc_perror_pager_map_wanted_ips_table_procfs_vget_uvm_sysctl_cd9660_defattr_readdisklabel_lance_init_memerr4m_ns_control_tp_detach_vop_revoke_desc_cd9660_link_ncr53c9x_free_ecb_uk_atapibus_ca_ukphyattach_xdc_remove_iorq_clnp_opt_sanity_compat_43_sys_getdtablesize_svr4_sys_sysconfig_rcons_clear2eol_xdclose_nfs_bwrite_isodomain_vop_open_desc_pmap_changeprot4_4c_fpu_itof_esis_usrreq_vop_reallocblks_desc_uvm_swapin_sys_sendmsg_sys_recvmsg_esp_obio_ca_qeintr_vmesearch_revarprequest_sys_lutimes_ns_printhost_tp_getoptions_ip_stripoptions_union_newupper_vfs_opv_numops_tlphy_acomp_be_ifmedia_upd_tp_ref_tp_soisdisconnecting_fr_ipfrttl_in_localaddr_soisdisconnecting_nfree_msgmaps_pcmcomcf_locnames_pcmciacf_locnames_vmecf_locnames_miicf_locnames_xdr_inaddr_decode_ns_rtchange_ip_natout_union_seek_nlinesw_sys_getpgrp_vop_readlink_desc_vop_strategy_desc_killproc_sys___lstat13_sys_sync_tpclnp_output_dg_iso_addrmatch1_route_src_disk_count_xycmatch_promops_ufs_bmap_dofilewritev_statmin_tcp_mss_to_advertise_tcp_syn_cache_syscallqdivrem.o_chattach_nat_icmpin_ip_reass_union_vget_kernfs_setattr_semtot_be_ifmedia_sts_uvm_pagefree_ffs_blkpref_OF_test_method_umap_node_hashtbl_null_node_hashtbl_sosend_sys_profil_getinoquota_iso_nlctloutput_readde_elf32_check_header_qeinit_ufs_open_pcbmap_procfs_dofpregs_uvm_pageremove_uvm_swap_get_lfs_bwrite_emul_netbsd_elf32_ncr53c9x_variant_names_pv_changepte4m_tcp_saveti_uvm_pageactivate_umap_reclaim_procfs_root_portal_reclaim_mbtypes_cs4231_round_blocksize_nfs_clearcommit_ad1848_round_blocksize_am7930_round_blocksize_lfs_vget_rootspec_qewatchdog_iso_rtchange_union_vn_create_cluster_wbuild_tcp_totbackoff_umap_print_ttstart_exec_aout_prep_zmagic_getdevunit__bus_dmamap_destroy_fdesc_link_softclock_audio_initbufs_nullfs_vfsops_si_vme_intr_on_ssmatch_mfs_bmap_nfs_start_nqsrv_send_eviction_N_TPREF_ifmedia_match_sparc_vme_bus_tag_tp_getref_ktrgetheader_vinvalbuf_sbus_attach_common_umap_getattr_portal_getattr_time_precision_cd9660_mmap_lance_reset_am7990_intr_xyread_uvmcnt_dump_nfs_fsinfo_spp_iss_msdosfs_mkdir_readep_portal_unmount_pffindtype_addupc_intr_ncr5380_scsi_cmd_sd_cd_sparc_interrupt44c_vpage_am7930attach_mainbus_sbus_attach_mainbus_fdcattach_mainbus_uvm_swap_put_dqhashtbl_nfs_checkexp_tp_ltrace_msdosfs_vget_nullfs_checkexp_cd9660_deftstamp_uvmspace_alloc_bpf_iflist_bpfopen_null_node_hash_vn_write_ptswrite_cgtwoopen_mfs_open_leapyear_ttyopen_sunos_sys_execv_cpu_hatched_doclusterwrite_msdosfs_update_union_root_fifo_lookup_rcons_delline_cs4231_trigger_output_qsync_nfsrvw_sort_clnp_stat_sl_uncompress_tcp_core_ppp_restartudiv.o_sunos_emul_path_zs_break_sysctl_dumpentry_loioctl_union_poll_svr4_sys_stat_xdstrategy_iommu_dma_tag_uvm_map_extract_esis_stat_cd9660_init_physio_audio_rint_proc0paddr_chkvnlock_uk_cd_lemediastatus_lfs_clean_vnhead_nfs_vfs_init_pfil_remove_hook_ptcread_elf32_read_from_lance_mediastatus_svr4_netopen_sdopen_fifo_printinfo_sigpending1_i82586_reset_lxtphy_ca_xldcontrolbidle_xysize_desirednfsrvcache_tpip_output_dg_iso_pcballoc_vrele_ad1848_attach_xdc_submit_iorq_atmresolve_procfs_access_proc0_lfs_cleaner_pid_tpiso_quench_procfs_validregs_compat_10_sys_msgsys_lxtphy_cd___qdivrem_scsipi_wait_drain_spec_print_soconnect2_swift_mmu_enable_ip_pcbopts_in_delmulti_npmemarr_am7930match_mainbus_uvm_aobj_pool_lfs_mountroot_esis_rdinput_unix2dostime_bufhash_semu_list_rpc_call_nfsrv_errmap_ns_echo_clnp_saddr_isop_null_node_create_vop_lease_desc_qzero_sunos_sys_creat_svr4_sys_sigaltstack_svr4_to_native_sigaltstack_am7930_sparc_w16_nsphyattach_clnp_er_index_msdosfs_mknod_ruadd_compat_13_sys_sigaltstack_fpu_sqrt_mono_time_audio_poll_m_retryhdr_kdstop_dqinit_tpclnp_output_rclnp_output_svr4_delete_socket__bus_dmamem_alloc_common_pmap_page_protect_p_nfs_print_msdosfs_root_uprintf_si_ca_tp_isopcb_union_copyup_vmcmd_map_pagedvn_want_ast_fpu_stof_cgsixclose_uvm_unloanpage_uvm_pagecopy_pppinput_audio_pint_svr4_setregs_mustek_get_status_fdcstatus_umap_reverse_findid_si_cd_svr4_sigcode_sdunlock_getcacheinfo_sun4c_cluster_write_cttyioctl_ptyioctl_ttybg_sys_getppid_sunos_sys_mknod_spec_nfsv2nodeop_p_fifo_nfsv2nodeop_p_union_islocked_genfs_noislocked_ktradref_swapbuf_pool_amap_lookup_iso_snparesolve_maxproc_ie_obio_write16_lfs_shellsort_clnlintrq_bufinit_ncr5380_wait_nrq_timo_arpintrq_esp_cd_dumplo_xdmatch_vm_nphysseg_ufs_setattrumul.o_logpoll_sys_mlock_sys_adjtime_kmembase_nqsrv_maxlease_mountroot_compat_12_sys_fstat_isohashtbl_fscale_ie_obio_write24_procfs_mount_sys_fsync_qec_meminit_ufsfifo_close_nfsrv3_procs_nfs_rcvunlock_audio_ioctl_startprofclock_svr4_sys_wait_ktrgenio_ufs_dirrewrite_rip_bind_issignal_mbinit_nfsrv_writegather_nl_protosw_udbtable_rn_mkfreelist_fdesc_open_cachestats_si_vme_dma_setup_stclose_powerdown_sys_preadv_vop_islocked_desc_atacf_locnames_obiocf_locnames_atapicf_locnames_uvm_km_init_spp_slowtimo_tp_slowtimo_minphys_fdformat_dqhash_mfs_doio_uvm_km_free_sys_sbrk_audio_check_params_audiostartp_svr4_sys_utssys_sa_hw_if_lfs_read_bpf_setf_sys_clock_gettime_audio_drain_nfs_remove_rn_lookup_ttyin_indent_audiostartr_pmap_is_modified4_4c_allocsys_sqphymatch_pmap_clear_modify_p_mountroothook_list_malloc_process_write_regs_sys___sigsuspend14_qsphy_ca_viking_mmu_enable_audio_read_rcons_text_pmap_dumpmmu_getpropstring_uvm_cnt_head_ufs_init_machine_arch_ptcpoll_uao_create_pool_head_slock_nfiles_qsphy_cd_sunos_sys_ioctl_mii_tick_iso_nchstats_en_sbus_ca_svr4_sys_execv_wzero_cd_scsibus_setvol_mbppwrite_fdcswintr_tp_rsyflush_if_qflush_msdosfs_read_union_access_sys_poll_xyc_chain_ippr_ftp_pasvmsg_portal_quotactl_fdesc_lookup_pgrphash_config_init_cd9660_fifoop_pmemcpy.o_si_find_incore_route_dst_procfs_sync_procfs_donote_maxlockdepth_cgsix_cd_kernel_regmap_store_kdclose_uvm_map_call_ips_stats_eonctlinput_sys_mkdir_tcp_new_iss_ipsendredirects_sloutput_sunos_esigcode_ssioctl_cdunlock_uvm_page_rehash_lfs_writeseg_nfsrvw_procrastinate_device_register_va_null_domountroothook_ifmedia_ioctl_fubyte_svr4_sys_vhangup_prom_vend_zdmap_mbpp_attach_nfs_rename_unp_attach_logread_sys_setreuid_memset_svr4_sys_putmsg_cs4231_get_port_lfs_remove_ufs_access_nfsrv_lookup_pppioctl_uvm_vnp_setsize_isp_async_svr4_setmcontext_fd_set_motor_ttyinfo_ttyoutput_lfs_vref_nfsspec_write_esis_input_null_unlock_nclruhead_spec_write_ukphy_ca_sw_options_ie_obio_memcopyin_vfs_unbusy_svr4_sys_pwrite_mfs_init_ptsstart_ttylist_v_putc_sys_pwrite_svr4_ustat_si_free_tcp_do_sack_ttyfree_ncr5380_wait_req_timo_ukphy_cd_swbuf_svr4_sys_creat_sbus_attach_xbox_clnp_forward_addupc_task_msgbufmapped_zstty_rbuf_lowat_tp_start_win_ttwrite_sys___posix_rename_audiopoll_longjmp_fdesc_start_raw_usrreq_lance_config_viking_memerr_nfs_write_tpip_output_dqfreelist_procfs_fhtovp_log_open_svr4_sys_time_si_obio_dma_setup_ifunit_wskbddevcf_locnames_wsemuldisplaydevcf_locnames_xy_casdiv.o_ipfr_nattab_tundebug_svr4_sys_mknod_cs4231attach_lfs_rename_uvm_km_suballoc_compat_43_sys_sigsetmask_sys_mknod_cd9660_bmap_lfs_writeinode_tcbhashsize_ipqent_pool_tunclose_bpfread_umap_mapids_compat_43_sys_truncate_ifmedia_set_xy_cd_sunos_sendsig_uvm_swap_alloc_chkiqchg_ufs_lock_svr4_sys_break_pmap_enu4_4c_lfs_sync_traceallspps_ippr_ftp_out_thread_sleep_msg_sys_pipe_cd9660_statfs_fb_pfour_id_kvm_uncache_iszerodev_ufs_link_dounmount_vfs_getopsbyname_sys_read_ether_ipmulticast_min_nmi_hard_mfs_mountroot_ns_init_procfs_doregs_disklist_acctwatch_am7930_device_uvm_pagermapout_elf32_load_file_ch_switch_kbdpoll_pmap_alloc_cpu_clnp_er_input_tcp_template_pool_rip_init_ifa_ifwithnet_sunos_sysent_pmap_zero_page_p_vm_physmem_clnp_discard_tty_attach_setrunqueue_rcons_delchar_kdread_zstty_rbuf_hiwat_tcp_newtcpcb_sunos_sys_statfs_ufs_vinit_nfs_inactive_tpin_quench_ktrsyscall_vop_remove_desc_ether_ipmulticast_max_module_ms2_msdosfs_sync_ktrderef_kernel_segmap_store_cd9660_rrip_getname_OF_setprop_tp_rsyset_compat_12_sys_swapon_zs_major_module_ms1_uvm_mlk_call_frstats_sockargs_tprintf_dmaattach_sbus_cd9660_islocked_audio_fill_silence_xdioctl_tcp_do_newreno_arpioctl_portal_lookup_lf_getlock_bwrite_au_get_port_si_vme_dma_start_idrp_usrreq_sys_writev_si_head_fdesc_print_audioread_svr4_sys_fstat_scsipi_strvis_nfsrv_null_xdr_inaddr_encode_ns_pcblookup_vfs_getuserstr_portal_start_memcpy_fbrcons_rows_ns_lastout_tp_confirm_msdosfs_mount_linear16_to_linear8_svr4_sys_ioctl_am7930_query_devinfo_cs4231_query_devinfo_xyc_remove_iorq_ipl_unreach_kmeminit_sys_ioctl_isodirino_st_space_ie_vme_read16_nqnfs_clientlease_nat_instances_union_quotactl_procinit_uvm_init_ffs_write_spp_quench_consintr_sys___msync13_esp_dma_ca_kbd_stringtab_clnp_drain_boottime_elf32_copyargs_en_dma_cgeight_ca_mbpp_ca_pmap_clear_modify4m_qe_ifmedia_upd_uvm_grow_xdccf_locnames_scsicf_locnames_zscf_locnames_fdesc_readdir_cd9660_sysctl_sunos_sys_mount_scanjet_ctl_write_ns_err_input_cgeight_cd_mbpp_cdsuiwordstrcat.o_ch_position_sbus_match_iommu_cs4231_open_ifnet_addrs_sys_getegid_ss_ca_uvm_mk_pcluster_ufs_mmap_rpc_reply_syn_cache_insert_ifioctl_extent_alloc_subregion1_sys___sigaltstack14udivdi3.o_makememarr_uvm_dump_lfs_writeindir_ap_sess_list_procfs_bmap_lkmexists_vop_truncate_desc_i82586_mediachange_cgthreemmap_kbdread_all_l1is_snpa_raw_input_ptcclose_ss_cd_cputyp_native_sigaltstack_to_sigaltstack13_qe_ifmedia_sts_idprom_OF_call_method_1_bootpath_fr_tcpidletimeout_fdesc_checkexp_m_devget_ncr53c9x_dmaselect_zstty_ffs_blkatoff_dump_addr_pppoutput_sys_ptrace_svr4_stream_ti_ioctl_tlphy_auto_tpclnp_input_consinit_rcons_puts_emulinstr_procfs_open_hashinit_xd_ca_ffs_cgupdate_bpfpoll_ifmedia_add_fpu_xtof_sun_noname_ttrstrt_ufs_fhtovp_tp_drain_sbcompress_sleep_sys_setregid_selwakeup_xd_cd_virtual_avail_clnp_er_codes_tcp_syn_bucket_limit_ifa_ifwithroute_pmap_enu4m_tcp_ctlinput_deextend_allocbuf_runtime_i82586_watchdog_ch_move_ldcontrolb_route_proto_updatefats_portal_print_probeset_sunos_sys_vhangup_pmap_enter4_4c_am7930attach_sbus_espattach_sbus_uvmfault_anonget_spp_do_persist_panics_ipforward_rt_rtalloc_process_write_fpregs_nfs_vfsops_cgtwommap_mbpp_rw_svr4_getmcontext_si_obio_dma_start_uvm_pageboot_alloc_ns_output_cpu_set_kpc_xdc_reset_nfsrtton_inetsw_rt_newaddrmsg_union_ioctl_m_prepend_i82586_proberam_strayintr_st_setpos_cd_read_toc_total_pmap_clear_reference_p_uvm_mlk_hint_uvm_loan_nfsm_uiotombuf_bufferssuibyte_iskmemdev_fdesc_targets_dofilereadv_compat_43_sys_getpagesize_intrcnt_svr4_sys_pwrite64_iommu_dmamem_free_idp_forward_cd9660_vptofh_audioioctl_mmu_3l_ufs_ihashinit_realitexpire_cgfourteenclose_xymatch_nfsm_rpchead_procfs_validfile_st_ca_svr4_sys_xmknod_nfsrv_link_rip_output_vn_closefile_exec_elf_setup_stack_exec_aout_setup_stack_cs4231_round_buffersize_wcopy_iommu_print_compat_12_sys_lstat_sdwrite_tcp_now_vop_whiteout_desc_vop_mknod_desc_vaccess_st_cd_pmemarr_dvmamap24_in_pcbstate_rt_setgate_cpumatch_unknown_iso_check_csum_clnp_frags_in_canforward_rawcb_uk_switch_uvm_map_init_ffs_reload_en_attach_lfs_vfsops_pgshift_msdosfs_access_reinsert_memchr_maxsmap_uvm_vslock_ad1848_mixer_set_port_stackgap_alloc_spp_usrreq_tpcons_output_msdosfs_bmap_sw_ca_union_lease_fdesc_write_lkmclose_amd7930_trap_tcxioctl_sbus_match_mainbus_fdcmatch_mainbus_cache_revlookup_nchash_sw_cd_TNew_umap_node_create_kbd_ca_svr4_sys_fpathconf_pmap_clear_modify4_4c_romgetcursoraddr_spp_input_soo_ioctl_sys_fpathconf_fix_incksum_msdosfs_open___moddi3_union_advlock_acctchkfreq_spec_lookup_memcmp_cgsix_obio_ca_kbd_cd_lfs_no_inactive_nfsrv_noop_win2unixfn_sbus_cd_turbosparc_get_syncflt_ms1_get_syncflt_viking_get_syncflt_hypersparc_get_syncflt_srmmu_get_syncflt_sunos_sys_lstat_trap_type_icsphy_reset_qe_mcreset_uvm_pager_init_tcp_cwm_fdesc_reclaim_cdwrite_fixtick_vgone_cd9660_check_export_udp_sysctl_setregs_sigcode_segm_lru_qereset_cp_time_sys_mount_leattach_sbus_uvm_map_entry_pool_tp_rttadd_ptcwakeup_sys_nosys_pgrp0_cgeightopen_mbppopen_ufs_rmdir_iso_getsufx_null_bwrite_ticks_ether_addmultianddi3.o_svr4_sys_stat64_compat_12_sys_msync_genfs_revoke_cd9660_sync_want_reschedstrchr.o_sbusreset_mii_phy_probe_isis_input_igmpstat_rcons_cnputc_ie_memcopyin_emul_svr4_uvm_mmap_spp_hardnosed_slioctl_bpfioctl_msdosfs_checkexp_fc_lfcempty_procfs_checkexp_fdesc_unmount_uvm_exit_cache_purgevfs_itimerfix_shmsegs_svr4_sys_utimes_pmap_rmk4_4c_nfsrv_zapsock_nv2tov_type_udp_input_sys_utimes_ffs_fragacct_ESHonly_uvm_unmap_remove_ipqmaxlen_compat_43_sys_sendmsg_compat_43_sys_recvmsg_cd9660_quotactl_ncr53c9x_done_pmap_protect_p_tcp_timers_fdesc_inactive_unp_connect_sys___stat13_setroot_autonicetime_lfs_match_tindir_ns_pcbnotify_tp_rttdiv_ipl_inited_semundo_clear_pfind_sbuscf_locnames_pcmciabuscf_locnames_xyccf_locnames_scsibuscf_locnames_atapibuscf_locnames_pcibuscf_locnames_cs4231_init_inside_udp_ctlinput_unixdomain_ktrpsig_qcopy_cs4231_free_createde_fdavail_probe_switch_dqsync_nfsrv_init_clnp_set_opts_cd9660_specop_p_if_attach_am7930_getdev_kernfs_vfsops_lemediachange_uvm_map_reference_udp_usrreq_fdinit1_lance_mediachange_power_ca_probeget_cache_print_mem_no_hypersparc_mmu_enable_ms1_mmu_enable_nfs_setattrrpc_sys_unmount_vop_bmap_desc_ccdioctl_power_cd_uvm_map_inherit_lfs_blkatoff_procfs_init_sbus_sc_lfs_close_ns_errstat_fr_checkp_sysctl_iflist_compat_43_sys_getpeername_sys_getpeername_compat_43_sys_creat_stopprofclock_sys_getfh_ulmin_svr4_to_native_sig_keymap_s4_uc_bestart_rn_search_m_no_asyncflt_regs_svr4_emul_path_cd1400_compute_baud_mfs_inactive_ufs_inactive_union_mount_qsphy_reset_fdmatch_ifconf_nullfs_statfs_kthread_create_deferred_uvm_fork_lebufattach_sys_geteuid_vm_object_count_idle_u_rcons_bell_mbpp_start__bus_dmamap_load_mbuf_iommu_dmamap_load_mbuf_st_rewind_ulmax_async_daemon_st_quirk_patterns_scsi_quirk_patterns_audio_close_ffs_vfsops_vnops_nqnfs_lease_updatetime_vfs_rootmountalloc_vfs_list_initial_fuswintrskpc.o_kbd_xlate_init_iommu_dmamem_mmap_fr_tcpstate_m_gethdr_brelvp_nfsrv_symlink_breada_linesw_cd9660_read_swap_bytes_panic_OF_child_openpromclose_cgfourmmap_keymap_s3_lc_tp_protocol_error_fdesc_getattr_mixer_ioctlstrcmp.o_fbclose_chclose_uvm_pageratop_dump_mbuf_iso_pcblookup_ip_mtudisc_timeout_umapfs_checkexp_kernfs_checkexp_unp_dispose_hardupdate_audio_clear_cgthreeopen_uvm_setpagesize_cd9660_rrip_getsymname__assert.o_vmeintr4m_xyioctl_clnp_input_ttysleep_scsibusopen_md_setup_time_tolerance_breadn_scsipi_adapter_delref_pmap_remove_spp_debug_idp_raw_usrreqashldi3.o_mmopen_nfsrtt_spp_istat_union_fsync_prtactive___iordi3_svr4_sys_lstat_OF_close_sdstart_spp_close_msdosfs_fhtovp_vndstrategy_m_get_ncr5380_abort_nullcf_locnames_scsipi_user_done_in_losing_uvm_km_alloc_poolpage1_siginit_lockinit_virtual_end_aps_free_tty_detach_uvm_scheduler_nexecs_genfs_eopnotsupp_vmmap_rpc_auth_kerb___umoddi3_putphysbuf_uvm_km_valloc_m_adj_st_load_xdc_start_raise_prom_boot_lfs_check_config_rootfound_ttcompatgetflags_stattach_ns_setpeeraddr_cd9660_vget_nfs_writebp_procfs_link_m_cat_sys___semctl_compat_43_sys_fstat_fb_setsize_obp_kbd_iopen_nfs_boot_deladdress_msdosfs_init_nullfs_sysctl_max_linkhdr_scanc_am7930_start_input_msioctl_idp_input_tp_input_snprintf_logclose_panicstr_sdgetdefaultlabel_cdgetdefaultlabel_cltp_notify_getvnode_vndgetdefaultlabel_disk_attach_am7990_meminit_uvm_km_pgremove_nfsrv_remove_tcp_usrclosed_syn_cache_lookup_cache_lookup_mainbus_match_brelse_swift_get_syncflt_pmap_enk4m_cdstart_fdstrategy_rn_search_msgbufenabled_stop_uvm_pageout_idp_donosocks_ns_netmask_in_pcbnotify_union_dowhiteout_null_bypass_crcopy_sys_sendto_tp_inpcb_fr_udptimeout_tcp_xmit_timer_tpip_ctlinput_fc_lmdistance_mbstat__remque_ssminphys_ufs_ihashrem_nfsrv_read_findwin95_nqsrv_unlocklease_igmp_init_netisr_vfs_getnewfsid_sys_flock_clnp_iso_addrp_in_addmulti_union_mkdir_bdwrite_sys_rename_mountroothook_destroy_biowait_pffasttimo___one_cmpldi2_pgdelete_svr4_netattach_svr4_ttold_ioctl_sdattach_nfsm_srvfattr_nsrawpcb_fr_authend_limit0_cd9660_setattr_vput_etext_cs4231_intr_mii_mediachg_lfs_flush_tp_ctimeout_sl_compress_setup_ifa_ifwithaf_kernfs_xwrite_logpri_lfs_bmapv_cache_purge_sunos_sys_fcntl_pmap_extract4_4c_OF_enter_rcons_init_ffs_setblock_i82586_start_xxxdebug_zsops_ms_nfsfifo_close_fifo_close_spec_fsync_consdev_kd_cn_tab_zs_def_cflag_nfsrv_rename_vndthrottle_OF_instance_to_path_kbdioctl_quotaoff_cd9660_root_scsipi_start_tp_quench__bus_dmamap_load_raw_iommu_dmamap_load_raw_nat_ioctl_sys_connect_nsphy_ca_fbrcons_cols_lastdosdate_netcon_boothowto_sun4_dmamap_unload_iommu_dmamap_unload_pmap_phys_address_lsi64854_scsi_intr_pmap_page_protect4m_prom_opennode_keymap_s4_lc_dqget_lfs_fsync_nfsm_strtmbuf_esis_shoutput_hostid_sys_setpgid_cd9660_vget_internal_m_retry_mbpool_nsphy_cd_nullfs_vptofh_ncr5380_intr_umapfs_vfsops_raster_textn_ufs_dirbad_fr_authexpire_ppp_compressors_m_getclr_q_to_b_trap_cgsixpoll_ufs_start_esis_eshinput_clnp_usrreq_soreceive_exit1_sys_getitimer_i82586_tint_oldmon_w_cmd_msdosfs_lock_kmemusage_ncr53c9x_intr_exit2_xyc_tick_union_mknod_null_setattr_cpu_ca_bzerosha1.o___negdi2_sunos_sys_unmount_cgfouropen_keymap_s3_uc_maxslp_around_rn_addroute_msdosfs_link_ttydefchars_fuword_OF_call_method_statintr_fr_active_putc_execsw_vmeprint_rclnp_input_null_print_kernfs_mount_mountlist_slock_ifinit_cpu_cd_msgpool_cgeightmmap_cpumatch_viking__bus_dmamap_load_uio_iommu_dmamap_load_uio_netcls_crfreepmatch.o_cnioctl_fdioctl_nfsstats_clnp_debug_relookup_msdosfs_inactive_procfs_inactive_zs_obio_ca_sigaltstack1_bucket_cd_load_toc_cd1400_read_reg_ufs_ihashins_union_copyfile_lfs_markv_vn_default_error_ncr5380_init_pmap_zero_page4_4c_sbus_setup_attach_args_sys_lseek_sys_select_audio_ca_lfs_fragextend_idp_sroute_tp_delay_au_get_gain_mmmmap_kd_init_sys_close_vndstart_audio_init_ringbuffer_ncr53c9x_initstrlen.o_nmifatal_lematch_ledma_spp_savesi_ap_free_audio_cd_cgfourteenioctl_procfs_checkioperm_uao_reference_shutdownhook_list_sys_semget_svr4_sys_waitsys_ufsspec_write_nfs_xdrneg1_union_statfs_portal_symlink_uvm_km_kmemalloc_vop_access_desc_i82586_rintstrncasecmp.o_cdattach_clnp_id_en_cdstrcpy.o_out_fdc_lfs_mkdir_namei_ad1848_get_device_gainurem.o_prom_init_kernfs_xread_lbolt_nfs_boot_sendrecv_tp_snd_control_audio_default_umap_rename_bwtwo_sbus_ca_lfs_ifind_tpsbcheck_iplclose_slinput_sigexit_unsleep_compat_43_sys_gethostname_nfs_getcacheblkmemcmp.o_dqrele_ufs_print_nfs_reconnect_ipl_disable_lkmioctl_compat_43_sys_sigblock_vme_iommu_ca_swstrategy_spp_abort_iso_pcbnotify_union_whiteout_procfs_validfpregs_pmap_rmu4_4c_in_revarpinput_revarpinput_svr4_sys_alarm_lba2msf_uvmspace_share_lfs_match_indir_vdumppages_ss_patterns_sd_scsibus_ops_sd_scsibus_patterns_cd_scsibus_ops_cd_scsibus_patterns_vmebus_sc_myetheraddr_skpc_tcp_compat_42_sys_chmod_allproc_sema_zs_write_data_uvm_anon_add_clnp_data_ck_dev_name2blk_nsphymatch_mfs_start_idp_usrreq_tp_usrreq_msdosfs_mmap_m_split_sys_chdir_sunos_sys_ustat_cred0_selrecord_cgeightpoll_mbpppoll_lfs_freebuf_tp_conn_param_in_setpeeraddr_unp_setpeeraddr_ttwakeup_stopsigmask_time_ufs_ihashget_tcp_rttdflt_setstatclockrate_cd_cd_sunos_sys_ptrace_svr4_sys_fcntl_fbrcons_init_lfs_writing_idp_ns_removede_nchashtbl_vfs_sysctl_sys_fcntl_cd9660_rrip_offset_sd_crazymap_audio_init_record_autoniceval_mustek_attach_kdtty_mtty_attach_lfs_mknod_vfs_op_init_soabort_qos_option_sccs_cgsixmmap_looutput_kernfs_inactive_fifo_inactive_be_ca_cypress_get_syncflt_ctx_alloc_getcacheinfo_sun4_lfs_vflush_union_close_sbus_iommu_ca_ssstrategy_ufs_check_export_tunattach_semu_union_sysctl_be_cd_svr4_sys_semsys_st_read_kernfs_init_sys_chown_au_set_lr_value_msginfo_loadfpstate_sunos_sigcode_kdopen_memecc_sc_ufs_direnter2_sbappendcontrol_shmfork_sys_reboot_check_exec_audioclose_inphy_ca_nfsdirhashmask_udpcksum_ip_directedbcast_ihash_syn_cache_timer_ip_id_lookup_msginit_raster_op_lfs_match_data_idpforwarding_llinfo_llc_sysctl_vnode_inphy_cd_tick_makefstype_audiocs_ca_raster_bitmask_turbosparc_cache_enable_cypress_cache_enable_hypersparc_cache_enable_viking_cache_enable_ms1_cache_enable_tcp_syn_cache_timeq_icmpmaskrepl_vop_blkatoff_desc___udivdi3_ufs_create_dead_write_vntblinit_shifthz_arp_ifinit_audiocs_cd_ukattach_mustek_rewind_scanner_unp_discard_spec_ioctl_emul_find_pmap_rmu_p_cd_scsibus_get_mode_lesetutp_syn_cache_respond_ttsetwater_sigsuspend1_rootdev_lfs_initseg_rpc_mismatch_fr_timeoutstate_spec_inactive_mfs_print_nextcfuiword_pmap_zero_page4m_clean_vnlocked_nfs_asyncio_nsintr_getpck_iso_pcbbind_in_broadcast___assert_vgetmemchr.o_pmap_pinit_si_dma_poll_tcxclose_idp_ctlinput_spp_ctlinput_tpclnp_ctlinput_netio_uvm_km_free_poolpage1_sysctl_doproc_fdhash_sysctl_rdint_trace_req_ifnet_mbppread_module_unknown_soo_close_dmaattach_obio_fdcattach_obio_udv_attach_clnp_protox_hardclock_sys_clock_settime_sunos_sys_stime_pmap_reference_lastseconds_vmeerr_handler_tp_error_emit_bigadj_isofncmp_crdup_config_search_time_freq_ch_ca_msghdrs_svr4_stream_get_dqref_tcp_outflags_bremfree_svr4_sys_pread_xdcmatch_in_maxmtu_rn_match_constty_sys_pread_zswrite_in_control_union_vptofh_ch_cd_sd_scsibus_attach_cd_scsibus_attach_nfs_pathconf_iso_addrmatch_syn_cache_unreach_pidhash_OF_package_to_path_spp_usrclosed_tcp_maxidle_llinfo_arp_updatepri_OF_getproplen_scsipi_init_uvm_wait_union_allocvp_vmcmd_map_readvn_ovbcopy_auiop_st_interpret_sense_sd_interpret_sense_scsipi_interpret_sense_ffs_flushfiles_nfs_statfs_iprintf_fdinit_compat_43_sys_lstat_numccd_bufpages_prom_halt_openpromioctl_cg6attach_mfs_vnodeopv_descs_lfs_vnodeopv_descs_ffs_vnodeopv_descs_nfs_strategy_nfs_vnodeopv_descs_msdosfs_vnodeopv_descs_union_vnodeopv_descs_umapfs_vnodeopv_descs_procfs_vnodeopv_descs_portal_vnodeopv_descs_nullfs_vnodeopv_descs_kernfs_vnodeopv_descs_fdesc_vnodeopv_descs_vfs_special_vnodeopv_descs_fdfree_cd9660_vnodeopv_descs_fbioctl_chioctl_sbus_destroy_attach_args_amap_splitref_bpfclose_kernfs_link_slclose_lfs_match_fake_sys_unlink_vop_reclaim_desc_rtc_offset_in_ifaddr_uao_detach_lfs_valloc_sys_fchroot_pmap_enk4_4c_si_obio_dma_stop__bus_dmamem_mmap_tp_set_npcb_sys_setitimer_isp_lostcmd_romp_pmap_rmk_p_scsipi_execute_xs_iommu_enter_vop_bwrite_desc_vop_update_desc_change_sign16_swap_bytes_atm_output_mntvnode_slock_fddump_auxio_regval_ipstat_union_setattr_sys___vfork14_oclock_ca_native_to_svr4_errno_uvm_vnp_uncache_ncr53c9x_select_mem_access_fault4m_svr4_sys_ulimit_raster_op_nosrc_noclip_dmtext_st_touch_tape_tp_sendoob_winChksum_msgbufp_audiogetinfo_sun4_dmamem_free_sync_crash_fr_scanlist_vnode_free_list_slock_oclock_cd_beattach_bpf_bufsize_disk_resetstat_portal_vfsops_pmap_copy_page_p_congest_threshold_tcp_keepcnt_alldevs_leavepgrp_compat_43_sys_sethostname_vndwrite_lfs_mountfs_iso_getnetaddr_zs_get_chan_addr_xyc_xyreset_mfs_initminiroot_lfs_statfs_ip_srcroute_fatentry_copyargs_sunos_sys_sigreturn_amap_lookups_rpc_autherr_idp_abort_fdesc_fhtovp_compat_13_sys_sigreturn_crget_bread_cltp_ctlinput_ccdclose_msgmaps_sunos_sys_setpgrp_rn_newpair_logioctl_disk_detach_espattach_obio_route_cb_sem_nbuf_svr4_sys_shmsys_am7930_sparc_onclose_subnetsarelocal_sir_sqphy_service_nsphy_service_shm_find_segment_by_shmid_vop_write_desc_le_ledma_ca_shminfo_ippr_ftp_in_raw_setpeeraddr_nullop_sys_chflags_nbootpath_xdc_xdreset_nfs_sysctl_fr_addgroup_proc_targets_shminit_st_identify_drive_tp_inputprep_vmcmdset_extend_ncr53c9x_poll_svr4_sys_gettimeofday_sd_shutdown_ufs_pathconf_ip_savecontrol_sys_gettimeofday_kcopy_pmap_clear_reference4m_xdc_ioctlcmd_cgtwoputcmap_uao_swhash_elt_pool_rt_timer_queue_change_procfs_lookup_tputchar_resettodr_cgthreepoll_mii_phy_reset_syn_cache_reset_cn_devvp_kbd_docmd_mfs_strategy_ufs_strategy_spp_trace_arp_rtrequest_procfs_freevp_pffasttimo_now_clalloc_mixer_close_nbpg_pv_link4m_bestop_ndqb_tickfixinterval_OF_getprop_tpclnp_mtu_tcprexmtthresh_kernfs_vget_nqfhhashtbl_clfree_ns_broadhost_ms_ca_cd1400_enable_transmitter_xyclose_soclose_fifo_ioctl_ncr5380_wait_phase_timo_pmap_bootstrap_ufs_direnter_uvm_swap_init_vm_object_cached_list_uvm_swap_free_nfsm_mbuftouio_in_fmtaddr_arp_maxtries_null_lookup_kernfs_get_rrootdev_shm_last_free_kmemstats_ms_cd_getcpuinfo_iommu_match_nqnfs_prog_arpt_prune_sysctl_ntptime___cmpdi2_fbopen_chopen_ns_pcbconnect_tp_rcvoob_umap_unlock_audio_write_nsintrq_lmin_scanjet_special_lfs_sysctl_ffs_sbupdate_loif_lf_split_compat_43_sys_mmap_sun4_dmamem_map_ncpu_lfs_mount_fd_ca_OF_parent_cgfourpoll_lesetaui_snpac_flushifp_fdesc_pathconf_logwakeup_fbnode_snpac_ownmulti_cdread_rpc_auth_unix_uipc_usrreq_max_protohdr_diskerr_fd_cd_fdchwintr_kernfs_statfs_soconnect_dofilewrite_lmax_svr4_sys_signal_bus_space_probe_xystrategy_ifa_ifwithladdr_ifpromisc_lasttime_uvm_atm_rtrequest___ffstab_getquota_esis_esconfig_time_esis_config_time_compat_43_sys_lseek_rmalloc_kern_sysctl_dma_cd_main_OF_write_msclose_nfs_vptofh_rtentry_pool_firstc_eopnotsupp_fdrelease_delay_leattach_obio_sddkdriver_ffs_valloc_zs_iflush_chkdq_nfsspec_access_nqsrv_instimeq_clnp_emit_er_unp_externalize_lkm_nofunc_svr4_sendsig_inphy_service_tlphy_service_mfs_rootbase_tp_goodack_route_output_cinit_ie_cd_maxfilesstrrchr.o_nfsnodehash_ns_output_cnt_kernfs_root_sbappendaddr_cfree_msopen_berint_sys_fktrace_cpu_setup_cdsize_qestart_free_fbmmap_in_ifinit_msdosfs_create_semu_alloc_lockstatus_st_decide_mode_spp_backoff_ipfr_inuse_union_newlower_fdesc_ioctl_vnode_pool_extent_alloc_region_pv_flushcache_uvm_analloc_nfsrv_getcache_rawcbtable_sys_setsid_svr4_sys_pgrpsys_arpt_keep_msdosfs_mountfs_bereset_fdciop_ffs_statfs_clnp_srcroute_isp_intr_lortrequest_union_readlink_rusage_pool_native_to_svr4_sig_pmap_rmk4m_beqint_fc_purge_pmap_protect4m_nfs_bootparam_ncvhashtbl_imin_lfs_vptofh_dead_print_svr4_trap_cpus_uvm_pager_put_nfsm_adj_unp_addsockcred_exec_map_sys___sigreturn14_lance_ioctl_cgfourteenopen_kbdclose_uvm_pagelookup_fr_tcpclosed_iplioctl_unp_internalize_sys_setuid_numvnd_timer_cd_mii_add_media_zs_conschan_stopcounter_ipforwarding_svr4_sys_utime_vmeintr4_ufs_dirempty_nsintr_dehash_audioprobe_iptime_domainnamelen_eccmemctl_ca_imax_pmap_copy_disabled_cnopen_fdopen_nfs_vattr_pool_kernfs_sysctl_sunos_sys_mctl_iommu_dmamem_map_lfs_updatemeta_tp_ftimeolist_sys_clock_getres_svr4_sys_pathconf_chmatch_uvm_km_free_wakeup_sys_pathconf_isp_init_eccmemctl_cd_lematch_obio_lxtphyattach_xyc_ioctlcmd_sigprop_ktrops_cpu_match_ufs_lookup_nfsv3_type_clnpqmaxlen_raw_init_mttywrite_nat_lookupredir_tcp_quench_bawrite_enxio_ad1848_halt_output_msize_edatabzero.o_lfs_vfree_m_compress_eonattach_i82586_ioctl_pmap_copy_page4_4c_sparc_vme4m_dma_tag_xycintr_kill_user_windows_chkiq_tp_goodXack_fixjobc_ntohl_setptesw4m_ipq_if_down_pgrphashtbl_mmrw_cgsixopen_ppp_dequeue_vop_link_desc_sys_shmctl_sys_setegid_chgproccnt_i82586_attach_scsibus_ca_OF_finddevice_cnclose_fdclose_pmap_update_kernfs_read_rrootdev_cngetc_shmexit_cpu_dumpconf_icsphy_service_mp_resume_cpus_xyc_entoact_nat_table_tcp_fasttimo_OF_exit_nfs_symlink_ns_pcbdetach_time_constant_kthread_run_deferred_queue_audioprint_scsibus_cd_SHA1Transform_if_up_sunos_sys_mmap_ffs_sysctl_tp_route_to_end_bcmp_compat_43_sigaltstack_to_sigstack_st_crazymap_ns_cksum_umapfs_mount_fdclear_raster_text_msdosfs_pathconf_procfs_pathconf_ktrcsw_biodone_lance_setladrf_OF_poweroff_exphyattach_tcp_ack_on_push_deget_vm_object_list_lock_fpu_cleanup_ukmatch_intr_fasttrap_mii_pollstat_ipfr_heads_ipfr_slowtimer_fc_fileextends_tinfo_t_dma_obio_ca_copyoutstr_auxregbisc_amap_pp_establish_inetctlerrmap_semlock_holdernegdi2.o___ucmpdi2___lshldi3_spp_init_msdosfs_strategy___main_xyc_e2str_ipfr_unload_bpfwrite_ktremul_vop_setattr_desc_spprexmtthresh_tprexmtthresh_icmp_sysctl_tcp_sysctl_au_get_lr_value_obio_find_rom_map_ifmedia_list_add_kernfs_vptofh_compat_12_sys_reboot_vm_cache_lock_tpip_input_version_fdalloc_sys_ntp_gettime_cmask_config_found_sm_cpumatch_sun4_cltpstat_tcp_newreno_wildcard_rt_tables_extent_destroy_endtsleep_spec_poll_ffs_tcxmmap_cpumatch_hypersparc_dirchk_nfs_hashlock_route_init_sohasoutofband_npty_cfroots_zsclose_uvm_map_deallocate_lfs_bwrite_ext_cltb_enoioctl_closef_sys_write_sunos_sys_open_swift_cache_enable_sun4_cache_enable_tp_data_retrans_nfssvc_sockhead_fd_types_pager_map_lfs_vunref_head_lf_getblock_ch_exchange_scsipi_adapter_addref_iso_hashchar_rt_setmetrics_dead_read_setrunnable_mii_phy_auto_betint_fdstart_turbosparc_hotfix_ufs_close_ns_ifaddr_lf_clearlock_sys_socketpair_le_sbus_ca_dmamatch_obio_inphyattach_ap_ok_vfs_opv_init_getc_fdcopy_falloc_bematch_ffs_mountfs_ip_natunload_routesw_vfs_opv_free_fifo_bmap_emul_flags_translate_dk_establish_spp_timers_ether_output_umapfs_statfs_cluster_read_ienab_bis_4_4c_svr4_sys_socket_hypersparc_memerr_pmap_deactivate_nfsv2_type_nfsrvlruhead_nfsrv_readlink_sys_socket_ns_zerohost_spp_drop_rt_timer_remove_all___lshrdi3_cdevsw_securelevel_ccdwrite_sunos_sys_wait4_mbpp_match_devout_nqsrv_getlease_cd9660_readdir_ntohs_ffs_vptofh_nfsm_disct_nssw_fdesc_mount_schedcpu_dmmin_fb_attach_qeattach_fr_defaultauthage_fifo_open_scsipi_done_si_vme_dma_stop_desireddquot_procfs_validmap_hztodivdi3.o_st_write_filemarks_exphy_service_beinit_memerr_handler_tcp_usrreq_sl_softc_kernfs_start_coredump_fdc_cd_min_cpumatch_sun4c_lfs_symlink_cksum_snpac_free_icmpstat_tcpstat_dosdirempty_devclslocore.o_EINTSTACKPIDLE_UPestack0cpcbcurproccputypvalcputypvarcputypvallen_msgbufaddrtrapbase_sun4dostartmemfault_sun4slowtrapwindow_ofwindow_uffp_exceptionsoftintr_sun44cnmi_sun4syscalltrapbase_sun4cmemfault_sun4cnmi_sun4ctrapbase_sun4mmemfault_sun4mnmi_sun4muwtabwmaskclean_trap_windowctw_userctw_mergectw_invalidNOP_ON_4M_1NOP_ON_4M_2NOP_ON_4M_3NOP_ON_4M_4normal_mem_faultreturn_from_trapspecial_fp_storesavefpcontsofttrapreturn_from_syscallsoftintr_commonsparc_interrupt_commonnmi_commonwinof_userrft_user_or_recover_pcb_windowswinuf_userwinuf_invalidNOP_ON_4M_5NOP_ON_4M_6winuf_okNOP_ON_4M_7NOP_ON_4M_8rft_kernelrft_userrft_invalidNOP_ON_4M_9NOP_ON_4M_10rft_user_okNOP_ON_4M_11NOP_ON_4M_12init_tablesis_sun4is_openfirmis_sun4cis_sun4mstart_havetypestartmap_doneremap_doneremap_notviknoplabwb1NOP_ON_4M_13NOP_ON_4M_14NOP_ON_4_4C_1param.ogcc2_compiled.___gnu_compiled_cioconf.ogcc2_compiled.___gnu_compiled_c_loc_pvam7930.ogcc2_compiled.___gnu_compiled_c_gx_coeff_ger_coeff_init_amdisp.ogcc2_compiled.___gnu_compiled_c_buf.94_buf.97_isp_mboxcmd_isp_dumpregs_isp_fw_state_isp_setdfltparm_isp_fibre_init_isp_mark_getpdb_all_isp_getpdb_isp_fclink_test_isp_update_isp_parse_async_isp_handle_other_response_isp_dumpxflist_isp_parse_status_isp_fastpost_complete_mbpcnt_isp_read_nvram_true.142_false.143_isp_rdnvram_wordisp_netbsd.ogcc2_compiled.___gnu_compiled_c_buf.94_buf.97_isp_dev_ispcmd_ispminphys_isp_watch_isp_poll_isp_internal_restart_roles.114am7990.ogcc2_compiled.___gnu_compiled_clance.ogcc2_compiled.___gnu_compiled_c_lance_shutdown_crctab.86ncr5380sbc.ogcc2_compiled.___gnu_compiled_c_phase_names_ncr5380_reselect_ncr5380_machine_ncr5380_sched_ncr5380_done_ncr5380_select_ncr5380_msg_out_ncr5380_msg_in_ncr5380_command_ncr5380_data_xfer_ncr5380_status_ncr5380_actions_ncr5380_disconnectedmidway.ogcc2_compiled.___gnu_compiled_c_en_dma_planA_en_dma_planB_en_dmaplan_en_dmaprobe_en_ioctl_en_start_en_dmaprobe_doit_en_rxctl_en_init_en_loadvc_en_mfix_en_txdma_en_txlaunch_en_servicencr53c9x.ogcc2_compiled.___gnu_compiled_ci82586.ogcc2_compiled.___gnu_compiled_c_i82586_cmd_wait_i82586_start_cmd_i82586_rx_errors_timesthru.150_i82586_drop_frames_ie_readframe_i82586_start_transceiver_i82586_chk_rx_ring_ie_mc_setup_iexmit_i82586_get_rbd_list_i82586_release_rbd_list_setup_simple_command_ie_run_tdr_i82586_setup_bufs_ie_cfg_setup_ie_ia_setup_iestop_ie_mc_resetad1848.ogcc2_compiled.___gnu_compiled_c_ad1848_init_values_ad_set_MCE_wait_for_calibration_vol_mid.142_vol_0.143_ad1848_mixer_find_dev_speed_table.186lsi64854.ogcc2_compiled.___gnu_compiled_c_dodrain.164auconv.ogcc2_compiled.___gnu_compiled_caudio.ogcc2_compiled.___gnu_compiled_c_itable_otable_mixer_signal_mixer_removeccd.ogcc2_compiled.___gnu_compiled_c_ccdinit_ccdinterleave_ccdgetdisklabel_ccdstart_ccdbuffer_ccdintr_ccdlookup_ccdgetdefaultlabel_ccdmakedisklabelvnd.ogcc2_compiled.___gnu_compiled_c_vndlock_vndunlockcd9660_bmap.ogcc2_compiled.___gnu_compiled_ccd9660_lookup.ogcc2_compiled.___gnu_compiled_ccd9660_node.ogcc2_compiled.___gnu_compiled_c_cd9660_chars2uicd9660_rrip.ogcc2_compiled.___gnu_compiled_c_cd9660_rrip_attr_cd9660_rrip_defattr_cd9660_rrip_slink_cd9660_rrip_altname_cd9660_rrip_defname_cd9660_rrip_pclink_cd9660_rrip_reldir_cd9660_rrip_tstamp_cd9660_rrip_deftstamp_cd9660_rrip_device_cd9660_rrip_idflag_cd9660_rrip_cont_cd9660_rrip_stop_cd9660_rrip_extref_cd9660_rrip_loop_rrip_table_analyze_rrip_table_getname_rrip_table_getsymname_rrip_table_extrefcd9660_util.ogcc2_compiled.___gnu_compiled_ccd9660_vfsops.ogcc2_compiled.___gnu_compiled_c_iso_mountfscd9660_vnops.ogcc2_compiled.___gnu_compiled_cexec_aout.ogcc2_compiled.___gnu_compiled_cexec_conf.ogcc2_compiled.___gnu_compiled_cexec_elf32.ogcc2_compiled.___gnu_compiled_c_netbsd_elf32_probe_netbsd_elf32_signatureexec_elf_common.ogcc2_compiled.___gnu_compiled_cexec_script.ogcc2_compiled.___gnu_compiled_cexec_subr.ogcc2_compiled.___gnu_compiled_cinit_main.ogcc2_compiled.___gnu_compiled_c_start_init_start_pagedaemon_start_reaper_check_console_initpathsinit_sysent.ogcc2_compiled.___gnu_compiled_ckern_acct.ogcc2_compiled.___gnu_compiled_ckern_clock.ogcc2_compiled.___gnu_compiled_c_psdiv_pscnt_schedclk.86kern_descrip.ogcc2_compiled.___gnu_compiled_ckern_exec.ogcc2_compiled.___gnu_compiled_ckern_exit.ogcc2_compiled.___gnu_compiled_ckern_fork.ogcc2_compiled.___gnu_compiled_c_nextpid.170_pidchecked.171kern_fthread.ogcc2_compiled.___gnu_compiled_ckern_kthread.ogcc2_compiled.___gnu_compiled_ckern_ktrace.ogcc2_compiled.___gnu_compiled_ckern_lkm.ogcc2_compiled.___gnu_compiled_c_lkm_v_lkm_state_lkmunreserve_curp_lkmods__lkm_syscall__lkm_vfs__lkm_dev__lkm_execkern_lock.ogcc2_compiled.___gnu_compiled_ckern_malloc.ogcc2_compiled.___gnu_compiled_c_kmem_map_storekern_ntptime.ogcc2_compiled.___gnu_compiled_ckern_physio.ogcc2_compiled.___gnu_compiled_ckern_proc.ogcc2_compiled.___gnu_compiled_c_orphanpgkern_prot.ogcc2_compiled.___gnu_compiled_ckern_resource.ogcc2_compiled.___gnu_compiled_ckern_sig.ogcc2_compiled.___gnu_compiled_ckern_subr.ogcc2_compiled.___gnu_compiled_c_last_nam2blk.80_getdisk_getstr_findblkmajor_findblkname_parsediskkern_synch.ogcc2_compiled.___gnu_compiled_ckern_sysctl.ogcc2_compiled.___gnu_compiled_c_memlockkern_time.ogcc2_compiled.___gnu_compiled_c_settime_nanowait.168kern_xxx.ogcc2_compiled.___gnu_compiled_csubr_autoconf.ogcc2_compiled.___gnu_compiled_c_mapply_msgs_number_config_process_deferred_childrensubr_disk.ogcc2_compiled.___gnu_compiled_c_fmt.64subr_extent.ogcc2_compiled.___gnu_compiled_c_expool_create_expool_extent_free_region_descriptor_extent_insert_and_optimize_extent_alloc_region_descriptorsubr_log.ogcc2_compiled.___gnu_compiled_csubr_pool.ogcc2_compiled.___gnu_compiled_c_pool_page_alloc_pool_page_free_phpool_drainpp_pool_prime_page_pool_catchupsubr_prf.ogcc2_compiled.___gnu_compiled_c_klogpri_kprintf_putcharsubr_prof.ogcc2_compiled.___gnu_compiled_csubr_rmap.ogcc2_compiled.___gnu_compiled_csubr_xxx.ogcc2_compiled.___gnu_compiled_csys_generic.ogcc2_compiled.___gnu_compiled_c_flag.80sys_process.ogcc2_compiled.___gnu_compiled_csys_socket.ogcc2_compiled.___gnu_compiled_csysv_ipc.ogcc2_compiled.___gnu_compiled_csysv_msg.ogcc2_compiled.___gnu_compiled_c_msg_freehdrsysv_sem.ogcc2_compiled.___gnu_compiled_csysv_shm.ogcc2_compiled.___gnu_compiled_c_shm_find_segment_by_key_shm_deallocate_segment_shm_delete_mapping_shmget_existing_shmget_allocate_segmenttty.ogcc2_compiled.___gnu_compiled_c_ttyblock_ttyecho_ttnread_ttyrubo_proc_comparetty_conf.ogcc2_compiled.___gnu_compiled_ctty_pty.ogcc2_compiled.___gnu_compiled_ctty_subr.ogcc2_compiled.___gnu_compiled_c_cctty_tty.ogcc2_compiled.___gnu_compiled_cuipc_domain.ogcc2_compiled.___gnu_compiled_cuipc_mbuf.ogcc2_compiled.___gnu_compiled_cuipc_proto.ogcc2_compiled.___gnu_compiled_cuipc_socket.ogcc2_compiled.___gnu_compiled_cuipc_socket2.ogcc2_compiled.___gnu_compiled_cuipc_syscalls.ogcc2_compiled.___gnu_compiled_cuipc_usrreq.ogcc2_compiled.___gnu_compiled_cvfs_bio.ogcc2_compiled.___gnu_compiled_cvfs_cache.ogcc2_compiled.___gnu_compiled_cvfs_cluster.ogcc2_compiled.___gnu_compiled_cvfs_getcwd.ogcc2_compiled.___gnu_compiled_c_getcwd_scandir_getcwd_getcache_getcwd_commonvfs_init.ogcc2_compiled.___gnu_compiled_cvfs_lockf.ogcc2_compiled.___gnu_compiled_c_lockstr.156vfs_lookup.ogcc2_compiled.___gnu_compiled_cvfs_subr.ogcc2_compiled.___gnu_compiled_c_mntid_slock_xxxfs_mntid.170_typename_vfs_hang_addrlist_vfs_free_netcred_vfs_free_addrlistvfs_syscalls.ogcc2_compiled.___gnu_compiled_c_change_dir_change_mode_change_owner_change_utimes_rename_filesvfs_vnops.ogcc2_compiled.___gnu_compiled_cvnode_if.ogcc2_compiled.___gnu_compiled_cdead_vnops.ogcc2_compiled.___gnu_compiled_cfdesc_vfsops.ogcc2_compiled.___gnu_compiled_cfdesc_vnops.ogcc2_compiled.___gnu_compiled_c_fdcache_lock_fdesc_attr_nfdesc_targetsfifo_vnops.ogcc2_compiled.___gnu_compiled_c_openstr.156genfs_vnops.ogcc2_compiled.___gnu_compiled_ckernfs_vfsops.ogcc2_compiled.___gnu_compiled_c_tried.156kernfs_vnops.ogcc2_compiled.___gnu_compiled_c_nkern_targetsnull_subr.ogcc2_compiled.___gnu_compiled_c_null_node_find_null_node_allocnull_vfsops.ogcc2_compiled.___gnu_compiled_cnull_vnops.ogcc2_compiled.___gnu_compiled_cportal_vfsops.ogcc2_compiled.___gnu_compiled_cportal_vnops.ogcc2_compiled.___gnu_compiled_c_portal_fileid_portal_closefd_portal_connectprocfs_ctl.ogcc2_compiled.___gnu_compiled_c_ctlnames_signamesprocfs_fpregs.ogcc2_compiled.___gnu_compiled_cprocfs_map.ogcc2_compiled.___gnu_compiled_cprocfs_mem.ogcc2_compiled.___gnu_compiled_cprocfs_note.ogcc2_compiled.___gnu_compiled_cprocfs_regs.ogcc2_compiled.___gnu_compiled_cprocfs_status.ogcc2_compiled.___gnu_compiled_cprocfs_cmdline.ogcc2_compiled.___gnu_compiled_cprocfs_subr.ogcc2_compiled.___gnu_compiled_c_pfshead_pfsvplockprocfs_vfsops.ogcc2_compiled.___gnu_compiled_cprocfs_vnops.ogcc2_compiled.___gnu_compiled_c_nproc_targets_atopidspec_vnops.ogcc2_compiled.___gnu_compiled_cumap_subr.ogcc2_compiled.___gnu_compiled_c_umap_findid_umap_node_find_umap_node_allocumap_vfsops.ogcc2_compiled.___gnu_compiled_cumap_vnops.ogcc2_compiled.___gnu_compiled_cunion_subr.ogcc2_compiled.___gnu_compiled_c_unhead_unvplock_union_list_lock_union_list_unlock_union_relookup_union_dircache_runion_vfsops.ogcc2_compiled.___gnu_compiled_cunion_vnops.ogcc2_compiled.___gnu_compiled_c_union_fixup_union_lookup1msdosfs_conv.ogcc2_compiled.___gnu_compiled_c_unix2dos_dos2unix_u2lmsdosfs_denode.ogcc2_compiled.___gnu_compiled_c_msdosfs_hashget_msdosfs_hashins_msdosfs_hashremmsdosfs_fat.ogcc2_compiled.___gnu_compiled_c_fatblock_fatchainmsdosfs_lookup.ogcc2_compiled.___gnu_compiled_cmsdosfs_vfsops.ogcc2_compiled.___gnu_compiled_c_update_mpmsdosfs_vnops.ogcc2_compiled.___gnu_compiled_cbpf.ogcc2_compiled.___gnu_compiled_c_bpf_movein_bpf_attachd_bpf_detachd_bpf_freed_dst.76_reset_d_bpf_ifname_bpf_setif_bpf_allocbufs_catchpacket_bpf_mcpybpf_filter.ogcc2_compiled.___gnu_compiled_c_m_xword_m_xhalfif.ogcc2_compiled.___gnu_compiled_c_if_indexlim.62if_atmsubr.ogcc2_compiled.___gnu_compiled_cif_ethersubr.ogcc2_compiled.___gnu_compiled_c_digits_etherbuf.64if_loop.ogcc2_compiled.___gnu_compiled_cif_media.ogcc2_compiled.___gnu_compiled_cif_sl.ogcc2_compiled.___gnu_compiled_c_slinit_sl_btomif_ppp.ogcc2_compiled.___gnu_compiled_c_pppsioctl_ppp_ccp_closed_ppp_requeue_pppdumpm_ppp_ccp_ppp_inproc_digits.88if_tun.ogcc2_compiled.___gnu_compiled_c_tuninitpfil.ogcc2_compiled.___gnu_compiled_c_pfil_init_done_pfil_init_pfil_list_add_pfil_list_removeppp_tty.ogcc2_compiled.___gnu_compiled_c_pppasyncstart_pppasyncctlp_pppasyncrelinq_pppgetm_ppp_timeout_fcstab_pppfcs_paritytab_ppplogchar_pppdumpb_digits.182radix.ogcc2_compiled.___gnu_compiled_c_normal_chars_rn_satsifies_leaf_rn_ones_last_zeroed.76_addmask_key_rn_lexobetter_rn_new_radix_mask_rn_zerosraw_cb.ogcc2_compiled.___gnu_compiled_craw_usrreq.ogcc2_compiled.___gnu_compiled_croute.ogcc2_compiled.___gnu_compiled_c_rt_init_donertsock.ogcc2_compiled.___gnu_compiled_c_rt_xaddrs_rt_msg2_rt_msg1slcompress.ogcc2_compiled.___gnu_compiled_cif_arp.ogcc2_compiled.___gnu_compiled_c_myip_initialized_revarp_in_progress_myip_ifp_buf.60_hexdigits.61_lla_snprintf_arptimer_arptfree_null_sdl.66_arprequest_arplookup_in_arpinput_sin.79_myip_srv_ipif_atm.ogcc2_compiled.___gnu_compiled_c_null_sdl.60igmp.ogcc2_compiled.___gnu_compiled_c_rti_head_rti_fill_rti_findin.ogcc2_compiled.___gnu_compiled_c_buf.66in_pcb.ogcc2_compiled.___gnu_compiled_c_inpcb_pool_initialized.60in_proto.ogcc2_compiled.___gnu_compiled_cip_gre.ogcc2_compiled.___gnu_compiled_cip_icmp.ogcc2_compiled.___gnu_compiled_c_icmpsrc_icmpdst_icmpgw_icmp_mtudisc_mtu_table.78_icmp_mtudisc_timeoutip_input.ogcc2_compiled.___gnu_compiled_c_save_rte_ip_srcrtip_output.ogcc2_compiled.___gnu_compiled_c_ip_insertoptions_ip_mloopbackraw_ip.ogcc2_compiled.___gnu_compiled_ctcp_debug.ogcc2_compiled.___gnu_compiled_ctcp_input.ogcc2_compiled.___gnu_compiled_ctcp_output.ogcc2_compiled.___gnu_compiled_ctcp_subr.ogcc2_compiled.___gnu_compiled_ctcp_timer.ogcc2_compiled.___gnu_compiled_c_syn_cache_last.66tcp_usrreq.ogcc2_compiled.___gnu_compiled_c_tcp_ctlvarsudp_usrreq.ogcc2_compiled.___gnu_compiled_c_udp_notifyip_auth.ogcc2_compiled.___gnu_compiled_c_rcsidip_fil.ogcc2_compiled.___gnu_compiled_c_rcsid_fr_savep_fr_saveslowtimo_frzerostats_frrequest_frsync_fixskipfil.ogcc2_compiled.___gnu_compiled_c_rcsid_fr_makefrip_fr_tcpudpchk_frflushlistip_nat.ogcc2_compiled.___gnu_compiled_c_rcsid_nat_flushtable_nat_clearlist_nat_delete_nat_ifpaddrip_frag.ogcc2_compiled.___gnu_compiled_c_rcsid_ipfr_new_ipfr_lookupip_proxy.ogcc2_compiled.___gnu_compiled_c_rcsid_ap_new_sessionip_state.ogcc2_compiled.___gnu_compiled_c_rcsid_fr_statetstats_fr_state_flush_fr_matchsrcdstclnp_debug.ogcc2_compiled.___gnu_compiled_c_letters_iso_addr_bclnp_er.ogcc2_compiled.___gnu_compiled_c_er_templateclnp_frag.ogcc2_compiled.___gnu_compiled_cclnp_input.ogcc2_compiled.___gnu_compiled_cclnp_options.ogcc2_compiled.___gnu_compiled_cclnp_output.ogcc2_compiled.___gnu_compiled_c_dt_template_raw_template_echo_template_echor_templateclnp_raw.ogcc2_compiled.___gnu_compiled_cclnp_subr.ogcc2_compiled.___gnu_compiled_cclnp_timer.ogcc2_compiled.___gnu_compiled_ccltp_usrreq.ogcc2_compiled.___gnu_compiled_cesis.ogcc2_compiled.___gnu_compiled_cidrp_usrreq.ogcc2_compiled.___gnu_compiled_c_idrp_addrsif_cons.ogcc2_compiled.___gnu_compiled_cif_eon.ogcc2_compiled.___gnu_compiled_c_eon_iphdr.70_route.71iso.ogcc2_compiled.___gnu_compiled_ciso_chksum.ogcc2_compiled.___gnu_compiled_ciso_pcb.ogcc2_compiled.___gnu_compiled_ciso_proto.ogcc2_compiled.___gnu_compiled_ciso_snpac.ogcc2_compiled.___gnu_compiled_c_dst_gte_msk_zmk_blank_dl_addrlist.62_nsap2.69_snpac_fixdstandmask_gte_dltp_astring.ogcc2_compiled.___gnu_compiled_ctp_cons.ogcc2_compiled.___gnu_compiled_ctp_driver.ogcc2_compiled.___gnu_compiled_c_statetable_trick_hc__Xebec_action__Xebec_index_inx_erroraction.64tp_emit.ogcc2_compiled.___gnu_compiled_ctp_inet.ogcc2_compiled.___gnu_compiled_ctp_input.ogcc2_compiled.___gnu_compiled_c_tpdu_info_tp_newsocket_bad_alt_classes.64tp_iso.ogcc2_compiled.___gnu_compiled_c_sisotp_meas.ogcc2_compiled.___gnu_compiled_ctp_output.ogcc2_compiled.___gnu_compiled_ctp_pcb.ogcc2_compiled.___gnu_compiled_c_init_done.60tp_subr.ogcc2_compiled.___gnu_compiled_ctp_subr2.ogcc2_compiled.___gnu_compiled_ctp_timer.ogcc2_compiled.___gnu_compiled_ctp_trace.ogcc2_compiled.___gnu_compiled_ctp_usrreq.ogcc2_compiled.___gnu_compiled_cidp_usrreq.ogcc2_compiled.___gnu_compiled_cns.ogcc2_compiled.___gnu_compiled_cns_error.ogcc2_compiled.___gnu_compiled_cns_input.ogcc2_compiled.___gnu_compiled_c_allonesns_ip.ogcc2_compiled.___gnu_compiled_cns_output.ogcc2_compiled.___gnu_compiled_cns_pcb.ogcc2_compiled.___gnu_compiled_cns_proto.ogcc2_compiled.___gnu_compiled_cspp_debug.ogcc2_compiled.___gnu_compiled_cspp_usrreq.ogcc2_compiled.___gnu_compiled_ckrpc_subr.ogcc2_compiled.___gnu_compiled_c_krpccheck_xid.64nfs_bio.ogcc2_compiled.___gnu_compiled_cnfs_boot.ogcc2_compiled.___gnu_compiled_c_nfs_boot_defrt_nfs_boot_getfh_nfs_boot_delroute_md_mountnfs_bootparam.ogcc2_compiled.___gnu_compiled_c_bp_whoami_bp_getfilenfs_node.ogcc2_compiled.___gnu_compiled_cnfs_nqlease.ogcc2_compiled.___gnu_compiled_cnfs_serv.ogcc2_compiled.___gnu_compiled_cnfs_socket.ogcc2_compiled.___gnu_compiled_c_proct_nfs_backoff_lasttime.172nfs_srvcache.ogcc2_compiled.___gnu_compiled_c_nfsv2_repstatnfs_subs.ogcc2_compiled.___gnu_compiled_c_nfs_xid_nfsrv_v2errmap_nfsv3err_null_nfsv3err_getattr_nfsv3err_setattr_nfsv3err_lookup_nfsv3err_access_nfsv3err_readlink_nfsv3err_read_nfsv3err_write_nfsv3err_create_nfsv3err_mkdir_nfsv3err_symlink_nfsv3err_mknod_nfsv3err_remove_nfsv3err_rmdir_nfsv3err_rename_nfsv3err_link_nfsv3err_readdir_nfsv3err_readdirplus_nfsv3err_fsstat_nfsv3err_fsinfo_nfsv3err_pathconf_nfsv3err_commit_nfsrv_v3errmap_base.162_dzeronfs_syscalls.ogcc2_compiled.___gnu_compiled_c_nfs_numnfsd_notstarted_modify_flag_nfsd_rt_nfsdrt_nfs_asyncdaemonnfs_vfsops.ogcc2_compiled.___gnu_compiled_c_nfs_mount_disklessnfs_vnops.ogcc2_compiled.___gnu_compiled_c_create_verf_hextoascffs_alloc.ogcc2_compiled.___gnu_compiled_c_ffs_alloccg_ffs_hashalloc_ffs_fserr_ffs_fragextend_ffs_clusteralloc_ffs_dirpref_ffs_nodealloccg_ffs_alloccgblk_ffs_mapsearchffs_balloc.ogcc2_compiled.___gnu_compiled_cffs_inode.ogcc2_compiled.___gnu_compiled_c_ffs_indirtruncffs_subr.ogcc2_compiled.___gnu_compiled_cffs_tables.ogcc2_compiled.___gnu_compiled_cffs_vfsops.ogcc2_compiled.___gnu_compiled_cffs_vnops.ogcc2_compiled.___gnu_compiled_clfs_alloc.ogcc2_compiled.___gnu_compiled_clfs_bio.ogcc2_compiled.___gnu_compiled_clfs_balloc.ogcc2_compiled.___gnu_compiled_clfs_cksum.ogcc2_compiled.___gnu_compiled_clfs_debug.ogcc2_compiled.___gnu_compiled_clfs_inode.ogcc2_compiled.___gnu_compiled_c_lfs_vinvalbuflfs_segment.ogcc2_compiled.___gnu_compiled_c___rsshell_increments.194lfs_subr.ogcc2_compiled.___gnu_compiled_clfs_syscalls.ogcc2_compiled.___gnu_compiled_clfs_vfsops.ogcc2_compiled.___gnu_compiled_clfs_vnops.ogcc2_compiled.___gnu_compiled_c_lfs_set_diropmfs_vfsops.ogcc2_compiled.___gnu_compiled_c_mfs_minormfs_vnops.ogcc2_compiled.___gnu_compiled_cufs_bmap.ogcc2_compiled.___gnu_compiled_cufs_ihash.ogcc2_compiled.___gnu_compiled_cufs_inode.ogcc2_compiled.___gnu_compiled_cufs_lookup.ogcc2_compiled.___gnu_compiled_cufs_quota.ogcc2_compiled.___gnu_compiled_c_quotatypesufs_vfsops.ogcc2_compiled.___gnu_compiled_c_done.146ufs_vnops.ogcc2_compiled.___gnu_compiled_c_ufs_chown_ufs_chmod_mastertemplateuvm_amap.ogcc2_compiled.___gnu_compiled_cuvm_anon.ogcc2_compiled.___gnu_compiled_cuvm_aobj.ogcc2_compiled.___gnu_compiled_c_uao_init_uao_flush_uao_get_uao_releasepg_uao_find_swhash_elt_uao_free_kernel_object_store.82_kobj_alloced.83_uao_list_uao_initialized.86_uao_list_lockuvm_device.ogcc2_compiled.___gnu_compiled_c_udv_init_udv_reference_udv_detach_udv_fault_udv_flush_udv_asyncget_udv_put_udv_list_udv_lockuvm_fault.ogcc2_compiled.___gnu_compiled_c_uvmadvice_uvmfault_amapcopyuvm_glue.ogcc2_compiled.___gnu_compiled_c_uvm_swapoutuvm_init.ogcc2_compiled.___gnu_compiled_cuvm_io.ogcc2_compiled.___gnu_compiled_cuvm_km.ogcc2_compiled.___gnu_compiled_c_km_pager_uvm_km_get_kmem_object_store_mb_object_store_kernel_map_storeuvm_loan.ogcc2_compiled.___gnu_compiled_c_uvm_loananon_uvm_loanuobj_uvm_loanzerouvm_map.ogcc2_compiled.___gnu_compiled_c_kernel_map_entry.92uvm_meter.ogcc2_compiled.___gnu_compiled_c_cexp_uvm_loadav_uvm_totaluvm_mmap.ogcc2_compiled.___gnu_compiled_cuvm_page.ogcc2_compiled.___gnu_compiled_c_uvm_bootbucket_virtual_space_start_virtual_space_end_initialized.98uvm_pager.ogcc2_compiled.___gnu_compiled_cuvm_pdaemon.ogcc2_compiled.___gnu_compiled_c_uvmpd_tune_uvmpd_scan_uvmpd_scan_inactiveuvm_pglist.ogcc2_compiled.___gnu_compiled_cuvm_stat.ogcc2_compiled.___gnu_compiled_cuvm_swap.ogcc2_compiled.___gnu_compiled_c_swap_priority_swapmap_swaplist_insert_swaplist_find_swaplist_trim_swapdrum_add_swapdrum_getsdp_swap_on_count.182_sw_reg_strategy_sw_reg_iodone_sw_reg_start_uvm_swap_io_uvm_swap_aiodone_uvm_swap_bufdoneuvm_unix.ogcc2_compiled.___gnu_compiled_cuvm_user.ogcc2_compiled.___gnu_compiled_cuvm_vnode.ogcc2_compiled.___gnu_compiled_c_uvn_init_uvn_reference_uvn_detach_uvn_flush_uvn_get_uvn_asyncget_uvn_put_uvn_cluster_uvn_releasepg_uvn_wlist_uvn_wl_lock_uvn_io_uvn_sync_qiommu.ogcc2_compiled.___gnu_compiled_cvme.ogcc2_compiled.___gnu_compiled_cif_ie_vme.ogcc2_compiled.___gnu_compiled_c_media_ie_vmereset_ie_vmeattend_ie_vmerun_ie_vmeintrxd.ogcc2_compiled.___gnu_compiled_c_xddummystrat_xd_labeldata_xdc_probexy.ogcc2_compiled.___gnu_compiled_c_xydummystrat_xy_labeldata_xyc_probeobio.ogcc2_compiled.___gnu_compiled_c_obiomatch_obioattach_obio_space_tag__obio_bus_map_obio_bus_mmap_intr_obio2ipl_special4m.138_obiosearch_obioprintvme_machdep.ogcc2_compiled.___gnu_compiled_c_vmematch_mainbus_vmeattach_mainbus_vmematch_iommu_vmeattach_iommu_sparc_vme_probe_sparc_vme_map_sparc_vme_unmap_sparc_vme_mmap_cookie_sparc_vme_intr_map_sparc_vme_intr_establish_sparc_vme_intr_disestablish_sparc_vme_bus_establish_sparc_vme4_dmamap_load_sparc_vme4_dmamap_unload_sparc_vme4_dmamap_sync_sparc_vme4_dmamem_alloc_sparc_vme4_dmamem_free_sparc_vme_dmamem_map_sparc_vme4m_dmamap_create_sparc_vme4m_dmamap_load_sparc_vme4m_dmamap_unload_sparc_vme4m_dmamap_sync_sparc_vme4m_dmamem_alloc_sparc_vme4m_dmamem_free_sparc_vme4m_barrier_sparc_vme_error_vmebus_translate_vme_ipl_to_pilauxreg.ogcc2_compiled.___gnu_compiled_c_auxregmatch_mainbus_auxregattach_mainbus_auxregmatch_obio_auxregattach_obio_auxregattachclock.ogcc2_compiled.___gnu_compiled_c_oldclk_oclockmatch_oclockattach_level10_level14_eeprom_busy_eeprom_wanted_eeprom_nvram_eeprom_match_eeprom_attach_clockmatch_mainbus_clockattach_mainbus_clockmatch_obio_clockattach_obio_timermatch_mainbus_timerattach_mainbus_timermatch_obio_timerattach_obio_clock_map_clockattach_timerattach_writers.166_oclk_get_secs_oclk_set_secs_oclk_get_dt_dt_to_gmt_gmt_to_dt_oclk_set_dt_month_days_lasttime.201_oneusec.202_eeprom_take_eeprom_update_eeprom_givepower.ogcc2_compiled.___gnu_compiled_c_powermatch_powerattachcpu.ogcc2_compiled.___gnu_compiled_c_cpu_attach_bootcpu.146_cpu_number.147_fsrtoname_fpu_typesmemreg.ogcc2_compiled.___gnu_compiled_c_memregmatch_mainbus_memregattach_mainbus_memregmatch_obio_memregattach_obio_hardmemerr4m_addrold_addroldtop_oldtypememecc.ogcc2_compiled.___gnu_compiled_c_memecc_match_memecc_attach_memecc_errorzs.ogcc2_compiled.___gnu_compiled_c_zs_defspeed_zs_init_reg_zsaddr_zs_match_mainbus_zs_attach_mainbus_zs_match_obio_zs_attach_obio_levelsoft_zssoft_zs_attach_didintr.140_prevpri.141_zs_hwflags_zs_get_speed_zs_print_zshard_zssoftpending_zscninit_zscngetc_zscnputc_prom_cninit_prom_cngetc_prom_cnputc_prom_inSrc_name_get_serial_promdevz8530sc.ogcc2_compiled.___gnu_compiled_c_zsnull_rxint_zsnull_stint_zsnull_txint_zsnull_softintfd.ogcc2_compiled.___gnu_compiled_c_fdconfbsd_fdintr.osave_lsenseispuriousnextcxresultphaseresultphase1ssixbox.ogcc2_compiled.___gnu_compiled_cisp_sbus.ogcc2_compiled.___gnu_compiled_c_buf.164_buf.167_ISP_RISC_CODE_mdvec_isp_sbus_rd_reg_isp_sbus_wr_reg_isp_sbus_mbxdma_isp_sbus_dmasetup_isp_sbus_dmateardown_isp_match_isp_sbus_attachdma_sbus.ogcc2_compiled.___gnu_compiled_c_dma_alloc_bustaglebuffer.ogcc2_compiled.___gnu_compiled_cif_le.ogcc2_compiled.___gnu_compiled_c_lemedia_lewrcsr_lerdcsrif_le_lebuffer.ogcc2_compiled.___gnu_compiled_c_lemedia_lewrcsr_lerdcsrif_le_ledma.ogcc2_compiled.___gnu_compiled_c_lemedia_lewrcsr_lerdcsr_lehwreset_lehwinit_lenocarrieresp_sbus.ogcc2_compiled.___gnu_compiled_c_esp_sbus_dev_esp_sbus_glue_esp_read_reg_esp_write_reg_esp_dma_isintr_esp_dma_reset_esp_dma_intr_esp_dma_setup_esp_dma_go_esp_dma_stop_esp_dma_isactive_esp_sbus_glue1_esp_rdreg1_esp_wrreg1_espattachif_en.ogcc2_compiled.___gnu_compiled_c_en_sbus_match_en_sbus_attachqec.ogcc2_compiled.___gnu_compiled_c_qecmatch_qecattach_qecprint_qec_bus_map_qec_intr_establishbe.ogcc2_compiled.___gnu_compiled_c_be_mii_readreg_be_mii_writereg_be_statchg_be_mii_sync_be_mii_resetqe.ogcc2_compiled.___gnu_compiled_ccs4231_sbus.ogcc2_compiled.___gnu_compiled_c_cs_read_cs_write_hw_if_csmapping_nummapmagma.ogcc2_compiled.___gnu_compiled_c_supported_cardssbus.ogcc2_compiled.___gnu_compiled_c_intr_sbus2ipl_4c_intr_sbus2ipl_4m_sbus_error_sbus_alloc_bustag_sbus_get_intr__sbus_bus_map_sbus_bus_mmap_sbus_intr_establish_straytime.170_nstray.171mii.ogcc2_compiled.___gnu_compiled_cmii_physubr.ogcc2_compiled.___gnu_compiled_cukphy_subr.ogcc2_compiled.___gnu_compiled_ctlphy.ogcc2_compiled.___gnu_compiled_cnsphy.ogcc2_compiled.___gnu_compiled_cqsphy.ogcc2_compiled.___gnu_compiled_cinphy.ogcc2_compiled.___gnu_compiled_cexphy.ogcc2_compiled.___gnu_compiled_clxtphy.ogcc2_compiled.___gnu_compiled_cicsphy.ogcc2_compiled.___gnu_compiled_csqphy.ogcc2_compiled.___gnu_compiled_cukphy.ogcc2_compiled.___gnu_compiled_cz8530tty.ogcc2_compiled.___gnu_compiled_c_zsppscap_zstty_match_zstty_attach_zsparam_zsstart_zshwiflow_zs_modem_zs_shutdown_zs_hwiflow_tiocm_to_zs_zs_to_tiocm_zs_maskintr_zstty_stint_zstty_softint_zstty_rxint_zstty_txint_zstty_diagevent.ogcc2_compiled.___gnu_compiled_ckbd.ogcc2_compiled.___gnu_compiled_c_kbd_match_kbd_attach_kbd_repeat_kbd_oldkeymap_kbd_iockeymap_kbd_iocsled_kbd_drain_tx_kbd_output_kbd_start_tx_kbd_set_leds_kbd_input_string_kbd_input_funckey_kbd_input_keysym_kbd_update_leds_kbd_input_raw_kbd_was_reset_kbd_new_layout_kbd_rxint_kbd_txint_kbd_stint_kbd_softintkbd_tables.ogcc2_compiled.___gnu_compiled_c_kbd_type3_kbd_type4kd.ogcc2_compiled.___gnu_compiled_c_kd_softc_kdstart_kdparam_kd_is_console_kd_putfb_kd_later_kdcnprobe_kdcninit_kdcngetc_kdcnputc_kdcnpollc_kdcn_statems.ogcc2_compiled.___gnu_compiled_c_ms_match_ms_attach_to_one.146_to_id.147_ms_input_ms_rxint_ms_txint_ms_stint_ms_softintscsipiconf.ogcc2_compiled.___gnu_compiled_cscsipi_base.ogcc2_compiled.___gnu_compiled_c_scsipi_init_done.88scsipi_ioctl.ogcc2_compiled.___gnu_compiled_cscsipi_verbose.ogcc2_compiled.___gnu_compiled_c_sense_keys_adesc_rqsbuf.90scsi_base.ogcc2_compiled.___gnu_compiled_cscsiconf.ogcc2_compiled.___gnu_compiled_c_inqbuf.100cd_scsi.ogcc2_compiled.___gnu_compiled_ccd.ogcc2_compiled.___gnu_compiled_cch.ogcc2_compiled.___gnu_compiled_csd_scsi.ogcc2_compiled.___gnu_compiled_c_sd_scsibus_get_parms_sd_scsibus_flush_sd_scsibus_mode_sense_sd_scsibus_get_optparmssd.ogcc2_compiled.___gnu_compiled_c_sddoingadump_sxst.ogcc2_compiled.___gnu_compiled_css.ogcc2_compiled.___gnu_compiled_css_mustek.ogcc2_compiled.___gnu_compiled_css_scanjet.ogcc2_compiled.___gnu_compiled_c_wfail.104_rfail.105_dfail.106uk.ogcc2_compiled.___gnu_compiled_cdma_obio.ogcc2_compiled.___gnu_compiled_cesp_obio.ogcc2_compiled.___gnu_compiled_c_esp_obio_dev_esp_obio_glue_esp_read_reg_esp_write_reg_esp_dma_isintr_esp_dma_reset_esp_dma_intr_esp_dma_setup_esp_dma_go_esp_dma_stop_esp_dma_isactiveam7930_sparc.ogcc2_compiled.___gnu_compiled_camd7930intr.osavepcbwtwo.ogcc2_compiled.___gnu_compiled_c_bwtwomatch_sbus_bwtwoattach_sbus_bwtwomatch_obio_bwtwoattach_obio_bwtwofbdriver_bwtwounblank_bwtwo_pfour_probe_bwtwo_get_video_sun4c_bwtwo_set_video_sun4c_bwtwoattach_bwtwo_get_video_sun4_bwtwo_set_video_sun4cgtwo.ogcc2_compiled.___gnu_compiled_c_cgtwomatch_cgtwoattach_cgtwofbdriver_cgtwounblankcgthree.ogcc2_compiled.___gnu_compiled_c_cgthreematch_sbus_cgthreeattach_sbus_cgthreematch_obio_cgthreeattach_obio_cgthreefbdriver_cgthreeunblank_cgthreeattach_cgthree_set_video_cgthreeloadcmap_cgthree_get_videocgfour.ogcc2_compiled.___gnu_compiled_c_cgfourmatch_cgfourattach_cgfourfbdriver_cgfourunblank_cg4_pfour_probe_cgfourloadcmap_cgfour_get_video_cgfour_set_videocgsix.ogcc2_compiled.___gnu_compiled_c_cg6_fbdriver_cg6_unblank_cg6_reset_cg6_loadcmap_cg6_setcursor_cg6_loadomap_cg6_loadcursor_mmo.158cgsix_sbus.ogcc2_compiled.___gnu_compiled_c_cgsixmatch_cgsixattachcgsix_obio.ogcc2_compiled.___gnu_compiled_c_cgsixmatch_cgsixattach_cg6_pfour_probecgeight.ogcc2_compiled.___gnu_compiled_c_cgeightmatch_cgeightattach_cgeightfbdriver_cgeightunblank_cg8_pfour_probe_cgeightloadcmap_cgeight_get_video_cgeight_set_videotcx.ogcc2_compiled.___gnu_compiled_c_tcxmatch_tcxattach_tcx_fbdriver_tcx_unblank_tcx_reset_tcx_loadcmap_mmo.154cgfourteen.ogcc2_compiled.___gnu_compiled_c_cgfourteenmatch_cgfourteenattach_cgfourteenfbdriver_cgfourteenunblank_cg14_set_video_cg14_opens_cg14_init_cg14_reset_cg14_get_cmap_cg14_put_cmap_cg14_load_hwcmap_cg14_get_video_cg14_setcursor_cg14_loadomap_cg14_loadcursorbt_subr.ogcc2_compiled.___gnu_compiled_cfb.ogcc2_compiled.___gnu_compiled_c_devfb_no_replace.132_seen_force.133_a2int_fb_bell_gallant19_0_pixels_gallant19_0_gallant19_1_pixels_gallant19_1_gallant19_2_pixels_gallant19_2_gallant19_3_pixels_gallant19_3_gallant19_4_pixels_gallant19_4_gallant19_5_pixels_gallant19_5_gallant19_6_pixels_gallant19_6_gallant19_7_pixels_gallant19_7_gallant19_8_pixels_gallant19_8_gallant19_9_pixels_gallant19_9_gallant19_10_pixels_gallant19_10_gallant19_11_pixels_gallant19_11_gallant19_12_pixels_gallant19_12_gallant19_13_pixels_gallant19_13_gallant19_14_pixels_gallant19_14_gallant19_15_pixels_gallant19_15_gallant19_16_pixels_gallant19_16_gallant19_17_pixels_gallant19_17_gallant19_18_pixels_gallant19_18_gallant19_19_pixels_gallant19_19_gallant19_20_pixels_gallant19_20_gallant19_21_pixels_gallant19_21_gallant19_22_pixels_gallant19_22_gallant19_23_pixels_gallant19_23_gallant19_24_pixels_gallant19_24_gallant19_25_pixels_gallant19_25_gallant19_26_pixels_gallant19_26_gallant19_27_pixels_gallant19_27_gallant19_28_pixels_gallant19_28_gallant19_29_pixels_gallant19_29_gallant19_30_pixels_gallant19_30_gallant19_31_pixels_gallant19_31_gallant19_32_pixels_gallant19_32_gallant19_33_pixels_gallant19_33_gallant19_34_pixels_gallant19_34_gallant19_35_pixels_gallant19_35_gallant19_36_pixels_gallant19_36_gallant19_37_pixels_gallant19_37_gallant19_38_pixels_gallant19_38_gallant19_39_pixels_gallant19_39_gallant19_40_pixels_gallant19_40_gallant19_41_pixels_gallant19_41_gallant19_42_pixels_gallant19_42_gallant19_43_pixels_gallant19_43_gallant19_44_pixels_gallant19_44_gallant19_45_pixels_gallant19_45_gallant19_46_pixels_gallant19_46_gallant19_47_pixels_gallant19_47_gallant19_48_pixels_gallant19_48_gallant19_49_pixels_gallant19_49_gallant19_50_pixels_gallant19_50_gallant19_51_pixels_gallant19_51_gallant19_52_pixels_gallant19_52_gallant19_53_pixels_gallant19_53_gallant19_54_pixels_gallant19_54_gallant19_55_pixels_gallant19_55_gallant19_56_pixels_gallant19_56_gallant19_57_pixels_gallant19_57_gallant19_58_pixels_gallant19_58_gallant19_59_pixels_gallant19_59_gallant19_60_pixels_gallant19_60_gallant19_61_pixels_gallant19_61_gallant19_62_pixels_gallant19_62_gallant19_63_pixels_gallant19_63_gallant19_64_pixels_gallant19_64_gallant19_65_pixels_gallant19_65_gallant19_66_pixels_gallant19_66_gallant19_67_pixels_gallant19_67_gallant19_68_pixels_gallant19_68_gallant19_69_pixels_gallant19_69_gallant19_70_pixels_gallant19_70_gallant19_71_pixels_gallant19_71_gallant19_72_pixels_gallant19_72_gallant19_73_pixels_gallant19_73_gallant19_74_pixels_gallant19_74_gallant19_75_pixels_gallant19_75_gallant19_76_pixels_gallant19_76_gallant19_77_pixels_gallant19_77_gallant19_78_pixels_gallant19_78_gallant19_79_pixels_gallant19_79_gallant19_80_pixels_gallant19_80_gallant19_81_pixels_gallant19_81_gallant19_82_pixels_gallant19_82_gallant19_83_pixels_gallant19_83_gallant19_84_pixels_gallant19_84_gallant19_85_pixels_gallant19_85_gallant19_86_pixels_gallant19_86_gallant19_87_pixels_gallant19_87_gallant19_88_pixels_gallant19_88_gallant19_89_pixels_gallant19_89_gallant19_90_pixels_gallant19_90_gallant19_91_pixels_gallant19_91_gallant19_92_pixels_gallant19_92_gallant19_93_pixels_gallant19_93_gallant19_94_pixels_gallant19_94_gallant19_95_pixels_gallant19_95_gallant19_96_pixels_gallant19_96_gallant19_97_pixels_gallant19_97_gallant19_98_pixels_gallant19_98_gallant19_99_pixels_gallant19_99_gallant19_100_pixels_gallant19_100_gallant19_101_pixels_gallant19_101_gallant19_102_pixels_gallant19_102_gallant19_103_pixels_gallant19_103_gallant19_104_pixels_gallant19_104_gallant19_105_pixels_gallant19_105_gallant19_106_pixels_gallant19_106_gallant19_107_pixels_gallant19_107_gallant19_108_pixels_gallant19_108_gallant19_109_pixels_gallant19_109_gallant19_110_pixels_gallant19_110_gallant19_111_pixels_gallant19_111_gallant19_112_pixels_gallant19_112_gallant19_113_pixels_gallant19_113_gallant19_114_pixels_gallant19_114_gallant19_115_pixels_gallant19_115_gallant19_116_pixels_gallant19_116_gallant19_117_pixels_gallant19_117_gallant19_118_pixels_gallant19_118_gallant19_119_pixels_gallant19_119_gallant19_120_pixels_gallant19_120_gallant19_121_pixels_gallant19_121_gallant19_122_pixels_gallant19_122_gallant19_123_pixels_gallant19_123_gallant19_124_pixels_gallant19_124_gallant19_125_pixels_gallant19_125_gallant19_126_pixels_gallant19_126_gallant19_127_pixels_gallant19_127_gallant19_128_pixels_gallant19_128_gallant19_129_pixels_gallant19_129_gallant19_130_pixels_gallant19_130_gallant19_131_pixels_gallant19_131_gallant19_132_pixels_gallant19_132_gallant19_133_pixels_gallant19_133_gallant19_134_pixels_gallant19_134_gallant19_135_pixels_gallant19_135_gallant19_136_pixels_gallant19_136_gallant19_137_pixels_gallant19_137_gallant19_138_pixels_gallant19_138_gallant19_139_pixels_gallant19_139_gallant19_140_pixels_gallant19_140_gallant19_141_pixels_gallant19_141_gallant19_142_pixels_gallant19_142_gallant19_143_pixels_gallant19_143_gallant19_144_pixels_gallant19_144_gallant19_145_pixels_gallant19_145_gallant19_146_pixels_gallant19_146_gallant19_147_pixels_gallant19_147_gallant19_148_pixels_gallant19_148_gallant19_149_pixels_gallant19_149_gallant19_150_pixels_gallant19_150_gallant19_151_pixels_gallant19_151_gallant19_152_pixels_gallant19_152_gallant19_153_pixels_gallant19_153_gallant19_154_pixels_gallant19_154_gallant19_155_pixels_gallant19_155_gallant19_156_pixels_gallant19_156_gallant19_157_pixels_gallant19_157_gallant19_158_pixels_gallant19_158_gallant19_159_pixels_gallant19_159_gallant19_160_pixels_gallant19_160_gallant19_161_pixels_gallant19_161_gallant19_162_pixels_gallant19_162_gallant19_163_pixels_gallant19_163_gallant19_164_pixels_gallant19_164_gallant19_165_pixels_gallant19_165_gallant19_166_pixels_gallant19_166_gallant19_167_pixels_gallant19_167_gallant19_168_pixels_gallant19_168_gallant19_169_pixels_gallant19_169_gallant19_170_pixels_gallant19_170_gallant19_171_pixels_gallant19_171_gallant19_172_pixels_gallant19_172_gallant19_173_pixels_gallant19_173_gallant19_174_pixels_gallant19_174_gallant19_175_pixels_gallant19_175_gallant19_176_pixels_gallant19_176_gallant19_177_pixels_gallant19_177_gallant19_178_pixels_gallant19_178_gallant19_179_pixels_gallant19_179_gallant19_180_pixels_gallant19_180_gallant19_181_pixels_gallant19_181_gallant19_182_pixels_gallant19_182_gallant19_183_pixels_gallant19_183_gallant19_184_pixels_gallant19_184_gallant19_185_pixels_gallant19_185_gallant19_186_pixels_gallant19_186_gallant19_187_pixels_gallant19_187_gallant19_188_pixels_gallant19_188_gallant19_189_pixels_gallant19_189_gallant19_190_pixels_gallant19_190_gallant19_191_pixels_gallant19_191_gallant19_192_pixels_gallant19_192_gallant19_193_pixels_gallant19_193_gallant19_194_pixels_gallant19_194_gallant19_195_pixels_gallant19_195_gallant19_196_pixels_gallant19_196_gallant19_197_pixels_gallant19_197_gallant19_198_pixels_gallant19_198_gallant19_199_pixels_gallant19_199_gallant19_200_pixels_gallant19_200_gallant19_201_pixels_gallant19_201_gallant19_202_pixels_gallant19_202_gallant19_203_pixels_gallant19_203_gallant19_204_pixels_gallant19_204_gallant19_205_pixels_gallant19_205_gallant19_206_pixels_gallant19_206_gallant19_207_pixels_gallant19_207_gallant19_208_pixels_gallant19_208_gallant19_209_pixels_gallant19_209_gallant19_210_pixels_gallant19_210_gallant19_211_pixels_gallant19_211_gallant19_212_pixels_gallant19_212_gallant19_213_pixels_gallant19_213_gallant19_214_pixels_gallant19_214_gallant19_215_pixels_gallant19_215_gallant19_216_pixels_gallant19_216_gallant19_217_pixels_gallant19_217_gallant19_218_pixels_gallant19_218_gallant19_219_pixels_gallant19_219_gallant19_220_pixels_gallant19_220_gallant19_221_pixels_gallant19_221_gallant19_222_pixels_gallant19_222_gallant19_223_pixels_gallant19_223_gallant19_224_pixels_gallant19_224_gallant19_225_pixels_gallant19_225_gallant19_226_pixels_gallant19_226_gallant19_227_pixels_gallant19_227_gallant19_228_pixels_gallant19_228_gallant19_229_pixels_gallant19_229_gallant19_230_pixels_gallant19_230_gallant19_231_pixels_gallant19_231_gallant19_232_pixels_gallant19_232_gallant19_233_pixels_gallant19_233_gallant19_234_pixels_gallant19_234_gallant19_235_pixels_gallant19_235_gallant19_236_pixels_gallant19_236_gallant19_237_pixels_gallant19_237_gallant19_238_pixels_gallant19_238_gallant19_239_pixels_gallant19_239_gallant19_240_pixels_gallant19_240_gallant19_241_pixels_gallant19_241_gallant19_242_pixels_gallant19_242_gallant19_243_pixels_gallant19_243_gallant19_244_pixels_gallant19_244_gallant19_245_pixels_gallant19_245_gallant19_246_pixels_gallant19_246_gallant19_247_pixels_gallant19_247_gallant19_248_pixels_gallant19_248_gallant19_249_pixels_gallant19_249_gallant19_250_pixels_gallant19_250_gallant19_251_pixels_gallant19_251_gallant19_252_pixels_gallant19_252_gallant19_253_pixels_gallant19_253_gallant19_254_pixels_gallant19_254_gallant19_255_pixels_gallant19_255if_le_obio.ogcc2_compiled.___gnu_compiled_c_lemedia_lewrcsr_lerdcsrif_ie_obio.ogcc2_compiled.___gnu_compiled_c_media_ie_obreset_ie_obattend_ie_obrunsi.ogcc2_compiled.___gnu_compiled_c_si_link_flags_si_dev_si_match_si_attach_sw_match_sw_attach_si_reset_adapter_reset_adapter_si_intr_si_attach_common_sw_reset_adapter_si_minphyscons.ogcc2_compiled.___gnu_compiled_c_refcount.172fpu.ogcc2_compiled.___gnu_compiled_c_cx_to_trapx_fpu_codesfpu_add.ogcc2_compiled.___gnu_compiled_cfpu_compare.ogcc2_compiled.___gnu_compiled_cfpu_div.ogcc2_compiled.___gnu_compiled_cfpu_explode.ogcc2_compiled.___gnu_compiled_cfpu_implode.ogcc2_compiled.___gnu_compiled_c_round_toinffpu_mul.ogcc2_compiled.___gnu_compiled_cfpu_sqrt.ogcc2_compiled.___gnu_compiled_cfpu_subr.ogcc2_compiled.___gnu_compiled_cautoconf.ogcc2_compiled.___gnu_compiled_c_str2hex_bootpath_build_bootpath_fake_bootpath_print_save.150_save.153_crazymap_prom_sd_crazymap.158_init.159_prom_st_crazymap.162_init.163_buf.172_mbprint_openboot_special4c.179_openboot_special4m.180_mainbus_attach_getprop_reg1_getprop_intr1_getprop_address1_bus_class_tab_bus_class_instance_match_nail_bootdevcache.ogcc2_compiled.___gnu_compiled_c_base.106conf.ogcc2_compiled.___gnu_compiled_c_chrtoblktblemul.ogcc2_compiled.___gnu_compiled_c_muldiv_sizedef.72in_cksum.ogcc2_compiled.___gnu_compiled_cintr.ogcc2_compiled.___gnu_compiled_c_straytime.66_nstray.67_level01_fastveclocore2.ogcc2_compiled.___gnu_compiled_cmachdep.ogcc2_compiled.___gnu_compiled_c_str.156_dumpspace_iobase.209_sparc_bus_map_sparc_bus_unmap_sparc_bus_subregion_sparc_bus_mmap_sparc_mainbus_intr_establish_sparc_bus_barrierprocess_machdep.ogcc2_compiled.___gnu_compiled_cmem.ogcc2_compiled.___gnu_compiled_c_physlock.70promlib.ogcc2_compiled.___gnu_compiled_c_notimplemented_stringbuf.64_obp_v2_finddevice_rootnode.75_buf.86_obp_v0_fortheval_obp_v0_read_obp_v0_write_obp_v2_getchar_obp_v2_peekchar_obp_v2_seek_obp_v0_getbootpath_obp_v0_getbootargs_obp_v0_getbootfile_parse_bootargs_obp_v2_getbootpath_obp_v2_getbootargs_storage.115_parse_bootfile_obp_v2_getbootfile_obp_v2_putstr_obp_set_callback_obp_ticks_chosennode.126_opf_getbootpath_opf_getbootargs_opf_getbootfile_opf_nextprop_obp_v2_putcharopenfirm.ogcc2_compiled.___gnu_compiled_c_args.66openprom.ogcc2_compiled.___gnu_compiled_c_openpromcheckid_openpromgetstr_lastnodepmap.ogcc2_compiled.___gnu_compiled_c_segfixmask_pgt_page_alloc_pgt_page_free_get_phys_mem_sortm_pmap_page_upload_srmmu_bypass_read_mmu_setup4m_L1_mmu_setup4m_L2_mmu_setup4m_L3_pv_pool_pv_table_map_pv_physmem_pmap_bootstrap4m_pmap_bootstrap4_4c_prom_ctxreg_pmap_pmap_pool_L1_pool_L23_poolsys_machdep.ogcc2_compiled.___gnu_compiled_ctrap.ogcc2_compiled.___gnu_compiled_c_T_tfaultaddrvm_machdep.ogcc2_compiled.___gnu_compiled_cdisksubr.ogcc2_compiled.___gnu_compiled_c_disklabel_sun_to_bsd_disklabel_bsd_to_sun_sun_fstypesraster_op.ogcc2_compiled.___gnu_compiled_c_needsrc_leftmask_rightmask_bytemask_raster_blitraster_text.ogcc2_compiled.___gnu_compiled_crcons_kern.ogcc2_compiled.___gnu_compiled_c_mydevicep_rcons_output_rcons_belltmr_xxxraster.68_row.69_col.70rcons_subr.ogcc2_compiled.___gnu_compiled_csvr4_errno.ogcc2_compiled.___gnu_compiled_csvr4_exec.ogcc2_compiled.___gnu_compiled_c_svr4_copyargssvr4_fcntl.ogcc2_compiled.___gnu_compiled_c_svr4_to_bsd_cmd_svr4_to_bsd_flags_bsd_to_svr4_flags_bsd_to_svr4_flock_svr4_to_bsd_flock_bsd_to_svr4_flock64_svr4_to_bsd_flock64_fd_revoke_fd_truncatesvr4_filio.ogcc2_compiled.___gnu_compiled_csvr4_ioctl.ogcc2_compiled.___gnu_compiled_csvr4_ipc.ogcc2_compiled.___gnu_compiled_c_svr4_to_bsd_ipc_perm_bsd_to_svr4_ipc_perm_bsd_to_svr4_semid_ds_svr4_to_bsd_semid_ds_svr4_setsemun_svr4_semctl_svr4_semget_svr4_semop_bsd_to_svr4_msqid_ds_svr4_to_bsd_msqid_ds_svr4_msgsnd_svr4_msgrcv_svr4_msgget_svr4_msgctl_bsd_to_svr4_shmid_ds_svr4_to_bsd_shmid_ds_svr4_shmat_svr4_shmdt_svr4_shmget_svr4_shmctlsvr4_misc.ogcc2_compiled.___gnu_compiled_c_svr4_mknod_svr4_pfind_svr4_hrtcntl_svr4_setinfo_bsd_statfs_to_svr4_statvfs_bsd_statfs_to_svr4_statvfs64svr4_net.ogcc2_compiled.___gnu_compiled_c_svr4_netops_svr4_soo_close_svr4_ptm_alloc_ptyname.160_ttyletters.161_ttynumbers.162svr4_resource.ogcc2_compiled.___gnu_compiled_csvr4_signal.ogcc2_compiled.___gnu_compiled_csvr4_socket.ogcc2_compiled.___gnu_compiled_c_initialized_svr4_headsvr4_sockio.ogcc2_compiled.___gnu_compiled_c_bsd_to_svr4_flagssvr4_stat.ogcc2_compiled.___gnu_compiled_c_bsd_to_svr4_xstat_bsd_to_svr4_stat64_svr4_to_bsd_pathconfsvr4_stream.ogcc2_compiled.___gnu_compiled_c_clean_pipe_sockaddr_to_netaddr_in_sockaddr_to_netaddr_un_netaddr_to_sockaddr_in_netaddr_to_sockaddr_un_getparm_si_ogetudata_si_sockparams_si_listen_si_getudata_si_shutdown_sockmod_ti_getinfo_ti_bind_timod_i_nread_i_fdinsert__i_bind_rsvd__i_rele_rsvd_i_str_i_setsig_i_getsigsvr4_syscalls.ogcc2_compiled.___gnu_compiled_csvr4_sysent.ogcc2_compiled.___gnu_compiled_csvr4_termios.ogcc2_compiled.___gnu_compiled_c_bsd_to_svr4_speed_svr4_to_bsd_speed_svr4_to_bsd_termios_bsd_to_svr4_termios_svr4_termio_to_termios_svr4_termios_to_termiosvr4_ttold.ogcc2_compiled.___gnu_compiled_c_svr4_tchars_to_bsd_tchars_bsd_tchars_to_svr4_tchars_svr4_sgttyb_to_bsd_sgttyb_bsd_sgttyb_to_svr4_sgttyb_svr4_ltchars_to_bsd_ltchars_bsd_ltchars_to_svr4_ltcharssvr4_machdep.ogcc2_compiled.___gnu_compiled_c_svr4_getsiginfosunos_exec.ogcc2_compiled.___gnu_compiled_csunos_sysent.ogcc2_compiled.___gnu_compiled_csunos_ioctl.ogcc2_compiled.___gnu_compiled_c_sptab_s2btab_stios2btios_btios2stios_stios2stio_stio2stios_bsd_to_sunos_flock_sunos_to_bsd_flock_sunfcntl_flgtabsunos_misc.ogcc2_compiled.___gnu_compiled_c_sunnfs_flgtab_ipoptxlat.198_sunstatfs_sreq2breq_nreqs_sunos_howto_convsunos_machdep.ogcc2_compiled.___gnu_compiled_ccompat_13_machdep.ogcc2_compiled.___gnu_compiled_cns_cksum.ogcc2_compiled.___gnu_compiled_ckern_ipc_10.okern_sig_13.ovm_12.ovfs_syscalls_12.okern_xxx_12.okern_info_09.ovm_43.ovfs_syscalls_43.ouipc_syscalls_43.otty_43.okern_sig_43.okern_resource_43.okern_info_43.okern_exit_43.ocompat_util.o/work/tmp/mrg/src/sys/arch/sparc/compile/GENERIC_SCSI3/lib/kern/libkern.overs.ogcc2_compiled.___gnu_compiled_cswapnetbsd.ogcc2_compiled.___gnu_compiled_c# $NetBSD: disktab,v 1.8 1999/01/26 07:35:54 mrg Exp $ # # @(#)disktab 5.5 (Berkeley) 2/27/91 # # Disk geometry and partition layout tables. # Key: # ty type of disk # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # rm rpm, 3600 default # se sector size, 512 default # sf supports bad144-style bad sector forwarding # so partition offsets in sectors # p[a-h] partition sizes in sectors # b[a-h] partition block sizes in bytes # f[a-h] partition fragment sizes in bytes # # pseudo-geometry taken from rd7945 miniroot:\ :ty=winchester:ns#16:nt#7:nc#968:\ :pa#10240:ba#8192:fa#1024: # psuedo-geometry like floppy below, only slightly slarger instfs|NetBSD floppy install filesystem:\ :ty=floppy:se#512:nt#2:rm#300:ns#18:nc#92:\ :pa#3312:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pc#3312:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD\ :pb#2880:ob#0:\ :pc#2880:oc#0: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: QUANTUM EMPIRE_2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: QUANTUM LPS540S:\ :ty#winchester:ns#125:nt#4:nc#2113: QUANTUM PD1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: QUANTUM XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum ProDrive 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate Sa  #n}bTbnobody*'Unprivileged user/nonexistent/sbin/nologin2 nobody*'Unprivileged user/nonexistent/sbin/nolofalken*Prof. Stephen &/usr/games/usr/games/wargames3news*Network News/var/spool/news/sbin/nologin2gbingres* J& Group/usr/ingres/sbin/nologin1ingresnobody*'Unprivileged user/nonexistent/sbin/nologin3games* Games pseudo-user/usr/games/sbin/nologin2news*Network News/var/spool/news/sbin/nologin3gbPK ingres* J& Group/usr/ingres/sbin/nologin2 uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/usr/guest/operator/sbin/nologin3operator*Syfalken*Prof. Stephen &/usr/games/usr/games/wargames1falkenpostfix* Postfix pseudo-user/var/spool/postfix/sbin/nologin2games* Games pseudo-user/usr/games/sbin/nologin3bin*Binaries Commands and Source//sbin/nologin1bin,,mh  falken*Prof. Stephen &/usr/games/usr/games/wargames2 uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucppostfix* Postfix pseudo-user/var/spool/postfix/sbin/nologin1postfixgames* Games pseudo-user/usr/games/sbin/nologin1gamesnews*Nuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2 rootCharlie &/root/bin/csh3rootCharlie &/root/bin/csh2un#falken*Pronobody*'Unprivileged user/nonexistent/sbin/nologin2 nobody*'Unprivileged user/nonexistent/sbin/nologin1nobodydaemon*The devil himself//sbin/nologin3toor*Bourne-again Superuser/root/bin/sh2z:5QL ingres* J& Group/usr/ingres/sbin/nologin2 uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/usr/guest/operator/sbin/nologin3operator*System &/usr/guest/operator/sbin/nologin1operatordaemon*The devil himself//sbin/nologin2daemon*The devil himself//sbin/nologin1daemontoor*Bourne-again Superuser/root/bin/sh1toorrootCharlie &/root/bin/csh1rootc^mh  falken*Prof. Stephen &/usr/games/usr/games/wargames2 uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucppostfix* Postfix pseudo-user/var/spool/postfix/sbin/nologin1postfixgames* Games pseudo-user/usr/games/sbin/nologin1gamesnews*Network News/var/spool/news/sbin/nologin1newsbin*Binaries Commands and Source//sbin/nologin3operator*System &/usr/guest/operator/sbin/nologin2ZUingres* J& Group/usr/ingres/sbin/nologin1ingringres* J& Group/usr/ingres/sbin/nologin3 postfix* Postfix pseudo-user/var/spool/postfix/sbin/nologin3 bin*Binaries Commands and Source//sbin/nologin2# $NetBSD: install.md,v 1.11.4.1 1999/07/01 19:27:47 perry Exp $ # # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # # machine dependent section of installation/upgrade script. # # Machine-dependent install sets MDSETS="kern xbase xcomp xcontrib xfont xserver" if [ "$MODE" = upgrade ]; then RELOCATED_FILES_13="${RELOCATED_FILES_13} /usr/sbin/installboot /usr/mdec/installboot" fi # Mount /kern to get at /kern/msgbuf mount -t kernfs none /kern md_set_term() { if [ ! -z "$TERM" ]; then return fi echo -n "Specify terminal type [sun]: " getresp "sun" TERM="$resp" export TERM } md_makerootwritable() { # Was: do_mfs_mount "/tmp" "2048" # /tmp is the mount point # 2048 is the size in DEV_BIZE blocks umount /tmp > /dev/null 2>&1 if ! mount_mfs -s 2048 swap /tmp ; then cat << \__mfs_failed_1 FATAL ERROR: Can't mount the memory filesystem. __mfs_failed_1 exit fi # Bleh. Give mount_mfs a chance to DTRT. sleep 2 } md_get_diskdevs() { # return available disk devices < /kern/msgbuf sed -n -e 's/^\(sd[0-9]\) .*/\1/p' -e 's/^\(x[dy][0-9]\) .*/\1/p' | sort -u } md_get_cddevs() { # return available CDROM devices < /kern/msgbuf sed -n -e 's/^\(cd[0-9]\) .*/\1/p' | sort -u } md_get_ifdevs() { # return available network devices < /kern/msgbuf sed -n -e 's/^\(le[0-9]\) .*/\1/p' -e 's/^\(ie[0-9]\) .*/\1/p' | sort -u } md_get_partition_range() { # return range of valid partition letters echo "[a-h]" } md_installboot() { echo "Installing boot block..." /usr/mdec/binstall ffs /mnt } md_native_fstype() { } md_native_fsopts() { } md_checkfordisklabel() { # $1 is the disk to check local rval local cfdl cfdl=`disklabel $1 2>&1 > /dev/null | \ sed -n -e '/no disk label/{s/.*/ndl/p;q;}; \ /disk label corrupted/{s/.*/dlc/p;q;}; \ $s/.*/no/p'` if [ x$cfdl = xndl ]; then rval=1 elif [ x$cfdl = xdlc ]; then rval=2 else rval=0 fi return $rval } md_prep_disklabel() { local _disk _disk=$1 md_checkfordisklabel $_disk case $? in 0) echo -n "Do you wish to edit the disklabel on $_disk? [y]" ;; 1) echo "WARNING: Disk $_disk has no label" echo -n "Do you want to create one with the disklabel editor? [y]" ;; 2) echo "WARNING: Label on disk $_disk is corrupted" echo -n "Do you want to try and repair the damage using the disklabel editor? [y]" ;; esac getresp "y" case "$resp" in y*|Y*) ;; *) return ;; esac # display example cat << \__md_prep_disklabel_1 Here is an example of what the partition information will look like once you have entered the disklabel editor. Disk partition sizes and offsets are in sector (most likely 512 bytes) units. Make sure these size/offset pairs are on cylinder boundaries (the number of sector per cylinder is given in the `sectors/cylinder' entry, which is not shown here). Do not change any parameters except the partition layout and the label name. It's probably also wisest not to touch the `8 partitions:' line, even in case you have defined less than eight partitions. [Example] 8 partitions: # size offset fstype [fsize bsize cpg] a: 50176 0 4.2BSD 1024 8192 16 # (Cyl. 0 - 111) b: 64512 50176 swap # (Cyl. 112 - 255) c: 640192 0 unknown # (Cyl. 0 - 1428) d: 525504 114688 4.2BSD 1024 8192 16 # (Cyl. 256 - 1428) [End of example] __md_prep_disklabel_1 echo -n "Press [Enter] to continue " getresp "" disklabel -W ${_disk} if [ -f /usr/bin/vi ]; then disklabel -e ${_disk} else disklabel -i ${_disk} fi } md_copy_kernel() { if [ -f /mnt/netbsd.GENERIC ]; then echo -n "Linking /netbsd.GENERIC to /netbsd ... " ln /mnt/netbsd.GENERIC /mnt/netbsd echo "done." else echo "WARNING: No /netbsd.GENERIC! Please install /netbsd manually!" fi } md_welcome_banner() { { if [ "$MODE" = "install" ]; then echo "" echo "Welcome to the NetBSD/sparc ${VERSION} installation program." cat << \__welcome_banner_1 This program is designed to help you put NetBSD on your disk, in a simple and rational way. You'll be asked several questions, and it would probably be useful to have your disk's hardware manual, the installation notes, and a calculator handy. __welcome_banner_1 else echo "" echo "Welcome to the NetBSD/sparc ${VERSION} upgrade program." cat << \__welcome_banner_2 This program is designed to help you upgrade your NetBSD system in a simple and rational way. As a reminder, installing the `etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the `etc' set into those files which already exist on your system. __welcome_banner_2 fi cat << \__welcome_banner_3 As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __welcome_banner_3 } | more } md_not_going_to_install() { cat << \__not_going_to_install_1 OK, then. Enter `halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __not_going_to_install_1 } md_congrats() { local what; if [ "$MODE" = "install" ]; then what="installed"; else what="upgraded"; fi cat << __congratulations_1 CONGRATULATIONS! You have successfully $what NetBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __congratulations_1 } ` 0 `@# ` 9#" $@` `T@ 6# 9c@2`"` H*/+ 9    9"a( 8"b0  "! 9"!  * 9"!!` 8""@oldmonobp v0obp v2㿘  1c€  1c€㿘@yCan't open device `%s' Can't open NFS network connection on `%s' 㿘@ % 1% ``  @  D 1$` $`b`% ?$ 6 ",+* ) ! 9! "# `0@ 2$@ `    ! 1$` $`bt    ! 1$` $`b%  ! 9 !@!h0!!@m $`&` 2 2 2 8 8b@- @   !@ː!0 8 b@  promstrategy: non-block device not supported 㿘    @#x ` 9a(,a(06 * '@㿘   .  1 #:`  ` 1c``8c``<'@ 㿘  @*& `& $& (   €@- " '@ 㿘 ` @@  1c€ 㿘   2 @ @ $ ? 6`$ *㿘 9!( 4㿘 1#㿘 9!( 8㿘 1#? xmit: not a network device 㿘  ,` @"(?@@ @`?㿘 ,@`€@㿘 1c㿘! 1#` $ \@,ے#%lx mac-address drop swap 6 cmoveX 1#`#`` `6 9` 60&`0" c  c   Њ@*@` 6#@ 0a(0  cP@A`Tielefdxyxdstsddevice_typeblocknetworkbyte㿘 1#``>``:  9 1"`2"N@J@2J`N` "( 2! a(€ @` @-`   `@-    @-`   㿘 1#``€  1 6`## #.prom_iopen: "%s" error=%d 㿘) 6#䀢 ?K  @ @ 9 $`" $` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` () V`" * @H$`0 "@$`4 " @I$` @ 2#&  %#  @"  㿘# 6c䀢  @ 4 "$c@ & 4$coldmon_mapin: length=%d oldmon_mapin: invalid maptype %d 㿘 9!*`@  #@h 1#T   1"ܐ  `   #@R`` 9@! 13 cX Ԣ&@  ` 8"cX @? Đ`IJ`  dvma_mapin㿘? #@(1? @!8dvma_mapout㿘 #@(1 @ !㿘@ " ڒ㿘 @Operation not implemented on ROM version %d X 1#` b @ 9a  9?`\€ 0!( `  `€0   㿘% 1` € $ @+ "  2 @G  ` @-``'@*ǒ& 㿘 7@ 㿐'L' L 2'L*@L㿈 '' 쀢 X L?@vN`E 1#` x@ N/ N /*`:   : * : ``/`@:    * *   *:  / *  : @K "?N 2 x WARNING: opennode not valid on PROM version %d 㿘 1#`#`` @ !   0@   D@no PROM root device㿘1 7 2 &  1cܟ€ 2&  @֐"8namex  1#`! "A @+S  `|@  㿘 1c€: @ PROM exit failed㿘! 1#` X€  H@PROM boot failed㿘! 1#` X€  L@㿘 7 'L'H'P'T'X!@"H  1#`O` (@ (@ &O㿘 9a(@* |€obp_v0_read: unimplemented read from %d 㿘 1#h   X?obp_v0_write: unimplemented write on %d 㿘 1#l    9a(`?㿐 1#` 8   2 8O  / . > 㿐 1`8  O ?  / . > 㿘 9!(`    1p 1p 1pJ-2    J?   J  1p@㿘 1#p`v2_bootargs too long 㿘N 7 ' "%*@` *:  @  -b 2 *@ "*@N?  " *@*@ N`  **@㿘 1#p`㿘 1` < 9(x"@ 1/chosenno CHOSEN node㿘1 7"( 2 &"( @T  2&"( @` bootpath㿐 `p''  1  bootargs㿐 `'' y 1 J 㿐 `'' d 1 ^ opf_nextprop not implemented yet 㿘 @1! stdinstdout㿘 9!`4 9?L 1"c`Jc`( "`  , "` ,  "`  "  \`"`"`"`"`"`("` "`$"`,"`L"`P"`H"`\"``"`X "`d(A @2 ` 1` (  t`( t  ` 1 `@(``   `t  H`d# L`l Pa X d \`p `` x |   ``9 ``"`H0"*a0 J  `L J" `,    `T  (`P  `X  $`` ,`$ 0`(, T 4 8 < ha la pa t(` @ "  @b#⨒" " " " " |    b x#" T" (" " $" , " 0a" 4 " 8`\" <" @" _" D 1 ! c` c` b$ < c$ D        # % ' ) + - / 1 3 5 7 9 ;  `ܒ`H!Ԛa0 0ئ∨#`@ะ"a x!a#Xa$ $ H$ L$ P$ T$ X$ \$ $ $ x$ |$ $ $ $ $ ($ $ $$ 0$ 4$ 8$ @b$  aȔ @b  aД @\ 㿐 1 `/ < vmunixonetbsd.gzonetbsdnetbsd.old.gznetbsd.oldnetbsd.gznetbsd  J- + J& # ""  9 (8 d" `@sa" ` "` "ᨐ J  2( >> %s, Revision %s >> (%s, %s) device[%s] ("halt" to halt): haltboot (press RETURN to try default list): open: %s: %s: trying %s... Booting %s @ %p 㿘@'! 16#`  2 2 8`X@Wx  2 2 P`@P + 9 €%a @`L@ %? 1#! a,! @ H @2  1c,@ "    @   @  $  `) 9@"@ ؐ `@'t  # 9M" 2%a@`a@ ŐLa` 1#  @ & 9  @@Bad format %ld+%ld+[%ld+%d]=%p boot: short read x@ <%?@  ?# @!2?2 a/ ? ?# @!2?$ a! ? ?# @! 2? a  ? ?# @ 2  `"  "@#?@ ?# @!  a ܤ` ܐ@ܔ  ? @@ ?# @! a ? ?# @! #a  @" .@`@2.@ #@F@` 2d @@: :.@  `耢 "< @  `@##@=耢 2A # 8@cD@2  7 @g cD   ?`@!2& @ #@`?    9"a # @@ 1c`  9 9!(ab1  Ā 0#(@㿘! 7"  @  2 "` 9 !,@0 " $"㿘 7b ? "b  2@z`boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' 2@ ?7 9"! #'@B@@ ) 9  8#@{b 2` 1 8`#@  9#!  '@#@e#'@)  9  9!, 2  9!0㿘 9!0 ` 9@  7$ " }   "a,?  9 , ? 90 㿘  ; < 㿘 = 9"    ?peer㿀 " 9 'a('''? child㿀 " 9 'a('''? parent㿀 #  9 'a('''? instance-to-package㿘  7#p 9"⠔ a($ $ $ ?? getproplen㿀 # 9  'a(''''??getpropx 9! 4?  8 9  'a(''''''؀??setpropx 9! 4?   9  'a(''''''؀??nextpropx !( 9  'a('''''؀??finddevice㿀 ! 9 'a('''??instance-to-pathx 9! 4? ! 9  'a('''''؀ ?package-to-pathx 9! 4? "` 9  'a('''''؀ ?call-method@'T  'X+  "ؔ '?'' ? T`?& 9a(€ ?, ? `+ ?   `? "@ 8'P'T''X  ."ؘ''''' P" 9a(€ ? @ ?* @?open㿀@#א 9a 6?   9 'a('''??close㿈 ! 9 'a('''test㿀 !@ 9 'a('''??test-method㿀 ! 9  'a(''''readx !  ?'''耦 % 9# 9a('@؀?? 2  &writeOF_write() > 1024 x "  '?''耦  ."! 93 9!  'a(@؀??&seekx 9(  P  ''''''@؀??OF_bootbootOF_boot failed㿈@# 9a &  @ v## 9 'a(''' @ i#enter㿈  @ 9'a(''€exitOF_exit failed㿈  x 9'a(''€ @ H SUNW,power-offOF_poweroff failed㿈   9'a(''€ @ 1 set-callback㿀 !  9 'a('''? set-symbol-lookup㿀 !x 9 'a(''''interpret㿀 ! 9 'a('''milliseconds㿈 " 9 'a(''㿐`@|`0@X``@#`` @#``@#,@ ` @"j@#`x`` * `d, `0 2`0`0@"`x @"P* @ ?  " ??%`0@f㿘 `  .` 8@ X&   ,`@@ ```&@`,`F C& h`>  ,` @!  @0$@     d ,  0 2 0 2 %@` ,@"@!,`& 㿐   e<`P @ K 4`0*:  8  2 `0 @8eD`0eD `L  Ȁ(u 2: @`0$  " @w  `d  *   0@^$ $  $&@&    b 8   @   " & 㿐`@!P  <@`@.@ 0 "  2  @!8  2  &*@ B<@@` 8Ԑ2 ``@͐ 㻀@$ Ш@ &`@@% `   `  @2 \F!T@ 0@@eg`0 @-   @"2t,   $@  ' f ` @  7%0<`@%0 @C  >%0 H L;`;   ;`; >%@>%8pؐ@^ @n 8 'pt@_ ,  $ #`a#\b` @ ?  9 H "a,؀` 9@@  "!,?㽠Px@(  @0 @4 8 t@& $`   h #`a#\b`$ @ ?  9!, x  |@ 0@ D 㺈ؐ @  `$#\#`ab  @X ?  9!, `  dh@ ݒd .@  ?nfsread: short packet, %d < %ld 0Ȣ @ Ɣ $$ $$L#`a$ $b$ (#\  @ ,? L 9 H"a,`"`H 9"!,?@ T@ 0@ >  9 H",?㿘@  2 9 "a,  8" РX6 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈/ 8HH   @ "8   l N /" c  0 _ @ ` x  $<N   /   L  N  / . @.0 /H 2:H@@ d*  '`@ @@ O/ H@ E x@ A x  @ : x   `H&`  @ ( x@ # x㿘  "& @  x&  㿘 ! 9@    ? !,   ;  B& > @ 2&       D"; 0 0   @ ;  `; ??0   2 0ఐ *  4  "` 8"`  <"` @"` D :`8bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p l 9ba"'Д  $ $ $ ''X@ؒ X? 2В??4` $@!"И#`ab#@ #\ @  ! 8 @̐"0<?# 9"@b"+ '4b2@  ` @"X#? 8'ܢ  8b"@ ? 9" 8b@w  ? 8@b ? ? 7 P 8" 8b''@H 2C?@ؐ@? 2:? 2  8?6 b"&# К#`a#@b#\ @     9 H"a,''@( 2?@J 2?#'@ ? ?㿘 &# @ &@  㿘`&@   ? & @ q.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@#rarp: bad socket. %d No response for RARP request   @Ґ"E?@  .     , , , , , /Ƣ, , @  @   4#\  `T  .@˚~ ! 9 @"?"@  " @ 0 2 ? @  2??"a" $㿘 2 X@ 5㿐@ 9 ."a,  5@2)?@`* @`2"?``* @h2?` 2?` 2?``* @`2 ? `@  ??callrpc: error = %d 㿐\@?B6 '?'??@ } ` 8@@ '?ܖ ?'?'? #@   #\ @  bЖ$ " @/?  9 H"a,`@ 9 H "a,`` #@@!p 9 H",?recvrpc: reject, astat=%d, errno=%d 㿘! 9$!,@i  8#@@ 2?`2 ?` ` $!,"@ʒ ??"@?2 9 8ȇ(    ?      ? 9a  #a  8ȇ+   #a  getport: %s㾐a"@3 o'?(' "p #\#` ""   ,   p'0 # 9! a,@j H@U H$a,?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentNot a directoryUnknown error: code %d㿘`Y "*` €0X0X0Y0Y0X0X0Y0X0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0X0Y0X0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0X0Y0Y0Y0Y0Y0Y0Y0Y0X0Y0Y0Y0Y0Y0XT0X`0Xl0Xx0X0X1 3!@1 0!X1 -!p1 *!1 '!1 $!1 !!1 !1 !1 "1 "(1 "P1 "h1  "1  "1 7" b @㿘'L'P'T'X @L  @ *`㿘W  ,  ". /.".+."&  "!"..鿐 0麐 鸐 ?鵐 0鲐 @͠L鬠 *L0馐 0飰 0sendudp: bad write (%d != %d)x@4 <* @ *@@ &  ,`,` 4` $`  @ $`4`  6 4 4  `''`` '`'@ ' 4` @4 &쀣?$` $`$` $`  2!     8`b'@ܖ@(@? "@^readudp: huge packet, udp len %d x@ް `}ހ((  * @`t?@o?2m?<@ 2f? 2b?6` <`\@ 2X? &T?``  2L?` &@  "4  ` 2=?` 5` % @ x0? ' ' ' ''@] `4 @F  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   ) 9 <+  $%!,3?@@b@, 4 2 "ޠ 2 !,   "$ Ȧ` l *` Є  *  :(Е*`*`8. 53 # .?#8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘# 7c,@  . @  0,@@O "@  0,@@D  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*? ` `. Ȓ?N*c  .   J    `&     ,` ` `   ( `߀` ܗ(2 ?# : :* arpwhohas: overflowed arp_list! arp: no response for %s # 2a8 @ 2 ؀@  'h@B`@  8   $a8@d @Ɛ@ .    , , , , /, , , @ @ h@ h 4&#\  a" .Z~?2  h!  h'll@  @ a8$a8㿘 2X@(㿐@ 9 :"a,(27?@`* @`20?``* @h2)?` 2%?` 2!?``* @``@?? 2!8 2*` ؑ*  `@  ??㿘@`*` ;``* @h4` 0` ,``* @`%` @u   ``.`.`@ `@  @ @  .@(㿘 @ @ޔ 6` [ `??㿘Y ` @.    2!X@'  "` ?` ?7 8 2@  : 0 *@ `  *@`*@` 8* 2J  "  JJ@ `  㿘 8a'H'L'P'T 'X @ "a@H @!㿘 9" , @  @ , 㿘'H'L'P'T'X@hH㿘@@h㿘@ 㿘@=㿘 < " ?21 9 @&!, D@$ 4  D!, `$ <?$ 8 $$ $  @`$㿘אԐ* А* ̐?. ?$`8㿘 2! , @ " ? X?& L  & & K`?  & L ` ?:& 8  ``* ?`??``x ?``p ?`"  < g   <  ?& 81.1.3㿘@ƒ?-`+@ P 8aБ. `"@@p P ?@ 8 `@ &`D&@o&`@0 @ѐ`@ P@$?㿘  9 "a,? 9". @  8. a@ @ D@@ P@㿘 8!Г.   8?? 2 $  ??~$ 8{$  L 2+    8     "@"$$ $  $ c&  @@ \? " $ V&  < # 9 D$a,@ 4 Da, `$ < D$ $@ے $$ 8  H@ " $ H  H ?  ?$ 8ʐ 8`2  8@  @  $ H 8 2   < 2   2 L  H@ |"  $ H&㾘  9  9"- @ 8@!9!Г-  `L@?2*$`(&$`" `  9e b 9a  @ F `%@"  @ ?K @`D@B P ?@͖ 8$@$`D$`@H `4@ 2` @ f )`' a !: @ 9  [d 4 `0 ["a,??㿐 9. " @@   9 ."a," @ * 2`   :     9 "a,  B < ' 9 "a,&?㿐 9"   `    9 H"a,$  $ $ < '" 9 9`  0 "`J + 2`*$@'$ `P @  8" @€ `2`P`    ` 9@ 9"!,$?㿘 9. "@ @   9 "   9  [ :@B: [?? "a,    㿘 9. " @  @   9 $"a,2  " @      @ $ 9"!,` 9 "!,?|/-\㿘 8!  cȖJ@ N#!L  8 8@`*@"㿘 !(@㿘 8! 8"a $! @!*!"8N@`N@`%` N@`oq``s`c"N`d``b"0T`l" 0z"B`u`ph0r]`x"h0m@wL`Р L !  ?,@ < ,L L    L  *`:    >0 `L` L` N@` - @0 N@@( N@@  {N@ 0 x@ oN@ % g lc0123456789abcdef㿈 #8@D @@,  ?L?` *    @ ?  *@0    *@ ` 2 ?@ @: ?  2a "a"     2? " 㿘 ?`2"`0"`"`   "` @{ 㿘 "? `"? $2` ? @0  $€ (&  㿘"M?N 12I?8 D?2 @? &  "& & ( $ 2  "& $   (  )& "  `"   "`  ( ?"  `   '  *@A  " ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "O?  "K? F` ??` >  4*` €0l0000(0|00000$0x00 ( `$ $  #   $  " cX 2    " cx " `  $ $    $`* @ː  &@ c`   &@ &@  `$ $    * "` $" `Β  $ $    *` " $"@ `  $ $    *` " $"@    $ $  @  ` #  $ $ 0" # c $ "  @?   " "9 " u @ `  "@'  "@ b `$ $    * "` $" `O  $ $   *` " $"@ `:  $ $   *` " $"@ `%   $ $   " $@  " c $  "  " ??㿘    "#?  ?@Ԕ 0  ? & 06 * ?$@ @N  " 㿘 ??`2@09  "@"``2.? 2!`  8  @`   #  $$$ " $$ "@?㿘 " ?   ?  @     㿘" <& ``$`(€ `2 ( @  (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$ `  `(  $ ($ ,$ 8$  `$ `(€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` - "!*` €00\0000$0l0 00Ȩ?  *`` 4  `&  `-`0  `4 $@&Υ4@@耢 & & & @&``$  &`&@& 4?  &4 "& &`4& & @&``$  &`&@& 4Ҕ?}?  *`` <?#2` @ @ " & &`& & @&``$  &`&@& 4?`&  l o  `& & @&``$  &`&@& 42C  , ` 0 ( @ "?"`21 & 4@  0 4  " ,? ,"@  ` ( "?"@`2 & & @&``$  &`&@& 4Q 8 "%%@&     &?  *``  ?, & 4   !  "&!&`& & @&``$  &`&@& 4 ? `  `( & & & @&``$  &`&@& 4? &4&   2  @ ! #?  *``   *@ *`"  & 2  4     !#* *`"  &  &   $ @  `$`(€ 2&  && & @&``$  &`&@& 4&&  0 `a   6 "#8a8 @,  Z?  *`@ ,   *` `  (" $@& T4` `   @  ??  *`@ 4$@* 4   !  $@ 4 `2! ` `$`( &&`& & @&``$  &`&@& 4%?  ( ? *"@?&  0  !@ *   $4  `#\#` &   !`''#d@*ܠ`$`(€ ?"&& & @&``$  &`&@& 4ޔ@؀ 2& & & @&``$  &`&@& 4ǔ?&& & @&``$  &`&@& 4@  @ 0 4@`  "? ,"   ^&&& 4@ 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘2 `$ `( (`$`(€ $`(`$€㿘 ( (& 0& 4`?w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z- %# `Y G: % 2(@   (@ 2 @(@ 2 (@ 2 (@ 2 (@ 2 (@ 2 (@2   % 2(@ :㿘?c6  ` [ V1?!:& ``@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ ̲` @`@@#@#񀦠,` #+3;CScspp !1Aa  0@` 㾸'H'P\' H'L'T'X''''''''''''''''(@&@H2X$"-   .@. *   .@.8 " ( .@  ,  . ??$  '4 8 0  .@(h&@$H*- h'H'0? 'p @¸  +`??',H'$h,'(*@ @R,*   ''%    #@,@? : d. d &d,@`(p$&$// @ "@68 '.@&@&X$@ @4(#@/  /L   `/'LT (P/ P('6 ,. . &@@ @ @ , 62 $," ? '@ ?.@??2U@ `@$C  2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀 ' (   #?#d#`#\#h   | ?? )! '  )@ 2 ( )!' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d`' !  (  W? ' '@"#\#`#d#h! ? ,?? )"$  )"$ ? (1 $ ' '\#`#d8##\#h  ? 2 (?? )" $ ? )# )#($ ? ( $ ( $ €㿘 20; 2&b4 2&@8 6&8& 㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@`  *!*` €0 000p0l00(0P00)` '& & @&``$@&@&`& 4 ` ``@` 0 4@ `  "@? ,": $@ ` `$` $`$@`  6`  *   6c8+`@ ` *   $ 4   $`$@   $` $`$@ @_   $@ *$@!`&`& & @&``$  &`&@& 4?`  6`[  *   6#8+`  ` ` `$`$ $` $`$@4 `  6`J  *   6c8+`@ ` *   $  4 $`  $` 7$@ @ $`  * .$` *$@!&`& & @&``$  &`&@& 4H?`  6`  *   6#8+`  `  $` $ $@4  ( `   ," "@` "$@26  ,  0 ( @ "?"2$ & 4@ 0 4  " ,? ,"@   ( "?"@"&  ( ,   (`? $`$@2C `  ,  0 ( @ "?"21 ` & 4@В 0 4  " ,? ,"@   ( "?"@2 ` & & @&``$  &`&@& 4 (c$@ & 4?`@ 0 4@& & @&``$  &`&@& 4r $@& & @&``$  &`&@& 4b & & @&``$  &`&@& 4T?& & @&``$  &`&@& 4F& & @&``$  &`&@& 48& & @&``$  &`&@& 4*& & @&``$  &`&@& 4& @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`@  ,  68. ( ǀ`0?(``( ( ` ,4c8`@` (` . ( `2&   &@/@7`6`` 8.&@" "@#`#"@"`"`"4 ` 1"` `&@˹7`(`&@ ` 7 ?(`` ( , %c8`@2 `(` (.  6` "`8.&@" "@#`#"@"`"`"4U? `&@ڹ7`@ (` ?(`@ (`&@ ('@7 &'@/@ `/@ `,  &/@ `(/@ `; `6` 8.&@" "@#`#"@"`"`"4 㿘 4 0@`  ,"` 8 " `"@&`&` 8 <& <&`0腔 ,@@ & 4  (& 4`" 8 " `"@&`&` 8 <& <&`0^@&` & 0㿘  `  `  @/# @*   & &@&& @.@* "   ` 㿘?#@6 6`@  `@  & $ $&@`@@2  ` *  , "@@ 4 "  "  , @@ 4    ,@@ 4  @@*  : : *2@ : @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &   J "     J@*8 ` "@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@000040000000 00000x0p0h0`0X0P0H 0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0P0`0P0@000(000;0?H0?0@0@0A 0FX0H0H0IT0I\0INetBSD/sparc Secondary Boot1.8Mon Jul 19 04:22:51 PDT 1999mrg@sun4690@` 0123456789abcdef/0 inflate 1.1.3 Copyright 1995-1998 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??