8% <  @  @ @(Z/mnt<@`bT 8%C <  @  @ @<@`bT U8%(ZXX ss?A 8%E) 8%) 8%) A8%E*Q8%R8%RA8%'c8%8%A8%E3%8%ׄ8%ׄA8%E8ـ8%E;38%F1-A8%FÀ8%F,8%FA8%Fw8%Xp8%XpC8%F S+8%F 8%FIA8%F߀8%F'V8%GwA8%Fܓ8%Z S+8%Z S+A8^W8m8%'VA8%Fe8%U8ـ8%U8ـA8%F#*8%F7n8%GwA8%F'V8%!8%!A8^`8m8%4sA8%F1xˀ8%G8%GwA8%F7n8%F:i8%G1-A8%G1-8%G,8%GwA8%Gw8%Z8%Z=8%It8%Oр8%XW (08@HPX 8%V8%V 8%V 8%VI8%Vܓ8%Vܓ8%VG8%Ve8%Ve78%V$[܀8%V) 8%V) h 8%V-D8%V2b8%V2bp8%V7n8%W98p8%W98pxB-8%W h8%W沀8%X !j)*8%Wf8%W8%X ! 8%X4΀8%X8%X../../instbin 8%X$[܀8%X&%8%X&%../../instbin 8%X*T8%X,8%X,../../instbin 8%X1xˀ8%X3B8%X3B../../instbin 8%X8C8%X98%X9../../instbin 8%Y8%YĴ8%YĴ../../instbin 8%Y h8%Y S+8%Y S+../../instbin 8%Y߀8%Y8%Y../../instbin 8%YW8%Yp8%Yp../../instbin 8%Y4΀8%Y8%Y../../instbin 8%Y$[܀8%Y&%8%Y&%../../instbin 8%Y*T8%Y,8%Y,../../instbin 8%Y1xˀ8%Y3B8%Y3B../../instbin 8%Y8C8%Y98%Y9../../instbin 8%Z8%ZĴ8%ZĴ../../instbin 8%Z h8%Z S+8%Z S+../../instbin8%Zv8%Z8%Z/tmpm88`8%沀pm48%8%Z) 8%Z) !8%[ 8%[ 8%[ !8%[I 8%[I 8%[4s!8%[8ـ8%[8ـ8%\߀!8%\C8%\C8%\'V!8%\+8%\+8%\-D!8%\2b8%\2b8%\4s !8%\8ـ8%\8ـ8%\;3!8%]8%]8%]!8%] !8%] !8%] X!8%]v8%]v8%]!8%]>8%]>8%]GA8%e$s8%e8%e$[܀w!8%]68%]68%e) !8%^Ĵ8%^Ĵ8%e) !8%^ S+8%^ S+8%e)'!8%^z98%^z98%e)'!8%^p8%^p8%e*Q!8%^e8%^e8%e*T!8%^'c8%^'c8%e*T!8%_8%_8%e*T!8%_ 8%_ 8%e*T!8%_8%_8%e*T !8%_p8%_p8%e)  !8%_8%_8%e)  !8%_$s8%_$s8%e)  !8%_*T8%_*T8%e)  !8%_058%_058%e) !8%_68%_68%e) !8%`1-8%`1-8%e) !8%`8%`8%e)'!8%` 8%` 8%e)'!8%`f8%`f8%e)'!8%`98%`98%e)'!8%` /8%` /8%e)'!8%`&68%`&68%e)'!8%`,8%`,8%e)'!8%`3B8%`3B8%e)'!8%`98%`98%e)'!8%aĴ8%aĴ8%e)'!8%a S+8%a S+8%e)'!8%a8%a8%e)'!8%ap8%ap8%e)'!8%ae8%ae8%e)'!8%a$s8%a$s8%e)'!8%a+8%a+8%e)' !8%a1xˀ8%a1xˀ8%e*Q!!8%a8C8%a8C8%e*Q"!8%b8%b8%e*Q#!8%b h8%b h8%e*Q$!8%bI8%bI8%e*Q%!8%bu*8%bu*8%e*Q&!8%b8%b8%e*Q'!8%b#F8%b#F8%e*Q(!8%b*Q8%b*Q8%e*Q)!8%b058%b058%e*Q*!8%b68%b68%e*Q+!8%c1-8%c1-8%e*Q,!8%c8%c8%e*Q-!8%cN8%cN8%e*Q.!8%cC8%cC8%e*Q/!8%c98%c98%e*Q0!8%c U8%c U8%e*Q1!8%c'V8%c'V8%e*T2!8%c-L8%c-L8%e*T3!8%c3B8%c3B8%e*T4!8%c98p8%c98p8%e*T5!8%d,8%d,8%e*T6!8%d 8%d 8%e*T7!8%dI 8%dI 8%e*T8!8%dׄ8%dׄ8%e*T9!8%de8%de8%e*T:!8%d$s8%d$s8%e*T;!8%d+8%d+8%e*T<!8%d2b8%d2b8%e*T=!8%d8ـ8%d8ـ8%e*T>!8%e8%e8%e*T?!8%e2b8%e2b8%f /!8%e6=8%e6=8%f /!8%e:i8%e:i8%f /!8%f8%f8%f / !8%f&68%f&68%gC!8%f*T8%f*T8%gC!8%f/q8%f/q8%gC !8%f3B8%f3B8%gC !8%gt8%gt8%h h!8%g8%g8%h h!8%g#*8%g#*8%h h!8%g'V8%g'V8%h h !8%h߀8%h߀8%h98p!8%hC8%hC8%h98p!8%hp8%hp8%h98p !8%h88%h88%h98p a8%i,8%i,8%jea8%iр8%iр8%jea8%i 8%i 8%jea8%iI 8%iI 8%jea8%iu*8%iu*8%jea8%iG8%iG8%jea8%ie8%ie8%jea8%i!8%i!8%je!8%i&%8%i&%8%je!8%i*Q8%i*Q8%je!8%i.}8%i.}8%je!8%i28%i28%je!8%i68%i68%je!8%i;38%i;38%je!8%j8%j8%je!8%j8%j8%jea8%j$s8%j$s8%la8%j) 8%j) 8%l a8%j-L8%j-L8%l a8%j1xˀ8%j1xˀ8%l a8%j58%j58%l a8%j98%j98%l a8%kbZ8%kbZ8%la8%kw8%kw8%l!8%k 8%k 8%l!8%k߀8%k߀8%l !8%kC8%kC8%l !8%kp8%kp8%l !8%k88%k88%l !8%k U8%k U8%l !8%k$s8%k$s8%l!8%k) 8%k) 8%la8%l 8%l 8%m$[܀a8%l沀8%l沀8%m$[܀a8%l8%l8%m$[܀a8%l>8%l>8%m$[܀a8%lk 8%lk 8%m$[܀a8%l(8%l(8%m$[܀a8%l#F8%l#F8%m$[܀a8%l'c8%l'c8%m$[܀!8%l,8%l,8%m$[܀!8%l058%l058%m$[܀!8%l5 R8%l5 R8%m$[܀!8%l98p8%l98p8%m$[܀!8%mÀ8%mÀ8%m$[܀!8%m8%m8%m$[܀!8%m !8%m !8%m$[܀!8%mN8%mN8%m$sa8%m,8%m,8%o Xa8%m0G8%m0G8%o Xa8%m4s8%m4s8%o Xa8%m98%m98%o Xa8%nbZ8%nbZ8%o Xa8%nw8%nw8%o Xa8%n 8%n 8%o Xa8%n沀8%n沀8%o X!8%nC8%nC8%o X !8%np8%np8%o X !8%n88%n88%o X !8%n U8%n U8%o X !8%n$s8%n$s8%o X !8%n) 8%n) 8%o X !8%n-L8%n-L8%o X !8%n2b8%n2b8%o  a8%of8%of8%p-La8%oׄ8%oׄ8%p-L a8%o8%o8%p-L a8%o /8%o /8%p-L a8%o$[܀8%o$[܀8%p-L a8%o(8%o(8%p-L a8%o,8%o,8%p-La8%o058%o058%p-L!8%o5 R8%o5 R8%p-L !8%o98p8%o98p8%p-D !8%pÀ8%pÀ8%p-D !8%pw8%pw8%p-D !8%p 8%p 8%p-D !8%p沀8%p沀8%p-D !8%p8%p8%p-D !8%p>8%p>8%p-D a8%p5 R8%p5 R8%ru*a8%p98p8%p98p8%ru*a8%qÀ8%qÀ8%ru*a8%q8%q8%ru*a8%q !8%q !8%ru*a8%qN8%qN8%r a8%qz98%qz98%r a8%qW8%qW8%r !8%q88%q88%r !8%q U8%q U8%r !8%q$s8%q$s8%r !8%q)'8%q)'8%r !8%q.}8%q.}8%r !8%q28%q28%r !8%q68%q68%r !8%q;38%q;38%r a8%r&%8%r&%8%tрa8%r*T8%r*T8%tрa8%r/q8%r/q8%t ha8%r3%8%r3%8%t ha8%r8C8%r8C8%t ha8%s1-8%s1-8%t ha8%s]J8%s]J8%t ha8%s !8%s !8%t h!8%s沀8%s沀8%t h!8%sf8%sf8%t h!8%sp8%sp8%t h!8%s88%s88%t h!8%s!`8%s!`8%t h!8%s% 8%s% 8%t h!8%s)'8%s)'8%t h!8%s.}8%s.}8%t ha8%tv8%tv8%u/qa8%tܓ8%tܓ8%u/ a8%t8%t8%u/ a8%t8%t8%u/ a8%t#*8%t#*8%u/ a8%t'c8%t'c8%u/ a8%t,8%t,8%u/a8%t0G8%t0G8%u/!8%t6=8%t6=8%u/!8%t:i8%t:i8%u/ !8%u8%u8%u/ !8%u'8%u'8%u/ !8%u S+8%u S+8%u/ !8%u߀8%u߀8%u/ !8%uC8%uC8%u/!8%u8%u8%u/a8%u68%u68%wk a8%v8%v8%wk a8%vĴ8%vĴ8%wk a8%v h8%v h8%wk a8%v 8%v 8%wk a8%v8%v8%wk a8%vW8%vW8%wk a8%vk 8%vk 8%wk !8%v(8%v(8%w!8%v'V8%v'V8%w!8%v+8%v+8%w!8%v/8%v/8%w!8%v4s8%v4s8%w!8%v8ـ8%v8ـ8%w!8%w1-8%w1-8%w!8%w]J8%w]J8%w!8%w#F8%w#F8%ze!8%w(8%w(8%ze!8%w,8%w,8%ze!8%w1xˀ8%w1xˀ8%ze!8%w58%w58%ze!8%w98%w98%z!8%xbZ8%xbZ8%ze!8%x'8%x'8%z!8%x 8%x 8%ze!8%xz98%xz98%z!8%x>8%x>8%ze!8%x8%x8%z!8%x U8%x U8%ze!8%x% 8%x% 8%z!8%x*T8%x*T8%ze!8%x/8%x/8%z!8%x4s8%x4s8%ze!8%x98p8%x98p8%z!8%y8%y8%ze !8%y8%y8%z !8%y X8%y X8%ze !8%yI 8%yI 8%z !8%y 8%y 8%ze !8%yt8%yt8%z !8%y(8%y(8%ze !8%y$[܀8%y$[܀8%z !8%y)'8%y)'8%ze !8%y.}8%y.}8%z !8%y3B8%y3B8%ze!8%y8C8%y8C8%z!8%z1-8%z1-8%ze!8%z8%z8%za8%z&68%z&68%|߀a8%z+8%z+8%|߀a8%z0G8%z0G8%|߀a8%z6=8%z6=8%|߀a8%z;38%z;38%|߀a8%{,8%{,8%|߀a8%{р8%{р8%|߀a8%{ 8%{ 8%|߀!8%{f8%{f8%|߀!8%{p8%{p8%|߀!8%{4΀8%{4΀8%|߀!8%{!8%{!8%|߀!8%{&68%{&68%|߀!8%{+8%{+8%|߀!8%{0G8%{0G8%|߀!8%{5 R8%{5 R8%|߀a8%|p8%|p8%~a8%|4΀8%|4΀8%~w a8%|!8%|!8%~w a8%|+8%|+8%~w a8%|058%|058%~w a8%|68%|68%~w a8%}8%}8%~wa8%}Ĵ8%}Ĵ8%~w!8%} h8%} h8%~w!8%}N8%}N8%~w !8%}8%}8%~w !8%}ׄ8%}ׄ8%~w !8%}88%}88%~w !8%}!`8%}!`8%~w !8%}&%8%}&%8%~w!8%}+8%}+8%~wa8%~沀8%~沀8%3Ba8%~f8%~f8%3Ba8%~p8%~p8%3Ba8%~4΀8%~4΀8%3Ba8%~!8%~!8%3Ba8%~&68%~&68%3Ba8%~,8%~,8%3Ba8%~058%~058%3B!8%~68%~68%3B!8%8%8%3B!8%Ĵ8%Ĵ8%3B!8% h8% h8%3B!8%N8%N8%3B!8%8%8%3%!8%ׄ8%ׄ8%3%!8%88%88%3%a8%8%8%"a8%Ĵ8%Ĵ8%"a8% h8% h8%"a8%N8%N8%"a8%8%8%"a8%ׄ8%ׄ8%"a8%88%88%"a8%!`8%!`8%"!8%&%8%&%8%"!8%*T8%*T8%"!8%/8%/8%"!8%4s8%4s8%"!8%98p8%98p8%"!8%bZ8%bZ8%"!8%'8%'8%"!8% 8% 8%#*a8%*T8%*T8%Ca8%/8%/8%Ca8%4s8%4s8%Ca8%:i8%:i8%Ca8%8%8%Ca8%X;8%X;8%Ca8% 8% 8%Ca8%8%8%C!8%ׄ8%ׄ8%C#!8%88%88%C#!8%!`8%!`8%C#!8%&%8%&%8%C#!8%*T8%*T8%C#!8%/8%/8%ܓ#!8%4s8%4s8%ܓ#!8%98p8%98p8%ܓ#a8%88%88%,a8%!`8%!`8%, a8%&%8%&%8%, a8%+8%+8%, a8%0G8%0G8%, a8%5 R8%5 R8%, a8%98%98%,a8%8%8%,!8%8%8%,#!8% X8% X8%Ĵ# !8%I 8%I 8%Ĵ# !8% 8% 8%Ĵ# !8%t8%t8%Ĵ# !8%(8%(8%Ĵ# !8%$[܀8%$[܀8%Ĵ#!8%) 8%) 8%Ĵ#a8% 8% 8%1xˀa8%8%8%1xˀa8%W8%W8%1xˀa8%k 8%k 8%2ba8% /8% /8%2ba8%$s8%$s8%2ba8%)'8%)'8%2ba8%.}8%.}8%2b!8%5 R8%5 R8%2b#!8%98%98%2b#!8%8%8%2b#!8%8%8%2b#!8% X8% X8%2b#!8%I 8%I 8%2b#!8% 8% 8%2b#!8%t8%t8%2b#a8%:i8%:i8%!a8%8%8%!a8%X;8%X;8%!a8% 8% 8%!a8%8%8%!a8%W8%W8%!a8%k 8%k 8%!a8% U8% U8%!!8%% 8%% 8%!#!8%*Q8%*Q8%!#!8%/q8%/q8%"#!8%3%8%3%8%"#!8%8ـ8%8ـ8%"#!8%À8%À8%"#!8%w8%w8%"#!8% S+8% S+8%"#!8%28%28%*Q!8%C8%C8%*Q!8%/q8%/q8%*Q!8%t8%t8%*Q!8%bZ8%bZ8%*Q!8%8%8%*Q!8%58%58%*Q!8%8%8%*Q!8%3B8%3B8%5 !8%À8%À8%À !8% h8% h8% h !8%0G8%0G8%0G!8%7n8%7n8%7n!8%8%8%!8% 8% 8% !8%+8%+8%+!8%28%28%2!8%98%98%9!8%]J8%]J8%]J!8%&%8%&%8%&%!8%-D8%-D8%-D !8%5 R8%5 R8%5 R !8%1-8%1-8%1- !8%"8%"8%" !8%*Q8%*Q8%*Q !8%2b8%2b8%2b!8%98%98%9!8%8%8%!8% 8% 8% !8%u*8%u*8%u*!8%4΀8%4΀8%4΀!8%,8%,8%Ĵ!8% X8% X8% /!8%'c8%'c8%!8%8%8%k !8%#*8%#*8%6!8%8%8%W!8%e8%e8%2b!8%98%98%!8%!8%!8%5!8%8%8%W!8%e8%e8%2b!8%98%98%!8%G8%G8%-L!8%58%58%8!8%:i8%:i8%8!8%8%8%8!8%X;8%X;8%8!$8%$[܀8%$[܀8%À!!8%) 8%) 8%,!!8%f8%f8%'V"!8%/q8%/q8%'"!8%N8%N8%!"!8%/q8%/q8%"A8^W8m8%&%$Ul8­8m8%I  (08@H$98­8m8%ePX`hpxm 88m8%$[܀A8^`8m8%3B$88m8% /n$I88m8%% o$Z88m8%,N$O88m8%2bO$I88m8%98p$888m8%$I88m8% h$I88m8%沀$`88m8%W$888m8%k $888m8%!`$I88m8%($I88m8%/q$I88m8%3%$88m8%#F$Z88m8%,$J88m8% S+$J88m8%߀$I88m8% $k88m8%4΀$88m8%#*$_88m8%($Z88m8%.}$s88m8%4s$\88m8%$Z88m8%]J$88m8%I$I88m8%$_88m8%ׄ$I88m8%e$_88m8%#F$88m8%)'$Z88m8%/$I88m8%5$;88m8%1-$g88m8%w$I88m8% X$I88m8%z9$I88m8%p$Z88m8%e$88m8%#F$O88m8%) $b88m8%/q$88m8%4s$J88m8%:i$a88m8%,$888m8% h$88m8%N$s88m8%u*$I88m8%9$I88m8% /$88m8%&%A8^`8m8%2b$m88m8%8ـ$I88m8%bZ$88m8%'$88m8%À$888m8%I $88m8%W$88m8%$88m8% U$88m8%&%$88m8%,$888m8%2bA8^`8m8%05$I88m8%'$h88m8% X$I88m8%v$I88m8% $I88m8%k $I88m8% /$I88m8%-D$888m8%3B$I88m8%8ـ$888m8%À$888m8%A8^`8m8%/$I88m8%W$T88m8%k $J88m8% /$`88m8%$s$J88m8%+$ 88m8%0G$88m8%7nA8^`8m8%.}"$E88m8%k $88m8% U$88m8%&%$Z88m8%+$88m8%05$Z88m8%5$V88m8%:i$l88m8%Ĵ$l88m8%р$88m8%N$88m8%) $88m8%9$88m8%!$88m8%&%$88m8%9$ 88m8%0G$/88m8%5$88m8%:i$88m8%$l88m8%р$m88m8% $88m8%z9$q88m8%W$`88m8%$88m8%$88m8%'c$#88m8%$I8 8m8% $8 8m8%8ـ$8 8m8%À$8 8m8%w$8 8m8% $8 8m8%߀ $8 8m8%2 $a8 8m8% $I8 8m8% U $l8 8m8%%  $8 8m8%)'$8 8m8%/q$8 8m8%4s$8 8m8%98p$8 8m8%$Z8 8m8%w$I8 8m8% $~8 8m8%v$=8 8m8% $y8 8m8%t$Z8 8m8%($I8 8m8%$[܀$8 8m8%5 R$8 8m8%/q$D8 8m8%5$8 8m8%;3$I8 8m8%,$8 8m8%X;$I8 8m8%  $C8 8m8%z9!$(8 8m8%9$l8 8m8% U$$I8 8m8%% %$8 8m8%,&$8 8m8%1xˀ'$8 8m8%7n($8 8m8%À)$8 8m8%*$8 8m8% +$8 8m8%f,$8 8m8%-$8 8m8%e.$8 8m8%#F/$G8 8m8%f0$ 8 8m8%u*4$ 8 8m8%ׄ8$8 8m8%7n<A8^`8m8%-L=$h8 8m8%!>$8 8m8%-D?$88m8%$[܀@$88m8%.}A$88m8%&6B$988m8%) C$88m8%+D$88m8%(E$88m8%0GF$88m8%4΀GA8^`8m8%,H$88m8% I$88m8%J$J88m8%GK$J88m8%(L$J88m8%,M$888m8%2N$988m8%8CO$S88m8%P$S88m8%рQ$E88m8%沀R$E88m8%ܓS$W88m8% T$F88m8%!`U$988m8%'VV$988m8%,W$K88m8%2X$l88m8%8ـY$88m8%Z$f88m8%$[܀[$#88m8%&6\$R88m8%u*]$I88m8%k ^$888m8%!`_$888m8%'V`$I88m8%-La$}88m8%b$[88m8%8ـc$I88m8%d$888m8% he$88m8%vf$888m8% g$888m8%k h$Z88m8% Ui$988m8%&%j$88m8%*Tk$888m8%0Gl$q88m8%m$88m8%n$[88m8%'oA8^`8m8%*Tp$+88m8%-Dq$C88m8%) s$88m8%'cu$88m8%3Bw$p88m8%7nx$88m8%bZy$88m8%z$+88m8% {$88m8%z9}$&88m8%I~$88m8%e$88m8%#*$88m8%'c$:88m8%,$E88m8%3B$K88m8%8ـ$788m8%bZ$b88m8%'$88m8% $>88m8%$88m8%>$L88m8%$J88m8%!`$88m8%$88m8%#F$r88m8%($/88m8%-D$"88m8%3B$&88m8%z9$88m8%+$88m8%-D$88m8% S+$@88m8%v$/88m8%]J$88m8%t$88m8%($88m8%#F$88m8%) $88m8%0G$88m8%5$88m8%;3$88m8%Ĵ$88m8%G$88m8% /$88m8%&6$88m8%*T$88m8%05A 8^`8m8%)' $88m8%4΀$88m8%#*$88m8%($88m8%$88m8%:i$\88m8%!$88m8%9$&88m8% $&88m8%I $:88m8%3B$788m8%k $788m8%5$88m8%8C$Q88m8%-L$ 88m8%1-A8^`8m8%($!88m8%р$88m8%X;$88m8%ܓ$88m8%4΀$88m8% $88m8%($ 88m8%$88m8%4s$88m8%6=$88m8%Ĵ$88m8%1-$88m8%$88m8%>$j88m8% $88m8%#*$88m8%8C$88m8%/q$M88m8%$88m8%X;$h88m8%$88m8%р$88m8% $88m8%$88m8%$88m8%$88m8%$s$88m8% $88m8%05$88m8%6$F88m8%($*88m8%$88m8% S+$988m8%4΀$188m8%k $I88m8%t$Z88m8% U$988m8%&6$88m8%,$p88m8%2b$I8 8m8%7n$~8 8m8%${8 8m8%e$I8 8m8%沀$8 8m8%ܓ$i8 8m8%9$I8 8m8%($I8 8m8%$[܀$s8 8m8%)'$8!8m8%/q$i8!8m8%4s$8!8m8%X;$`8!8m8%Ĵ$I8!8m8% !$8!8m8%v$I8!8m8% $N8!8m8%k $I8!8m8% U$I8!8m8%*T$8"8m8%0G$I8"8m8%5$8"8m8%;3$I8"8m8%]J$I8"8m8%N $,8"8m8%߀ $8"8m8%u* $8"8m8%t $B8"8m8% U $8"8m8%% $B8#8m8%*T $Z8#8m8%05 $\8$8m8%6= $8$8m8%#* $8$8m8%]J $w8$8m8% $8$8m8%߀ $8$8m8%ܓ $8$8m8%% $8$8m8%( $8$8m8%% $c8$8m8%*T $8$8m8%'c $8%8m8% U $T8%8m8%G $`8%8m8%Ĵ $Z8%8m8% h $I8%8m8%沀 $V8%8m8%C $u8%8m8%G $8%8m8% $8%8m8%$[܀ $8%8m8%) $I8&8m8%/q $8&8m8%3% $V8&8m8%98p A8^`8m8%'V$ 88&8m8%7n$88'8m8% #$88'8m8%9 $$;8'8m8%5 %$;8'8m8% &$;8'8m8%w '$;8'8m8% S+ ($;8'8m8%I )$:8'8m8%> *$:8'8m8%4΀ +$:8'8m8%" ,$:8(8m8%( -$:8(8m8%.} .$:8(8m8%3% /$:8(8m8%98p 0$:8(8m8%bZ 1$:8(8m8% 2$:8(8m8%  3$:8(8m8%z9 4$:8(8m8%p 5$:8(8m8%e 6$:8)8m8%#F 7$:8)8m8%*T 8$:8)8m8%0G 9$:8)8m8%5 :$:8)8m8% ;$;8)8m8% <$;8)8m8% =$;8)8m8%v >$e8*8m8%&% ?A8^`8m8%&% @$8*8m8%8ـ A$8*8m8% C$8*8m8% h E$8*8m8%߀ H$8*8m8% J$8+8m8% L$88+8m8%! G$88+8m8%'V N$88+8m8%, O$88+8m8%2 P$88+8m8%8C Q$88+8m8%1- R$88+8m8%w SA8^`8m8%$s TA8^`8m8%#F UA8^`8m8%" VA8^`8m8%!` WA8^`8m8%( XA8^`8m8%e YA8^`8m8%8 Za8% /8%e8%e ` h p x Pj8%w8%f8%f #8%98% /8% /P [8%1-8%8%/tmp/disktab.shadow8%8% !8% !/tmp/fstab.shadow8%沀8%v8%v/tmp/resolv.conf.shadow 8% 8%ׄ8%ׄ/tmp/hosts 8%e8% U8% U \88%&%8%,8%,X`(Z . .. catchmod7* cpx_dd7* dd df edexpr7*hostname  ln lskill7*mkdir7* mt mv pwd pax rm shstty7*sleep7*sync7*test7*[ . ..SYS_INST  SYS_UBOOT  . ..group7* master.passwd passwd* protocols services disktab.shadow disktab fstab7* resolv.conf< hosts7* ... ... . ..fsck_ffs fsck7*reboot*halt7* x_ifconfigifconfig init_s*init7*mknod7*mount7* mount_cd9660  mount_ffs  mount_nfs newfs7* mount_mfs ping7*route7*shutdown slattach umount* disklabel ldmesg7* ... . .. bin dev etc mntmnt2X \sbinX \ tmp usr varinstbin install.subinstallupgradenetbsd*.profile   install.md . .. bin mdecX \ sbinX \share \ . .. tarcpio7*chflagschgrp7* ftpgzip7*gunzip*gzcat7* sedsort7* tip basename  cksum7* sum! cut" gawk7*# awk$ grep7*% egrep7*& fgrep7*' netstat( rsh) tset7** reset7*+ vi, less7*-h more7* . ../mkboot*rbootd\inst.lif  uboot.lif rdboot*bootrd*sdboot*bootsd*ctboot*bootct*@ installboot . ..chown7*chroot*update* . ..miscX \zoneinfo,keymaps . ..termcap . ..Africa\,Atlantic,8Indian\D Antarctica,LAsia]\ Australia,PacificEurope\ WET CET MET EETAmericai EtcFactorySystemVArctic\EST5EDTCST6CDTMST7MDTPST8PDT EST MST HST USj GMTBrazil\Canada\Chile\4Cuba7*Egypt7*Eire7* GBGB-EirejGMT+07*jGMT-07*jGMT07*j Greenwich [Hongkong 0IcelandeIran7*gIsrael*=JamaicahJapan7* Kwajalein Libya7*Mexico\Navajo* NZNZ-CHATW PRCPoland*Portugal \ ROCn ROK~ Singapore Turkey*l UCTk UTCk Universal W-SU7*kZulu7*Mideast posixrules . ..amiga \atari \ ... ... . ... tmpwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: news:*:8: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: staff:*:20:root guest:*:31:root nobody:*:39: utmp:*:45: ingres:*:74:ingres dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/csh toor:*:0:0::0:0:Bourne-again Superuser:/root:/bin/sh daemon:*:1:31::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin news:*:6:8::0:0:Network News:/var/spool/news:/sbin/nologin games:*:7:13::0:0:Games pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:Postfix pseudo-user:/var/spool/postfix:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin ingres:*:267:74::0:0:& Group:/usr/ingres:/sbin/nologin falken:*:32766:31::0:0:Prof. Stephen &:/usr/games:/usr/games/wargames root:*:0:0:Charlie &:/root:/bin/csh toor:*:0:0:Bourne-again Superuser:/root:/bin/sh daemon:*:1:31:The devil himself:/:/sbin/nologin operator:*:2:5:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin news:*:6:8:Network News:/var/spool/news:/sbin/nologin games:*:7:13:Games pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12:Postfix pseudo-user:/var/spool/postfix:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico nobody:*:32767:39:Unprivileged user:/nonexistent:/sbin/nologin ingres:*:267:74:& Group:/usr/ingres:/sbin/nologin falken:*:32766:31:Prof. Stephen &:/usr/games:/usr/games/wargames ( _devs="" _mps="" while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab }   # A C// /N v$NetBSD: crt0.c,v 1.21 1999/01/22 11:29:16 mycroft Exp $NVH0 $n &.#$F$g&Hx//a#Pf#`R#// /.ap/a$Nq$NetBSD: crunched_main.c,v 1.2 1997/08/02 21:30:10 perry Exp $instbin%s: %s not compiled in NVH 0&n a4 SJgJfaHx//aP$RJf$EJg(//aDPJgPJfJg/ /. jN`/HzqHzuHya$TapL N^NuNV/ $nrmaT". X/HjaT$nN^NuUsage: %s ..., where is one of: %sNVH00HzHzHyGFNBEO JgD/aB$R ЂXrOm&`HzHyN&P/HzHyNO PJfHzHyNHxaFNqpwd[testhaltrebootumountupdateddx_ddhostnamemkdir-shshmountchgrpchownlncpiotarpaxsyncfsckfsck_ffsrouteftpbasenamechmodseddmesgrshexprifconfigx_ifconfigsumcksumfgrepegrepgrepdfsortnetstatcatedmvnfsmount_nfskillmtsleepcd9660mount_cd9660ffsmount_ffsslattachtipcpmount_mfsnewfsshutdowndisklabelresettsetlsrmpingviinitinit_smknodawkgawksttychflagschrootgzcatgunzipgzipcutmorelessNV/./. /.aN^NuNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketNVH?0,... *.$nWI/a @"AXvxg/ /a2PJg Jg BHzD`BHzN`BHz[`~G,Nx gvf JfBHzR`^fSJnJfaE-"Jg$KB`,fR`$f SjpJgp/a//ax`NxfBHz aL N^Nuseek errorread errorWaiting for dataNVH>8B"y<&I$Qg ) f"* $cb`$Rf kgvg0Jьg)g 9@xgoadJgBь y<$h%h B "HB ) v Ё(@a @"Avxg " &( lV y< " &(((gR(fp?`B/ / /( av"OvxfBHzaNap`b y yNV nJgfA *fR( kg"n dg`6 sg ug `(r#`$r#`r#`r#`BT#N^NuLESSBINFMTLESSCHARSETLESSCHARDEFNV/ HzEY N/aNHzN/aOJfHzN @XJg Jg/a`a$nN^NuNVB. AH0rN^NuNVB. AH0rN^Nu%cESC^%cNVH0 B. /ENXJf/Hz`>rfHzHy@aԐ`2rm$ B@/NXJf/Hz`//9Hy@a\ <@L N^NuNV#HPB9HBHBTBXN^NuNVaBLBHN^NuNV/ /$./a/Ee:NѹH/NѹL$.$nN^NuNVHyHa/N^NuNVH0 &.az yPJg^Ee: yPI/a$/NйHPxd0/a/NѹHP yPC#PJ(f`a¶PeL N^NuNV"9HLo ax 9H"S#HSLn"9TH#PN^NuNVH0 &<H$yTB`Jg0I/a/a.ԀP 9xL jR‰n̕#T$9PaZ/aL N^NuNVH0 &<H$yTB`d0"I/a/a.NԀP 9xL jR‰n̕#T$9Pa/aXL N^NuNVH0 yPJghI/a"$/Ee:NйHPxd$/NйH"9xSXf yPJ(gaRP/a/NѹHBL N^NuNV/ / yPHcN(I/a$@/ Ge:NйLPHcaSP/ NHXJg aJfB$n&nN^NuNV/ HyHEe:NX c ap`DHyHN @HX 9PbCSSc yP /9PaaB$nN^NuNV/$<HPfp`B"yP"  g Jg g&Jg"aH"yP  g` Hc ) g &<H,fB`RB Cc(99" Jf f p$`fBRbJf$ Sd BSS gSe L|N^NuNV/ / 9\g/aZvB\Xa($@Jgx#d 9`g /aZNXHx yPHhayr#`"9P// /a yPBO9fR/ a*H#\ yP$.$nN^Nu?NV/ .". tgtg` /Hypa`/Hypa ` <? $.N^NuLESSSEPARATOR/NV/ /$.JgrfFa 9\grf#h`Dr#/HypaB/aT#hO`/9h/a<#hP`a"9Pdb 9hfB/9`ad`X/E\NXJfP/9ha0 XJgJ yPHc(9fa@HzaXJf <?z/NXJg BaFB$.$nN^NuNV/$.JXgBX`aJg/adXJmrl/aV$.N^NuNVHyHa1N^NuNV <HN^NuNVaX/ a$n#$XJfL 9$fHzvHzxak`4Hzf/ak`&Jf/ 9I/amBHzCaN$.$nN^NuNV//$. 9v/e>0; N4444n`44444444n444444444444444444444444444444pЂv dHx/aPvdfa#BaB`ش$gѬg9g +g -flv+gv-g `v#`@v#`6vf/aXJg/9Hz/ap`V9 +g -f `/arXJf|-BB. YB/Hx/aR`aJnB [v;e0; Nx~x~rF`"<`r`"<`r@Jg a `@v g2v g,/aXvfp`"pйvealap`p$.&.N^NuNVH8aJg8$9D&9HprfHxBBaX`4/9L//aX `"J@g$9x#aV#LN^Nu[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]NV/ / 9 g xba&rf.Jlg&a f/9daOxXJfBapa$Jhga`HzLaLanBh`>a$f Hx:a`(a,/ERNXJ`gHz"NXa($.$nN^Nuless version %sNV-|HnHzaN^NuNV y JgVxcC# (I`BB aJg,aJg" 9rgmr`rg`pg` p `aN^Nuungetcc overflowNV y Jf#x AxeBHza2Hxao< R N^NuNV/ / &n/ aEXbI/aXSc$n&nN^NuPattern not foundNVH< *.$. Ba( 9g.ga`aJg /a`vyE`,J9lLg Hxa` HxaDXJf*v///9N$ 9r€#O JglJoBHz6aPJg/aL l~J : BHz HxaO `t 9o#Jn atv#aRHxB/9a'O ` 9o#Jn at6#aHxB/9a(lO `EGutJnz#NBB/9`TEGvfJn|#NBB/9`*EGutJnz#NBHx/9`EtGvfJn|#NBHx/9`EHGutJn asN#NBHx/9`afa aMz#BlJ fEutBBHxNO J gB 9 ghf`x2`Z 9EGut` 9EGvfJo#ѠNBB/9ѠNO `aZg aސaZDaVaN`EHG6Jn0|#`& 9E&G lBBzdl#N/9NX`a 9n aLv`/aMX`|aAJlB/9Ѽ,9[I//NO `Faf8aa-@HnHz`ata`A0EchJdgNgHxNXJg nJg I/agBagz#EAJn#NN`|#EAJnz#NN`EAzGxJn.|#`$yEATGRJnz#NN/9BNP`($9ExAGg |z` |z#`8$9EDAGg z|` z|zF#Jn|#NN/9BN#P`a>`afzaHzUa 8X`fJf/9HzbHx aa6&O `Jfatf$Hz:/9daE.a(PJf BHz`Jg BHz%`/9Hz@HxaFa a*BB/9шa$XO.a\O`Ac6Jnz#/9NXJgEr$<BbJgJlgaݮfBae> |l <K-@HnHz`NEchJnz#/9NXJg <BbEr|l <K-@HnHzcNP`AcJnz#/9NXJgBHzB`^BHzHx/a|#a&O `BHz!Hxaal&O $glѬgbBHz/apO `LBHzHx aa*&O `Jf/9Hz|Hxaa&O `\aHfBHzHxaXa&O $gֶѬgz g| g/aeX`BHzLHxaa&O $gѬgz gz| gr/af X`dJgBHzPa"P`JBHzHx%GNE&N&O $g$ѬgAz g| fv./NXJf/9HzJHx%NN&O `.BHz/a:a&O ` 9n z#p"98l# #8` 9n z#pѹ8|#@`lEXzgNBHzHxa/a0,.dgaa&Jdg2a$ag /a9Xrm/a7&9hXJf /a`v/a8/a(BHnHn/a*O$f$Jgt`BHz/EռNPJf-yt` Hz/NPJf r-At`/a-@XgRHnHzau/.ENO G Jg/.//av/NO/N/N/ap`B/aB-@Pl,/ap-@HnHzgau,/.ENO`tJfZ/a88$.a,B/HnINBPGF`T/a L*/HnNBO E` /a\XJfJf/9da6(X/HnN$Pf/NX/HnN&PfJf /ap`./9d/a5Pdg/a/a`/a^BL|N^NuNVBdHxaN^NuNVBdHxaN^NuNVH<$.(. *.`Jg #gp`.$Jo /a4``/a4zX&Sj/aXJfBLXNrfan$nN^NuWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"NVH<8&.a\fZ/a`&B/G fN$/INFOlJxgpO`-CHnHzap~P$|exЄz0e02 NxbxbHx/a#tP`ZHx /N#tHxBB/a6Oxzf./9tNz#tX`BaQBHzkaoP`Jtl-CHnHzan/a2L "Sn0؄BHx/N$@// aҶ/a.h$ /aO +*S'ESj/ awX&` SBRz gzfB L|&^`\NV/. JfHza#Xf #k&I//9a_JVID$.N^NuNVH08&nah(@/ a&t$KXJg RI/aXJg JfB`FԃRJfHx/aLd$$BPJg$I/aLXJg/ / aJPJfB L N^NuSHELL%s -c "%s"%s -c %srNVH88(.Hza(@XJgJg/a,&Xf@Hx/ Ee:NX&@/NXHsaK$// Hz/aOE`BHx/ Ee:NX&@/NXHsaKx$// HzY/a^/ENOHzH/a&@/N`Hz4/an&@ LN^NuLESSECHOlessecho%s -p0x%x -d0x%x -- %sNVH<8/.a*XJf/a(Hza(@PJgJfI/a&Xf /a+p`Hx/ Ee:NX&@/NXHsaJ$/9I/9I// HzR/aXO.aL&@/IN/NO Jg&/ aD$@/ a\PJg /N/N ` / N/N L.I/"DN n n HzaH`/ a(@/ aJVI" L<N^NuLESSCLOSENVH<0 .JfJg /a~XHza*Xg/. EN(Xg|/.N&Xf /a)2`fHx/Ge:NX$@/NX/NXHraHB$////a*/a"&@/ENO.N/NPJg/ a~4L O/a' $.&.N^NuNVHn/.a$JlBB` .".N^NuNVJfa(`aN^NuNV//Jf6#f,Hxad$&Xprg azfRl$.&.N^NuNVJpg Bpa+N^Nu...skipping... NVH?<*.(n$.,.͗aBJg 9Sm 9ml 9Sg~JfJgV 9SnJa$. &.g6ae"//adp8|PvgJ(gaa~ `a@/a~NXHxacX$. &.f aeJgJad/./. ad8|P 9gvfa~a}`J(f Hza`XSkJoSf~B B`t/./. a%-@ -APtvfR:|JfBac*XfBBENPJf&HxHxNPJf&9S/HxNPJfv/./. ac2RPJfTJ(g4 . ".tvf"JfJfJf v#p`EҜtfa}NQBESdJgBl`Jg#fRl`a,Jfa` Jga)*B(Hxa:.L ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. --------------------------------------------------- m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------- :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. = ^G :f Print current file name. V Print version number of "less". -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. __<_f_l_a_g_> Display the setting of a command line option. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. --------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - command. -? Display help (from command line). -a Forward search skips current screen. -b [_N] Number of buffers. -B Don't automatically allocate buffers for pipes. -c -C Repaint by scrolling/clearing. -d Dumb terminal. -e -E Quit at end of file. -f Force open non-regular files. -g Highlight only last match for searches. -G Don't highlight any matches for searches. -h [_N] Backward scroll limit. -i Ignore case in searches. -I Ignore case in searches and in search patterns. -j [_N] Screen position of target lines. -k [_f_i_l_e] Use a lesskey file. -m -M Set prompt style. -n -N Use line numbers. -o [_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] Define new prompt. -q -Q Quiet the terminal bell. -r Output "raw" control characters. -s Squeeze multiple blank lines. -S Chop long lines. -t [_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U Change handling of backspaces. -V Display the version number of "less". -w Display ~ for lines after end-of-file. -x [_N] Set tab stops. -X Don't use termcap init/deinit strings. -y [_N] Forward scroll limit. -z [_N] Set size of window. --------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. CNTL-RightArrow ESC-RightArrow ESC-w Move cursor right one word. CNTL-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. CNTL-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. CNTL-DELETE ESC-DELETE ESC-X Delete word under cursor. CNTL-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. CNTL-L Complete filename, list all. !NV n". <,g Ө PfN^NuNV/ $n"n JfC,$%I Q!J""iR%IHx/aRR$nN^NuNV n"P#h"h"Hx/axSRN^NuNVH0 $.&. Hx&Hxa!n$@/a!%@%|%|B*BB // aB L N^NuNV/ / &nJg*df / at#dX/ aR/+EN/ N$n&nN^NuNV nJfA,  ,VIN^NuNV nJfA, ( ,VIN^NuNV/$./aXJf /aJfB$.N^NuNV 9RN^NuNVH 0$.G,$Sg/*/a=PJf `$RfBL N^NuNV/$./aXJf /. /a$.N^NuNV nBJg (N^NuNV n (N^NuNV"n n #X#X#P"N^NuNV"n n   "N^NuNV n|N^NuNV n(IN^NuNV n . ѨN^NuNV n (N^NuNV n ( N^NuNV n!n N^NuNVH<0$.&. prgzzќf4pJgp/ yXA"[I҃т////afO//E*lNPJf*a//a//NG,N$Ozfa.pr`Bz gz fNx`JNBS///a >O Jg*Jdg`zg:N$z f`.NtvցՀB`(N$#fE,z gzfN$&p/a XJ\g4Jg0` #fPN$z gz gzgaN$& "L zm&aJf/9Ѽa//aBHzT` -DHnHzga7L &.$. .".BB|܁ۀ////aS@OJgt//a(PJѸo/a"9҄ҀXpxn 9 cp`JozJg8SA 0 f(EJ2f/aXJo 9S`8 9o6"SA0g& g | fJfI/aJotSA 9AٹBL|N^NuNVH<(.$. &.J9g*/9/99I/a~O Jgp`hB9z f J$ y"98O o 9xjR‰l/ar L0*.|mBB`G$Sg o$Rff *"* `a%ڷg j "*o\$j/* /*a|TPJf(*$*&* oB//a$&O #f^prgTRn`X/* /*a{PJf8(*$*&* l4B//a$&O #f prfpr`Sm///a "L |N^NuNVH> (./EN$&a}p*,`lR/N$&XprfJlprf$&//a(fS L|N^Nu! /dev/ttySHELL%s -c "%s"sh (press RETURN)NVH?<*n -fR` aBHzERN/ NHzNO a *Baa@a#B.<"GNB,<"FNB(<Yn"DN$B&<"CNBHzJap\OJl/"DNXHz7a(@XJgNJgJJf/ a$@X`8Hx/ Ee:NX&@/ NXHsa$@/ / Hz/ aXOJfAJfHz`/ N$@X/ ag*/ aTB"CN/"DN/"CNHx"FNHx"GNOJ g/. ERNHzNa$XPa?fr#@/aBaPLLN^NuCannot seek to start positionwCannot create pipeNVH?<(.*. ,.(n*n//axXPJgBHz`Hz/a:@&@PJfBHza#0p`Ta?HzERN/NHzNa><$.(n aQ#SBHz (<Y "DN$@XJg Jgz#Hz/9&<ռ"CNPJfz#pHxaߢ#a5aa$a~aXJpg0HzGXNHzNHzNHzNHz"DN/NO`Hz"DN/GXNPzf4Hzl/"CNPJf HzcNBXHz\/"CNPJf HzVNBXK2Jo: T -g +fJ(fNJg$\SHz%/ "CNPJg / NXJnNJg aBaHz"DN @#XgJf"Hz"DN @#XgJf #Hz"DN @#шXgJf #шBJJtlBHz9a2`(/9|a-@HnHz%a/.aے$.N^NuNVp#x/. /.aN^NuLine number is required after -lNV/$. JfB-BHnHxlHna O JfJnBHza`r#/aZ$.N^NuCannot use lesskey file "%s"NV/$. Jf2/aXJg$/a-@HnHza/.aڒ$.N^Nutags support is not availableNVH< .". Jgzg `x#`pJgBHza`Z/a/aDa(aFPJf6aF$&prf /a`/a/9Ѽ//aL mg sf2E|R`.EрR`$EфR`EbR`EfR`E|/a؈/ aj$` 98A|-p HnHzJa$n&nN^NuNV .gmrm/9@al#@N^NuNV .mrl rfa92N^NuNV/$.pmJmafJfBal$.N^Nu-" must be followed by 1 or 2 charsquotes %sNV . n rgBmJg`drf^J(gJ(gBHz`D(f `2`*yyB.C-IHnHzaN^NuUse "h" for helpNV .gmrmBHzap`r# ȄLR`/avxfV` 9l`Hz8/9da4.a` 94`BJ4gaP8vxfV`jax]`\ 9ѐ`\B/a~XvxgaOJfJR`^ID `,aOvxfV`/9daJVID`BLN^NuNVH?". pЮ|6e0; N^n^|/a(*Xprg\//a`T/9a"`F/9d`/9da`/a> @XJg/a`aN$&BRчB~c//a* @PJoHha`a`:/a(*aNb$&XprgJo////a/aF`aN($&prgn//a`h yL <ȄdX" ( fNC#L Sd< @`/9daXJg"/a/aX$/a/aH`aLN^NuNV/ nrR :g n Jg0 .g` ?g \g`R`tf `Sf `R` S$N^NuNV/ / $n&n  lgn bg ` pfRIr2e0; Nvp|jfB`&r&` r&`r&`/9Ѽa&`BS $n&nN^NuNVH0 n&. #ȄLf <`$H :gZn %g^ .g` ?g \fR yLRL``RIg6BHn/ a$@/./aOJf6/ a6$@X`*RIfS`BHn/ al$@/./aORfdBѐ yL <ȄfB`BJoЃ"9Lb ` <ȄL N^NuNVB/9baN^NuNVaOf( yxTtHh 98A|/0 ` yxTtHh/9faN^NuNV/ /$.tgJgbE/ HxaPJxf^#P#T#X#\#`#d#h#l#p#t#xr#x/ a0X Xg(b\rnge r2ge Jg`jrKg`^ gb g`D g ,g`, %gb2 gb g` `g g` gb Kg` g g`By$Ch`3$Ch`3$Ch`3$Ch`3$Ch`3$Ch`v3$Ch`l3$Ch`b3$Ch`X3 $Ch`N3 $Ch`D3 $Ch`:3 $Ch`03 $Ch`&3$Ch`3$Ch`3$Ch`3$ChB.#$B.#ѬB.#Dnpr€-A|B.B.B.`ZE$P-yT-yX-y\-y`-yd-yh-yl-yp-yt-yx/ BHxa|#t$.$nN^NuLESS_TERMCAP_NV/zzzzzzzzzzzzzz/.tԎ/aX/at.$.N^NuNV/$./ax @XJgBg 0VID`Jf /a<`B$.N^NuNV/$./a2XJg /a`Jf /a`p$.N^NuNV/$./aXJfJf/. /a`B$.N^NuLINESliCOLUMNScoNVH0 BBHn/<@thHxaO Jf0.gB40.g6HzEY NXJg/aL#X`*Jo#`Hza XJo#`r#HzkNXJg/a#x`(Jo#x`HzKaJo#x`rP#xL N^NukrklkukdkPkNkh@7kDNVH?N#Hz5N#Hz,N#,Hz#N#ѴHza#TOlBT#Tt 9T#0###(#X#oBќ-|̠HnHzGN @#РPg$EpHnHzN#Pf #HnHzN#Pf #Jf,Jpf$HnHzYN#HnHzLN#OJf #Jf #HnHzN @#иPgJfr#p#иHnHzN @#мPJѴgJgJfr#p#иHnHzN @#дPgJfr#p#дHnHzN @#аPgJf#аB`r#HnHzKHzGHyHyHzPHzOENHn/9/9HyHyHz*Hz)NO8Hn/9/9HyHyHzHzNHn/9/9HyHyHzHzNO8HnHzN#Pf #HzNXJfHnHzN @#PgJf #HnHzN$Pf$< yаJfE?`4BB/a//.aN$n/ av nA-HOHzA/ /IN#ФHnHz+N$Of$< yаJfE`<"9S/B/av//.aNb$n/ avN nA-HOHz/ /N#ЬHnHzN$Of$<HnHzN$@PJfEQJ,g#Ш`Hz=/ /N#Ш yШJfr#$LN^NuNVRN^NuNVBHz/9/.al 9N^NuNVH08&n(n JfJf(v#p .` Jg/ EN$/ N" n ` L N^NuNVH 8(n&n$. //.EdN(Pf (&` //. N&Pf/HzpN&f&LN^NuNV/ J f6Hy/9/9ENHy/9/9Np#l$nN^NuNV/ J f(9JfJfz#Jfa`p 9SobG/ N$&Xprg:HjNHx////aVOJg//a/ a^aݐO R 9Sn#L 0$n$. &.Hn//aF(*$R2|JgJg *"*f*%B%C` * "*f%B %C2|$R` nJg *.$n (.JgJfpaJf BHz|` "9 g BHz` 9ќ|fBaX 9ќ|fJg Ba4B`/ a$X|ѤfHx/ / axO // aVPJlp`#g|ѤgB` #Ѥ 9ќgBaBa\X 9ќ|fa/a-@-AX$&prfJl `BHza֢p`pBHnHx//HxHx//ab(O$g|ќfJoHxa``f/9Ѽ/./.aO |ќfHxa.BL|N^NuNVH?8,... (.*.&y(y -y-yaJgf"y$y " tvg2prg " n-y-y .".쒇l$a prg| yXA"[Iځـ`fprg( .".쒅l yXA"[Iځـ`( * " o0 yXA&[I B"C " oBB`&&F(G`,...prg "oPHnB/.BHx ////aJmL(9*9prg .".o -n-n## ##LN^NuNVH08&.$n &n(ng<"C JfJgJg RRgJfJg&Jg(p` RfBL N^NuNVHzHxaExr PJPgaN^NuNVHzHxaEJr PJPgaN^NuNVHzHxaEr PJPgaθN^NuNV/ Jg HzhHxEFNHzHxNHz`BHxEFNBHxNHxHxN$nN^NuLine numbers turned offNVH00&9 g B gzHxHxEFNaaa6BGNBHxNBHxNHxaD/aDO .HxNHxNar#@rO g@$9x$yaִxfg 9R jR#Ѡr#@g8aJ\g*B\r4fr#@B4BHzaL N^NutagsrNo tags fileNo such tag in tags fileNVH<<(./9ac>-@Hz/a&/.a"OJf BHz`/Ke:N$XE*<r`b// /aO JfL2( g f:B(B$B,Hr(GfN-@X @Jg#$"H`Jg R-@"@ g fB .R-@/N-@X @Jg/9$a:#$HnBHna&#,OJgB, nIR n ^fR-HHx/.NXR/a,#($@P"n I` g$ \f I-L"LR n"HIf *$WID#0gSB/af`0/Hx/ (ENO Jf/aFBHzaB$L<0 9,g /a`BHzabpr`BBBBa(P#f*,Hn//a$&O JgRprgEe:G J4g///aO /9(N$@/ /./9(NOJfJ0g n2g fp/9(a4B( "L |N^Nu/dev/ttyNVBHzap#4lr#4N^NuNVN^NuNVHxHn/94aO rfp`&Jl Hxa@J.f|rfB.N^NuNV/./. /.aN^Nu@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $NetBSD: cut.c,v 1.13 1998/11/06 23:07:39 christos Exp $b:c:d:f:snr%sstdinNVH 8$.$n a(HzBaF hPI`rЁr4e0; NjjG /9$Fadr#HX`@ y$Fhr#``*/9$Fa8G r#dX`r#X`aHz/ /NO rf 9DE Jdg JHg`JHgJ`fJXgaJgHJgJfHzHxa>2 oHx/HzHxa>\o#\ B` RlBHzZ/N-@ @"HPJf 9Lg\l#\ 9Pg/Hx1HyUa<LN^NuNVH80$nB(<U&D&9\g *"S%ASj/ a֐X$` RBRrgPr g JgB 9"S#Sjm  g yR`Hy/a6PSfr gJLg`Jr g 9"S#Sjm  g yR`Hy/a6 P *"S%ASj/ aղX$` RBRrg4`r g, *"S%ASj/ a~X$` RBRrf 9"S#Sk y R`HyHx a5P`zL N^Nu%s: line too long. NVH?<*n.. yh*Ir`BB$E.I`RIf/HzHxa;fp| fJfJXf/Hz a`GU&9\$EgJgR|gB 9,S#Sjm  g yR`Hy/a4PI| g(gX 9,S#Sjm  g yR`Hy/`I| g g I| f| gSRf:| gJLgJgB 9,S#Sjm  g yR`Hy/a3PI| gX 9,S#Sjm  g yR`Hy/a3lPRI| f`R  f 9,S#Sk y R`HyHx a3P/ Hx/NO JfLJZ@g>Jf.Jf&HyZPHyެ/9^`Hz Hya OJZ@fJWID#Z@JgHyެGe:NXEFvmHyެNX"<"rvl"<"p`"<?/HyެHzHyNO`8JgRJZDfJ"yⰳ^dg<*nGHzHy(,<ռ FNPJfG/ Ie:N(Xr m / ` Є`XHuHE/ aXO.aQ$/ N&P* ڃ/N$Xl  2/g/ E/ FNPJgXJfBL<|N^Nu.ZNVH0<&. G/.Hyެa4/HyެKNOJgJgav @rg Hyެ`HyެaXJgHyެ`lHyެa:$HzHy(a@O JfG I=/HyެN/HyެNOJg.EެB2(X fHy(/ N/ ar#p`BL< N^Nu%s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged NV/ / HyެHyZPaHyZPa$@O JgJf^ 9fJfJfJfJfJfJfHyެ/9^`Hz(Hya2`/ aNHzH/ GռNO Jg Hz7/ NJf J`jB`fJgJJfJf&Jf/ Hyެ/9^`HzHyaJfr#p`BZ@Hy(HyZPa B$n&nN^Nu%s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored NVH80JgLJgD 9ⰰ^ddA^l0R` HxaJX@ 9ⰰ^deBHx`P 9ⰰ^ddA^l0R` BaJX@ 9ⰰ^ddA^l0R` BaJvX@r#RBHBZDHxHzz$U&/G&NO JgHxHz]/NO Jf 9ⰰ^ddA^l0R` BaIX#rg"/Hyެ/9^`HzHyad`#b 9ⰰ^ddA^l0R` BaIXgHyެ/9^`Hz`Dg2Hyެ/9^`HzHyar#Olg:BCHyެ/9^`HzHyar#Opl 9ⰰ^ddA^lB0R` BaHX$ 9ⰰ^ddA^l0ሄR`BaHXሄ 9ⰰ^ddA^l0H@B@R`BaH\XH@B@ 9ⰰ^ddA^l0r㨄R`BaH&Xr㨄JgJf#Z4"9ⰲ^ddR` BaGX"9ⰲ^ddR` BaGXJg 9ⰰ^ddA^lB0R` BaGX$ 9ⰰ^ddA^l0ሄR`BaGfXሄJg"/Hyެ/9^`HzWHyaOg 9ⰰ^ddA^lB0R` BaGX$ 9ⰰ^ddA^l0ሄR`BaFXሄJg"/Hyެ/9^`HzHya@OSrg*"9ⰲ^ddR` BaFxXQBBSdgJfJgJg rl0E^l 9ⰰ^dd 2R` BaFXJf`VHyZPaG$$BXG^l`^Pe Hz>aIX 9ⰰ^dd 3R` BaEXfg8`BaEXJg( 9ⰰ^ddA^l0RJfrf""9P#H`HxHz/NO JfHrf>HxHzHy^lNO Jf&B#b/.a+XJf`HxHzz/$KNO Jf#r#`HxHzQ/NO Jf#r#`XHxHz,/NO Jf# r#`.Jg.Jg&JfB#x\Br#ZD 9lhrf(Hyެ/9^`HzHyar#p`6JfHyެ/9^`HzHyaJfr#pL N^Nudeflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s NVH< (.&. J4g6Jm6B4Jg Hz6aiXJfHz=aiX`zJlv 9 o "9$oJg //Hz9`Jf//HzNaiTO 9 "9$Hy/9$H/aFHz#ai`t#^P#Z8E(zfJZDfHxHxHx/ae# OghP#HxHn/aeVO gaEB.ኄ.B.ሀ.H@B@B.ቂ.B.ሀ.H@B@#^PHyZ4a @XB( XJg//A8/0<Hz>NO/9^P/9HzN"9O zf# BHB^PB` 9 mЁ# "9^Pzf#$BHB^PBB` 9$mЁ#$Hy/9^P 9ⴐH/aEDHyZPHzNL $n,. / a,F(2Hv֎Hx`//a]O B2HB// a2O Jf//aJVIDH L|N^Nuname too shortcan't recover suffix .internal error in shorten_nameNVH0<*nt/ a+&XJgrm HzaBB58`/ af$@XJf Hz}aBXBr#Z@rl4HzI/ aPJfzzz `In`SgBHx// N$@P Jg R$@Jg"Hz/ aPlGJgRJfJgJg AJf`"Hx./ N&@PJf HzaAXJ+fSHy(/ aL< N^Nu%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten NVPH 0EN @BtԎG R`N @r?fHyZPaX/HyZPNPJfJf0/HyZPa(PJgHyZPa/HyZPNO JfL/HyaPJgfHyZPHyެaPJf( <?Jg </Hyެ/9^`Hz`HyZPHyެ/9^`HzHya `JfAPPhQHyZP/9^`HzHyEFNOJgDG(2k/ aWXJg,HzuHyNHyaR/ HxOHnPa5O.PI yL0grYf`rygHzLHyNJfDr`:HyZPaȸXJfB`,/9^`HzHyaHyZPar#pL DN^NuNV/ $n -j-j$Hn/.aPJgX * @gFJf/9^`HzHyaHO Jfr#Jf HyZPa $nN^Nu%s: time stamp restored NV/ $nJg6 9Z4g.$g(%@$rlHyZPHzHyaO / HyZPa "*/HyZPa0OJgHJf/9^`HzHyalO Jfr#JfHyZPa.X/*/*HyZPaB(HyެaOJgFJf/9^`HzRHyaO Jfr#Jf Hyެa$nN^Nu%s: %s unreadable ..%s: %s/%s: pathname too long NVH<<&./a(Xf$//9^`HzHya`r#`*<`Hz$P/EռNPJgHz{/NPJgz/Ee:N&@/NA P n4/E/ I=BNPKJg/R/HsN/ NO `&///9^`HzHyar#O/ ENXJfR/aL<±~b4/aN& 9xXd&xf 9Z0Z cv yZ("9Z0xdeHh R/a -@"9xR 9Z(#xU#Z(PBG^dC^dBEZ2 9Z0(@R#Z0"9p @RIZP4#p 417 3 9Z((S#Z(xfvI#Z0JgB R"9^X/ FЀҍ/(FN#Z0^XO `lJgPB5/Ba PJg2B"9^X(9Z0/ FЀҍ/(FN#Z0^XO RZ0` 6|R#Z0Sx`af 9x bJtgJfJg$ 9Z0SAZP0/Ba 8PHx 9^X(9Z0/JmZP`B/(FNL2<<2|$Rl$ R5<nFK Ru*ȹn *n u B22< ЈLѹ lJgB01<ЈLӹ pR 8*. B@rx؎CA XH2R|lBm8B(D$nGB4XJg/ Ѐ84/Rta 84PXRlL|N^NuNVH?<"n&Q(i")x*B #=$B&<,o3,s4XPC,1(0RbR"nR77,#0RHx/ "FNP 9 ~mj 9$"@S#$C,#0 /.a,// aLJg:Hx/ ajp й tx"@C# tHx//a,O`f8HxHla*HyHyta 9 tVй p# tO`RHxHlaHk(9 R/"yR/ a>Hy|Hyބa 9 tVй l# tOa\Jg a^ t 9 tLN^NuNVH< ".$. A^l 9 \R \Jf AބRp,`tSAlB0(AބRp  nAlB0` Al0 A|Rp 9 `A^P1 R `9 j9 h9 j j(9 \Cf(A\ 9 d hR dB9 h jzlR fL"&9Z0^XBE(A|4X ZLҀRzl ∰ `cpbB g  `fpL5</<5</`AlB08B05- /B05- /N"A 0PE^PGlgAl//NP"nB62R bB38` B3 "n B01,/B01,/N"C( 1PgA//NP  \eB0-/B0-/NLz#`4Hyެ/9^`Hz.Hyaz#BTBXp`BTBXBL<(n~(> GB-J $(nv p*BK* Ѐ!1ڋnm.qG$.n..nS-G(ne|c`R*n d r brA(n=lX`&*nu (nX *n=u r$쪶c0(BI* *AK* ЀCA Ѐ2ԁbt..` fpS"€*n(nrg&t nzYrYzSv"S fSdRn..norBJg ~VIDLX 娆Prd*BCHCrԁreDE^lBB 9ⰰ^dd2 娆R`Ba X 娆Prd Fgp`BCHCrԁSrgzGZPBreBE^lB 9ⰰ^dd2 娆R`Ba pX 娆PrdxR f#Z$a BQQBESd#Z$#ZL#ZHBL N^NuNVpH 0EtpFAr YQBBSdA@tor QBBSd$<Ar R o nA,r R or-A|Hn|HnxHyHyHxHx / GN$Of| Jr Rrlr-AtHntHnpHy`Hy$BHx/ N$Orl /.xar `2/.t/.|/.p/.xaOJf/.xEJN/.pNB`pL dN^Nu incomplete literal tree incomplete distance tree NVH?<(9ZL&9ZH~eDE^lBB 9ⰰ^dd2 稈R`BarX 稈P~d ~-@[~eDE^lBB 9ⰰ^dd2 稈R`BaX 稈P~d ~R-@[~eDE^lBB 9ⰰ^dd2 稈R`BaX 稈P~d ~&@XY b~e BIcdBK\~eBE^lB 9ⰰ^dd2 稈R`BaL N^NuNV//.a$XfHz{a $.N^Nuoutput in compress .Z format not supported NVJf*r#HzHyaƼ". gr#pN^Nu %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.NVH?< 9ⰰ^ddA^l0R` Ba2X# vFƀ#v`g:Jf"/Hyެ/9^`HzHyaŐOJfv#p # v-Cvl0Hx/Hyެ/9^`HzHya>v#p`-y^dz -|-n:|BB&y& &C.<Jg.<HxBHy^daO tFA[OSQBBSd $9^dBoA^lERn#^dv?e C" L@GR f-n` pS-@pS-@` @^lPh .$.脀B(H@B@ vĮvf,E o HzaX*B-M6 HR`| f Jf(BE^NnZlRA|$<Jf(Jo$/Hy /. -HaNٹ^PO n Jg </NX.$ c$"<ZPA^d"A1(40* bCZP1(-B.$<^N"҂ ?oj <@l$Jo// C HqHaO ؂ ?o&Jf/Hy /. a~ٹ^PO B$<^NJn` //  /-AalO ".(l"nT2CZPxR*LmJfJfJo/Hy /. aٹ^PBL8Hx E@N*Xf@Hx N$&<ABSQBCSd&<A~N0UQBCSd`BoI G8B9A B40 |l 32 bitstoo many leaves in Huffman treeNVH<GE^l$R 9ⰰ^dd 2R` BaBX(SJnRo 9R L<EjJg 9/5 /Hz9HyaDO/9Nѹ`Jg 9(R#EJgrJg R#`JgD u (-f//HzHyaO`/I//HzHyaO/9NѹB`xfVRo# R`@Jg/5 /HzHyabO/9Nѹ"F :Wx:`/9NѹJg"n" lJg B` , `Jg* 9 u (-g yI//aPJfhJgJ 9 u (-f/9/Hz=Hya`/9I//Hz=Hya#RB` yRI//at @$yPJfRJg :f(Jg//HzHya #B` (:f| (:fJg#`ZB`XJg#`F 9ؾf4Jg//HzHya#"F :W:I`# RB L8,9^T 9Z($|^d(|ZS*9Z0&LE~bBZHxHz/ NO JgHx Hz/ NO JfJgJg`Jg`HxHz/ K&NO JfJf`"HxHzw/ NO JfJg Jgnr`hJgdr`^HxHz/ NO JfJf.`6HxHz9/ NO JgHx Hz-/ NO JfJg Jgr`Jg r`p`HzHn CN$@PJf,BL<N^NuNV/./. /.a$N^Nu$NetBSD: cchar.c,v 1.13 1998/07/28 11:51:47 mycroft Exp $ys okf`[VPLG ?9 2- ( #werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscardrprntflushbrkNV"n n //a+N^Nuoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sNVH8<$n*n R&-CHz&Hx HxHztԎ/IN&@OJf$HzHx HxHz/N&@OJfB`& RC$$hJf/Hza$a%TP ufHz/ a*PJg <&.Hx:/. *<n"EN-@ Pf BaX . R-@ gHzHn aX&@PJgJgHx=/ "EN$P(<eJf/ ajX"BRBHnHzK/"DNO cfHz;/ a'PJf "C#n`F ifPHz/ EռNPJf "C"`" if,Hz/ NPJfHnHz/"DN"C#n$O ` lfHz/ a'PJf "C#n ` ofPHz/ EռNPJf "C#n` of*Hz/ NPJfHnHzx/"DN"C#n(O `tE^ RJg`IbfB// a&PJf2"pЁ"CKA|e/Hz /"DNO " R`I E RJfJf/ aXJ fP +g& UC* ()@f/ HzGaaP/ kNpL<N^NuNV nHx/(HhDHhaN^NuNV nJg/a` h"r ($@@!@$!A N^NuNV/ $n/*a5@Fr%A$nN^NuNV n|+|-|0p$rC!A$hr!A N^NuNV nHx/(HhDHhaN^NuNV/ $nJg BHn` r-AHn/<t`/atr%A $nN^NuNV/ $n/*a/Hja]r%A $nN^NuNV nJghp` hpp!@ N^NuNV/ $n/*a~/Hja]r%A $nN^NuNV/ $nJg/ aP` Hja] * @@%@ r%A $nN^NuNV/ $n/*a5@Dr%A$nN^NuNV n ( @K!@ !|+ ($@g@!@$r!Ar!A N^Nu%d %d NV nB0(F/B0(D/HzaTN^Nu%d NVrҮ/a]./Hza.N^NuTIOCSETDNVBHn/<tBaO JlHzHxaN^NuTIOCSTARTNV/< tnBaPJlHzHxaN^NuTIOCSTOPNV/< toBaNPJlHzHxaN^Nu$NetBSD: modes.c,v 1.14 1998/07/28 11:40:59 mycroft Exp $>:62+#  #3#3233#@@@@wn-cdtrctscdtrcts-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5zrle^ V P@I@C<6/*$   -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrkke_XOE?82+$ @@@@    xqib@Z@SKD < 8C$3C,C$$C -kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoechoyrmg`XR K D@<@-onlretonlret-onocronocr-oxtabsoxtabs-tabstabs-ocrnlocrnl-onlcronlcr-litoutlitout-opostopostNVH 0 n&n P$E$Jg2//aPJf *F '@ '@ `E JfEJJg0//aPJf *F'@'@`nE JfE~Jg0//aPJf *F$'@$'@$`6E JfEJg8//aHPJf *F'@'@r'A p` E JfBL N^Nu$NetBSD: print.c,v 1.19 1999/03/02 17:27:03 christos Exp $tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s%s NV8H?<*n$n .,.BJgPrgmrg`0rgrg`"Hz`Hz` Hz`Hzaܺ&X`/Hzaܨ&P/ aN$/ aNPg//Hza~րO `/HzajրPrdB0*/B0/HzaHրO Jg Hza4X$- HzsIʜNXrefz/aXGreJm/NXre fA/NXref/NXreg/NXregA/NXreg r/NXreg/NXregA/NXreg/NXre g/NXreJl ЀD/NXregA/NXreg/NXreg/NXreg/NXre g/NX$HzNXreg /NXref/NXregA/NXreJl#/NXre f*/NXre gA0/NXre f7/NXre f>/NXreg rG/NXrefO/NXregW/NXregA^/NXregf/NX$-HzNXref ru/NXref|/NXregƒ/NXrefAŠ/NXregA’/NXregA™/NX$-Hz}NXre f¨/NX  g nJg`, g g`Hz=`Hz;` Hz9`Hz7NX¿/NXre g/NXrefA/NXreJBl/NXre gA/NXreg/NXreg/NXreg/NX~ލrfVHzNE^XJg%dNV/". f <V`p npШte/HzHxHya;`BAJlM-At‚tf ^?`tm^@B <$.N^Nu@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: stty.c,v 1.17 1999/03/02 17:30:05 christos Exp $-aefgaef:g%sTIOCGETDtcgetattrTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZNVH?8&.a9jBB@`Hz/. /aOO rgrЁr(e0; NRX^4|`64|`0Hx/9$FaR-@Pl/9$FHzHxav4| 9Do2Hz n /0 aD$ 9D n /0 a2O g 9D n A -H Hn/<@t/.GNO JlHzdHxazڎ//.aPJlHzIHxa.Q//<@th/.NO Jl Hz+aXrg(bre*` n Jf / /.//aXO` /aXBB n Jgx؎,B/Hn aPJf/Hn anPJf/Hn aPJf$n "R yL08g*/ a $//aA//aBr-AO`HHxHzX/aQXO Jf n PZ//ar-A` n /Hz*apaP n I-L Jf*Jg$/B/.a&O JlHzHxaZJg"//<tg/.NO Jl HzaXXBaNqusage: stty [-a|-e|-g] [-f file] [options] NVHzHyauHxaNqNV/./. /.aN^Nu%.6gsourcehelpusageversionassignfilefield-separatorcopyrightcopyleftnostalgiaposixlintcompat+F:f:v:W:m:@(#)srcfilesmain%s: %s: can't allocate memory (%s)-m[fr] option irrelevant-m option usage: -m[fn]=nnnempty argument to --source ignored%s: option requires an argument -- %c POSIXLY_CORRECTenvironment variable `POSIXLY_CORRECT' set: turning on --posixno programNVH>8(.&n a4N*<BHyHxEFNHyHx NHyHx N/a0#h&HxHz/9aNXO(JfX|m HxaJXBBHzgaz @#BB|>!F1||aFa $/a#Of(a" @/a*/HzHzHzaaO/B/9atBO`BOdtO EG`Jg|#O`|fgnm2|FgVm|Cg*mvJg`l|Vg |Wg`X|sgm |mg`B|ug|vg`./9OXaX`l"yOXI yL0gRI0f 9(@R#"R y|!Jf 9O\! RO\` !OX`/9OXa X`J g Hza`X yOX rg ff (=gHz`:/9OXa X`a`aX`BaLX`"yOXJfHza_X`r 9(@R#R y|!!`NJf" 9Odg//aPJf #O\v`L 9Odg//9hHz}HyapOBOd$9O\BHy // /NO|fJga Jf4HzTa1TXJg|#J g HzDa^XJg|#8y/ aXJg|#"9|fL SO\mJgHxaX"9(AR#R y|! 9O\! R#O\/ /9h//9O\aaaԌOJfJg HxaabJ g$Jf$JfJf Hza]XJg|#/9a"XBJfJfJg af 9g|#/a XBar\JgJf|#/9aNq -f progfile [--] [--] 'program' [POSIX or GNU style options]Usage: %s%s%s file ... %s%s%s file ... POSIX options: GNU long options: -f progfile --file=progfile -F fs --field-separator=fs -v var=val --assign=var=val -m[fr]=val -W compat --compat -W copyleft --copyleft -W copyright --copyright -W help --help -W lint --lint -W posix --posix -W source=program-text --source=program-text -W usage --usage -W version --version NV/ /$. <*Hz&//9hHz//9hHz 9"R#R yr!!`"I/HzCHyacO Rf\$n&nN^Nuawk: bailing out near line 1 NVHzHyabaaNq%s, patchlevel %d NVHx/9HzHyabBadNqNV/$.Hx//a"Jg$R $.N^Nueval.cinternal error line %d, file: %suse of `break' outside of loop is not portableuse of `break' outside of loop is not alloweduse of `continue' outside of loop is not portableuse of `continue' outside of loop is not allowedstatement has no effectNV/Bt-BB$B .g n0h # n#$ npШt1e0; Nhd&TL\jzxB-n .g .g n-P n0h # n#$Hya~XtgmJg `6tg*`. nJg n/aXJg, n/(aX`B`HzHxHzaN~O .gb n-h .fV`L-n .g> n/alX n-h .f` n/a`XJg n h/a8` n h/(a$`HxTHyLHnaO R-n`LHyLalXtg8mJg `tg` n/(aX`HzHxHzaMO n/aXJf`pHxTHyLHnanO R-nHyLaXtg8mJg `tg(` n/(aDX`Hzgtgtgtgz j# PJg (z'f /a|`z>g zgzgzgzgzgzZXHxc `L\8Hza>8XHxc'u'uaO//a:`>Hxc `Hxc 'ua` /*Hza=P/*Hza=BL<<.0N^NuNVH0 $npJg *v@f2Jf R/aXJfB`v%C R/(aJgBp`x#v'gv>gvgtHxa 'uaz$`(Hxa 'uaz$`HzHxHza8dO nJgN L .0N^Nufunction `%s' not definedlocal_stackfunc_callfunction `%s' called with more arguments than declaredNVDH8<(.BTBL"D/)a-@HXg rB"@g"D/)Hz^a7P"nH Q:h Jg@ /a-@L .LXf(a @/a/Hz4Hzgr y` $HJg(\` y/av|Hxa9@t'tat y $HJg(`~$yxJgr(b`h$y$Jg\(`R$yJgF(`<$yJg0(`&2k y$p`# SJg* (v'gv>gvgxN @JgN @/aX` </ <Jg ,//.HzAa*LN^Nuexp argument %g is out of rangeNVH> n# PJg, (|'g|>g|gzgzgxgvgtg~g~g~g~g~g~grgtgvgvgvgvgvgr<(nBJg"Hn/,a&Pgt"C()gj`(<(TJg4*<# TJg, (|'g|>g|gtgv0$n# RJg, (|'g|>g|g|gxgxgvgrgrfB`rgrbufget_a_recorderror reading input: %sNVH?<&n $k* BB|gv.Jf~ +g$Ы*@`N @"n"`,R`,`"M/ //ae'@O |f2AJfJfN @/a/HzFa\O `Jg k 'H JfZJgBgJg8 + $c" g g fRb2|-IgFB* Jgg6B + feJfN|-F`S +g"J'I+fbB"+ +(؀& lI|f'| <`Ѐ'@m-k kHhN'@Xf(ah @/a/HzHzHz4a"O +Ы*@"+ +JoD$ԀIc "D/ /,/NO //`///NO "+ +Ё'@'@ $@* Jg /.a` X + bR+g|'F|f+ff "nBp`D'J"gRBJf( k + efC'I Id"fB`R"n" LHxHyaNqrcannot open file `%s' for reading (%s)-NVH 8Jg 94g/aNB4B` y4Jgtg `t/a$B4X yp PT`"9,oHxc@'ta @$P jOJg * B0GJf y"P9@,t P1|`/*NXJfnR0Hz/*aT#4Pf$afL @/aT//*HzaO y/a>0/ a: y BR,P`("9,$R#, yp PT`RnJ0f4t#0BHxHzua; y 8y6/ aZ#4 94LN^NuNV y PT9`N^NuNV y PT9`N^NuNV/BB yI//.HnaOrft`RRHx//.a $.N^Nuclose of fd %d failed (%s)NVH80$nJfB`GN @B*g&%j/*a(Ъ%@ BBB`0y6 g0yg 0yfB` /a`F&XxfN @/a}`//HzLaO*fd"*gV y"P )b: d4B/) I/(a:$ y/a< y atO/*a[X/ a[xWIDL N^NuNV/HyaX`&/9aJXJg /a>>|<invalid tree type %d in redirect()expression in `%s' redirection only has numeric valueexpression for `%s' redirection has null string value01filename `%s' for `%s' redirection may be result of logical expressionrpredirect%s: %s: can't allocate memory (%s)strwacan't open pipe ("%s") for output (%s)fromcan't open pipe ("%s") for input (%s)io.cinternal error line %d, file: %scan't redirect %s `%s' (%s)NVH?<*.,. B(<=B"E")pЁ~eN0; N (2g~/ / anPJfP"CN @/awH// Hz aO`.(<>Hz/ a %@ P`Hz HxHza~O Jg|/ / aN$P~lj"<("A0ig "<"A0ig"<"A0if%A`/ /a%@Pf/aYpX *g/aPXJg~ *fJ ft&CN @~g N @~f a *`T"CN @"F"p"EЩ~e("CN @/av2// /HzAaO *`-g/ a5B`JfJ g-g/ a4 L//*HzZabOB`$jJfJf HzUa$n&nN^NuNV/ / n# PJg( (r'gr>grHz*/ NPJfg6y`p sfHz/ NPJfg6y`N ffHHxHz/ CNO Jf2VHn/ a$//T`&DPxlf6|xfHx// aԲ&@O g0Hn/ aJ8PJo . @f / Hzla L<N^Nucpspec_setupNVH 0&n$n Jg:HjaK$Xf$aT @/am/HzHzHzDa<'B` /+a$@ k R kB2'kBB'J'J r&r'AL N^NuNV/ $n/./. aPrg4/aXJg&"J @""""""""r/aLB`p$nN^Nu%d NV/ /$n n ( gfa ` ifa@`a /Hz$/aPO.aHx// a//*aB$.$nN^Nu%d %d %d %dcould not find groups: %s%dNVH<<*.a/a/a/af/Hz(/K 0N/Ie:N$DG/ Hxa &O$rf aR @/ak/HzbaZO Bo /Hzb/ N/ NORn B/NHx//a/"E/)aBL<///"FNO Jf,Jfj/// UNO Jg`//HzaHB`tK,I,r,ԁG,RrnrfHx/./a.*O rg2Hn/aEPJo . @f/HzaP/aBL8&.BHxHxGFN,HxHxN*HxHxN(OI`frgR$y(JgBf4r%A%n *g/ahBX * g/aB X`$jJfrfaO @r gHnN$XJgf/HxN/HxN/HxN .L|N^Nucannot open pipe "%s" (%s)close of stdout in child failed (%s)dup of pipe failed (%s)close of pipe failed (%s)close of stdin in child failed (%s)-csh/bin/shcannot fork for "%s" (%s)NVH0<&.$n Hna XJl"aN @/ag//Hz a&Oa $fHxENXGIK4rfN @/N/HzNO /.aXrgN @/N/HzNO /.NXrg/.NXrfN @/N/HzNO BNXrfN @/N/HzNO B/HzHzHzaHxa$rf"aM @/af//Hza"O%B/.aIlXrf aM| @/af/Hz*aO /.a%@ L< N^NuNV/ $n/* aZB *Xrg/a%@r%A `B*$nN^NuNVH8<(.B"D )fBa$@XJfHxcBB`BHn/a&@PJf\ .gVJf>/ae-@ y/a$B/.a./.a" y OHxcB/<`l$k Jf HxcBB`XBHn yI// Hna$OJfP .gJ/ae-@ y/a$B/.a./.a! y HxcB/<`rf0Jg f/ aB X rF&HxcBB`Jf RR"D fHx//.a$O `bB @IyKe:&<wr<f$H`Hn/aP$@/NB/.N./."CN @$hO nJgNrgHxcB/PJfB`JfBJg"BHza$@XJg Jg#$yHx// atPJgHz/ a`&<Jp$K=BGB. B` :g RRfg (/g// /`/ /NXO.9/"CNPJl  :f JgRRJfHz:/ "CNL< N^Nufields_arrinit_fields%s: %s: can't allocate memory (%s)nodesNV/ HxEN#Xf(aI: @/abB/HzHzHzaܢOHxN#\Xf(aI @/ab /HzHz_HzgajO 9g $@#`a d$@ y"J"""""""""y y\ " y P#P y/a*#Xr#$nN^Nuset_fieldNVH0 &.$R//9E*N#Pf(aH. @/aa6/HzHzHzaۖO//9\N#\Pf(aG @/a`/HzHzvHzWaZO$9`F 9g $@#`aL$@ y"J"""""""""y y\!,#,Rl#L N^NuNV/$.o/a y\ p,!n !n 1|"y#,$.N^Nuopsrebuild_recordNVH<< y# P(g (zglg/aBX(`(9"D$) 9 yI dD# y(g (zglg/aX$@`$H Yb 9SLJlHma= &Xf(aFD @/a_L/HzHzHza٬O&CB yI"9`|$T * zf j`Jg"//*/ a;|O "9 yC g6zf "D i`Jg"/"D/)/ a;:O "9 yXC dzHx/ /a$@ y/av y z#L<<*.*n .&n(n,. $U$9( ؀ fBJg yJf&Jgc g g fRb& `bo"k& k" fRfH/" //R/N*O`V/Њ//R/N k&& Of/B/ R/NOc"Hx"/B/ / a Orfzgc/"// R/N$D* L<|N^NuNVH<<(.(n &.*n*. $T$9G8 fBJgv nJ f/// R/Nה`\ oNcJ g fRbc2" ` g R f/"J/ /R/NOgRn( L<`, y$0<rg& l$///R/N؂Onrf$`$ L N^NuNVH0 $.$n fzJf^vfPBHz/9/9X y P 9P h /HyP/< yLN##Oa Jg$\ 9` JgB 9lvfJf y P#PBHz`/9/9X y P 9P h /HyP/ yLN"# y P (Ш OPf# f$ 9oNJgBo /a 9"Rm  @ Rl##` <` yA, L N^NuNVH0 $.&.B/./. a$@jHxc@'tab//a . @ L N^Nusecond argument of split is not a variableNVH8<&nB# SJg, (r'gr>grgr \f zzzzz`I/HzHnaO J.g2Hx/9ttԎ/a./a ##]zL`2 ]zLf Hx/9t/* /*a#`Bv#TL N^NuNV y # P(g (rglg /a bX y P#aN^Nuuse of FIELDWIDTHS is a gawk extensionFIELDWIDTHSset_FIELDWIDTHSNVH8 J gJfx#Hza̶XJfPJgB/<aP#_L y# P(g (xglg/a ~X @` y&((R-DJfB 9/a/#Xf(a8 @/aQ/HzHzHz9a<(n ,r&gl#g(r'gr>grgrgr$@//* /*ad// / ahOJf*g/ a `*g/ a p$n&nN^Nusubscript of array `%s' is null stringNVH8<(n&n #+g +xglg / aXJgstptrforce_string%s: %s: can't allocate memory (%s)NVH0 $ntԎ/*/a//TPT8"stptrdupnodeNV/ / &n0+g@@7@ `@ @f+ bR@` 9g $@#`a$@ J"K 0*@@5@r>fj+gb|"* T/a!p%@Xf(a* @/aC/Hz.Hz3HzaO/* /+/*a "j j B0 $n&nN^NuNV/ 9g @#`a @r>!A".$. !B1n $.N^Nubackslash at end of stringmake_str_nodeNVH00$.$n &. 9g &@#`a^&@r>'A7|g'B`JHja Z'@Xf&a) @/aB/Hz/HzaO/ //+aO kB2g +$Ԋ$@-J Jc<I-Hr\f$HnaXJlJ g HzaTXp\ nbĕHj/+a!'@Pf$a( @/aA/HzfHzHz aH kB2k'J |r'A L N^NuNVB/. /.a @hN^NunextfreenewnodeNVHx a#Xf$a(J @/aAR/HzHzHzva y  `c"Bhp Ј @bB y# N^NuNV/ $nJgN0*fDg>2A5Ag"* c gS@`/*a$#$nN^NuPosix does not allow "\x" escapesno hex digits in \x escape sequenceNV/ /$n RI BRtxe0;N"******** \p` p`p `p `p `p `p `p`Sp`r҈p RI BRt/lt7mA"Rtl`J gJ`ft#`HzaXJgpx`t R(I"yL1DfHzapx`NBI B1DRJg0 9L"@1gA`gA`A" R`S ` $.$nN^Nu@(#)Gnu Awk (gawk) 2.15destmake_regexp%s: %s: can't allocate memory (%s)re.cinternal error line %d, file: %srprp->pat.bufferrp->pat.fastmap%s: /%s/NVH8< .&n (.-@EHkKN&@XJf(a$D @/a=L/Hz6Hz7Hz?aO& ` \fR-HIpЂrHe0; NHna$XlHzHxLHzaO `\`R nbBHx(MN$@XJf(a# @/a</HzTHzHzapOHxB/ aɼPO.N$Xf(a" @/a;/HzHzHza*Or%AHxN%@Xf(a" @/a;/HzHzyHzaOJg %|`B/ / /aDO Jg//HzaO *Jg"JfHxHj*/ /ar%AO`B/a L<N^NuNVH0<&n$n *n(n Jg4B$ Ԍ2(HnHnHxAHt/Hk*at(OJg(JfJfHk/ / Ht/ / ag`p`pL< N^NuNV/ / $n/GN/*NP *"g/NX *&g/NXJg Hj*aX/ N$n&nN^NuNV/.axN^NuNVH 0&n+ptfg +`# kJg( (t'gt>gtgt"@ f&<`!"9|g g !f fR# 9" @"yxc0g, g&R`#NRHyNRa."9 AX/9/HzKatԎ BCO Jtg.$ycd  f ` b^ EJfE &.//a/ /HzaZHxa6JNqbufget_src_buf%s: %s: can't allocate memory (%s)can't open source file "%s" for reading (%s)can't read sourcefile "%s" (%s)NVH08&9NdBn 9Nd yvfJNlfR/0a"#NlXfRNd`v# 9Nd y 0#|#tЁ#x` R`PJNpf yt ( gv#Np 9$$@ 9|GId  gSe yt#NlHhN#NhXf(a @/a3/HztHztHz|aNO/9Nl/ /9NhNO #Nh yNhNl#t 9t&##Nh|R#x`BNlB|BtB"9tf 9Nd&R#NdRoh `,JN`f#$ 9$f4 9Nhg/aBNhBNlB|BtBB`/a#dXGvf&a @/a2//9$Hzua$O/9daL#NlX 9Nhg /ajX&9Nl/N#NhXf(aT @/a2\/HzHzHzaO&9Nh#|v#N`# `|R`."9t 9$$@ 9|Id  gSe orFpЁ&9Nh #// /NO pЂ&9Nh##|/9Nl&9Nh//9da6$@O vf&ab @/a1j//9$HzJaOJf"BN`RNd yJgBBNl`B 9Nh"#tҊ#xL N^NutokstarttokexpandNV/"9 $9 9NtЀ#NtJg//a# P`/aZ# XJf$a @/a0/HzHzHz$a 9 "@Nt#Ђ#$.N^Nusource file does not end in newlineunterminated regexp ends with \ at end of fileunterminated regexpunterminated regexp at end of filebackslash not last character on line**= is not allowed by POSIX** is not allowed by POSIXoperator `^=' is not supported in old awkoperator `^' is not supported in old awkunterminated stringInvalid char '%c' in expression tokkeyyylex%s() is a gawk extensionPOSIX does not allow %s%s is not supported in old awkNVH?8BB ytJgxea|Jg ytRtJfB  N|g# N|J g JNf HzaX~#N` 9tg|cS#t#tBJlgBBl# E.`^~[g0m~/gm*Jg~ g`~\g~]g `v`B` ytJgxeaJg ytIRt`BJfHz`~ f R ` y\R.9fa*`Jf 9tg|cS#t yBR.9fa# #N| <` 9tAg|cS#tHzNXHzNX yR.9fa~ ytJgxeafJg ytIRt`BJfrI ytJgxea,Jg ytIRt`B~ g~ g 9tgS#B# B~~e 0;*N @ j, rrBr Z          rrHr rr> r dF  N|g# N|J gxJNfnHz@a~#N`XR `DJfF  N|g4# N|J g*JNf Hza|~#N` B` ytJgxea,Jg ytIRt`B~ fR ` ytJgxdIRt~ g `(aJg ytIRt~ f R `rHzaX` ~#h~$#N|p$`X ytJgxea~Jg ytIRt`B~=f~`Jf~*f ytJgxdIRt~=g `Fa Jg> ytIRt~=f(J gJNf~#NHz1a ~`4 9tg|cS#tJ gJNf~#NHz ` 9tg|cS#t~*#N|p*` @Jhg` ytJgxdIRt~=g `$aLJg ytIRt~=f~` 9tg|cS#t~/#N|p/` ytJgxdIRt~=g `$aJg ytIRt~=f~` 9tg|cS#t~%#N|p%` \ ytJgxdIRt~=g `FapJg> ytIRt~=f(J gJNf~#NHza\~` 9tg|cS#tJ gJNf~#NHza~^#N|p^` ytJgxeaJg ytIRt`B~=f~`~+f#!N| <!` V 9tg|cS#t~+#N|p+` 0 ytJgxeaVJg ytIRt`B~=f~`F~~f~ ` 9tg|cS#t~!#N|p!` ytJgxdIRt~=g `$aJg ytIRt~=f~`~( 9tg|cS#t~<#N|p<` R ytJgxdIRt~=g `"afJg ytIRt~=f~`Z~( 9tg|cS#t`| ytJgxeaJg ytIRt`B~=f~(#N| <` ~>f~8(#N| <` ~~( 9tg|cS#t~>#N|p>` T~(Bh# N| < ` 6JNxgBNx#N| ` ~#NxSt# N| < `B`~ f$ 9tArg|cS#tHzNX~\f` ytJgxeaJg ytIRt`B~ fR `lv y\R.9faJf$ 9tAg|cS#tHzMNX yR.9faZ ytJgxeaBJg ytIRt`B~"fDD/ 9 .9//a( yh#N| <` ytJgxeaJg ytIRt`B~=f~(# N| < `Z~-f#"N| <"`@ 9tg|cS#t~-#N|p-` ytJgxea@Jg ytIRt`B 9tg|cS#t yL0(f~.#N|p.`t.`. ytJgxeaJg ytIRt`BB yR.9fa~9m~0o~.g`~Eg~eg`Jfx`Jfz ytJgxeaNJg ytIRt`B~-g~+f" yR.9f"a ` 9tg|c S#t`vJgJg 9tg6|c.S#t`$J gJNfHzLa~#NX yBR.9faHxa/9 aX//a( yh#N| <` ytJgxea0Jg ytIRt`B~&f~(`v~#f<`Jg ytJgxeaJg ytIRt`B~ f~ fR yL0(f 9tgF|c>S#t`4 ytJgxea~Jg ytIRt`BJfXBh#N| <` 9tg|cS#t~&#N|p&` ytJgxea Jg ytIRt`B~|f~(`v~#f<`Jg ytJgxeaJg ytIRt`B~ f~ fR yL0(f 9tgF|c>S#t`4 ytJgxeaXJg ytIRt`BJfXBh# N| < ` 9tg|cS#t~|#N|p|`~_g yL(f /Hza.P# `N yR.9fa ytJgxeaJg ytIRt`B yLC(f~_g yBR 9f aN 9 /a,Xf(a @/a/Hz"Hz%HzavO 9 .9///ahO Jg 9tg6|c.S#t`$J gJNfHzRa~#NXz)GK Ѕ&jR"y I($ԃ s(If// a8P"Jl*S`Jo$CR`J gTEK 2( g/3(HzAaPP 2( g/3(Hz@a6P 2(g/3(Hz>aPJg ЃAK0 fbJg ЃAK0 fH"҃EK 2~e(` AK(/ab Ѓ 2 #N|`>l( yt (g~#h#N| <`#N| <LN^NuNV 9g @#`aٖ @!n1|"yJg  f29"SA1A `1y" !y$ N^NuNV//$.&./. a @ !C$.&.N^Nu%s() cannot have %d argument%cstring literal as last arg of substituteNVH88&n$nB/. a(@ KXJgRxm hJf& "ҊAKB0g$f psxfp ///0HzTa`O ЊAK)p Jf:  Jf0BHx&BHxHxaBBaHPO.ENPO.N&@` , ,vf k PxEg/a k ` 2g 2fx SxEg /a&Xxf6BHx&BHxHxaBBaPO.EZNPO.N// aP`J g k h Px>fnHzoa`b bfZxfBHx&/9a// aO k h PxEg/aL k h xf k h P(( LN^NuNV 9g @#`a @r@!A B N^Nurmake_for_loopNV/ Hx a$@XJf(a @/a /HzHzHzalO 9g @#`af @B$%n %n!J $nN^NuNVH8 $.$n /a(Hx//a&O 9g "@#`a"@rF#A A"!#D#J #B%B ) LN^NuNVH 0&n/ aF$Hx// a|A$p OJg4f(Jg$ jf// /a}O Jf * `$RJfBL N^NuNV n". "HNf yN`#N )g @ (f!A#N N^Nunamesdup_parmsfunction `%s': parameter #%d, `%s', duplicates parameter #%dNVH<< n*:h $(BJg /a(@XJf(a @/a/HzlHznHzaRO BJg "L" hJfBtoF(Ro6&L//4,a1JPJfRHj///Hz"aOXRn$n/ aTJ^IDL<Jg: jf0// /a{@O Jf&$#Jg/aJ`&J$RJfL< N^NuNV/ $nJg/*aHx/ aP$nN^NuNV/$. 9g @#`aҖ @r'!AB 1y R//a2$.N^NuENVIRONNV/ /$nJNf& Ef Hz/ a/TPJfa6r#N/ a`$XfBHx##\ 9ЄU#dB`pLN^Nusyntax errorBEGIN blocks must have an action partEND blocks must have an action part%s() is a built-in function, it cannot be redefinedplain `print' in BEGIN or END rule should probably be `print ""'file`next file' is a gawk extension`next file' used in BEGIN or END actionnext used in BEGIN or END actionreturn used outside function context`delete array' is a gawk extensionRegular expression on left of assignment.non-redirected getline undefined inside BEGIN or END actionRegular expression on left of MATCH operator.regexp looks like a C comment, but is notRegular expression on left of comparison.call of `length' without parentheses is not portablecall of `length' without parentheses is deprecated by POSIXyacc stack overflowNVH? *  * < N | *   " 6 J ^ r 6** *:V y#` y Ig(`B`"y If(`p iJgEjGl|"gBHx"/)N y!@O "HBHx"/N/ y/(N(O` yIEJgLGz"gBHx"/N#O BHx" y/Hx#BNPO.N//9NO` y/Hx#BN#O B|#` B` yIE~JgHG|z"gBHx"/N#O BHx" y/Hx#BNPO.N//9`l y/Hx#BN#`pHz`HzaRBX` y/Hx#/(a` y/Hx#Ba`BHx.BHx&BHxHxaBBaPO.ENPO.NPO.N/Hx# y/(N#BO` l y//(aBBP` J/9 Hz abRP` 0B` & y/(/(a.a#z#p/aO Jg R` y#Bp` BHx3Ba#BpO ` y/Hx/(a/a`Rl` 9Ig $@#`aƺ$@|E%F y/(a8$B/ y/(a%@HxB/ y/(a^%@B|5| (O `  y#` "y iIEGJgz$gBHx$/)N y!@O "HBHx$/N/ y/(N(` y/Hx)/(` Z y/(Hx2/(` DHx y/(GHN/BHx y/(NXO.a/Hx+ y/a&#O `  y/(/(/(a/Hx* y/a` y/(B/(an/Hx* y/a`BHx,B` BHx-B` y/(/(/(` p yIE|.ffJf`BHx&BHxHxaBBa¼PO.NPO.N y!@O J g$JfJNfz#NHzaX y/(/(/(`&yIEJgdHz(arXfTJ g HzaXJfJgRHzaXJfRHzaXpS`Jf Hz aΜXp0B/B`,BHx1 y/(`0JpfJHzahX`BHx!`, y#`F y/(Hx?/(a` y/(Hx?/(a`IJ g HzaxX y/Hx?BaX(O JgHzaxX`B y/(a. y/(an/HxC y/(a# y/(a"O`pBHx `:BHx `0 y$PIz>f8#*gT`/ a./Tt y(`BHx/a` y/HxHxaBBaDPO.`B` y#`Hx y/a#P`"y iIEGJf6/HxHx/)NXO.N("y i #O `P/HxHx/)NXO.N(O `2BHx y/a"#O `BBh`Bփ"y#4Q勗A60HHJfdJf`4|K#3| yK#*9,9!E!F Jla#lBJg`,"ҁA 02pJg,Jm&_n ЀA*J0pf A 4p` A4p,9deaJf< yK#1J yK#*9,9!E!F `Hz'ap`BLA <lA <lA <lr#NN^NuNV 9N#NN^NuUnmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNVH?<(n-n&.֮ -C-lBBBBHxGN-@Xg v -CB)n ,BBafJf, gHx /a(P` Hx N(XJg Lv )C&T-K"ng-IJg B$n2BvЃvre0; N2$rrdL@ .R"n谉g.f/./ /.aO Jg`v g Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`"ng.f/././ a8O Jg2`v g Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez `B-I` .fJf.ff.grB.B.B.BB`| I-HJg $n2( *g^.f +gP ?gJ`B \f \f8gX-HJgn*n$nr.p` ]f .Rg+g BJ3fBSCSgJ3gB+`.f*`.f`.f``JnmT` . g` nfp`RBvЃvUen0; N dZddddddd d nZdd dddddddddddddddddddd 0dddddddd Hd dddddddddddddddddddd ddd`.fRR"nf2 $@E //.a-@Pg .Ѐ-@"n nC *n؛! n"nA"Jg R#`B n"nA& # n"nA#Ќ b n"nA T#`j g Ѐ)@A* c)|/,/N"(Pgg, &AJg .ހJg *ڀJg ,܀$ V",eBRBB-KB`.f JJf.f :p`FJg`v g* Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez FHs/Hx aO nJf.f p`E-J(.$A "T" & *@ֵH-C uHJgA.`B nA *$@ڲ( -r(B b IH.Ә.`v g Ѐ)@A* c)|/,/N"(Pg Ҳg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ V",ez` 0.@f ^.f f`v g P Ѐ)@A* c)|/,/N"(Pg $g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ V",ez/ KHh/.Hxa BVOJg KHh/Hx a O . `j g Ѐ)@A* c)|/,/N"(Pg ^g, &AJg .ހJg *ڀJg ,܀$ V",eVB-K` .g . g ". Ufg :|-M4|-J nK-M-nfJfzp ` RJg B$n2B yL0gTB"HBJlB*n$MK *BK -M ng"RJg $n2B1f ,f ng~RJg B*n5B yL0gTB"HBJlB$n*JE $BE -J ng"RJg *n5B1fJl-|`-nJmL nB$nn8Jf, \f ng <RJg B*n5 }gJfp ` "Jf.f .g* Jf`v g Ѐ)@A* c)|/,/N"(Pg g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ V",ez/ & //Hx a VO`x vlzx`v g 8 Ѐ)@A* c)|/,/N"(Pg g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ Є",ez/ /.$ Z(<*vl T` W//Hx$DN&B/ /.Hx/HxNZO(vl$.S/ EHh/ Hxa|Z/ /$K/ /Hx*DNZO$`-n ngRJg B$n2Jf nc (\g`9Nf* `v g Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`9Nf<* `v g$ Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`J9Nf`v g Ѐ)@A* c)|/,/N"(PgZg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`9Nf`v g Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`9Nf``v gJ Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`p9Nf`v g Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`9Nf$`v g Ѐ)@A* c)|/,/N"(PgⲂg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez `49Nf`v gp Ѐ)@A* c)|/,/N"(PgDg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez `.fD.B.b/A// /(a.OJf* `v g Ѐ)@A* c)|/,/N"(Pgrg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ T",ez`.fJg B*n5Jgx$FBE fh*F g`"n I *gR ^gL.g \f) +g4 ?g..g4.g {g`" \f ){f* `v gn Ѐ)@A* c)|/,/N"(PgBg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ T",ezB, S`v g Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez$FR ."@fJg KHh/Hx aFO Jf0/.a|)KB`p `p`p `p`p` p`p `pL 爟$//./aO -Bg .Ѐ-@". n!R` p`^,Jg2TB`,T*IሀTJfY|`pX`T` a^B$Ef~JfJIBLN^NuNV"n n ".gpB !n!n`BBBBN^NuNV .//./././/. BB/.aN^NuNVH?<(n*.&.$. $l&l,.܅ ЂJmm~o$F`l$Jg T  f JoJnhtJg",f/ aX~f p`H `BBB`JoSR`RSJgܼoJ,mJo(n ."@` Ђn  B"n Jg4lNY*nu..J2xf6BBSl,3J2f `lBJ2fBSlJ2gք`BJgn *n5`*n 58Jg3`AJg@Jmf JgJ,l4/.(/.$//././/. / aJO Jl~gJfpL b j0 BJgLB`(nܹg*n-nܻg(n4fSf`&,.ܼg*n-nܻg fSf eL(nA\XRd`4,.ܼgl*n-nܻg(n,f"JgB(n 4 g8`  g.(nJ,lJgB(nJ4f ` Jg e(nA\XRd` +WDf,.ܼg*n-nܻgJgB(n4`BB爰c3r‚gJWDBGJgl eX(nA\XRd`@-KB(n |f/ /.Hna^BIO B(ng(n 4 f `(n 4(n)B(n) B(n4 B4 B f *` B(ng(n 4 f `(n 4(n)B(n) B(n4 g.Sg(B(n4 fBSg(n4 gJf*<.<`BB(n4 g +f FAd :B-HBR b d g `( f"r n(Iገ T-@JgT-@ n-HJl f (f (f (n4 gd4 BB+ЁcNBB "n n(.؀(n-L(nX (DX m"XXR+ Ђb .,R-F @R(IገV-@&."C$."  @RIc` L-H(nG L9Ne$ 爟$//./aFO -Bg .Ѐ-@&."C$."e"eP &n&.ր"n n!,R . n(CX! R . n! RR$.d n!,R . n! R . nخ! R . n! R` Γ, "F(n 4$<茴g (n"4 Ag &BJg ecxBJg e SID$.䰄gp$`l,.ܼg Z*n-nܻg(.ܘ l(Jg/./// -IaO`/// -IaHO "nJf քfg(n 4g &.$g䴃f`Jg g`gJf(n,gf` - f `4f(n,gB` f(n  g ` n  f f(n,f` TJg g`gJf 4`+IገT&."C$."  @RIch L-H(nA L9Neb 爟$//./-HaO -B ng6 .Ѐ-@&."C$."e"e\ &.ր(n-L"n n!,R . n(nX! R . n(CX! RR$.d n!,R . n! R . n؋! `"+IገT-K KdBJf,R-F @R d*Jg谮d fB(B(.ހ f*&."C$."  @RIch L-H(nA L9Ne 爟$//./-HaO -B ng .Ѐ-@&."C$."e"e\ &.ր(n-L"n n!,R . n(nX! R . n(CX! RR$.d n!,R . n! R . n؋! R . n! R`D+IገT K `[ b V Teg g(n,g| fvv g( Є-@ @"H (f(fJ)W bB WIDB(爰c 0rƒg JWIDJf|U +g | ` .,S-F nU(@S-LS"0 ,S-F$0 bX "n&.ր .(@S-L n(C( Y .,S-F n" .(@S-L n" YSc+IገGH`&.($."  @RCch(nA L9Ne^ 爟$//./-H-IaxO -B n"ng* .Ѐ-@&.($."b"eT &.ր(.؀"n n!,R . n(DX! R . n(CX! RR$.d n!,R . n! R . nB R . nB R`&.($."  @RCcl(nA L9Ne> 爟$//./-H-IaZO -B n"ng .Ѐ-@`p`&.($."b"eT &.ր(.؀"n n!,R . n(DX! R . n(CX! RR$.d n!,R . n! R . nB R . nB R`+Iገ+JoSTDT`pJfjB+B+`+Iገ+JgSDD`XX`8+IገTAH-H+IገT nD`Jg g`gJggAC猱f(n` .Sf (n,`I 1WIDf(n` .Sf (n,`I 1WIDfj`Jg g`gJggAC猱f(n` .Sf (n,`I 1WIDf(n` .Sf (n,`I 1WIDf `C猻f(n` .Sf (n,`I 1fJg g`gvJgnAf(n` .Sf (n,`I 1f:`zJg f `jgbJgZAC猱f(n` .Sf (n,`I 1f f(n` .Sf (n,`I 1f쬻g`,.ܼg*n-nܻgC猻f(n` .Sf (n,`I 1f e~(nA\XRd`h,.ܼgj*n-nܻgC猻f(n` .Sf (n,`I 1g& e(nA\XRdR`aE> .g,S-FS n"0 g*A(@S-LS&p ,S-FS.0 (@S-L*0 "bb $.Ԁ&.ր"n .,S-F n" Y .(@S-L n(C( Y .,S-F n(B( YScJgNdPB b d g `8 f2rA-H(IገAH-HJg g` g eꬻb-n`Jf g//Hna9g4J,f < gF/ajX y(B$GR(S,J,f < g/ajX y(BR( 9,.S#,~-f~f < g/ajhX y(BR( 9,.S#,~]fS(#,`t~\f:9g0~f < gr/aj X y(BR(S,J,f < g@/aiX y(BR(S,`$ mRG\// NPJ g8~e2 yL0g / y`g/ y0p/NPRl$D~]fJg/axX9g /Hx a PB4/`hB4J gl~ef yLgXzڎ$/a// GN yLO 0g / y`/ y0p/NP/a&#0` `R~lTa-~#0pLHx a>O Rd * R(1.*1.!!R`Fc * R(3>*3>!!`( * R(1.*1.!!R *"R T*0>RR -n~oD *"R U(0.*0.##RRm` *"R T(0>*0>##RRmL<XR"-nBGo m 0< o g o^Hn$,-0܂/EPN/ HnN m0"n )O>o//0>a> m0!>P m0Hp(/.NP"-Rn|"nBB"Dl"$nHnQ./ZaO R"Dm/ HnNBBP"n$)o$ nX"P |?F~0‡gxRn|+F,B(Hxaj+@$B/Hn/ a/.EN/.N/.NO.N/.N/N/.NL q/0./0.aO R rx 0>(n "l0mR(nlHm(n J4g,B`Hnט h/0>/0>aBO R(n l$mB(.ׄ(n`HtHHx aPJg4B(nt ,o&$ nטX"P ~?F~0‡g|RnBBC n` fR~d~e.B(nt ,o $ nטX P~gzRnBBHnט/. N$@OJgBHxHnט/. N&@O`&JJgHxBHnט/. N,O`, B-n`H"yLB*"(nH 4Xg< A~ f (n)K(`(~eCg (n)`n(n)R~dXR~dPLRׄ..ׄהmBׄG..ׄהlE/PNXRׄ..ׄהm/.טN/.׈NL< N^NuNVH><(.$n *< oNB"j8o> j@ 0,g/ah j@` jH 0,g/ah jHB,X"j8RnB8(.&. &n*.J g/ab$Xf HzaJXB Bc2(yL$y"B DJmI4g `RRRb/ a/ //E"N/ac/ aB BBBB|# / //NO$`/ a/ //a/ a// aL|N^NuNVH 8&n/IN/+ NBP(l k$/0NXER(m/+$NBX"+o k0 0.g /NX"+Rn/+0NBX"+8o$ k@ 0,f kH 0,g /NX"+8Rn +Dg/NX +Hg/NX +Pg/NX +Lg/NX$kTJgG$*/*N/ NP$BJfLN^NuNVH00$.&. g/a.\X$@`Jf`Jf `F/a.<&@XJfHja`$@X`Hr/ab$@PJgJg /Hsa L N^NuNV/.BarN^NuNVH8 $.&. /a-($BXJg/// aJO Jf `RJfBLN^NuNV .g/aaFN^NuNV/ nJgJg$H/aa&BXJf$nN^NuNVH0<(n*n Jg/ aF*@XJf/ a` .B5BJg$L/ /a0PJfdXRJfBJg4G,$L// aPJfXR`/a`YSXg$BJf  @Hh/ a`(@Jg),B,`/ a`` `BL< N^NuNVH<<$.(. JgJgHxa^(@XJfB`|B$BJgr&<nKBI//`0pJgA* R&ERfRRJfd$I/Hi&CN"@PJfJg// / a(@O JgRRJf L<(J CJg0K$C//a$Pg// aV&@/NO JgXJfXJf L< N^NuNV/ / "n&i$i i BBB/af$n&nN^NuNVH?<-|OTB*n -R/a]8*Xg&E"-m($ @    Rlڕʲm,<-E&P$Xx ؅Hx*FN*n*Hx*FN*B*Hx*FN*C*Hx*FN"@*D*~؇O*nJg*B(UJg*C UJgJgBBB*n UB߮ևԇR*n"-l|BoVv ֋*n m $0l  gdn n@ lF~gb` n  l6  g` n`d~ևG/ aJX`p ЅbG( ~ևG*D/- *C/aP$<e:Jg UB"kJg I*D"-(I*ARfRRJfB2/+*BN-@*D/-*BN$.Pl$(ko$*DЭ"@S..AxSSfRnɵo .AR(knB1*D//a$Pg/a/a\&P`ĺd~ևG*C UB`pЅf*E UIռJg2Ge:/0N$/.NPd *E U-pR*E  @Jf*E/- /.NPJfb~-G`Xp ЅbNG$K~ևG//a&Pg0"kJgN jJgF/ a$Xg/*/a$Pg/a'j///a&/a[OJg*C UIJg/*/+N'@Pg j Jf kB/*/+N'@Pg*C"UJg j Jg //N*P``B``~npJglA o/ NX`B/ N*C$U"k k$U"k kB(B)B*Hx//aB&OJg~ևGR*nm/.Ge:NXJgBHx aX$@$/.NR/aX%@/./a:*n%mT+JTO*nnR&<7t ԅ(P(EX&E/a|/*CN/IN*D/~؇*CN*B/ԇ*CNOGR*no/aY|L $n(9T*9X,9O\l`l\&$l*ȴo &"҈"r Ј% % Rn䜂`‘ȶo"҈"r Ј% % Rn؃`"9O\ XѹT#XL|N^NuPOSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c NVH?<,.*n *.&.BOXJO\f`~#O\#X#TBL"E -f ~#PR`0 +f BPR` HzdaXJgBP`~#P yLJgJfN 9O\~Pff$9T"9Xgg./ ajX 9O\`g#T` 9O\"@R#O\Ro u -fJ(g#O\X 9O\g`Hz/5 a:PJfB 9O\.R#O\"9XTgRg/ aX`R#T#X#O\ 9O\f 9TXg #O\` u -f(f2JPfp`#OXRO\p`(J-C2|-I`BJg -WIDA#LJg 9O\ u -f (-gJg&yLBB` =gRf$CBJgN 9L. ///a(O Jf&$ L/a!zXgTJf(J-C`xERJfJgFJf@Ee:JO`g 9O\/5 /Hz=HyaO/9LNѹL`Jg$ 9O\"@R#O\Ee:JgrJg R#OX`JO`gD u (-f//HzHya|O`/I//HzHya\O/9LNѹLp?`(~fXRo# OXRO\`BJO`g/5 /HzHyaO/9LNѹLp?"E :fp:`/9LNѹLJg"n" lJg B` , `Jg, 9O\ u (-g yLI//aPJfhJO`gJ 9O\ u (-f/9L/Hz9HyaJ`/9LI//Hz9Hya*#A%LRO\p?` yLRLI//af @$yLPJfRO\Jg :f(JO`g//HzHya#Odp?` (:f (:f Jg#OXRO\`BOXBL`^Jg#OX`B 9O\f0JO`g//HzHyaL#Odv?"E :fv:`# OXRO\BLI L @r"f/HzHxaXRnJg rg pЎ` B` .`//NPJg/ /a PPJm`$// /a ,O Jl/HzHHxaOBL<FXHzkE]dNXrg /a_X`B#8 9 XHz,NXrg /a_jX`B#< 9@g /a=XHzVNXrg /a_6`B#@$nN^Nu\\\\\\\\Z\\\\\\\\\\\\\\\\\\\\\\\\\\{\x\t\q\m\j\f\c\]\Z\T\QZ)\N\I\F\@\=Z$\:\5\2sosmsokstismcupsermsoketermcuplilineskRkrikPkppkNknpkHkllkFkindkAkil1kIkich1khkhomekEkelkSkedkLkdl1kDkdch1kukcuu1krkcuf1kdkcud1klkcub1vbceelupcuu1cmcupcocols0123456789;123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzNV n //.ax`N^NuNV/ /$nHzHxHxHz/ aB @OJfH kfF *ff>HjaXr?m,r m|k`|FA<pB.E`$h$<8-BHn/ a Jft $.$nN^NuNV//$.Hz6HxHxHz0/aAh @OJg$(/a  rvg" $.&.N^Nu@(#)cl_funcs.c 10.40 (Berkeley) 5/16/96NV/ /"nB y$C"()fD$iH )@ i4cЊg `,E f" )P"fgt/9$Ca X/./. /9$Ca O Jfp`Jg /9$Ca B$.$nN^NuNV n".J frpgJ h h$Jfp``JgHyPHx/(`HyPHx/(a ?PO.a/`&Jg/9$Ca T`/9$Ca r`azBN^NuNV/ n$n h h$A/a H gHb rKg@er2g8`Brng0 g(`2 ,gb g` Xg g ` $X` $`$%B$nN^NuNV"npgHxHzHxaBN^NuNV/9$Ca JWIDN^NuNV/ / &n"n $n y$C" y$C$"+HB$_&_N^NuNVH?<&n ++fP"fg y$C*h-h"kH +@ k4c, ܀`C, BBI~B///9$CN"y$C ) i" p ) h0 O  g  fR`:./// NO EfpJgHx /9$CNPSf//9$CNPR8e|/./ /9$Ca EO /9$Ca hJWIDLy@zHz6HjHxNO Jf xHz6HjHxNO Jga3 @/aL//Hz"Hyap`hHzBHxEmNO Jf8(n$n *.(. l&h$&|ƆJf "+g +g |̀'F`n| ` |4gfg|`g|`gH|́'FHnHnHnHx/ aOJgp`Jg/././ a|`$|0ĆBJgB L< bM Ѐ-A 눐"AC D 눐A -@pЎ/HnHx/ // aRO|e00; N  $%K%n| %F`|`|`| `a4BL|N^NuinputNVXH?<,.$. .. .(F(,(D*l$B|J,Am0/./Ba,O vgTJfp`(n(B`I-LXBI-LxBI-LtBI-LpBI-LlBI-LhBI-LdBI-L`BGBBJg0v/BB/.XHxaOvgJfp` v0gE/ Ba%@PJfr8|-L|gP&-n-n-n-n-n-n-n-n-n-nnnHn`Hm\HxBaO (D,Ag(nXB(nxB(ntB(npB(nlB(nhB(ndB(n`Bv(D"l Pg<$nXz-@\(FJ,l" l$( v"ꊃ, (l&@"Q\fBBB/.XHkaOvgpJfa.f/aXJg@p`(nHl/Ba*bO vg,JfP -(@R+LRv1m(Gv(n(`Tt`Ra.d @tvgBtHzLHx/aLO `*(F,g(@ 4 xg (GR(n(BBJ|gHnHxBa L<0N^Nulines=%lucolumns=%luNVH0<&.$-BBBBA-HEA%H/. HzHx/KN/Ie:N-@B/ /GCNO Jf*/.Hz|Hx/N/N-@B/ /NJVID`pL< N^Nu@(#)cl_screen.c 10.44 (Berkeley) 5/16/96NVH08$n&. &j(k$+Ag/ a>XJfrë>$rāg *f *gfgr%@gbr€%A Pg(B"*HҪ4//9$Ca 2/9$Ca HOB jH4Hh/9$Ca 2/9$Ca OJgl/ afXJfjr)A*gfJg`HyPHx*g jA$jC8 1` *S/B/,a +PO.a )`/ a`Jgp` BrBL N^NuNVH 0&nB$k$fB``/ a XJgtJ+Al2*g/ aXJgtJ+Al*g/ aXJgtHjHxBa,rê L N^Nu016|Vi's standard input and output must be a terminalTERMLINESCOLUMNSunknownterminal type unknownerror initializing terminal%s: unknown terminal typetcgetattrtcsetattrsmcupNVH<<(n l&h$+fLJ(AlHxaXJfHzHx/ a,p`BHx>/ aԮO Jf,fg l^A"lE8$r`$l^HzKN*B/ Hz$<|"BNHzN(O,g lAv8֬"C 1` ,/BHz"BNHzN&O,Jg lBA"lK8 5` ,B/BHzy"BNKN @BHy(Hy/ aOJf@N @Jg"HzI/ a]PJfHz?`HzM`/ Hz_Hx/ a`Jf HzaXJf HzaXJf HzaX/ /,a a Ja a nHx/9$Ca pHx/9$Car'ABHxaLO E\/ BaPJgHz`h + g j + gjkjPwPuPvP{PzP~/ aXJf,Hk\HxBaO JgHzmHx/ aO /,a^`JfHr'AJfE/ HzA/ aDO JgHyPHx/+a %O HyaBL<k2r4Hk0HxBaO JgHzkHx/ap`NrfDBJfE/ Hz/aLO JgHyPHx/+a #O HyaBL< N^NuNV n/($avBN^NuNV///. a$XgJrgD/avXJg6&R/a n XfBHx/.ap`///a$B$.&.N^NuNV/ $n *g/aBX *g/aBX *g/aBX *g/aBX *g /aB$nN^Nu%luNV//&. . gHx/`/.HzHx(tԎ/aHx//a$.&.N^Nu@(#)cl_term.c 10.20 (Berkeley) 5/3/96%#~~~~~~~~~~~~~~~~~~~~~~t~n~l~`~\~Z~P~L~J~B~>~<~2~.~+~~ ~ }}}}cursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1~~~n~`}}~ ~}lakahajaNVH8<(.K`Jgp$<e:GXIP&</aݦ$@XJg0,.*.$R/GrfN/HzHx@x؎/EN/a&Ogrg/aXJfBJg>/N/HzHx@/N$Hx/. /././aj.////a4`Hz//Hx/apL |N^NuNV"n . rgmrg`8rgr>f, ir@>ré` nJWID/ i/($/ aPBN^Nustderr%s046|messages not turned on: %s045|messages not turned off: %sNVH0 &.$n HxaV$XfJgHzHx/a2`Hn/ahPJl Jgr/Hzi`^J fp.gp%@ Jg"r//avPJl%@j(jj-jnj@/-/./ a\/-/ // asOJgp` (<"CfHnHnHx// "DNOJfΕJg$kJg*@g(B .cV/HnB/ atOJg(@`: .nc /Hjn/*j/ aLOJgl%@j(jj-jnj@"-g//./ aO "- .S"C$i/ nHpHtaZ".S"C )// // aqOJf`$-gBHnHx// "DNOJfȕJg$kJg*@g.B g\/HnB/ ahOJg(@`> nc /Hjn/*j/ a:OJgZ%@j(jj-jnj@//./ axO HnHnHx"C// "DNOJf .gS"C")gЂdHzHx/ aO `|Jf*Jg$kJg*@g.BJc~/HnB``Jg$kJgjf>j@nc /Hjn/*j/ aTOJgt%@j(jj-jnj@`"c/Hn/ / aOJg>(@ .S"C$i/ nHpHt(aZ .S"CԀO // // aoOJf"C-Q c|// alPJfpRd$."L<Q"@C " "@C" 割f0 k(Af6HxBB/ abTOJf k(Af .*S-ESbB`tJg$Jg kJgjfh@`/ aX L</Hx:// *FNOJf k(Af$HxBB/ a`OJf& k(AgHz#/ a/ *DNO ` HxnBE/ a kxO CtJf$~)G` $)h)|/ NXJgJ,Al$k*Af$HxBB/ a_bOJf&$k*Ag~Ϫ>HzHx/ aO ,Af"+ g *E*BL@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedNVH?<*n-m,-&n$krJg 'j 'j *zg$HmL/ akPJfFBP *z%@zg&nRR *z%@z$Hx/BHjOa腪z/ / a4OJfBBBJg""jIz f&nRR "j`z g~ frR%I *&@S%Kzf *g~:f:r&@S%Kg jG%K(Iz:f *.S%Gzf *g~"fR&@S%Kzg& jG%K ( g **S%E~f j  f~{RS`l jIz g~ fR%H *&@S%KzfJf6Jg-f*|g"/ a!XJf&n$krJg`Jj|l *gzf j gj|Hn/ / aO JfHJfDJg4"j II~ g z g~:fR%H *&@S%KzfBJg j |g gI/Hzpa1>PJg(jG%KSt`H(j"LJg. yLIg **S%EG%K"Kzf$ fHz`2I~e0; N@"L"<&A -@ @fR R-@ @g lg pg +g -g ^g #f\ *%IѪ&A%S$%y(%y,%y0%y 45y8%|.`z-EI y // a"%@ Pf kg sg4`J,gJ,f S *SЂ%@%| `C(Sg cg gg rfRSfJfV S *SЂ%@%y$%y(%y,%y0%y45y8%|w(G$%K `&JgI y // / a O `z"* \f-g%|r "<rJg.&A+f g fBJg &A+g&A+g>-g mA&mC8Jf`JgHx&A// a&O ` f fTI-|Jg$ jIf **S%ER%H~f&j/ / / / &nNOJfl * f &F'|0`& f &F'|0` f &F'|0z`<%| &F*+0zJ\f-fz%E\.-LR%G`%mPdz-Ng mFA&mC8Jf`JFg{jx`{-g( j (fJg/HzLHx/ a`| j *zh%@zJf@%@zB%j * &g $*g"j !fG%K*S%Ejx"K%ISJg"j g f.S%GR%ISfJg\"j +fPG%K*S%E(K-L~gB jI*{gzg8`Z b mA? 0(g`@ m(>b6// aR4P~f$ *zdS%@ jG%K(I` z g ~ g *&@S%KRzfj *-@..ܟ%@` g g 0f**۪B`X Lg fH$*g@"jI~ gz f.S%GR%ISfJgz!f ժB`I麹fJg* j g f *.S%GR%Hzf"jI yLCf |f>%T$%y(%y,%y0%y45y8%|w(G$%K `h *gbR%I*S%Ex~gLJgH"j I \f$*zdR%I.S%GS`I$*fS&BS%KRzfB$*"jg  VI-@DB(IJgBI*{g~g8`v b mA? 0(g`\ m(>bR// aOPzf@~d8 j(I-@z g~|fB` &nRR SRR&.`$z g~|f`{$*S%B"j`&"*&AS%K **R%E"@R~f.I%j%L%j$*" R%A  f(B g \fSRf *z"z…~ge zg`~gzg`"*\~g~mJg`tzgN`j~%G\%@zg&Hn/ a`PJf Jf B`zz`%mL`%mPd` ~%G\%jh`%jld` J\g`jJ\fd%@zz%E\JfBh`Hjh/ a_PJf D *zgJhfB`~%Gz`z%E`BlBd~z` *\zgnmJf~%G\"*z%Az -Lf4g.Hn/ a_PJf JfBhB`zz` -L%@h%@` -P%@l%@d`~%G\%j`h%jdl`J\fJ n fpz%E\.-LR%G` -L-g mA&mC8б`Э%@h -P%@l%@dHn/ a^lPJf  .gLc hd%@hBX"* &A(k `j !f(Jg\ j !fPR%HS%Bjx`:JgD j g f*S%ER%HSfJgI1~Fe0; N**.r\FJgV j ^g4n +g&n #g*`6 -g`, lg, pg6`RX`:SX`4{jx&Fk2`jx&Fk2`jx&Fk2 **S%ER~fp`Jg j .g*n +g* -g` =g* ^g`j x`&j@x`jx`jx` 3fdjx *&@S%KRzf`D j +g -g ^g #fHx1/ a$PJf"jI yL0fYO%ISjx`R"j" I yL0f +f +g -f&AA -fjx` +fjxHx Hn/*HnNOzf$.f 0f". %A af%jh`%jld *`ЂS%@h`%BTjx`"/*/*/ / a&`|HnHnHn/ / a hOJf pJflJg2 .g// aZPJg0%nP`Jg*  WID//*/*/ / a$O`/*/*/ / a$` *-@(@-|JgB jI*{g~g8`X b mA? 0(g`> m(>b4// aHpPzf" *~dS%@ jG%K`z g~ f RS` *&@S%KRzfb ./ // / &nNOJf$$*g jIz g~ f&BS%KR%HSfJg *-@(@JgBB jI*{gzg:`Z b mA?0H~g`> m(>b4// aGfPzf" *~dS%@ jG%K` **S%ERR~ft ./ // / &nNOJf.`/*/*/ / a&@OJfR NgIzЅ-@ of &FJ,g&F,f`$< bB&@G mA D `I// aDP"* /&A/HzHx/ &BNOR$*JfJg0 jIRz g~ f *&@S%KzfJfHz/ aŰPJg j /(HzpHx/ at` *\~gtzf *hf( *zf\-ffNHxHx/* `// aV~PJf.*yf HxHx`Hn/ aVPJf%nh *`f( *zf:-ff,HxHx/* ``// aVPJf HxHx`B *z-fgvgpJfj *\~gzfJ"-L *hf~g:`"-L *`gf`(zg"APCBJfp+@LB/// NO %j%j`Fg0-mL-mP{HxHnHx'/ apOJf-gR,Jg-f / aXdXJj|lJ *zJg8-g0&nJ+Al&f n fHx/ &n kfNP *z@%@z j / / hNPJf0 m(Af$HxBB/ aFOJf" m(Ag&nJ+Amm`-g / avVXJgN"*XgHlDLe6Hz`N mL FcHx`nHp/ aT$PJfHz` **XۭL-gJgJLgJ*yljx*{gjx2*xf<-f4-g mA&mC8Jf`Jg*}g"<Jg"-mLpЎB//// / aOJg jG%K| R*{g*.&n 3XgV`j*.&n3X b mA? 0g,`@ m(>b6*.&n3XI// aB P~f jG%K|R*.؛۪//./*a{O %j%j -gXBB m$hrJg`B*N |^~eB00 N@@::::Jf*tHz,` JfvHzVHx/ ao~O `a$RJfJf"Jf -fR`Hz+Hx/ ao>O `2Hz//*Hx/ ar`HxHx`/HxB/ aOJfJgB jIR*{gzg8`P b mA? 0Hg`6 m(>b,// a@zP~f$*zd.S%GRS`$*z g~|f zd%E`.S%GzfjJfpvЮ&nаrgHzHHx/ an6/ a |OHx/ aINPJgHzNHx/ an z-E`B&nB .Ltg`6%lL`%lPdr%A\`%jh`%jld%lLh%lPlt%B\ j ;f> *\rgmJg `,tg`$a@)j`L)jdP` )jhL)jlP j6|R%HS`f/ HnHn/ / aOJfJf8JgrJg *\rg(mJg `Ttg2`L".$.%A`%Bdt%B\`4".$.%Ah%Blt%B\`%jh`%jld".$.%Ah%Bl`*zf *\tfglmJg `xrgR`p%lL`%lPdt%B\p`ZHxHxB/ a r*`hHxBB/ a `Tp`VHxBB/ a r`@%jh`%jld%lLh%lPlr%A\ptf"*h`dHzHx/ ajt*BL<N^Nu$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0NVH?<&.$n *n*.(.(DB(EB{(CJf4 jI/HzLa8PJgHxHxB/a N|(D(`&j"KI|8eX0; NrNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNJ|(E({B/ /aLVPJf|`|(E({Hx Hn/*Hna؈ @Og/HxB/aT`*B". %A`\|(E({fHzHx/ah`Hx/ j(I//ae$OJfTU`|d) /g ?gHzHx/ah&`dI%LSA )/fA|`A(C*L+lPHxpHn/*/ / /NOJf". %A|(E({`f|(E((C+lP ,Lf / /aJPJgp`XJg|*`*|d"j)I yL0g+`RSJg* j g fR%H *(@S%L|fBJg"jI yL0f +g -g ^fr(EJf|((C*L+lP{`I0f*+I(@4xf +fR`SS%AR`A -g ^fR%KS6|`Hx Hn/*HnN @O|f@Jl".l0 <m$0|`Jo".0|o <b0||g /Hx`:".Jg`ԁ". %AJgf j g fR%H *,S%F|f"*g6"j&II yL.0f +g -g ^g(EJg>Jg:l D"d*HzHx/aeN`" Fc HxHx`n҂*BL`!j jf&` / "DNX$l:fg)lF/,J lJHh/,a)lJ *+@L)@BR,N gBL<N^NuNVH < n*h&mrtvԍgrINgD"k:E:g0 Qf'i>`!i if$` / NX"k:f/+FNX SJg!k k / NX&mrfBBL<N^Nu098|The %s command is unknownNVH 8(n$.Jg$lJg*@g*B RgV/HnB/ a`OJg&@`8 Rnc/Hjn/*j/ a6OJg`%@j&jj-jnj@B3(//. / arHzF/ Hx/ aeOJg lJgjfh@`/ aLN^NuNV/B/. /.a`Jg Jg ft $.N^NuNV/"n n 1!gB`BHh/ aJg WID $.N^NuNVH 0&n$. En RJg.m&f/// aGO Jf `E  @JfBL N^Nu099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0NV/ /$n n ". .tg$btgtg`BHx`hHz`^Hz`XJfHx// a`hteb0;N 0BHHz`$Hn/ aCSRRfHxB k/(/ S/(/BB/ aªJf lz>B`HzHx/ a]pLHxGh/ E`/ B/ a¼OJfHx/ / / anOJf -g m$@&HJg  gRSJffJfF,g vf .f RJg^S`R"K/ //RHx/ a:OJfzJg&RSJfBHz/RHx/ a:OJfP KJfrJg+K+J ,fJg lHx/ hNPJgHx m // ap`2 ,v)C @gHzY/ aPBHzK/ ahd// EJNHz1/ N/ aO <-xf,,g lA"lE8Jf` Jg <,,g l$A"lE8Jf` J$gv@BGB-K-K/B/ / aOJf$ng(/*/*/RHx/ a9"OJf$Rf)BLfHx/ a<&n +$fHzHx/ aT`BBv$@IJJg*<KJZ/aX"҄ k(fTԁ +8Sb $BHz` |gxHzt/ NP k(R f <// f </HzM/ N kO(Af,HxBB/ a(OJf k(AfXJfZHz/ NBL<|N^NuNVH08$.$n &.0|Jg jtHxHhax(@PJfBHx/aSO &LJg"Jf"/a///aœ(gG`6B`6$jp RJg&/( R//ar&O gXX  @JfB L N^Nu@(#)ex_argv.c 10.19 (Berkeley) 3/30/96NV/ / n&n $hB,Hx/a L'j$p'j,tB$n&nN^NuNVH 8 n(n $.&n$h/ /a / / *, j$ p /a *, j$ p PB3 *, j$ p !KR,)j$p)j,tBLN^NuNVH 0&n$. Jg$kJg*@g*BBHxHnB/ aOJg-@`< nb HxHjn/*j/ aOJgp%@j-jj-jnj@B/.HnHnHn/././.// aO$Jg.Jg kJg"njfh@` /.aʈp`j .g8 n"Ҁc g fRb첈g/./.// adOJg kJg"njfh@` /.aBL N^Nuecho NVH<8&n(. Jg$kJg*@g(BBHxHnB/ aOJg,-@`B nb&HxHjn/*j/ aVOJfp`%@j-jj-jnj@HxHzd/.aЊ$nZz-EBHnHnHn/ /./.// aNO0JfHxHx3/ EKNO JfHxHx4/ NO Jf+g kA(kC8&1`&+$CgP yL  g  gICfRfJg($n$.gI//aPJfFSRf`>$n$.g\ g& g I yLCf//aPJfSRfJg$HnHnHn/ a4OJgt`"$n` $nZ[/./ // a<$OJg kJg(njfh@` /.a L m b0Y ?rg`$(>b// a (Prf rdRS` r gr g RSRJf// "FN ,, l$ p !D l$ p -PPJghBBB"n ){g g>`> b mA?0hrg ` m(>b// aPrfRS"nRJf"nBR,Jf"n #l$p#l,tBLj@nc /Hjn/*j/ a&OJg%@j&jj-jnj@`"c/Hn/ / aOJgN&@/// aB"G{O `rd"E) %g #g !fRSRJg$lJgjf>j@nc /Hjn/*j/ apOJg%@j&jj-jnj@`"c/Hn/ / a:OJg&@"ESRJfRJg$lJgjf8j@nc/Hjn/*j/ aJgN%@j&jj-jnj@`>c8/Hn/ / aJf"`Hz` Hz`HzHx/ aIp`&@BS"n""n ""n$"BLHxHxN&@PJg"D'i`){g'i` ,N`"D'ih ,N&:'B>f)K>` R!K)K:$m $ Pg  jG$jf Ѐz/a @)HXfBHx/aAp`h)HF)KJB3G$m g$/*/*/ a O $jf"C i (r(g hr!L"C i!Lrzrک)EBL< *f4g/HzQ/ aO `/Hz?/ aj/ akZOJ\f j(Xg~*g jAt8Ԫ"BJf`JgHx/ aPJgF`(*g jAt8Ԫ"BJf`"Jg*fBHz/ aMN&@O pWID// // / aO`JfHx l // ap`r@zr`f.hf(Hn/ a"PJgp`xJf BhB`6|/ /HnHlhHl`/ / a=@%nLO*gBPHjP/./ a"O `%nP *f Hz/ aizBL<N^Nu@(#)ex_cd.c 10.9 (Berkeley) 3/30/96120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%sNVH88&n$n k(Xg**xf" k h /gHz,Hx/ a=`F *tgxgL`THzRa$J&XfJas/a1 @XJg hJgJfHz%Hx/ a=b`&` jp P&`abd/IbNXJfB`Jtg jp P"P /g"(xf .gxd .f ).f) /gjJgf k$hJgZ$//*HzHx/a$8/NOJf*Hx/aPJgdHz/Hx/ a@`N$RJfHz/Hx/ a?pLN^Nu.NVH><*.,. "E&)"C$iJg8G RJg!j`"C#j j /*N/ NP"C$iJf$(FB`Jg Jg`6|$<xHx KN$@XJfBHx/a;p`HkN%@XfBHx/a;O Jf / a~p`^/ //*a jB3B"C%i i #J$ RO Jg$Rg :f&LJfXf8Jf2BL<|N^NuNVH8 n&h$kJg4I RJg!j`'j j /*N/ NP$kJfBLN^Nu@(#)ex_cmd.c 10.17 (Berkeley) 4/10/96}Dz|ylj&hO!D0wܾm4BYHF1D3mHBܾF1j^c^|W<9R|9Z"~<^B{X70:-B~W61---`]R-S$T-L|p1jy^Y2BT+  9~C=lB{ZU9~C?6<&:ƒzsD0O0+ADDzB 4xqB4d,#B|DjKqmhL&j^SNM10C2S :jTO J7sUdPA d|qsRjsRjrp<^B{R7N@J91 j$Jjjuqn4g>9z@|2 ¼~8$xJB|B|!-wo_@:F$- DŽ$-$-pl^$MHCͮ?Vx<Nreplace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnext[Tt]a[g][!] [string]tag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]edit the file containing the tagrta[g][!] [string]!w1ortagre-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalswitch the current screen and a backgrounded screenfg [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, screens or tagsdisplay b[uffers] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangebackground the current screenbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.6 (Berkeley) 5/16/96(zn_ZA5//Discard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd db-nameAdd a new cscope databaseadd309|Use "cscope help" for helpNVH8&n(n $k*@f/ / aPJgp`*@ lp P$P"(o yLI0gSRJnJgN"Jo yLI0fSRJnJgBJg yLI0gRJf/ ap @XJfHz/Hx/ ap` / / / hNLN^NuCSCOPE_DIRS NVH08(n&. Hza$Xg/ab&@XJg$lJg*@g*BBJcX/ HnB/ a4OJg&-@`:nc"/ Hjn/*j/ aOJfp`V%@j-jj-jnj@Hk//.aO E`Jg /// a4O Hz&HnN @PJfBL N^Nucscope.out%s/%sNVH <(n$n $.*l/Ge:N/// / aˢOJf> *trgmJg `(rg` aAHz/ a `"jp i$`Hx// a`Hzf i/HzgHxE/ aHn/ a~OJg/ Hx/ a"`/N&@Hk6Hxa@$@O JfBHx/ a`~p4Њ%@%K / //ajO %n/ / atPJfH/ / a0PJf: -$g m!J+JK%M/ / aPJg B/ / a ` B` / abpL<N^Nucscope.tpath%s:NVH08&.(n Hz/,HzKHx$/aHn/a^OJf&nHka)@,XfBHx/a`BB/a4$@O Jm/ /,,/ aO g(Hz_/Hx/a2OJm/ at`/ ah l,B3 l,XgC :fJgRRRfHxHja>)@(Pg\&@Hz/,,E`&HzBN @PJfB`H/,a|)@,XgHxHxa> @)H(Pg ,B` ,,g /aB,pL N^Nupipevforkcd '%s' && exec cscope -dl-csh/bin/shexecl: %swrNVH 0r-AA!A-A/E`NXJm HnNXJlHz` aY"n #@rgJgn`HziHx/.a"O .rg /aX .rg /aX .rg /aX .rg/ap`B/.EY^NHxG/+NHx/+N/.EN/.NO "n /)HzHx$/aB/HzHzHzaA|O .v/Hx/.aHxa?/.EN/.NA"n #h$Hz/(EN"n #@ #nHzf/)N"n #@BL N^Nu310|No cscope connections running%d%s 278|No matches for queryNVH?<$.*. B*hJfHzHx/aj`0B̻fXHxHxGDN(@PJgE$)J Hx*HxN(Pg"D"#J f)D ` R!D)D)DHn/./a&@O Jg B.( -hL-hPB"GJ)l EA|,RB$mJg^&"kT/ /.Hz/* aNVH?<,. *`:Hx /aD-@ @PC JgB/*F/-HzHx/.NO*F/-Hx/aeRO JgzHnHnHz`/aWOrf .*@S-MJg**F/-Hx/aeO Jg.Hx /a-@ @PJfF`r g*F m ("S!ASj/-aԨX`*F m"PBRrg`B-EBGHzHnN$@PJg*F m( g a @r *F/-HzHx/.axB//.apLg4 j ("S!ASj/*aX` j"PBRrfrfB/ /ap`v j ("S!ASj/*a͐Xr>f` j"PRr>f j ("S!ASj/*aXXr fZ` j"PRr fFBLN^Nu@(#)ex_delete.c 10.8 (Berkeley) 3/6/96NVH00&n n JfHx h // ap`nHxthԈ/E`/ (yvDrO҈// apOJfHx// / avxOJf'RLHn/ a,Jf .Ld'@LBL N^Nu@(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstagsNV/ /$.$n jp"P QBrcgLm rbg`rsgdrtg` )re/Hz/a8O Jf/a` )r et/Hzj/a O Jf^/a"`j )reJ/HzL/aO Jf4/a<^`@ )re /Hz*/aO Jf /a`Hx j /(/a"p$.$nN^Nu123|No cut buffers to displaydefault bufferNVH 0&n kJ,fJfHzHx/ a`$h,JgdB* yL0(fJAgB/ / aO k(AfHxBB/ aTOJf k(Af$RJf k$h,Jg`B* yL0(gFAgB/ / aO k(Af@HxBB/ aOJf k(Af$RJf k$hJg Hz/ / a>BL N^Nu (line mode) (character mode)********** %s%s NVH<<(n$n < *g </ .f6* b"@C lA D `B@/ a֌P/Hz/ a0&jO* PgKJ$k&+SrgvBB b"BC* lA D `// a$P// N lP(AfBHxBB/ aڊOJf l(AfRQBCSdHz/ NP&SfjL<$rgJg0`|HzHx/.a^/.N/.N6|-KO`T/.NHzT/.a$O Jf Hxa%|HxBB/././Hz/.a|/a%T/.azXr f/./.aFPJgD6|-K`:HxHn/./.Hz/.a.OJg8|-L".&nӫ\HxBHz//.aEOJg8|-LJfNJ fHHx/./.B/.acOJfHx/././.aiOJg :|-M` &n rd//.aߦPJfS&n k(XBBBr f&nDD//.//.aDTJfJgt L< N^Nufilter readNVH<$n(n *jG`BB/./-4/ a"bOJfBHn/ / NO Jf0 j(Af$HxBB/ aOJf j(Ag, gHzpHx/ aO / aBL<N^Nu@(#)ex_global.c 10.20 (Berkeley) 5/3/96NV/ n (xt‚///.ad$.N^NuNVHx/. /.aJN^Nu124|The %s command can't be used as part of a global or v commandppNVH?<(n*. ..JfHx*E m /`,g*E m /Hz~Hx/ ap`*EJtgJ mp P ` R-@"@ g gg$I yLC(f \g |g fHx *E m /(`v R-@$@"J J`: \f&)If ` )\f\ .R-@"@ .R-@"@gIfIfR-IBJfB ,fHxB/ a`,fLHxHlBB// aa2OJg.`HxHlHlHl/ / aa OJf|)F-lL-lPHxHnHx'/ avOJfHx~Hxa &@PJgHK:-M*'M>/.a>-@Xf-|$|-FpЀ|/ap @'HXfBHx/ a`*'HF .'@J//.HpayBBO B+NJf`@N l (r&g hr!K l!Kr|rܬ'FBvd*E$-`*-hehQpBCSdh l(Af$HxBB/ aOJf4 l(Ag( SJg!k k /+EN/ NP`// a\xvdPHnHnHx// aOJf"BB-nBHxHnB/.E/ a %*OJg|gA`|g`Jg|` / // NO $k>g S f%B `THxHxa0$@PJfBHx/ avO Jg|%B %B$%k>*n Ug k> 'J>RdHx/ a[BL"@S%I Sdz"<f+j>`'j jf(` / "ANX`JHxHxa&@PJg.*R'E"j R'I *S%E &'J Rf+K>`!K$$Kf2+BB*UJf BL< k ( g"/a%@ XfBHx/ a.p`/ / au"pJfBLN^NuNVH 8$n&jJfB`xBJ*l/ a6XJVID/ aXJgt +4g /amX + Ig/NX/ azXJgt/ apXJgt/ NB LN^NuNV/ n . ".tgt=g`//a`//ayH`B$.N^Nu/etc/vi.exrcNEXINITEXINITHOME.nexrc%s/%s.exrcNV@H<<(nBHxHzv֎(// K0NOzdzfHz/ aPJfHzGN$@XJg&HxHx/ a8./ Hze/ a:O`Hz[N$@XJg&HxHx/ a8./ Hz9/ aO`Hz.N$@XJgJgHz/ HzHx$@/GNO.B/// NOzgDbzg,`:Hz/ HzHx/NHxB/// NO(zf// aPJf l hrJg / aiX ,f,g l~A"lE8Jf `J~gBBHzG$@// NOzgbbzg4`XBBHz*// NOzf@"n@f *.Dg,Hz`"n@f *.DgHz/ a`HHx// aRbBA/ aP`Bx gmxg`Px fJ b*@K lA D `B@/ aP/HzHx/ axp`*Hx/*E"mp i/(/ Q/(/ BB/ aLRL<HxBB/ aOJf j(AfRRQBBSdQBFSd~"n"BL/ aO `Hz1/ a4P/ aX +f'@g( kHx/ hNPJg Hx j `(rHx jp p,/HnBHj`/ / aBOJfr@z'nL+gBPHkP/./ a?B` k ((`// / / aOJf *tmrl rg `a jp"h( k 0(@ @fP/)// a?`$O g k /(aIJ k !BX k h? k h / *E mNX`&// aP`Hx jp P// as`Hz/aPl(@PJgHn:l/ aEPJgHz/Hx/ aV` . g/ anHzYHx/ aϞ`dB:l/ BB/ a@Orf/HzHHx/ ajOBHnE`/ / // aJ'RLJgRLL<8(n l$hzڈfHzHx/ a2`BBv`X j /(aF"҄ԁ ,8SXGJb $BHz` |g xHz/ NP j /(/ NRP$R lg.(Af^HxBB/ aJOJf l(Agx(Af0HxBB/ aOJf l(Af Hz / aBL|N^Nu@(#)ex_script.c 10.29 (Berkeley) 5/12/96150|The script command is only available in vi modeNV/ $n n *fHzHx/ ap`&Jtg// a8PJgp` / aRJVID$nN^NutcgetattrptyforkemacsTERMemacs:TERMCAPtEMACS-iexecl: %sNVH <*nBHx3/ aO JfHxaA$@XJfBHx/ a`+JB Br%A%AI\/ Ba@2PrfHzH`vrê`rêdGT/ /<@thB$<"BNO rfHz`B/ / HjI/ G/ a jOrfHz`a $rgJgD`*HzHx/ adO *rg /aF,X *rg/aF`HxHzHzEcNHxHzHzNHxHzHzNO$a$B/< ta/"BN/GNB/EY^NHx/NO./N/NO -g mA"mE8$r`$mHx// aPJf `RBHz // a Hz/ Hx/ aO.a/ aTJf mr>B`pL<N^NuselectError: timed outError: shell: EOFshellNVH?<&nABBBBBBBB*(~-G,"FB*k$-I ~rꊃ,/BB/ "mR/ a ROJg n~f`2HzQHx`. 2|/ //-aD O ~gJfHz0Hx`Hz6`؀&$Ec~B k b B0) ?`(>bB@/ aP`B~g~ f8Hn/ aPJf"J/ //.B/ aOJf& RRbd$///aF(؂O gB"F#|/BB/ .-R/a *OJg*n~g ` ~g`HzHx/ a0O `0$Hn/ adPJf///.B/ a,OJg / ap` /// aLHnHnHx/./ a@OJfHn/././ KaNOJgJfvJg$lJg*@g0B .g^/HnB/ a2OJg&@`@ .nc /Hjn/*j/ a2OJg%@j&jj-jnj@/././ aDO `BHnHnHn/. / aOJg Jf,`f .g"Hn//./ NOJg ". .䰁f HzHx``Ѯ-A$l/././*KN$O fBHxHzb/*NO zg(Jf aE @z HzHx/ aO `JgJg$lJgjfDj@ .Ю䰪nc/Hjn/*j/ a1ROJg>%@j&jj-jnj@`. ."Ү䲮c"/Hn/ / a1OJfp`d&@ ././.HsaCZ*.ڮ// /./ aOJgxJg$Jg lJgjfh@`/ a; L<J*l" j ("|† 4 g / aXJf $Rf` pLb// aLP`Brgr f*, ///.RHx/ axOJf & RRbd, Hn/// aOJgJg~B-|BBBBBBBB$,A rxꊉ,HnBB/",R/a Orf///a?$ԆO `/// aO Jgp`l///.RHx/ aOJf&'nLJgS'FP`BPHx/ a *@PJg kJgjfh@`/a8 L%K j B3B`/ apLN^NuNVH 0 n$n "n&n h"(bH h JgDJg8f(Jg4SRg.gJg&Jg"gSRJfJgRfSSfJgB`Jg&pL N^Nuscript-shellNVH8(n&lJgZ/ a\ +Xrg /a:X +rg /a:XBBHz// aB/+ EN/ NBBLN^NuNV n"h i PgJ(lr>` Pfré>N^Nuttypqrs0123456789abcdefNVH?<*.,...Hza Ĥ @XxJg((IJgOEJgGOK fpOBHxHkN&O rfa= @rf`t/a /Hka HxHka Hka lBHxHkN$O$rgL"n""n "JgHk/a|PJg/Hx/a $O Jg//<tg/a8B`(/a8XRJf&RJfa< @r pLk)kjjjjjFilesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitPower failure imminentProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %dNV/".BAʲf (`&RPt d/HzHx(HyHa <H$.N^Nu@(#)ex_shift.c 10.10 (Berkeley) 3/6/96NVB/. /.a:N^NuNVHx/. /.a$N^Nu152|shiftwidth option set to 0NVH?<&nJfHx(n l // aVp` + g kA(kC8Jf`JfHzHx/ a.`Hx(n HlhHl`B/ aOJf(n lp P -@`*+ g kA(kC8` R-@$@ >g `p)ML)nHP&.B*.D֮HՅ&n " l\BrFlE8`E-J .f/. a*X`/. /aP-@fBHx/ aNO JgZ/.H"n/ *.ڮ/GN*.Hۮ4|/.Hn HnHn"n/ / aO$Jfz-E .P܀BJgbJ,gZJ,gr&.Jg~"҇ . dV$ c$ԁ-B .f /aFX` //aP-@fBHx/ alO Jgx/ܮ/"n/ N߮O ,B",gTBcB l p,/Ю// / a}OJf l 0,RR\RRRe,B/.Ю// / a~OJfHn8HnHx/ / ayjOJfrJg$lJg *.躪jfDj@ .8nc /Hjn/*j/ a OJg%@j-jj-jn4j@`* .84c /Hn4/./ a OJg-@/.8/./.N-n..8B . O dV" c"҆-A .f /aX` //aP-@fBHx/ aO Jg//."n/ NݮO Jg(f`J,gJgJfpBz`bJgJg".҇ . dV$ c$ԁ-B .f /aX` //a(P-@fBHx/ aO Jg/ܮ/"n/ a߮O B",gPBcB l p,/Ю// / a{ OJf^ l 0,RR\RRReB/.Ю// / a|(OJfXg)MXR`Jf JfJgpE,$-M$G$BBJgHx/ / /. / aOJgHx/ / /. / aOJgHx/ / /. / aORJgbJ,f* ,Lf *. PgBPHlP// aO BJg,JfDJf>Jf8z@"n z`,/.// a`,fHzHx/ a:]]NVH8<&n(. *D(UB`. [gn *g .g` \g ~g`R g` ~g`2|P` k +gA *kA8J f`ZJf`R k +gA *kA8J fl`Jff2|`^ k +gA *kA8J f`>Jg:2|ҫ`0 k +gA *kA8J f`Jf 2|T`RRfJf *nB`Jg$kJg*@g(BB RgZ/HnB/ aOJg($`> Rnc$/Hjn/*j/ aOJfp`%@j$*j-jnj@*D(U$B`R [gn *g .g `0 \g ~g`R g` ~g(`HxHz`HxHz/ a<^O `+g k A*kC8Jfr`VJ fj`N+g k A*kC8Jfv`xJ gr`l+g k A*kC8Jf` J g/+/+/ aO `2~`,+g k A*kC8Jf `J f\RfB*D*v*n*BL<N^Nu^.[]$*NVH8<(n*n nB&U/ aB$XJg$lJg*@g(BB ЀgZ/HnB/ aOJg(&`> Ѐnc$/Hjn/*j/ a^OJfp`%@j&*j-jnj@(C3( /g ?fB3( 3$(fxB3(`B /g ?fR ^f (C^RJg@E \f /g ?fRR`I/Hza=zPJg\RfJg$B*r n BL<N^Nu([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*NVH<<"n*. B*E$U$ ` fRRf ATK A Ѐ*@K Jg$iJg*@g&BBJcV/HnB/ aOJg$$`:nc$/Hjn/*j/ aOJfp`%@j$*j-jnj@$B^&<*Hx// INO *BE*E&U`8 fHx// NO E`I/Hza<PJg\RfHx// NE$B*E* nx BL< ,.*. (.BHz//EQZN&/a$OfBHx/a"`(////N/HzHx/aO.aL|N^NuNVH?<$n"n-Q"n*Q"n&QB(j"n-I"*S-AtgIz&g |\g4`H j *gA "jA8J f`"Jg`JgSIpЃrOe0; NR j *gA "jA8J f0`Jf(B`pЃR."n"1x$1xz|g"1x$1x g 1x.1x -G"n -ISrgTBB"n j bC".B0 ?`(>b// a_P`Btgz fh *谪fL|І%@ jJf/abX`//aP%@fBHx/ aO Jg * j! R`hJgdrgetg`Nzg(|g$`@BB yL0g2 y0 `&BB yL0g y0 `aC-IdZcG`GJf / aX`/ /.aP-@fBHx/ aO Jg-M"nR*nRSdl`RB`Rx`Rx`Rx`Rx`R j bB0 ?`(>bBC/ a]P`Brgt fn *谪fRzЅ%@&*f/aX`//aP%@fBHx/ aO Jf Bp` * j! R`hJgd|gerg`Ntg(zg$`@BB yL0g2 y0 `&BB yL0g y0 `aR& RdZ cG`GJf / aX`/ /.aP-@fBHx/ aO Jg(-M"nR*CSd"n""n""n"BLB/.a /.ap``"n#j iR#k "i j 3h k/(B/ a0 n!@$!@( (@rF!A%HjB$n&nN^Nu159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]NVH<<*n(. &m"fBHx/ ap`"D )tg zg `(A`"D ip P$Hx Hn/aߐ nO Jfb`8// /aO rf& `$  jR$Cc  gbf LN^NuNVH0 &.$n $.c.// /a2O Jf `Jnrgc  gԴb`BL N^NuNV/"n n ".` g$g ror `2RRgc fJfBc  g  VI`p$N^Nu@(#)ex_tcl.c 8.9 (Berkeley) 4/28/96302|Vi was not loaded with a Tcl interpreterNVHzHx/.anpN^Nu@(#)ex_txt.c 10.13 (Berkeley) 3/6/96NVH?<*n(n ..&.B g $@f| e / aX`B`6Hx BB/ a($@OJgf$%Lf)J` T!J("mLR%I(-"DJ)Al\g C@/ BB/-L/ a`OJf/// / a O`("j jB0` y R`|ƆBzڎBB// aAOJf .S|e 0; N( 2|-I`// aGP` *R c /Hj /*/ aڠOJgT%@ .U|e0; NT&0n.gg&jJg j 0\f S%K` f gH *R&jf: j 0.f. Rf)j`!j jf(` / aB`Hx BB/ a6&@OJgt"jR'IgNA(|f(/ /.HnB/ NOJf>/.aX`/ /*/ B/ NOJfB/// / a&$K$%lOf(` l )K`"jbgt`,*bxgpt`j glB jc-H&j g fRef@|%F j jB( 9"@S#SjhHyHx a`:gj"*gb|gb|ghG` *Re" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" NV/ /$.Hz/EJNHz!/NHzO/NHz/NO.6/NB$.$nN^NuThe %.*s command is unknown Command: %s Usage: %s ^D%*s: %s NVH08(n n (tgvf hp&P"SB yL0gt y `BEnJg./+//aJO JgEJfJg Jg2*f*Jg SB"y //+Hz / a`/*/*Hz%/ GJZNO <\grf谊fEr`$@/*/*Hz/ N`$<n$B`zGJZfC`P*gF|[ RI yp  RP|]"RRAArҎJgJf"A`"R/*/ Hx Hz/ NOEJg< l(Af0HxBB/ a8,OJf^ l(Af `NaBL N^NuThe %s key has no current meaning Key:%s%s Usage: %s %s NVH 0$n"n )tgrf ip PgHx i /(/ ap` PBr~m\r[gr]f B(fFr~f.*zg jrA&jC8Jf`JrgAC`  @$ (f> bB&@G jA D ` // a2\P/Hz/ a`//( h  g f <` </Hz/ aV`B`Zr~f.*zg jrA&jC8Jf`JrgAC`  @$ ( g/Hz/ aO Rr~m< j(Af0HxBB/ a6OJf| j(Af `la~BL N^Nu@(#)ex_util.c 10.21 (Berkeley) 5/8/96NVH<8&n$n $.&.(.*.(n Hx~B/ aC 刐AnA 'H 'B\'C`'Dhr'Al'AdJgkxBt'LpgBLR jR-JHnawXJf/ aXJfHzD/ a` vv%CBL N^Nu@(#)ex_write.c 10.25 (Berkeley) 5/8/96NV/ /$.$n B/ /aXO Jf B/a PJfBt/ /a`p$.$nN^NuNVH 0$n&n Hx/ / aO Jf(B/ a bPJf4+x// aJgp` *Jg@`@%@BL N^NuNVHx/. /.aN^NuNVH 0$n&n jJfHx k // a2p`Z(XgHx/ / aVO JfB/ aPJf4+x// aJf *Jg@`@%@BL N^Nu! NVH8<&n(n &.JfHx l /`*t,xgt",tg@ lp P$P` g fRfJgxf !f+g kA*kC8Jf`JgHx l /`Rg g fRfJfHx l /(`Hx/ ap./ / / aOJf,Hx lp h/HnHlhHl`/ / aT6OJgp`\ +f Hz/ aB`>Jg6xg( >f" *>fxT` g fRfJgJf,}gx/B`/ a// / / abOJfp ,tmxl xg `azj lp"h& k 0(@ @fT/)// a$@O Jg k /(a k !JX k h? k h  k/ hNX` // a .hd%@h/ / at$Jf Jg'DLBL<X +Trg /a*X +Lg/NX +Pg/NX/ NBL<N^Nu244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu charactersappended: 257|%s: %s%lu lines, %lu charactersNV|H?<&n$...(k Jg/,/aPJfx$,`B,ŕfBJg>+g kA*kC8Jf`Jg <!g <`&rƁf+g kA*kC8Jf`JfxJg,g*Hn/aBPJf <og <A/`DfOJg$Jg kJgjfh@`/aBL-@O lN @rfB`$"//aBBBBBB/aO$ NfvR`B/ a// //aOJfXrg Hz/ Hx/aA8/.a`0JgvJg(F$lJg*@g6BB$n R (Ѐr2Ёgh/HnB/aOJgn*`F n P (Ѐr2Ёnc /Hjn/*j/aOJg8%@j**j-jnj@$n"E R$Pg&A %f %g%` /f&IRf& %dBJfHza $$E`B/a$/$KXJf n P(``$Hn/ Hha O rf .l&@/aJ @XJf/ajHkHzm (n/ /a#-EO` B n P-PHn/.a*OJg&Jg(F lJgjfh@`/abpLN^Nu265|File is a temporary; exit will discard modificationsNV/ $n"jJg, j (g rmJ fHzHx/ a7vp`B$nN^Nu266|File readonly, modifications not auto-writtenNV/ / $n j(Xg&*g jA&jC8Jf `JfB`J*g jA&jC8Jf`JgHzdHx/ a6p`/. BBB/ a$n&nN^NuNV/ /$n$. *g /apXJfB`/a%@XfBHx/ a6V$.$nN^NuNV/ "n)g iA"iC8Jf`BJgEP"9PSxg>BG?APCPB,>dP> b(\\\QBASdrB yL0(gR`AhBLN^NuNVH 0 n$. "hHnHn/./ inNJfNJfHEP JJg.CP\f `&\Jf yPG Ѐ%R#PL N^NuNVH8<(n&lBKB"CC:$ ԂE) D// N @,) IPSrg QB@SdR cL<N^NuNV/ $n/. / a& *$nN^Nu0123456789abcdef01234567NVH8<(nn,g lxA*lC8 q` lxJgg.gTRf.,Dg lbB@/ -AaP".`B%@(A~҇GEQBBSd|BL<*n(n v| f&,$m jJg"* $* Ђ"j d p@|?d // aP j"* $* 爐A 爐G ԃ%B| fv*,S|g|BIE B|'F"ER b mA?B0H` m(>b// a|P`B'@BIEGQBCSd`&"K L""""""BL<|N^NuNVH?<*n(. $.,.&mJfx؎BBJgBfJ ~Ag+Ag/ ah*XJf&/~1Ά/// kbNOJf $D"* W~eJ0; N0BBB&p~gp// a`4|-J`" m~>f// aPJf ~Af + "牒 kA-H~g:$DX(HX$ D"n +S'@fB `R `Jf$n*f ~g* m3 4~gHnpgp//+B/.B/ a-@OJg-g m|A$mC8Jf`vJ|gp~ $nؾf*-rg mjA(mC8 q`4 mjI `.-g mA$mC8 qI ` mE A$`B` JfV(nB, yL0ff\$DX(nX$ D"n +S'@fB `@R `:g:$n jJg.B yL0f(D|a B~)GB,B`$n/*"+ 爐 kHp /*aO JWID +'@fB ` $n.*߫ (nJg-g mA$mC8Jf `JgR~g" L< fffg Ѐ$AE" ҁf6BHxHn/ kbNOJf~f m~>$D%G`JgbHx(n., /$l/ B/ arOJfxHx(n/,/,B/ aRJf\ + "牒 kA-H`Hx$n/* /*B/ aOJg`Hx(n/, /,B/ aJgpL<$.(.*n(n . &g&B$kJfHxB/aƼ`fj&B+gL,+x&F"k&B k|"(e(b$ Fg PfJg(Jg*`d-@ f Jgx( `rBG -Kz-E jBHnHn/ h NOzg zf g /. /aJgBJgBp`$%n %n %nJg(Jg*BL<|N^Nu003|unable to delete line %luNV/ / &n$kJfHxB/ aņp`/. Hx/ a O Jf/. Hx/ a*O JfHx/. / aC -Ir-A jBHn/ hNOrf/. HzJHx/ a!X`z"n bB *gS%@*Xg/ agX*X@XHxHx/. / a$n&nN^Nu004|unable to append to line %luNVH 0&n$kJfHxB/ abp`C-Ir-A-n-n jHxHnHn/ hNOrf/.HztHx/ a bp`"ndB *gR%@*Xg/ afX*X@XHx".R// a>"nR/ Hx/ aOJVID".R/Hx/ a(O Jgt/. B/./ a@JfJg4| L N^Nu005|unable to insert at line %luNVH 0&n$kJfHxB/ a p`C -Ir-A-n-n jHxHnHn/ hNOrf/. HztHx/ a p`"n eB *gR%@*Xg/ aeX*X@XHx/. / a/. Hx/ aOJVID/. Hx/ a'jO JgtHxHx/. / aJfJg4| L N^Nu006|unable to store line %luNVH8&n$kJfHxB/ ap`Hx/. / Ip`"*g$(+g k|"kx (Ҁ(`K-Mt-B jHxHnHn/ hNOtgtg`HzTHx/ aBp`HB`BHx/.Hna".%A%A%n %n+g k| (e (BL<N^Nu008|Error: unable to retrieve line %luNV/. HzHx/.aN^NuNVH08&n&. $.+fH(krg8 k$hPg*gf/// aO Jf$R +PfJfB`p` /// aL N^Nu@(#)log.c 10.8 (Berkeley) 3/6/96009|Log fileNV/ $n BB r%A,B0%A(%A$BHxHxHxBa %@OgB`HzHx/.at*Xp$nN^NuNV/ $n jJg/ hNBX *g /a&BB r%A,B0%A(%A$B$nN^NuNV"n i(XgB`*J,g!iL,!iP0B`!iL,!iP0Hx/ a>N^Nu/u1/NetBSD-1.4.2/usr/src/usr.bin/vi/build/../common/log.cNVH8(n$lr e Hx Hj /*/ aOJg|%@ jHxHj,"*R/aNG(-Kr-A-jr -A jBHnHn/ hNOrg "R&R%@$B`HxHz/ a .pLN^NuNVH 8(n$.&l+XgB`P@XJ,gHx/ aPJf.B,rfFHnHnHx/. / a&OJgH . rg// a`B-|:`"HnHnHx/. / aOJf .Z c /Hk /+/ aOJg'@ kHxHn "+R/EN/./."+Z/NE(-Jr-A-k".Z-A kBHnHn/ hNO(rg "R$R'@$B`HxHz/ apLN^NuNVH8(n$l*XgB`J,gHx/ aPJfB,r e HxHj /*/ aOJg|%@ jHx/. "*R/aG(-Kr-A-jr-A jBHnHn/ hNOrg "R&R%@$B`HxYHz/ apLN^Nu010|Logging not being performed, undo not possible011|No changes to undoNVH08(n&. &l+XgHzHx/ a`r(f&HzHx/ a`HxHz/ a`@XC(-Ir-ABS( kBHnHn/ h NOJf$nBS | re800 N0b0JgHxHj/a\+XB`tHxHjHnaE`rЁr8e0; NrJf<'y$F`nrƁr`drë>`\:|-M`Rz`N|`Jrtg xr`>~`:rrgrtgxt-y$F`rƁr`$9$F` kNp`HzL/ /. NO rf 9DI JgfHzB`gJ+Am~HnB/ acFO Jg8"nJg"#n*n f'I ` *n U!I'n`T"nr"#n*n f'I ` *n U!I'n/+aXJf  @Jgr) Jgr Jgr r6 r //.a$PPJfJgX/HzHx$/a-B/aO-@BBK-MAK!MB//.a.O JgXBBBHx/.EJNBBBHx(/.NO$BBBHxC/.NBBBHxG/.N nO($n*g jA*jC8 1` *%@4$n*Jg jBA*jC8 1` *B%@8Jf(pg$/.a|XJf n (frrfJf/.aX>XJfz/.`|$n*g jA*jC8 1` *R%@Jf n rJg/./.a~hPJfJg n"h JgN/)aMR/af)PfBa @//aO ` n h /(/a%P n!L(!L$ n ("A !Arrf@`!@ nJ f"h$JfB/a"@PJgb`&//a"@PJgL n(gi BB/ /.a,OJf krJg0/.a8 n (Xg/aavXJf` n(grHnHx/a/./Hxa,OtԎE` /. kNNXBB//.NOJf .rgrf .rgr f nrƁ1Jg.(g Hnay` Hna%XJf0 . @JfB`$Hz`Hz` Hz`HzB/a(p`t/ a L`-g mA"EE8Jf `Jgx-f`a$X 9p.R#pJf,<`(Jg mJgjfh@` /awX܆BBJg$mJg*@g"JcT/HnB/ alpOJg6&`6nc /Hjn/*j/ alJOJg%@j&*j-jnj@(C~f8HnHzO/ a &@ .O ba~* @/a2/Hz"n/ / a-@".OexRe Jg / a'XJg/ /// "E i~N`// HzHya"OJg mJgjfh@`/auzBpL299|yanked298|shifted297|moved296|joined295|deleted294|changed293|added$$301|lines300|line%lu NVH?<*n-fBX-g mA"mE8&2`&-BBx\؍ DИRrdJgetcB DBRrd`Jg$mJg*@g$BHxHnB/ ahnOJgV,`< nb"HxHjn/*j/ ahBOJg*%@j,*j-jnj@$Fz&<$"B.<(D-L"nXJgA(<$JgB` ; T/HzHx/ N-@HnrVr"D/1/ a/.// "GN n GO(Hn"C// at/.// "GN .BOXXRrdR R/ a$ m/ /Hx/ h~NOJg mJgjfh@`/arXLnc/Hjn/*j/ a^dOJg%@j&*j-jnj@` <.`h~&&C Ю(S$FgHBcB b"BC* lA D`I// a\P @`cJfRfgB LN^Nu@(#)options.c 10.43 (Berkeley) 5/16/966YT6666666z6rY6j6`6S6H6=686/]6)6#666]5]55]b5Zt5\05]b555555\L5\5]b5\555\5}\5v5m\5f5_5Y5R5L5E5:51]5* 5$55@544@444]b@444 4444]44^P 4^ 4^ 44}^4u4j4a4Xwriteanywrapscanwrapmarginwraplenwindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsgtagsmodeflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase8r8o8l8i8f8b 8_ 8\ 8Y8V8S8P8M8C8@"8<%87&84+81)8-/8(18%38 986858=8<8A8 ;8 >8>7H7L7H7I7J7KwswmwlwiwawttytypettytstotltagswsmslowshsectscrroreparaoptnumodelinesliichtgtexedebdircobfawapaiCDPATH:cdpath=%sTMPDIR/tmpdirectory=%sescapetime=1keytime=6matchtime=7./msgcat=%sreport=5paragraphs=IPLPPPQPP LIpplpipbp/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshSHELL/bin/shshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionNVH?<*n,(-FBBBI-LEI%LHxBBHx>/ aOJf-fHxBBHx/ aOJf-BBBHx/ apOJf-JHxBBHx2/ aNOJf-Hz$<(BNX"<8|Jg"/HzHx/GNO .a*-@B/ / .<C(GNOJgz`2Hz(BNX"<8Jg"/HzHx/NO .a*.-@B/ / (GNOJgz `Csg4 Fheb_\YVSPMJG/a)-@B/ / (GNOJgz `C g( F  /a)z-@B/ / (GNOJgz`2Cֳg0 F/a)-@B/ / (GNOJgz`HzHzHx/NO .a(-@BHn/ (GNOJgz `CYg$ DNKHEB?<9/a(-@BHn/ (GNOJgz-`J <8ڰgHx //aYO /a(R-@BHn/ (GNOJgz&`HzHzHx/NO .a(-@BHn/ (GNOJgz*` <9gHx//aYFO /a'-@BHn/ (GNOJgz1`Hz(BNX"<94Jg"/HzHx/NO .a'-@BHn/ (GNOJgz3`> <9EgHx//aXO /a'F-@BHn/ (GNOJgz4`CBg4 D741.+(%"/a&-@BHn/ (GNOJgz5`Cg8 D/a&~-@BHn/ (GNOJgz8`4Cg( D~{xur/a&(-@BHn/ (GNOJgz;`HzHzEHx/NO .a%-@BHn/ (GNOJgz=`-g mA(mC8 1` -S-@ .fv-Cp/HzHx/NO .a%~-@BHn/ (GNOJgz/`4 mHn/ hJNPJf: . Xbv-C`8 bv-C`(-g mA(mC8 1` -S-@/.HzJHx/NO .a$-@BHn/ (GNOJgzH`-|0BJg"GEB(n ,vgbvg4vgh`HxBB// a HxBHx// a O(`g SA(mC8 1` &. 59 /BHx// a O`ng SA(mC8Jf`R&.J9 gFBg SA(mC8 1` &. 59 /Hx // a DOJf`av׮G E v ׮R(nJf(n "`J 爐IV 4 g //a tP/a#b-@BHn/ (GNOJfX (n "vfB`&(n * 爐A/0 Hz}Hx/ apL<*n$n Ip* Jg, f LC" ҀC" |ҀA&D ,|gdb |g`f"CC< ЀGF5 g u Ar8ҭ"AJf `J g/Hz4`/Hz4/ NO `"CC< ЀGF5 g u Ar8ҭ"A 1` 5 //Hz/ NO`( ЃЀ5 g u A"mG8Jf`J gHz/ a$&TP`r| g | g|\f. *"@S%ISjm R\R`/ Hx\a P *,S%FSj m  g RR` / /a PRIf *"@S%ISjm R=R`/ Hx=a xP ЃЀ5 g u A"mG8&s`z&u `r| g | g|\f. *"@S%ISjm R\R`/ Hx\a P *,S%FSj m  g RR` / /a PRIf *"@S%ISk R R`/ Hx a P* gBHx/ aʞp` IJf0BL<|N^NuNVH00&n-KHyVZHxHx%HzHnEN @OJg"( 爐ADA `v-KHyVtHxHxMHz&HnN$@OJg`NB`J/ a0&BEX RJg0nm&// /aO JfJf$ E  @Jf L N^NuNV"n n //aPN^NuNV"n n //a6N^NuNVH?<$n Hx*nHm$ /aIlBBO .<J(BGB*<0B*E rځrfK65HfJf$g TA*jC8Jf0`J) f&BBHx// *GNBBHx// NO(`Bg TA*jC8 1` 2) /Hx// aPOJgBBHx// a8O`\g TA*jCrlHzUHx/.aO "noHzrHx/.aO B*n|Hm/. /.a\OJg/EN/ N/.a'0p`*"n i!CP!nTJf *n m( XBL8*. ,.BB/aX(O rgFEI`"BG/Hr8/NO Jm րJfHx / /N$O nfB`Hz1/Hx/.a"pL|N^NuNVH8$.&.(. S///a&(O xg.Hx /aTPJgBrҀ[I///a&V `BLN^NuNV//&. /a$XrfHz/.Hx/.a|` /./a v $.&.N^Nu/usr/sbin/sendmail071|not sending email: %s%s -t < %sNV/HnHzaPJgHzHzHx/.a`(/. HzHzHx$/a/a $.N^Nu@(#)screen.c 10.13 (Berkeley) 5/10/96NVH <(n&n *nBHxHxa̖$@PJfBHx/ a`* ,"R)AR%@r%A %Lr%A,Ax %H|JfB`& +g/aA%@XgJkl jkJVID%@ +g/+// aB%@O g%k +g/+// a%@O g\%k +g/+// a%@O g8%k +g^$/a%@XfBHx/ aO *fBHx/ aO `^%k%k//+/a&O / / a PJf0p/ / aPJf/ / aERPJf*B`/ a pL<N^NuNVH 8&n + "S'A rgB` SJg$"k Pf#k `!k + k rë/ aEXJVID/ aXJgt+f$ +$g$@IJg /NXJf/+$NXIJxg HkxaLX +g/NX +g/NX+g Hka X +g/NX+g Hka X +g/NX +g/NX/ a6/ N LN^NuNVH8$n&j"kI" g f"Qfg `HE"Rg< Qf'i`!i i "#A f'I ` T!I'I `BLN^Nu@(#)search.c 10.24 (Berkeley) 5/26/96NVH<<(n(. $n*n&.zLe"Hn/ a|PJfFJf g:B`0gJg*fJgR` f@JgT*",fHx/ a.p`,fpfp/HlBB/`nI&J JC`If \fRRRgIfIfRBJg*pfpJlzgz/HlHlHl/ / a Jf^g)DBL<Jg Hx/ aZ .L<&. *n*.$.(.(n JgB n h$h0JgJf> j"Eebf*$f" *A&d"//`4 j- edbXfR*$fJ" *ANd"// /*NO Jn0m$ *egJgJg"C" `Jg|(` &J$SJfNJg"C"BL<|N^NuNVH8(n$l0JgJG * g/NX *g/NX *g/NX RJg!j j / NX$l0JfLN^Nu NVH?<(nB l&h0JgB"n f+$fR$k&+BKJJoBB b"DCJ lA D `// affP// NԀPSRJn"L<*"ҁ"@C Ѐ tJoHzF/ NPJn +gR$@&+ BJoHBB b"DCJ lA D `// aeP// NԀPSRJn`BJgJ g"L<*"ҁ"@C Ѐ tJoHz/ NPJn$k &+oBBB b"BC* lA D `// ae>P// NPSRJnHzJ/ NP&SJf\ Lr g8r g2 m b0I ?r g`F(>b@// af*Pr f. *"S%ASjm RR`/ Hxa P *"S%ASj m  g RR` / /a PSfR *"S%ASjm R R`/ Hx a P +g(@&+ gBBBrg>r|g8 b mA?0Xr g`J m(>b@// ae:Pr f. *"S%ASjm RR`/ Hxa (P *"S%ASj m  g RR` / /a PSfX *"S%ASk R R`/ Hx a P&SJfBL"ftrq["@ X@="D  ,  Dw`D@"^MK4C(,LD@"lD@"ZDHJD eDH\31J@" @ D L, pR, <4@"N  5pD {qX2D O5fF "EHE  t EkREP7@"5  r m F Z.+ ,/D 8 => D@ m,D@ jRzD P5˘D@3ήB"j 5D Ĥ x ua2D XA$F . 8D ‚ ZDDD jΈcW@"5A* 8#ٖ F Ȝ F g+ eQ0D H38" "9 :@BD@"k(D bPӎD@"G-( $ ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.8 (Berkeley) 5/19/96NVH>0*.$n *0'"|g"|/x<؊/v4֊/D" R//aOJf////a߰OJfp,*DR//aUPJf&Hn/aVRPJfHJf|%FDBH`HnBB/*D/GNOJg HnBHx/./NJgp`L%nD *0f$@| %F0".HbJVIS%@H *0g @|@%F0BL |N^Nu@(#)v_ex.c 10.38 (Berkeley) 4/28/96NVlH0 &.$n HnlHx/*4/*4HxHx$t/aHxHzHn/a@O(./ /aL `N^Nu207|The Q command requires the ex terminal interface NV/ $n jHx/ hNPJf< j !jL j !jP j hpr%AHz/ aB`HzjHx/ aq2p$nN^NuNV/ /$n "j4 R*2g jrdC BB//*4HxHxtԎ/a// /.a$.x$n|N^Nu<NVlH0 &.$n HnlB/*NVlH0 &.$n HnlB/* .g(BB//.B/ awJf %jjB`HzrHx/ ahp$nN^NuNVH 0$n&n jJf / a`XJfN j h$* (fB`8%@Hn/ aKPJf/+/+/.B/ aGj%B`%BpL N^NuNVH00&n$+B/ a&PgH"BE/ / /aO Jf.BB//a OJf R h(XB` /apL N^Nu@(#)v_increment.c 10.12 (Berkeley) 3/19/96%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a numberNV|H?<*n - #f|+p+ +g& -g Hx*n m(/(/.av&p`*n -2g -lHx/.aD`,`|HnHnHn*n /-4/.aBOJg Jff`*n &m8& ".$cN"n yLEI0gRbc(g*n+KPB/ aP"."n-A| 30f~dX1 Xg xfHtI4I yL0f/HzaFP"nJg*:Z 1Xf`*:H`X 30f:~|d2tI4I yL0gP4 8gF 9g@*:`J|g23 +g -f"t I*:4I yL0g"`t (K*:3I yL0fHzHx/.ae`.~ gVm ~g`~g^`"n$I4I yL0g4 8g 9fb4 b^t *:4`L n4I yL0f4`< n4I yL0f/Hz.aPJf`aReP-L. -n|Jg*n$mJg*@g0BB".p2Ёgb/HnB/.aѼOJg$(`>p2Юnc"/Hjn/*j/.aюOJg%@j(*j-jnj@".f$/.|..ދ//a*n|B5H O ` .Ћ~ fHx B/Hna&O~fl$*n --fD".&oJo <bJlJl <m Ђ-@&<Jf Af*(/./HxdtԎ/aJx*O`/B/Hna,O~f*n -+f". Fcp`҆-A` .cp`-@&<~fU|/./.|/HxdtԎ/aI*O/ /./*CN//EH/ N .// HrXN" ҅ .Ҁ-AO ./*n /-4/.aC$O` t//.azPJg*Jg*n mJgjfh@`/aڼ LBP jJg ( "牒Ҩ A(f / aB2XvfBB/./*L/ a"k8 .`RbHzm` n1I~>glm~)g:m~(g(`~E`x<(n&n (+4  k,JgB(g: +8f,|fHk4/ aWp`l,S'F4|0 S`S'@8 |d0HnHnB// KNOJft+2g$+Ԃ .g//.aW~PJgz` SBJ8gRHnHnBS// NOJfJg |g` .g//.aW*PJgSgz$n fSg|` .f".|d l hzg*Cf f|g*fSg:TTf`X .gP//.aVPJf U"m&'I","A)Af$HxBB/ a>OJf l(Agp` SJfBL<N^NuNVH <(n$n *0 g/ / aP *0t g$* SJg|KDG4Hx/ / 2D" R/B/ aOJf> U"m&'I","A)Af$HxBB/ azOJf l(Agp` SJfBL<N^NuNV"n B)rЁreF0; N $(,p2`p3`p4`p5`p6` p7`p8`p9 n h@@N^Nu@(#)v_redraw.c 10.6 (Berkeley) 3/6/96NV n"hHx/ iNN^Nu@(#)v_replace.c 10.16 (Berkeley) 4/27/96186|No characters to replaceNVH<<&n(n *kHnHnHx/,4/ a!VOJf".fHzHx/ aDp`B$,0x g(,)l4< ,8ЄS)@@SdHl4/ aQD`B fz'EB/ a `zBBE/ / aOJf .Sze^0; N 88$VBJf .zfv`z fB`n<+n>`*k`:/ / a$PJg`&/ / a&`•Jg$kJg*@g*BB .cX/HnB/ aOJg$`: .పnc /Hjn/*j/ aOJg%@j$*j-jnj@/././a -BO Jfz>g z >fV ,4"@R)I/ aX`0/B-$@OJg kJgjfh@`/a8)l<D)l@H L<B/aLHp`2S%@@ j,Jg(g *4"*8` *<"*@%@D%AHBL N^Nu@(#)v_screen.c 10.10 (Berkeley) 4/27/96308|Enter to execute a command, :q to exit187|No other screen to switch toNV"n)gHz` )P Qg#H` fHzHx/ a>Pp`#@ iBN^Nu@(#)v_scroll.c 10.9 (Berkeley) 4/27/96NV/ /$.$n *2gJ/*/a PJf0rfHn/a!PJfJg m,Jg (g.+z// / a`$*+zJg"D zf DR"Sg<$yLI2gRSfJg  c +g ^fSp`BJfBJf Hx HxHzB/ a@OJfHx //B/ ENOJfv/-:]][[:<:]]%s%s%sNVH 0&n kpШ4Jg$kJg*@g&BBJcT/HnB/ aOJg$$`8nc"/Hjn/*j/ abOJfp`r%@j$*j-jnj@Hz\ k/(0HzXHz\/./aHxHx@//. / aV$@O,Jg kJgjfh@`/a. L N^Nu189|No previous search patternNVH0 $.$n "n". .vg<(n$n ,g lA*lC8(1`(,Jg6 j,JgH(g@J8g4%j4<%j8@B@G@/ /*<*n$n *4zeB/ a~gJfXSfR//NPJfJf|. g fj/`~f SgX//aPJfSgB`B.~Ї~Te0; Nt`8~g2`.~f B~fB`JfSf//aPJgB`t//NPJfx .~f~"j4f.*8fB/a7`J%n<%n@ j,Jgr(gjJ8fRJfJfF n4c4HnBHxC%IJf:. g0 g*E//NPJfJf. g fBG`L~gB~fSgH/ /a"PJfB`"B.~.gm~ g ~!g `~?fJgSf$.,.E`. )g ]g "g 'f//NPJf<".gJf. g f//aVPJf"l4f.,8f//NPJf".~gJf. g g~gXR-B-F`B~g(. g g )g ]g "g 'ft//NPJfx".~f)n<)n@ l,Jgb(gZ ,8fNJfJfBHnBHx l4C)I4Hh/aJf".VIS)@8~0` p`S)@8)l<D)l@HBL*n6-Ag2HnHHnD/*n Hm / / a OJf t .Df .(-|Jg~-G.CggHn@/ / a O .(gSS 'k4'k0'kHx/+/ *nNO Jf B,&+($+ .(gFJgB$k g f RSR,JfJfhJgd g fVRR,S` +Ы$@,g lA*lC8Jf`Jg` g fRSJfB BHh // / a$@OJg 2%B %C(.+R%G.+grA(~.fH/ /.HnB/ NOJf Jg lJg*njfh@`&/.aX`/ /+/ B/ NOJf B.%jJg$.t fJxfJpg j .x"npA " c,/Hj /*/ a>OJg J%@$.t .x"np BHq/.X.*ު/ar .tЮxЮpѪ..tߪ%nx(%np O BJ(fNJ fH *R c /Hj /*/ aOJg %@~("j j R R&J&'l|*Ef*` l| )J|Hx/*/ *nNO Jf f`BJn*l~$dBS$BB .(-@(fg'k( B(-@(`*k$b~'G8.;g +$Rb~'G8~fH .(f>*n6-Ag2HnHHnD/*n Hm / / aOJf .Df .(.CggHn@/ / a O .(g SS .(g/././ // a hO"+(g0 + g&/ kHp.+ޫ/alO "+( .(g/// aO Jf`:"k R c$/Hk /+/ aOJg'@"k kB1-| +gS'@Hx/+/ *nNJgX`.+b.+g:|-M.`.+b.+g:|-M.`.+g$+g~.gb~.gt` +gЫ$ReBB +c/HnB/ aOJg-@/+/+/.a +-@-@:|-M.O $+` +g&Ы$ReB. k ("+$ +ѫ(B'A`J +gЫ$eB/ / a O `&a;$+" +$eJ.+lB8`Jf Hn(/ // a $@OJg&J`ంd.S'GR( S"+cS'A`$+f Hn(/ // a D$@OJg&J$+$c +gd&` B&+$$+"d, S @S g f*AS'MR(Se"k g0".(g8dX"k.S'GR( @S1 g8 g0 e`&g$K'MR( k0 g g"kdB$k2I yLCf 2_fr-AD +d"k$yL$.S'GR(B @S1ICf 1_frf k1 gt gn e`f$+f Hn(/ // a$@OJg0&J$+$b.(f/ aX` +gd&` B&+$$+ի('C.;g@;`.*gPHx/ / aO Jf`..(g.:|-M`$|`n*n |^ |~@`@:|-M"`N.+gF*n B- yL0g.~ g(~g"HzJ.)l*n2+DJ,f*n +kD+kHB` // apL(j$*$4 fS` f""LE""jK%MR( MeʸbBB`($B` LE ԀR LE Ђd☂$Jg.ނ%G| JgBHn/ / a TOSf| JgBHn/ / a 4OSfBL&n [R-J*. SJo4$S".b/"n Q//a O JgB`SXJn*. &noVBB S$ng8BB b l"BC* 0 I؆`// aP؀Rf̻d*DSXJn" L<"@C Ѐ*@\ ,gr-A)@`B ,8d~Hn S"n/ / a.$@*. O o$/ Hz/ a.O "n)AfSJnJg&Jg lJgjfh@` / a}NX"n )>`,S" LA` d&. LF0JgR`vBc$Bc"nG\Hn SG<".Ґ// ap$@/ Hz/ a.8.OJg&Jg lJgjfh@` / a|X"n )>fԃ d0Hz" /Hz/ a-"n )>OfRRb^Hz/ a."n )>Pf.Rb(Hz`/ a-"n )>Pf / a.>` r€"n#A>JgBL<(.&n *..g +(gxS'@(`J(gf"k-I(E f8 k1 HnHn/+/+/aa"k nO`< b"(D l(@I 0 I`B@/aBP-@JgB +(gS'@( k"n1 fHnHn/+//aaO`: b(D l(CI: 0 I`1I//aP-@ .$.gc R-B`"+Ҁ c(/Hk /+/alTOJgB'@$. .$(k( / kHhHp(a~իի($k"n1O fAS|gv QBBSd`f b$(@I (D lA D "Ү` 1I//a P"Ү$k"nAS|g(ARQBBSdB`JfjJg0 +'@g$ k( Hu kHu/a}O Jgp +"R c&/Hk /+/akOJfp`X'@ +R'@ + g0|f"k k`Ы(/ k/Hha},"k k(ERBL<|N^NuNVH<<$n&n *.*nr4f`(E"l& re'k4D'k8H`(E l  0\frgr 0\fh0f$rg (C 4\g'k4D'k8H`<1B1(E(, jh/ aXJfg"+4$+8-A-Bp@`"+D$+H-A-BpH(E l /f/BHhHkDHn/ aX`/BHhHkDHn/ a[OJf.%kDL%kHP jJfB/ aKPJgp`n/ aXJf jh j h(E)P"l l"j ig$BB// a/OJf jB/ hNBL< *.$n &*4(*8t*2g$*`HnHnB//aӶOJg|fHxB/a p`jS`` .fSBH`J"҂C*6b @S%HH` ASB%AH///././/NOJgp`JgRBJfj%CDBL|N^NuNVH00&.$n $*4GHnHnHx//NOJfD .gBA*6*3f PJf|Jfd SJgLE//NPJfX".|g,Jf. g fJg//aPJf |gS` SJgE쀗˛Jf, .&F yLCf ._g:|BB`2Jf yLC8f _fD` yLC(f2 _g,//NPJf".|gdJf. g fJfJfH//aPJg8`VJf. g f//aPJf2|g SJf$,.꼬4f,.8fHl4/a\p`.)n<)n@)l<D)l@H l,Jg (gS8BLbB@/ ahP`Bvgv gHx k(/(/ a`&Hx/./ aL"pJfBL< N^NuNVH 0&n . '@<'@D"+4Sd'A<'AD k"kJf jB`p$nN^Nu@(#)vi.c 10.47 (Berkeley) 5/18/96110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|InterruptedNVH?<&."C$Q$*GHxLB/ (<G"DNO | / aXJgp`|*jB`P$@*jm`@ +0gLJfFHxL/ .*/aWO jh +2g jh jh +0| gzeJgtA~g(`` g:AHIBb|@g0`D g(`:>-|@Ά//+D/ N'@HO `$m@`B//+D/ NO Jfd`a%kDL%kHP +0f*g .*LfJk2lV"jLf ,*PgBHxHnHx'/ aHx/ aPA JgHz`HzHx/ NO * gB,F%Fg/ a*tXJfn$j*jmHx/ a/bPJf *.G%G"B)Afg"C"/ a`" jJg ( "牒Ҩ A(f/ a)XJf0-g @;@`|%FB/ a.PJf +0`gmHjT/ a?P jJg" ( "牒Ҩ A(g~-G`/ aĊXJf@B"B irJg '|(`HxLB/ "DNO HnHnB/ ,*// aO~e"0; N 8/ / aqN`p(k(,gr*g jAr8Ҫ"AJf`RJgLHxIö b"@C jA D `B@/ aP// NO `L +0 gJg j|!F +0(k('@0g -jL-jP *L'@D'@<'@4 *P'@H'@@'@8+1gZHn/ .*// a@OJg: j(AfHxBB/ aOJf j(Af` +0 f +p`B@Jg%|C( ."*0%A0 f%A0%n,". .e f$..쾮c,...%F4%G8,...`,...%F4%G8,...%F<%G@,...%FD%GH j((gHxL// aH)DBLN^Nu214|Windows option value is too large, max is %uNVH <&n(k kHx/ hNPJfNpt'B+g kA*kC8 1` +)@'@4+Jg kBA*kC8 1` +B'@8+g kA*kC8 q` k'HD'H<"+4tg2 Sd"'@<'@D/HzHx/ a&O"+4S'A@`t'B@BHHx k hR/a k!@PgN$k krSg rYg&`0|$c`*|$d`|_c`|_y` .`,Hx HxHnB/.aJfB$`B$nN^Nu235|Number larger than %luNVH>8,.(nnzڎGSBBC ."DC $ d@BHx /B/NOrfX. yL0(fHxHzxHx/a`0$BHx /B/NOrf. yL08f(B`pL|N^NuNVH88&n(. $n&.BI/B/ / NOJf^B *Sr e\0; NHH(L8TTTTLLrft`p`8 k/ hNNp`(/ / arPJgp`Jgp` / / alBLN^Nu@(#)vs_line.c 10.18 (Berkeley) 5/13/96%7lu NV8H?<&n*n +f k|Ze <gD"k MA   H@B@"ҀD$+@ +4cf`SfJ-VI-@\D\JfJ\f-klHn|Hnx/ $nl jZNB"k MA   H@B@ЈD// jzNHntHnpB// an(-k8dO,+g kA (kA8J f`Jg B8-m``,-S-F8-F`L.hd-F`+g kA$kC8-qT`-kTBP+fj-nTP+Ng kFA(kC8Jf`DJFg>QdJg|f0J`f*/Hz;HxE/ a R// / (nl lBNOJf$.tfJgB,Lf:"k MA   H@B@ЈD$n$,+8d(n(J\fBB B-B-J`fJg |g~~`JPgr~$ b kB$@E 0 I` // aP/ bB(@I kA D ` // aP// $nl jBNO / (nl lVN/.|/.x/ lz`fJ`fBB B<``J\g*- B--F<`D kgTA(gJ$PfD(g*(B<@?` *(RB<+E n?ۮp,.`dc-k8d`BBB< k+gA $kA8J f `JgдcBB8 npRp| fZJTfT+Hg"k@E (kA8$0 `"k@$ gC $kA8"Lp `", LF&`2 b kG;$n8(JE B0 I`// a P&؃`d RteT`g+E ``ԴcBB@ npRp| fZJTfT+Hg"k@E (kA8$0 `"k@$ gC $kA8"Lp `", LF&`2 b kGC$n@(JE B0 I`// aRP&؃ded-k8dS8g RteDJg+E -C<n?Sp` R+E B-Jg,Lf"+Pb .dЅcBhJ\fE-J@`R-AhI-L@-n@8E-JLBXBtdBBHBD npRp| fbJTf\+Hg"k@E (kA8$0 `$+@"BgC $kA8"Lp `", LF&<؃r`> b" kGK$nH(JE p IG&.D`// aP&<؃Bde@|fdCC(.d`C dCdc4|-JX+E*.tJhgShf+fJXf"k MA   H@B@ЈD(n(+g(D`(DS$n$+Ng kFA$kC8Jf`JFg+f J`f(nPJ\fJ\fJgNS|g$.@$n8LeB/ // (nl lBN-B8O $n8R8 QBCSd` .8ЃLe&(n8B@/ /.@/ $nl jBN-n@8O bB(@I kA D ` // aP ng|̀'F>/ kNNX` |&D'F>",f |gf*g lHx/ hNP` / a]XJf|fHxB/ &D kFNO / /Hz.a O gvƀ)C>/ lNNX +g'@Hx/+L/ aO / a`XJdgv+fHx/ aPJgp`$ldJgH$</*/* /*/ l~NO RJg!j j /* "BN/ "BNP$ldJfm -Zgvg`B`8Bm`.BB/ a`v-CO mZ"+4pc -@-ApBZBVBRJgHn/ aRP/././ lzNBL< N^NuNVH08$n$.&j(j"*4vglB ,Zc j@c ` R `B// kzN/ k^N *POg*B j@ *4"Sc"// kzN/ krNOvf (lR@e //. / a L N^NuNVH8<$n*n &.&j(jB j@ *4"Sc"// kzNO x4f HnHx`*xgbxf*HnHx`HnHx`HnHx/ aO `a ט|qx>`j/.// kBNRZBR/ kVNB/ kNOJgBtԎI`xg/ kNNXBB// NOJf8 .xfxgb&xf .qfx>` .:fJgx*L<N^Nu+=+=+=+=+=+=+=+NVH 0&n$+8rdt$kHxB/ jFN/Hz/ jBNBB/ jFNL N^Nu%.*s NVH0 &.$.HxHxa $@PJgl/a(%@ XgN///a1:%B%n  n h"hdJfB!JdAd%H`:"@ f$g Q!J"%I`"Jg / a)X//HzbHya ָL N^Nu@(#)vs_refresh.c 10.35 (Berkeley) 5/7/96NV/ / &n$n "j bD kC hCB)BB/ / aOJgp` * "R%A "@RcB$n&nN^NuNVH<<(n,g"&l$k`g z@&l$R Pfx&l,Ng lFAC8Jf`JFgx1$k PKpg\BBgJ"* f<&n k Jg*k(+8S$hJgRJfScBB /gn b k"BC* 0 I`I// arPd> b k"@C 0 I`I// aqPR`S k bzB$+@ +4"Sc"// mzN +P"O fgg~BB b k"CC: 0 I`I// aqVP/ b"BC* kA D `I// aq\P// mBNO Rf/ mVNX+g kA"kE8Jf `JgHn/ a,.R//+LHz)Hxv֎/a T-@ @R"Oc&/$+@ +4"Sc"// mzN n`"C cHxHz/ mBN nIO /// mBNO $+ g kA"kE8Jf`8Jg2 k(Xg$SHn +A/0 / a*O Td~/$+@ +4"Sc"// mzNO + g kA"kE8Jf`Jfp`6B/ /B/ a4"Lj8JgRJfrJf j!B j!A LN^NuNVH?<$n . f8HnHn B/./ azOJg . fJg*nBB`n*g jA*jC8&q`&j*g jA*jC8(q`(j-@BB*Ng jFA*jC8Jf`JFgxJf ..S-G,S~gB*nR~ fXJfT*Hg"j@K *jA8$0 `"j@$ gC *jA8"Lp `". LG `4 b jB*@K 0 I`// alP,.$؀րJf *8b~ f B"L@`*FS-M S,~f*`*n-UBB`S*nR~ fTJfP*H"j@gK *jA8$0 `$ gC *jA8"Lp `". LG `. b j*FKj 0 I` // akP$؀րJf *8b~ f B"L@`Jf>JgJf jB(!؀Jg .*n* L `: `4؀Jf *8b| f B"L@`Q&BGSd .SL idtrgb rg2`$a  + k hv k hB k h!C k"hd"tԉ// / NO Jf"B keBL<N^NuNVH<<&n". k(H$lgEf+g kA*kC8Jf` Jgx`xA ,ef RAd<&n(n *.$k +4|eHxHzHx/ a{p`$Jg|dtHx k hR/a  l!@PfBHx/ a{XO l hJfp`j L l hB l h|!F*kD@VID)k88BJfFHn/ aPJf4 k,. FA   H@B@ЈD怴UIDJg^*k4)M4)kHH'B4,,4ݫH()k k 'L"l4 k@A /$kC jHp/a t`2)B4 +4'@4ЫH)@H()K P Sf%L `!L&"+4pg S'@@ ,4rg"S)A@JgbJg< +@p`f&j P Rf'j `!j j A$%k"Pf"` k 'J j/(a jB%njB$n&nN^NuNVH0<(n$n&,*C&mtԃg$Jg/ k /(a +BPJg&Sfഋf *n B`x*n * l Jg!lL l !lP l h)Kl k"l!i*kD@V'l88'l44'lHHJgJ+g kA*kC8 1` +'@<'@D",@d 'k@<",@Dd'k@D` +4S'@D'@@'@< +@'@Hx k hR/a @ k!@PfBHx/ atp`~ k"k8&n". &.*+Jg4|f +@g$dB"`vBBJf,JlD$K R@bp"j I Pf"Rg.`r(`r"K$Q EPg R@b (`JfR$kf$ <7Jf </Hx/ arp` R@cHxHz Hx/ arp`t$D4٪Hө4թHө< )@Df(@#LDЁ#@@ i(AI$ ը < *@%@@Dd%@D j BL|N^NuNV/./. /.aN^Nu$NetBSD: ping.c,v 1.47.2.1 1999/06/24 16:23:03 perry Exp $ac:dDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packetsBad/invalid interval %sBad/invalid preload value %sOnly one of -P and -p allowedBad/invalid packet size %spacket size is too largebad tos value: %sttl out of range-I-gBad/invalid maxwait time %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lSorry, no audible output for flood pingsOut of memoryCannot create socketCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeNVH<8(.(n a U\z-EBB.BEG`zЅz3e0; NxxxxxxbxxxVxxxxxxxxxxxxxhxtx xx&xdp|nxJ.yP` BHn/9$Fa # L nO JfJnHzgHxa yP`z`zP`$9DS`Hn/9$Fa .//T9t nPJf \8l/9$FHz Hxa BHn/9$Fa # nO JfJl./9$FHzHxa yP`yP`J9PlHzHxa z@P#$F` 9PgHzHxa zzF#P`zP`zP`z`BHn/9$Fa H#P nO JfJn/9$FHzRHxa oBHzUHxa zP`(zP`y@P`BHn/9$Fa S& nO Jf c/9$FHz Hxa BHn/9$Fa Ȓ nO Jf nJnHzHxa X@`yPBBHy /9$FHz`z PBBHy/9$FHzNO`NHn/9$Fa //T9tP nPJf \8/9$FHziHxa a+Hze/ /NO zf\\9T, HzHxa  g*Hx/ Hx B/9 @NOJlHzHxa z/9P/a ~.Hy 4Hza :O`" 9P#PfHzHxa 2HxHyPHx/</9 @NOJmHxHyPHx/</9 @NHyϞHxEFNtԎ/Ba O$zg,". @# P-A/BBa VO HyςHxNHyςHxNBOlBHya aJPRmaBLJf:z'u"nB)//.B0-/"n/)a ڀ./.aPO yP~dJ9PmHhHy $Hma ?O Jgv 9PG(EoI ,A fRnJf:z'u"nB)//.B0-/"n/)a ./.aOB28/A B08//HzNvOPlTBP"lr҃~‡ ~fHzNX/HzNPRPm`/././ a O Jg z"nE~lBBB~gmJg$G(`@~g gG(`&B`lURBYJo`~m Vj `G(Iz'u"ni/./.=m/."n/)a ؜./.alOHzNX`8 9.S#Sk y R`HyHx a yP/ HzVNXYYPJn`RBBUl&YJo~m`f>/Hy/ a BJf4Jg.pPf$Hxa(. X/a //Hz6a t LN^NuDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %dNVH00&n". $.Bve0; N2||&||"t8ZHx/// aLOJgB+ve0; N &,28FLRX^djpv|Hz``Hz`ZHz`THz`NB0+/Hz+`RHzJ`:HzX`4Hzj`.Hz}`(Hz`"Hz`Hz`Hz`Hz` Hz`Hza lX`/Hza ZP`Hx/// azOJg$Hza 4`Hx/// aVOJfB`B+vgmJg`0vgvg`"Hz`Hz` Hz`HzE(NX`B+/HzE(NPHka/HzN`B/// aOJgxB0+/B0+/Hza v`B/// aOJgDHza R`B/// avOJg Hza .`Hx/// aPOJgB+gvg`Hz`Hza X`@B+/Hza P`*Hx/// aOJgB+/Hza Ȯ// a`B/// aOJgtHza Ȃ`B/// aOJgPHza ^`B/// aOJg,Hzma :`B/// a^OJgHz]a `~B/// a$@O Jf /a Ɩ/HzHxHya ,` /a v//HzHxHya , <$n&nN^Nu TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%uNV/ / $nG&-j -j-j-j9Pg /. / atPrA . f49PgB(ሀ(/Bሀ(/Hza ,` f29PgB(ሀ(/Bሀ(/Hza `Z fTHx/Hna PO .f89PgB0./B0./Hza ê`B0./Hza Ö$n&nN^Nu"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xNVH<0$y JgB"yL1DgRfg Jfz l&Hya /9Hz6Hxa l$yv֎HnHnHnHnHnHnHnHnHnHnHnHnHnHnHn/Hz/ a (pBOH"9Pm C $AXRn CVBRl9Pf4HzG(NBXoBE $/HzNPRnHzNL JgN @rg,N @r?g"N @rg/*Hza jr#P/N$@XJf N @JgHz~Hxa L< N^Nu%s: is a directoryNVH80&n$gDv֎//a ;PJf0Jg:Hxa Ԕ//Hza x#O`Jg-|".  @fJf/Hzda <`Jf" g&///aO Jg . f /a ph`, @f /a q`EJg//a^P/NXJgBJg$EN @xg*N @x?g N @xg/Hza x#P$fL N^NuNVߠH?<&n JftԎ//.a 9PJf&B + fBHx/.a 9l*O ~gHx Hx,ߠ/a `$+4&+8O JoFE B"CB"< l0|2| ( / //NO fL"[IJn/ICNXJf(BBB/K,NO.f Hx B/a `6O $+4&+8JoFE B"CB"< l0|2| ( / //NO f"[IJn/NXJfBBB/NO.fHx Hx/a _$+4&+8O JoDE B"CB"< l0|2| ( / //NO f*"[IJn/NXJf/a >XJg~#/.Hza ŤL`p$n&nN^NuNV/ / &n$n j<"k<"(, ),mn"(0 )0lp`n / / a `p$n&nN^NuNVH<0&n$n j<"k<((4*(8$)4&)8 "op`m / / a`pL O JfJgJgr`zJgtr`lHxHz/ K&NO JfJf`(HxHz/ NO Jf$JgJg.`$Jg`HxHz`/ NO JfJf0`>HxHz/ NO JgHx Hz/ NO JfJgJg`Jg`HxHz/ K&NO JfJf`"HxHzw/ NO JfJg Jgnr`hJgdr`^HxHz/ NO JfJf.`6HxHz9/ NO JgHx Hz-/ NO JfJg Jgr`Jg r`p`HzHn CN$@PJf,BL<N^Nu@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: ls.c,v 1.36 1999/02/17 15:28:09 kleink Exp $COLUMNS1ACFLRSTWacdfgiklmnopqrstuxNVH80&.$n a BHxa XJg`Hza &XJg/a }#PX`.Hn/<@thHxa O Jf0.g ByP3Pr##t`r#a aBJfr#|tG`0rЁrGe0; NnFR^ j"z4r#B`Hr#tBBBB`Xr#BB`r#BBBBt`r#BBBBt`r#B`r#B`r#`rār`r#`r r#|`r#xB`r#`r#`x#x`jr#``r#`Vr#`Lr#`Br#`8r#P`.r#`$r#`r#P`r#`aHz/ /NO rf 9DE Jf, 9f@JfJfJf JPfr 9fJxf JfrJgrFJfJg.JfHyHna :P 9lr # 9PJglrg"mJg`rg `#d`#d`Jg#d`Jg #zd`l#2d``rgmJg `Rrg`J#d`>#d`2Jg #d`Jg #(d` #dJg #*``FJg #``2Jg #``Jg #b`` #x`Jg// /` /HyQHxaHPOBa Nq%s%s: directory causes a cycle%s: %s %s: %s: fts_readNVH<<*.$.JWI`///. a :L&O fHzHzHxa pB/K:N/BI4NOJxfBJfGG7<`B0*6rgm rgH`rgrg`Hj@Hza P`/*a /Hj@Hza O`|Jj4g *.@fJ|gfJhg/*Hza `rl/*Hza rr#hP//N$// NOJfJgHx/ /a ?O /N$@XJfa  @JgHz{Hxa 0L<B.B2BfBjB"B&BVBZ(n BNJg Kz-M*0,6 @g @ f(/,a /Hl@Hzia |)F O`Jf @f$Jxf` ,.@fJ|f |)F `JgB0,&/p@Ќ//aDO B0,&Bo,-FBJ:gP&l<(+<*+@ y .f".jd-Df-Ej +bc-@b + ^c-@^$+4&+8 ..".2d-B.-C2 + g `f2:|-MR"+ Zo-@Z | 쨀Vo-@Vۮ&,."݄-F"Jg*<=BJgo-M>/N$XFo-BFJg,Hz/+Ha-@6/a f"@O Jo-IJ`*nA(Hqa P$@XJfHzHzHxa p Њ$//*EN*nK %@//*ENOJg*nK( Њ%@/.6/*ENP)JRN(lJfJNgb-n -nN-nBJ:g-n"-n&/.j/.fHz HxtԎ/EN/Ge:N-@-nJ-nF/.bHzHx/NO$.N-@/.^HzHx/N/N-@/.2/..HzHx/NO(.N-@-n>XJRg^/.ZHzkHx/N/N-@/.VHzSHx/NO .N @-H"nK" .Xl-A`Ul-@`BBHn y`N|#hXJg(n Jg/,a X(lJfLP(lJf L8(n$ltI‚gB 9$S#Sjm y*R`HyHx*a 4jp`B$.N^Nu%s/%s ls: %s: %s -> %sNV/ / nJh4f"Hh@HzHx$/a O`(Hh@ h/(HzHx$/a tOHxE/ /a O rf&a @/a //Hz^Hya 6`B2/ HzSa $.$nN^Nu$NetBSD: util.c,v 1.17 1999/02/17 15:28:09 kleink Exp $NVH< $n(. $.Szg*I"DR yL08r?JgQBBSdL<@=!:illegal -m option format: %sNVH<8(.&n / a &Hxa $@PJgJfHzHxa 8BJf#` y@ #@%KB Hzt/ a `<&@PJf%jB`fB`(KI!ze|0; Nhtttttttttttttttttttttttttt@dPtd * fz` * fzz%E ` z`z R`r :f J fTR`$Hx:$ /a V&@PJg:B/a%@XJg(%KJgB * g Fzʀ%E JgJg/HzWHxa 7%DL49$ChH´W`>49$ChH´\`.49$ChH´^`49$ChH´_`49$ChH´]IDJg *` $RJfd L N^NuNV n BfR/a _N^Nu$NetBSD: misc.c,v 1.5 1997/10/20 01:07:52 lukem Exp $%swrite to stderrNVH8 (.BB/a &O l/HzHxa v$E`&//Hxa O rfHzHxa @Hx//NO Jng/HznHxa /a LN^NuNV". 9"@S#Sjm  g yR`Hy/a .xN^Nu$NetBSD: set.c,v 1.7 1997/10/14 02:07:59 lukem Exp $NVHy Hxa tPA+fpAfpAfpA$fpC!fpC*fpC%fpC"fpC(fpC)fpC&fpC fpA @@# pr# 9@@ # 9@#/HxHxa K"N^NukbbcbsosNV/ /C-IHnHzErN @PJgJ(gHnHzN @PJg J(f`Hza \0XJVJf2HzErpNXJf 9gHzvNJfJgr# 9AlJg I#` r#pJgJgJg9`pA$JgJgpJg9A!JgJgpJg9$.$nN^NuUCLCEPOPNLHDptNVH BNJgrÒrL<N^NupcrsisrfifNVH8 $(-BHnHzErNPJg$Epa&JO $nJg@ :g:$ Hz/a N$@PJg$B/a ^&@XJfHzcHxa {Jg/ HzTa |P`RJg/ HzDHya "O Jf4HxHxHz:E$rNHxHxHz,NHxHxHz#NO$Jg/ Hza |/.a0O JgdHza $@XI(Jg*Hz/ a AbXHra PJf E$<` E $</ / N/.a/NOBa Nqisset to%s %s kbbackspace. delete. control-%c (^%c). . %c. NVH0 . AB0AB0fg <$)f <$&//.HzvHyEFNC-IHnHz_a MOJg.If J.fHz@`4vfHz@`(ve B@//Hz5HyN`$ fHz2HyN`/Hz,HyNL N^Nu-e^H-i^C-k^UNV/ $n"RJgl -f\ jJg -fN) eg ig kf8J)f2) ign eg ` kg`$%T`$%Y`$%^X "@Jf$_N^Nuusage: tset [-IQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] NVHzHya Hxa Nq$NetBSD: wrterm.c,v 1.6 1997/10/20 01:07:55 lukem Exp $termcap names not colon terminated| '"%s%s:\E\040\041\054\042\047\140NVH00Hx:/.a -@$@PJfHzHxa "|BR$<&G`.Jg*Hz/ a JTPJf/ /Hzwa x$<&O Hz\HnN$@PJf 9&S#Sjl`Ig yL0gRIfJgRpЁvEe0; NHzna wXHze`Hzd`Hzc`Hzb` Hza`Hz`a wX` 9&S#Sjm  g yR`Hy/a >PIgB 9&S#Sjm  g yR`Hy/a PIf 9&S#Sjm y:R`HyHx:a PHz`HnN$@PJfL N^NuNV/./. /.a:N^Nu@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $NetBSD: disklabel.c,v 1.63.2.5 1999/06/22 14:37:43 perry Exp $**************y*tRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknown++++x+o+h+Y+R+L+E*+@+8+3+.+*+!+Linux Ext2FILECOREHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedBCNRWb:ef:irs:tw%srioctl DIOCWLABELNVH08$n&n a ڠBI`\rЁr8eL0; NBBBrBBBBBBBBBBBBBBBBBBBBBBBBBBB|BBBBBBBBBBBB$BBB,R:``#$F:l`R>|`JQ&ga,B`*JQ&ga,r#Q&`JQ&ga,r-Ar#Q&`lJQ&ga,r#Q&`V/9$Fa ZXrfB`x`"R>t`JQ&ga,8r#Q&`a,*HzZ/ / NO rf 9DG J:`gR>tJQ&fr` JQ&fr#Q&Jna+#DBHx/9Q"rQ&V€//9Da +$#Q"H/9Q"a 7j yQ"A#Q"OJl/9HHzHxa pL 9Q&reT0; NFl2\,rga+6/ad//a`rga+/aH$@XJf%| Jf%| // a4P`rga*/a$@XJ>xg/ Hya ` / HyaPXO.a$&X` Urda*J:`grfHy9LB/+aO /Hy9LHy>a$@Hz/+a qfOJf/+HzHxa o/ /a6PJg`Hn/<dm/a mO JlHzHHxa n Urda)Hy9LBrf +//+a/Hy9LHy>a$@HxHy9L/ a fPO.a#OJgp`/a&Hx//INO XrfHy9LB/+aO /Hy9LHy>a$@Hx// NPO.a#.OJf/ Hy>/a.&O `v`a)/a Nqunknown disk type: %s/usr/mdec%s/%sNVH0 $.&. $n/a  XJf/HzHxa Hx// a eO J:lfD jJg< /g/HzHzHy:ta 4O`/Hy:ta 2P#:t:lABBB B$JgHx//a L N^Nuioctl DIOCSDINFOlseekwriteioctl DIOCWDINFONVH08$.$n/ a$6$VEW%|VEWBj/ a(5@PJ>tg/ /<df/INO Jl"GN @vgN @vgHz\`BBB/a k*OJjHzO`hv-CHn/<dm/NO Jl Hz|a X/*/. /GNO f 9:dg&/9:h//NO :hgHza lp`LBHn/<dm/NO Jl0Hz a D`$/ /<dg/a j"O Jl Hzap`BL N^Nu%s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskNV/$.a m @ rg4mrg`Frg2rg`8/Hza c`6/Hza c`(/Hz>a c`/HzXa c` /HzUa z$.N^Nuno disk labeldisk label corruptedioctl DIOCGDINFONVH 0$.J>tgBBB/a htOJkHx Hy>/a gO n/9HHzHxa iV <4dE>$<]lGZ2e0 VEWf" VEWf jb / NXJ@gD <4rXd/Hxa :E9L/ /tgPBBB/a g OJkHx / /a fO n/9HHzYHxa gHxB/N`J:lg J:pf&yQ"Hx//9Da $@PJf$yD`R` yQ"RRQ"gI yL0g yQ"BRQ"J:lfr/ HzHz/9Q"E 0NB/9Q"a OJl rfR#Q":l/ HzZHz\/9Q"N/9:la - yQ"A#Q"OB/9:la $Pl/9:lHz9Hxa f/,/ /GNO Jl/9:lHz Hxa fHn/a ^R nؑ#:hPop ,(A"D€#:h/a _$@#:dXf/9:lHzHxa fJ/9:h/ /NO Jl /9:da `/9:lHzHxa f/a d$CX$cJgHz/ N"F/),HzC/ NO "F/)0HzE/ N"F/)8HzM/ N"F/)4HzV/ NO$"F/)|gt"F()8gl&),gf"LC/LD LC//Hz-x؎/E 0N$+"F"),&LA0/Li 8LA//HztԎ/NO$./"EHiaHz`/+/"EHiaHz/ NO+ bA/0 Hz` B@Hz/ NO B+ ~e0; N$@h@hHzB+ +L//Hzw`B0+/B+ +L//Hzj/ NO`0B+ +L//Hz[/ NO`HzUHz\/ NO "F )8g.+L@p /HzB/ N"+"FLi8O Jg( ,.S)GSjm T*R`6/ Hx*`& ,"@S)ISjm T R`/ Hx a P k"F")8A LA"@HiHz/ N +Г"FLi8O Jg. ,.S)GSjm T*R`/ Hx*a ~PHz{`Hz/ NPRG"FB0)nv/ a LL/aO Jg`Hza \DHya KjPE( *"S%ASj / a X` RBR$r g6G(rg* +"S'ASj / a bX` RBRr frngrNgNJfHyQa \pLN^NuforkEDITOR/usr/bin/viNVH00BBBBr-Av֎/HnHxGGNO E`R`a \$ @r#fvHxa nXN$mfzB/HxNa  MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %d offset %dNVH>8(nBJ(fBHz`J,fBHz` J0fBHza D|p`J4fBHza DdzPJlHfBHza DNPJ8f,,,L,h0)F8J/aXJgHz`$/Hy>/.aўO JgHzw`Hza @2$.N^NuUnknown command %s NVH80&n(. &.EQ0Jg8/a /// a OJf jJg@// /NB`FE JfJ+f* `o$IarraЁo// /aB`p`/ Hzba ?pL N^Nu%s [%s]%s NVH88(.&. $.&nIrE(/HzNPJg /HzNP/HzNHy(Hx/ NOJfp`* gJfJgB`Hx / a 2 @JgBpLN^Nu%gc, %ds, %gMNV/ n ".@ ((@Jl NVH8 (.&. $E@/BHzHzNOrg///arO rfLN^NuNV/./. /.a^N^Nu@(#) Copyright (c) 1988, 1990, 1993 The Regents of the University of California. All rights reserved. $NetBSD: shutdown.c,v 1.34 1998/11/22 19:13:45 bad Exp $NOT super-userDdfhknprincompatible switches -f and -nphincompatible switches -%s and -r-Shutdown at %.24s. Shutdown NOW! ???shutdown: forkshutdown: [pid %d] shutdownNVH80$.&n a 4a JgHz,Hxa .E`rЁr3e0; Nrh|r#_`Hr#_`>r#_`4r#_r#_`"r#_`r#_`r#_`a HzU/ /NO rf 9DG Jna bJ_gJ_fJ_fr#_J_gJ_gHza 1a $XJ_g.J_g& <dJ_g <d/Hza 1Ra P/aX gHz/a nPJfJgN(<_$D&<Jg4/a ,$Xrl Ag /// NO Jf B`X/a ƆXI/dGj`P/NXJf ,nxad/*NXJfaZLN^Nu/usr/bin/wall%s -nwshutdown: can't find %s: %mFINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s sSystem going down in %d minute%s System going down in 30 seconds System going down IMMEDIATELY NVH80&. 9^(R#^JfHxHy^a B9_PHzHzHx$/a $Hz/a -@OfHzHzHxa F`Hy^/9_ <iYJg <iX/Hz/.EFNO Xo"Hy_a x ؀/Hz/.NO`Vx;l: <iXxHxEFNHyr>HxNHyr>HxNHyr>HxNO .HxHzta $O m\Hx"Hzk/ENHy_a Hxr Ҁ//NHxHzb/NO$._a /Hy_/N/a *$.$nN^NuNVJ_f Hza XBa HNqillegal time formatNVHza %a8N^Nuusage: shutdown [-Ddfhknpr] time [message ... | -] NVHzHya 4Hxa HNqNV/./. /.aN^Nu$NetBSD: dkcksum.c,v 1.8 1997/09/14 08:50:18 lukem Exp $NV/BA nB0(C c4AbB0$N^Nu$NetBSD: getmntopts.c,v 1.5 1997/09/16 12:22:42 lukem Exp $%s,-o %s: option not supportedNVH>8,. *.(./.a F&XfHzHzHxa *T&CI`An nf +oftT`BHx=/ N @PJgB$FJg>// a *^PJgEJfJg" EJ g Df"*`" *F`JQf/ Hz$Hxa Hz/ N&@PJfd/aJL|N^Nu@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: newfs.c,v 1.37 1999/01/19 19:34:50 tron Exp $atimeupdateasyncsympermunionrdonlysuidexecdevcoredumpautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:a:b:c:d:e:f:i:m:o:s:B:NOS:T:a:b:c:d:e:f:i:k:l:m:n:o:p:r:s:t:u:x:bele%s: bad sector size%s: bad maximum contiguous blocks%s: bad block size%s: bad cylinders/group%s: bad rotational delay%s: bad blocks per file in a cylinder group%s: bad fragment size%s: bad bytes per inode%s: bad track skew%s: bad interleave%s: bad free space %%%s: bad rotational layout countspacetimeuse `space' or `time'.unknown optimization preference: %s %s%s: bad spare sectors per track%s: bad revolutions/minute%s: bad file system size%s: bad total tracks%s: bad sectors/track%s: bad spare sectors per cylinderswap/dev/%sr%s%s%s%s: open%s: getmntinfo%s is mounted on %s%s: unknown disk type%s: fstat%s: not a character-special devicecan't figure out file system partition`%c' partition is unavailable`%c' partition overlaps boot programmaximum file system size on the `%c' partition is %dno default #tracksno default #sectors/trackno default sector sizebecause minfree is less thanWarning: changing optimization to space%s %s %d%%disagrees with disk labelWarning: calculated sectors per cylinder%s (%d) %s (%u) mfs:%dstatfs %swaitpid%s: mount: %sabnormal termination/NVH?<$.*n a BBHz/9a .PJg|#e,Ri@a$-@|l/HzHxa Ξ&<uJe,g&<uE`|І|9e0; Nzzztzzzzzzzzzzzzzzzzzzzzzzzzzz,^zzzBnxz&zzPHz/9$FGռNPJgHzw/9$FNPJf|#S `|#i@`|#iD`/9$Fa |#i4Xn/9$FHz$Hxa z#$FiT`/9$Fa B#SXnh/9$FHzHxa @/9$Fa #RX n6/9$FHzHxa /9$Fa #RXn/9$FHzHxa Rih`/9$Fa #S Xl/9$FHzHxa ̮/9$Fa #idXn/9$FHzHxa ̂/9$Fa X#RXn~/9$FHzHxa V/9$Fa ,# ilXnR/9$FHzHxa */9$Fa #RXl&/9$FHz|Hxa /9$Fa #i\Xn/9$FHzcHxa /9$Fa #SXm|cl/9$FHzDHxa ˠ/9$Fa v#SXn/9$FHz.Hxa tJe,g"BHySHyQ/9$FaO`^Hz/9$FGռNPJf |#S`:Hz/9$FNPJf BS`HzHzHzHxa /9$Fa #RXl/9$FHzHxa /9$Fa # Xn/9$FHzHxa ʜ/9$Fa r#i`Xn/9$FHzHxa p/9$Fa F#i5@/ /<dg/. a OJlHza %P/.HzHxa V$nN^Nuusage: %s [ -fsoptions ] special-device mount-point [device-type]usage: %s [ -fsoptions ] special-device%s where fsoptions are: -B byte order (`be' or `le') -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -s file system size (sectors) -r revolutions/minute -t tracks/cylinder -u sectors/track -x spare sectors per cylinder NV/ Je,g/9HzHyEFNO ` Hz/9HzHyEFNOHzHyNHzHyNHzHyNHzHyNO.?HyNHz6HyNHz8HyNHzKHyNO.HyNHzRHyNHzvHyNHzHyNO.HyNHzHyNHzHyNHzHyNO.HyNHzHyNHz%HyNHz6HyNO.*HyNHzPHyNHzYHyNHz`HyNO.a ,Nq$NetBSD: mkfs.c,v 1.35 1999/03/16 21:52:34 wrstuden Exp $preposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk minimum bytes per inode isWith a block size of %d %s %d Minimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, This requires the block size%s to be changed from %d to %d and the fragment size %s to be changed from %d to %d CylinderWarning: cylinder%s groups must have a multiple of %d cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder File system performance may be impaired. and ntrakrotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sinode blocks/cyl group (%d) >= data blocks (%d) must be increasednumber of cylinders per cylinder group (%d) %s. Filesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cylinders%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d,NV' H?# l*.-Eȸl(f"A l  ..-Gxlg&y l,9 j-F*L9Xi4-E &9 i"@C8-I( LC@LH-D 9 i$L<,UUUVЀ"AC8" LCLl-A(9 i .LCй iL9 i"9 iFL"AC-I( LFH-DIH* . LGXLX(E# j$# j( 9Sxlzlp# nBE i`ƼcR~-G 9 i n\Ѐ# i.f (.-D`. 9 lЀ# l* څ&E..Ix( LEHLH(D# j$ Ѐ$R izlL"9 i ifHzE(NHz,NHxa " $S iҁ# i 9 iЀ# i$9 j$ L9 nЀ @AA,&"9 j( ^jpЁ,܀&L98 j$9 i"LB ^jpЁ܀-y i 9 no @.9 i"LB ^jpЁЈІbBHn/./ a-@# j(O 9 i$L<,UUUVЀ 9 i"AC" L@Ll:|-Mxgظ ig,9 i g* L.\-E-GC iE$*0&L<<UUUVԂ$*x*@K( LBL"[I//(.*...//a O$&"CHiHz/Hza ,9 i# i 9 i# iS i( &D"nC LDLH# j$$ L*PЀ @AA,&"* ^jpЁ C&L98 j$*|"LB ^jpЁ-HO 9 no( @(*`"LB ^jpЁЈЮe`d 9 iЀ# i`X(y j$Hn/./ a-@# j(O 9 i$L<,UUUVЀ 9 i"AC" L@Lm$Jg 9 i$L<,UUUVЀ 9 i*AK$ L@(L(lP( L.L-D-E"[I//(.*...//a *O @"AHiHza P`$Jf$/9 ilHzE(N/ HzNOJg/9 jHzE(N/ HzNOJfJgT 9 i"9RE(g//HzHzNO&9 i 9Rg//HzHz*NOHxa #R j$"9 j$( LDJgR/ <6E(Jihg <-/HzN 9 j$S"ҋ* LEL# j$O Jihf#RHn/./9 j$a# j(O E ipA j$"*0&L<<UUUVҁ"*x"BC$ LA(L(l`:|-M  Hn/./-HaD# j(O *0&L<<UUUVЀ *x"AC" L@L nв j(mE j$`,d:|-M $Hn/./a# j(O $9 j$ L9 nЀ @AA,&"9 j( ^jpЁ,܀&L98 j$9 i"LB ^jpЁ F,9 i 9 nol-@(9 i"LB ^jpЁЮЈeF&9 j$"L9 j 9 i*L@X# j,.9 iL@JgHzda Hxa ʹo/ Hzoa Hxa RgrE(Jihf HzvNX`JfJf Hxa zJgJgHzT`JgHzp`HzN. j$HzNPJihg Hxa 6$9 j$ L9 nЀ @AA,&"9 j( ^jpЁ"Ҁ,L9h j&9 i$LC( ^jpЂҀ 9 no" @(9 i$LC( ^jpЂЈҀB*9 nҹ nх.9 i΁# j"9i`(9 i#i`# iL9 i 9 j&L@8# j LlR# j z-EJ j nHza vHxa 0#i\ i#R i#i8 i~# nA i 9 nb i jf B l` 9 n&9 l$L(Ԃ,L9h j"9 i(9 iLAh"bzf~m#\ n#` n`#` n"BC`# n҂ n 9 i(9 iሰ jl4Hz/9 jHz/9 jHzHzHz@a bB lO` й n i B llpG nE lBlX-C*-EI l"ҁ~ nf n` L9 nC ipC й n @0TR nmRmSL9h i-FmG lI n .L9 i(LyH j-D&$9 jLBL9 iL9 iЁLB-y nL.(Ly( i,.*9 i"ҁ-y n~f Ћ C`L.8C ipC: й n @ Pf$xg  ip y n`AhBԂ`bzg  ip$y n`EhԂ~f ."ҋ @`"(.L.H"DK ipC й n @(z nf.. Ћ G`$(.L9H n"DK ipC й n @0(9 ij"9 j Ly j$# iJgR# iC iG +x(+`*9 j(L@X й i# i 9 iF.9 iS-G,l-@ y j,&L.8(+F(Dɮ"+*.LX Ѓ-k$n $n: 9 iL@(/L@8/ Hz`E(NHz/9 j$HzNHxa  L.9i`-Gȴo ( L&.ցlE(Jf( y iA .ЈL+|/Hz^NHxa "9 i .LA/LA8/HzbN*.L+X|/HzNS i 9 j $Ly( j$# j L9 jLk|#i`# iBOJg:Je,f2 9i`L9 i"9 j S$9 jL/Hz\a HP# i j,< j 9 iй n i"F"-y i(.-DD# iA iBzlR..-Gxm"F/Hxa# #T n#S i#S i#S i#i0 j# j#id i"9 $L<,Ёҁ# i#S iB lDB j0B j4B j8B jE(N/9 j(9@ i9@' j,'t "$<>B//U//U #'u/9 j$/9 i9@ i't "//U #'uHzNO`\BGeDlLI iK$M$<L LT/ Uf *`Њ` <i/Hy ip"BNO JfؔmHza $B`$"E,)`/ Uf -`Ѝ` <i/Hy ipa O J no"*l l^Ҁ爔SeLS j4 y S . gReHR j0R""EL)|Ly j"CA Uf Ј hT` AeS "EL)|&Ly8 j$9 jLBL9 iL9 iЁLB$9 nLLy iҁ Ug f C`L8C: ЭX @SP ig 9 i"GC" L@ y Ѩ $ ѹ j vЀrF0(`( vF0(`/)8HzfHya v$.&.N^Nusetblock bad fs_frag %d NV//"n n $.")8vg0mvg<`Jvg vf>P(`L vr₃0(`8 vЀr䂃0(`$ v悃0(`/)8HznHya $.&.N^NuNVH?<(n$n /GhN$/,N%@/,N%@/, N%@ B0,/a 5@B0,/a 5@/,N%@/,N%@O.N%@/, N%@ /,$N%@$/,(N%@(/,,N%@,/,0N%@0/,TN%@T/,XN%@XO.\N%@\/,`N%@`/,dN%@d/,hN%@h/,lN%@l/,pN%@pBOv4֊K4/N CX XR~l Uf*"*X *T&,*\* ڀ( ؀A-HҌ-A`P/*XN&/*TN/*\N,/*XN/*TN* ڀ/*TN( ؀/*XNЊ-@/*XNЌ-@O B䋶c*D/N EX XRbB(⌸c"B*.*n6/a L ET0XRb Uf *h* ڀ( ؀`/*hN* ڀ/*hN( ؀PBI n Ro*E$D/N*XR RnL"X`" +L$ ԁJg /a "Xzf" \ +L` ,TJg/a "X`" +LҌB*A(B`bZ6/a :XR +LJg /a Xzg +XJg/a $X`$ +PJg /a XL(bL<N^Nu@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: cp.c,v 1.27 1999/03/01 18:57:29 mjl Exp $HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%sNV@H><&.&n a ;B!BBI`|І|3e0; NhpxxB`dzB`\4|BB`R|#!`H|#!0B!$`8:y6/ a (#!$B!0X`|#!`|#! `arHzS/ /NO |f 9DG |maDtJ! g2J!gHzHxa }JfJfJgHz7Hxa }tJ!gJg|Jg|Ć|`|Ć|a #!,BEVN#!(/NS$s</ Ie:NO c/ Hz Hxa }"/ HyWa pEW|HyWN"<W @$O f.R yW|B <Wd "J yW| (/f QK"B(e#W|WB<HnHyWI RN$@P|f"a  @|g(HyWHzgHxa 2 . @g|la Hxa |fnJ! fJ!gJfJg Hn@/N` Hn@/a S$@P|f/HzHxa к .H @fJ!fJ! gp`B`p/// a/a Nq%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected.fts_readNVH?<$nBHy/./ a e$.O f /Hxa NB`B0+6|gm|g2`<|g| f0/+a //+Hza vO`/+Hz`0J gB0+&йW"<WR oHk@/Hzra Ȓ`4KWY*<WJk4fP| gBHx//+a 6"@PEռJg k( R`B kHza p:|P`/<Hy /N$@O JnJl"E/)Hza ::|Prf/EN/Np`J!g// aPJg:|`l , g`$,!,fTHn/a pPJf,"lf8 9!(F//a PJgHyWHzfa ט:|P/EN/NPJgHyWHzXJg HyWHz`&/*/*HyWa O JgHyWHza Ֆp`J!fB`B/ a($nN^Nuchown: %schmod: %schflags: %sNVH<0$n(. B"*$ WID %AJg/*/*/a O Jf`D/*/*HyWa 6O Jg(a ~ @zgHyWHzZa vPj Jg/*/a PJf`*/*HyWa ~PJgHyWHza ԂvPJf^GN @BJg/*H/a @PJf`:/*HHyWa PJg$N @z-fJHgHyWHza vPJf/ HyWaPJgv L Hz y[/Hz/9^a"`,/a N <`./a > < ` y[ h N < Jg <ۺL N^Nucall terminated disconnecting...NV .J!4fHz/9!Hz/9^a!`dJf6Hz y[/Hz^/9^a!OJy_Pg,Hza X`/ y[/Hz*/9^a!O y[ hNN^NuNVHx/.a f^HxHy! #! OlHy!Hz-a ` from [to] cat %s;echo NVH0 HxPHy!Hza/O JfHy!Hy!a$PJorl Hza `hrf #!!E!/apHxHx/a <&Ol/Hz#a `&/*HzZHx$/a #HzP//a6L N^Nu %d write error lines transferred in NVH> $.A-H/a @///9!ENB!xHx/9!a cHxHy!/9!`a | O .Hn/9!NO ` || g,HxHn/9!a RO .IJ!g fHy!,HxBa |\Hy!a HyHxa b(*Ba H(BOJ!xfHxHn/9!a O J_ID.IJ!fAJ!xfJf/.I/a1\PJf|.g g nR . fJy_PgR/HzPa PE$.^fR// /. a ,O gHza |#!xX-J` $.g"///. a O g Hza FXJy_PgBa Gd/HzaO Hy!HxBa zHxHy!/9!a /Hxa `O. a L|N^NuLocal command? can't establish pipe can't fork! can't execl! NVH 0Hx$/HzENO JfHna y8XJgHza N`a yn&@JlHza 4`JgHx/HzNO Jg"/.EN/.NHx / a `z`/.a HyHx EFN/9^`/./aBHx NO E`gTHnNXJoH`B/.a q/.GN4|O / NXRrl/a FHza dBa L N^NuNVr#!|HxHxa ^N^Nur%s: cannot open NV. I 9"@S#Sjm  g yR`Hy/a ZPHxPHy!THz)a*NO JfTHy!TaRHzx/a O JfHy!THz`a `$B/9^n/aHO Jy_zf /9!a 'N^Nu timed out at eol chars transferred in NVH?<&n$.Hx/9!a ^B!|HzHxa ]-@Hy!,HxBa wHxHy!/9!`KNO(JgL$BJgI/aXJfJy_zgHxHn/9!NO `/9!a &Hxa EPBBBa C,X*<_NI_B`Jlf +"@S'ISj / a X` SBR-@J!|f@"~g6~fJlgxE.~m\A_~ fJhfJ~ -G`B~ f6Jhf6Jy_Bg.Hx E2NXRCg&Hx NXRCf`Jhg*I/aX~ f0E_x"EJigR/Hza pPJjgB!/9_ESNX` pgTHxHn/9!NO J!f J!|g` Hza XBNX`$9^IJ!gB.fBNX`  gJy_f Hx aXJ g$n JgI/aXJfBa A$/ a B/.Hxa [NO"EJig Jy_g /Hz+`/Hz a PHxHy!/9!a Hy!HxBa uL from [to] cat>%s stty -echo;cat>%s;stty echo NV//HxPHy!Hza&\O JfHy!Hy!aPJorl Hz{a `~rf #!!/9!a &$HzJ/a &O f/Hz6a ``@A!Jy_zg/Hz:`/Hz:Hx$/a O .Hz9/a$.&.N^Nu timeout error (%s) NVH00 .B@HxHn/9!GNO Jy_zgvB!/9_ESNHxHn/9!a >BNOJ!g>I/a)/Hzja tO RrmHxHy\/9!NO `L N^NuNVHzHxa Xr#!N^Nucan't find `%s' away for NVH<8B. I 9*S#Sjm  g yR`Hy/a TPHx&/Hza$.O JfLHx/9!a YHxHxGFNHxHxNHy!,HxBI`NO .Hy!/9!`a a q`$O lHz{a $X`|Jg&Ba >D(XE`g`HnNXJoT`Hx/9!a jtPE/NXRzlBHxNBHxN/a/Hza Ba hJy_PgBa =Đ/HzzaO HxHy!/9!a Hy!HxBNBHxNOBHxNL %s NV/ / y\JgHx0h/Eq&NPJlHza A`a #$fa T/a R @X$<Jg$Ba *-@Hna \ @B(/./.Hz]/.//HzR/9\a ClO$.\a Hx y\0h/N$.$nN^Nuacan't open log file %s. NV/ $y^Jg(Hz/ a #\Pf/ HzHya B$nN^Nu$NetBSD: partab.c,v 1.5 1997/11/22 07:28:44 lukem Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $NetBSD: remote.c,v 1.8 1998/08/25 20:59:41 ross Exp $parercfoexesdiprpnoeieelcucmdvat/etc/remoteREMOTEtip: unknown host %s tip: can't open host description file tip: possible reference loop in host description file brfsdu%s: missing device spec %s: missing phone number hdraecbenbsctbvbnvtantrwdctip.record  dlcletNVH<(nHza  @XJg" /g /a nX`#]#&]/ Hy]Hna Ŝ$@O JlJ!f /fVHx#!/ a )PJf>#!!#!r#!B!J!f #!#!`2rg(mrg&`6rf0/ Hz3Hya ?O `Hz3`HzTHya ?PHxa E]G]HJg SJf///.a dO XXJfJ!f(Hy!Hz1/.a O rf #!Hy!Hz /.KTNO rf #!J!lB!Gʞ`&Hx:Hz/.GʞNO JVID#! 9!f/ HzHya >Hxa J!g2J!f#!J!f/ HzHya >Hxa Hx:Hz/.NO JVID#!J!f0 9!gJ!g//9!a PJf4|#!#!Hx:Hz(/.$KNO Jgr#^Hx:Hz /.NO Jgr#_xHx:Hz/.NO Jgr#^6Hx:Hz/.NO JgB^6Hx:Hz/.NO Jgr#_2Hx:Hz/.NO Jgr#_@Hx:Hz/.NO Jgr#_NHx:Hzk/.NO JgB_NHx:HzR/.NO Jgr#_Hx:Hz7/.NO JgB_Hx:Hz/.NO Jgr#_Hx:Hz/.NO Jgr#_Hx:Hz/.NO Jg! J!f #!J!f #! 9!g/HzaJP 9!(g/Hzya4P 9!g/HzoaP 9!g/HzJaPHy!Hz\/.$MNO rfB!Hy!Hz=/.NO rfB!Hy!Hz /.Nrfr #!L<N^NuHOSTtip: no host specified NV .J]fFJf*Hza ^XJfHzHya ;Hxa n/a#!!pR]X 9!pfB` C_Jg y_Jf"$Hz/EռNPJf |#!`B!BxFBHz/NPJfzF`RHzu/NPJfx`@Hzh/NPJfvF`,Hz%/NPJg/HzHHya +Hya uA!C\"<!SlL|N^Nu$NetBSD: tipout.c,v 1.7 1998/07/12 09:59:30 mrg Exp $NVHxHy!/9!da HxHy!/9!a HxHy!Ta >NqaNVH08&$CHxHnI!/GNO . g($<JoSHxHn/NO . fBG_2Jkg 9!Xg /a fXf B|y`(Hzp/a #!XPf|n` |yr&HxHn/9!da HxHy!Ta bNqNVJy_4g 9!Xg /a XBa NqNVA^6JhWID HxHy!Ta NqNVH< HxHxEFNHxHxNHzHxNHzHxNO.HxNHzhHxNHzHx NHy!Ta @BO(Hx//9!a 0$O n*la \ @zfHx@a 8VBaP`HxH`a 8@&$DX Ђc"IJ!fb/E/ Hxa O Jy_4g 9!XgJy^8f//Hx/ a 6O`n Ђcf$ ^c/9^I/a PJg:I"y!X )*S#ESj m  g QR` / /a %TPRb/a 7$X`Nq$NetBSD: uucplock.c,v 1.10 1998/07/12 09:59:30 mrg Exp $/var/spool/lock/LCK..%sCan't open lock file. Can't read lock file. Stale lock on %s PID=%d... overriding. Can't seek lock file. %10d lock writeNVH?0,./HzYHx*/GNHxHx /E fN(OlBHx/N(O l/a $Hz!Hya &`$HxPE/ /a }&O n$/a $/a }HzHya &`B28/ a $B/a (NO Jga @~g /a }p`//HzHyEFNBBB/a }O Jj/a $8/a }0HzHyN``a '/HzHxQ$/N/a EN&///a |O f /a |B`/a |/a Hzha #pL tN^NuNV//.HzHx$/a 2/a x$.N^Nu$NetBSD: value.c,v 1.9 1998/07/12 09:59:30 mrg Exp $%s/.tiprcrset %sNVH0E`Jg4Hn/a PJgPJf`".RSJnHnHzja l/.Hxa nB$.|$nN^Nu AT Z +++NVH?-@Hx0/EnNOJfHxO/ NPJgHxK/ NPJgp`nHxNHxHz/9! DNHxNB/< tx/9!NO.NB/< ty/9!NO RrlHxHz`/9! DNBL/NNORQBBSdL N^NuNVH<B/aB/a@O .Hx/9!a B/< t/9!NO/9!a G$.$nN^NuNV/ Hxa 9aXoHx /a "PJ! oB/< t/9!a G4O /9! EN 9!XoB/< tx/a GO /9!N$nN^Nu/dev/cua1/dev/cua0Unable to locate dialer (%s) NVH 8$. /.a&@X <$.BB/< tx/9!(< DNHxI/dNB/< ty/9! DNO*<ԆKHxHz/N/< ENHxHzy/NHxNO Hn/<@f/ DNO Jl HzZa N`b .oTEGrd8 d0 d*@d%dddd@dforcedevmtimeatimereloadupdatesyncasyncsympermunionrdonlysuidexecdevcoredumpautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %sNVH 0$.$n azBr#$Cx#DG`,r?g"rofBHnHz/9$FaO`aHz8/ /NO rf 9DE rga-R$*r-A.g -|`BHn/./Hza OJlZEN @ rgrf <d`$ <d.g <d`N @/a T0X///.HzHxa Ba TNqusage: mount_ffs [-o options] special node NVHzHya ߴHxa TNq$NetBSD: getmntopts.c,v 1.5 1997/09/16 12:22:42 lukem Exp $%s,-o %s: option not supportedNVH>8,. *.(./.a S&XfHzHzHxa 7\&CI`An nf +oftT`BHx=/ N @PJgB$FJg>// a 7fPJgEJfJg" EJ g Df"*`" *F`Ja,f/ Hz$Hxa Hz/ N&@PJfd/a 1^L|N^NuNV/./. /.aN^Nu@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_cd9660.c,v 1.6.2.1 1999/09/05 15:05:49 he Exp $iiiiiii~iyitimig i_ iXupdatesympermunionrdonlysuidexecdevcoredumpautorwrogroupquotauserquotaego:rcd9660%s on %sNVH80&.$n aBBG`Vrgg$mr?gDreg`8,. *.(./.a N&XfHzHzHxa 2&CI`An nf +oftT`BHx=/ N @PJgB$FJg>// a 2PJgEJfJg" EJ g Df"*`" *F`Ja0f/ Hz$Hxa BHz/ N&@PJfd/a ,L|N^NuNV/./. /.aN^Nu@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: sleep.c,v 1.16 1998/11/04 20:13:03 christos Exp $NV'H00$.$n a.HzBa ZNHynHxa نOG`aHz/ /NO vf 9DE vgaB"R IJgB$yL2fRRJfJg`/ a//UX\8 Ba M'uaj//T(rdfd=|r-AE/ //G>NO Jl/HzHxa *j=|-n/ //NO Jl/HzHxa *<=j -nHn//a3O Jl//HzHxa *G/ //a2O Jl//HzHxa )/ aHX`xHn/*/a2O Jl/HzQHxa )/./HzGa +zO `:Hn/*/a2zO Jl"/HzHxa )l/*Hz"Hxa ԖBa ENqu8u!u76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) NVH<(nG2`G0gjTf2l/ /+HztK(N/+2l/ HzzEvN/+ 2l/ HzgNO$ 9"@S#Sk" y R`"8T/ Hza )`FHyHx a ̢P/,$/, /,/,/,HzN/,4/,0/,,/,(/,Hz NL<N^Nu%s=%o%s=%xNVH0 .&. $nBJg f //Hz`//Hza )HO RJgJJgD 9"@S#Sjm yR`HyHx>a L N^Nuusage: mt [-f device] command [ count ] NVHzHya ̈́Hxa BfNqNV/./. /.aN^Nu@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: kill.c,v 1.17 1998/11/04 18:14:15 christos Exp $-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%sNVH88$.$n armavSXHzw/GռNPJfSXG}VrlNrf| RB yL0fNHx Hn/a v& nO Jg/HzHxa Drlrց Srd/aX y@/0<Hza %Ba @tHyaBa @bHz/NPJfNq NVH0 &.tEF y@/0,Hz/NO rgr fHz`Hz/NPRr lL N^Nuusage: kill [-s signal_name] pid ... kill -l [exit_status] kill -signal_name pid ... kill -signal_number pid ... NV/ HznHyEFNHzHyNHzHyNHzHyNO.a =NNqNV/./. /.aN^Nu@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.22.2.1 1999/09/05 15:15:11 he Exp $}w o ib_ZPKE <@5+%  nfsv2tcpsoftnqnfsnoresportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforcesympermunionrdonlysuidexecdevcoredumpautorwrogroupquotauserquota23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UX-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsnqnfs only available with v3illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sstrdupnfs%s on %snqnfs 1/mount_nfs:nfssvc err %mNVH88$.&n a#'!0BBEHxHHya4/ a  O I`BxЄxFe20; N(((((((((((((((4>(((((((((j((8 ((((((((((*((((((&((0t~.J((JagHzHxa @x#a`~JagHzHxa x#aj`VHx Hn/9$Fa nO JfJl/9$FHz]Hxa %@8j `xa|`j`j`Hx Hn/9$Fa nO JfJn/9$FHzHxa n%@@j@`j`Hx Hn/9$Fa V nO JfJn/9$FHzHxa %@(`Zx@`PHx Hn/9$Fa  nO Jfxm/9$FHzHxa %@<j``HnHnHz/9$Fa f ."OAgxa|gj g j .g x@ .g"JagHzHxa 6x#a . g(JagHzHxa x#aj .gJ(lBa .gj g(JagHzHxa øx#aj . g x . gx%D x#aB`j`j`JagHzQHxa Px#aj`Hx Hn/9$Fa > nO JfJn/9$FHz$Hxa #!0`FHx Hn/9$Fa nO JfJn/9$FHzHxa %@$x`x`x%D x#a`Hx Hn/9$Fa nO JfJn/9$FHzHxa b%@,x`Hx Hn/9$Fa T nO JfJn/9$FHzHxa %@ x`XHx Hn/9$Fa  nO JfJn/9$FHzRHxa %@0x`` Ba`aHz/ /NO xf 9DG xga$&S/a 2n&XfHzHxa 0/ /aPJf Hxa 2/ /./ Hza OJg/ /HzHxa  *g9afPa JgxfHzHxa Ba 2Ra ΖBENHxNHxNHzma QOHxHxHzYa ,4|-KO tԎGX6`$a  @xQgHz4Hxa ( P`4|// NPJmBa 1Nqno : or @ speccan't reverse resolve net addresscan't get net id for hostNFS PortmapCannot MNT RPCMNT RPC%sbad MNT RPCnqnfs 2can't access %s: %sNVH?<..r-ABnHxZ/Hy!a AB9!&Hx@/EnN @OJgE`Hx:/N @PJfHz`^$G.RBHy!p/ a PJg.&n +g\HxHxHy!pa %rO Jf@Hz`/ a !"@XJfHza tB` i/) /Hy!pa O Jag":||` #!0:||&n k`:||-y!0r #!|J!0o:!m3o!n/9a/ /<Hy!la =@Of9afZHz?`rBy!nt BJag*r&n fBBHn//<Hy!la j`Hn////<Hy!la $@OJf9afHza ^X`a$x BA!C!&n r+gr " j//HiHy/HyHx/ PNO Jg2r fPrf JagHzh/ a N/HzbHxa & R"h / iN j/ hNB!0P`&9afHz)/ a /Hza vO 9!0&@S#!0SJo 9a|I/dgdr€#a|a pAW6EJgrfHzHxa BBa -NBNHxNHxNHza M8ra|OHx8,. *.(./.a * &XfHzHzHxa &CI`An nf +oftT`BHx=/ N @PJgB$FJg>// a PJgEJfJg" EJ g Df"*`" *F`Jaf/ Hz$Hxa nHz/ N&@PJfd/a L|N^NuNV/./. /.aN^Nu@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mv.c,v 1.20 1998/11/04 18:56:53 christos Exp $if%s: destination pathname too longNVH><$.&n atpN^Nuusage: mv [-fi] source target mv [-fi] source ... directory NV/ HzHyEFNHzHyNHxa DNqNV/./. /.a$&N^Nu$NetBSD: buf.c,v 1.19 1998/11/04 13:41:32 christos Exp $%s cannot seek temp fileout of memorycannot read temp fileNVH8 $n!fB`x#!$*&* 9!"9!gR#!#!B/9!/9!a |O Jl*a ^ @/a f/HzIHya :Hz=`d$j" R 9al$Ra  l <Ԁ//9aa PJfa  @/a /HzHya HzHyc a l 9a(S#aOxf 9agHxa[alO JlHxaA! #!A!`R o$.N^NuNV/ /$. n .E!`"9aa#a"B SoB Sn $$_N^Nu$NetBSD: cbc.c,v 1.13 1998/07/28 05:46:20 mycroft Exp $NVN^NuNVpN^NuNVpN^NuNVpN^Nu$NetBSD: glbl.c,v 1.4 1998/08/19 01:33:31 thorpej Exp $invalid pattern delimiterNVH<0*. y!  g  fHzHyc a dp`aU(g y!ܴfR#!a/9!aT$@&9!X!nh/ a$XgGMPJ!gHx B/*/aZOBBB//NOJWIDf/ a:XJmbR$R!oBL X 9ag HxaNN^Nu$NetBSD: io.c,v 1.4 1997/07/20 06:35:38 thorpej Exp $r%s: %s cannot open input filecannot close input file%lu NVH8 $n(. !fHzHja AD`Hz/ aJ.a *.&. ,./ar$@BXJag`a2`XmX/ a @XJg:$*C!fJ!gJ!f (R///NO Jlp`(؂R$RJfJag/a"Pp( L|N^Nucannot write fileNVH0 &.$n $.SrgrJag/I/azPJm`J/I/anPJl6a @/a /HzHya Hz|Hyc a Tp` QBBSdBL N^Nuunexpected end-of-fileNVH?<,.*. "y! I  f$H~lHr/ (<*DNPJf*F* 9!`~*F* 9aİl$Ra l <Ԁ//9aa PJfa @/a /Hz Hya HzHyc a S 9a.S#aO~f 9agHxaBX 9agHxaB`#a#a 9a*@S#a~f0 9agHxaAX 9ag HxaBX/ /9!/9a&<*CNO S`E ya JgSa&@Jm g y! 0 gHz4Hyc a RB`vI 9aİl$Ra A*l <Ԁ//9aNPJfa T @/a \/HzHya 0HzHyc a RP 9a.S#aO~fl 9agHxa@X 9agFHxaAd`8#a#a 9a*@S#a~f0 9agHxa@JX 9ag HxaAX/ /9!a/ *CNO ~l yaHt/*DNPJfp" R 9aİl$Ra A* l <Ԁ//9aNPJfa  @/a /HzXHya HzLHyc a Q 9a.S#aO~f 9agHxa?TX 9agHxa@`#a#a 9a*@S#a~f. 9agHxa>X 9ag Hxa? yaB4*F* 9aL`#!#! 9a*S#azf0 9agHxa=lX 9ag Hxa>2X y!Rfz#!z fR!`b0+ gBa r @/a z/HzFHya NHzAHyc a Nnk B!p`,@7@ g( `8Jg y!B2#!! L HzHyc a GpBa ҾOJf &9!r y!B"yL1gB  gE#! J1f y!*IpЄ|Ue0; NT,T~~~~~~~~~~TE#!B("yL1g$B y!  gE#!(1f y!B"yL1gVHx Hy!/a $O g fa @|"fHz8`^|-g|^f``ւ`Z1HfP|-g|^fS`>R`8JgHx Hy!/9!a &O g fa T @|"fHz`JgR#!|.f&9!`Jg|/WID/a2/a&Pm y!IfR#!`JglE#!(I/R!a-&Xlb`XJg0R#!R!|;f #!!`|#!&9!`,fp`0Jm!oHzHyc a Ap` ` B y!`*L|N^Nuinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiterawcrypt unavailable%ld ! unknown commandNVH?8BBB y!B"yL1gB  gI#! L1f y!IpЄR!~pe60; N,,,,,,,,,,,,,,,,,,,,,,D,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,,,,T> ,   ~X,B y! ngn lg ` pf~`~`~I#! L`RJgR! gHzT`J!tfaF&/9!a`/9!/9!aPJmB y! ngn lg ` pf~`~`~I#! L`RJgR! gHz`pJ!tfaE/9!/9!a'PJm/9!a,Jld`/9!/9!a\PJmB y! ngn lg ` pf~`~`~I#! L`RJgR! gHz"`J!tfaD/9!/9!a' Jm`"9!R!_Ig#!`J!gJafp`J!oHz`\ y!B yL0fHz`g"9!R/Hza 9!`| .S oHz"Hyc a (~B`X 9c nRa$@E/ /9ca HPJf~a  @/a "/HzݜHya dHzHyc a ( 9a&@S#aOrf~ 9agHxafX 9agZHxa,`N#c#c 9a&@S#arf, 9agHxaX 9ag HxaXB$y!  g& yc"nR!R 9!$@  f"yc nB0/9ca$JVIc$n&nN^Nushell access restrictedno previous commandNVH80BJagHz`\HxHna8#!&@PJfp`".R 9c l$Ra  l <Ԁ//9ca lPJf~a > @/a F/HzHya cHzHyc a &: 9a(S#aOxfn 9agHxaX 9agJHxaP`>#c #c 9a(S#axf, 9agHxa8X 9ag HxaX yc!4| y!  gN !gZ %g" T 9c l$Ra A* l <Ԁ//9cNPJf~a  @/a /HzچHya aHzHyc a % 9a(S#aOxf4 9agHxaPX 9agHxa`#c #c 9a(S#axf, 9agHxaX 9ag HxaX"yc y!R y!R! \f"yc y!R!R`ܱg*& R 9c l$Ra A* l <Ԁ//9cNPJf~a @/a Զ/Hz0Hya `Hz`Hyc a # 9a(S#aOxf 9agHxaX 9agHxa`#c #c 9a(S#axf, 9agHxaX 9ag HxapX"yc y!R!$C` y!JgJ(fHz`j" ҹ! 9c l$Ra A* l <Ԁ//9cNPJf~a j @/a r/HzHya _FHzHyc a "f 9a(S#aOxf 9agHxaX 9agvHxa|`j#c #c 9a(S#axf, 9agHxadX 9ag Hxa,X 9!&@R` ycR 9!й!b`NAaJg/a~&@/ a }-@" Ҁ 9c Pl $Ra A* l <Ԁ//9cNPJf~a  @/a /Hz֒Hya ]HzHyc a ! 9a(S#aOxf@ 9agHxa\X 9agHxa"`#c #c 9a(S#axf: 9agHxa X 9agHxaX` ycR .(S-DJf&y!R! 9! @  f" R 9!̰l$Ra A* l <Ԁ//9!NPJfa @/a /HzJHya \HzzHyc a  9a(S#aOxf 9agHxaX 9agHxa`HzPHyc a h`#!#! 9a(S#axf, 9agHxa X 9ag HxavX/ /9c/9!a p#! y!B2B !g %fr L N^NuNVH 8#!J!tf:aΐ @Jlp`Jg"y! 1 gy4JVI`$I`($y!g2` y!R! f y!ܑrf .f * fB`<$ ԈRaI/ N$@XJfH 9a"S#arf^ 9agHxa vX 9ag:Hxa <`.Jg/9!aR'@X`f/9!/9!Ba!&@O JfH 9a"S#arf 9agHxa X 9agHxa `f*r#! 9a"S#arfv 9agHxa X 9agRHxa hX`DLN^Nu NVH>8(.*. R!_I€/EN&/N&@PgF/ a$Xg`" ҫ 9!pl$@Ra A* l </ /9cNPJf~a < @/a D/HzѾHya YHzHyc a 8 9a,S#aO|f 9agHxa X 9agHxa N`#!p#c 9a,S#a|f, 9agHxa 6X 9ag Hxa X/+/,9c܌/a O &Sf" T 9!pl$@Ra A* l </ /9cNPJfza @/a /HzЌHya WHzHyc a  9a,S#aO|f 9agHxa VX 9agzHxa `p#!p#c 9a,S#a|f, 9agHxa X 9ag Hxa X"ycAn//aPJlp`S#!Ra/9caXJg/9!/9!Ba6O JfD 9a,S#a|f 9agHxabX 9agHxa *`||#! 9a,S#a|f* 9agHxaX 9agHxaBL|N^NuNVH><(. y!"R!_I&ƀ$9!SBgfpRaJg"/EN(@/N&@#!!P`//HxE RNO Jg"*R!_I//HxNO JfF 9a,S#a|f* 9agHxa,X 9agHxap`/IN*@X!l/N$@/N&@` /N&@/N$@P(S& R!K m )m$+J 9!n ` ,9!Ԝ Ѕ#!J!tg / /aP|#! 9a,S#a|f* 9agHxa\X 9agHxa$BL<|N^NuNVH>8(./9!IN&@$9!"9! &RB#!Xm o &R*`Ra/ a$Xg2/aBXJg%B`b/9!/9!BaJ$@O JfD 9a,S#a|f* 9agHxatX 9agHxa/ NOHxaLN^NuNVJaf HxaXp aHxHy!`abNqNVp aHn/<@thBa Jm00. @cU#b0. @cQ#cN^Nu..NV/ $nJag> !g$Hz/ a tPJgHx// a PJgHzHyc a B`p$nN^Nu$NetBSD: re.c,v 1.15 1997/07/20 06:35:40 thorpej Exp $invalid pattern delimiterno previous pattern%s out of memoryNV/ y! fHzHyc a ` gC#!(  gf$ 9dHfHzHyc a  9dH`I/a$XBJg 9dHgJbf /a mX`HHxa &#dHXf4a \ @/a d/Hz+Hya K8HzHyc a X`PBbB//9dHa_O Jf 9dH`,Hx'Hyc /9dH/aVB/9dHa BdHB$.N^Nuunbalanced brackets ([])trailing backslash (\)NVH00$.$y!`: g: [g \g`"Hja$@XJfHz`nR  g`RIf&J!" R 9dPl$Ra  l <Ԁ//9dLa 0PJfa @/a /HzHya IHzHyc a 9a&S#aOvf 9agHxaLX 9agHxa`#dP#dL 9a&S#avf0 9agHxaX 9ag HxaX/ /9!/9dLa O ydLB3#!J!f 9dL`(Hz=Hyc a B`Hx B/ /9dLaL N^NuNV/ n ^fR ]f R ]gXC gN [f<It.g t:gt=f&TTI`It fB`&RR ]f貀fRR ]f ]WI$$N^Nu$NetBSD: sub.c,v 1.5 1997/07/20 06:35:41 thorpej Exp $number out of rangeNVH00$n&n BB y!  f B!v`aJfp` y! fv`zf C#! I bLHx Hy!/a }&O g f6a R @v"f(HzGHyc a bBp` gf R#!v$BL N^Nuno previous substitution%s out of memoryNVH80 y!R! y! %f`(fXR#! 9!fpHzHyc a `VSS#!`*" T 9!䰁l$Ra A* l <Ԁ//9!NPJg(#!#! 9a(S#axf0 9agHxaX 9ag Hxa~X"y! y!R!R f y!Jg4 \fV y!"y!R!R f6J!tf.G ` y! 0 gy4N"@JgnJm y!ܶf" R 9!䰁l$Ra A* l <Ԁ//9!NPJf~a  @/a "/HzHya DHzHyc a  9a(S#aOxf. 9agHxahX 9ag Hxa.B`f#!#! 9a(S#axf. 9agHxaX 9ag Hxa#! y!B2 9!L N^Nuno matchNVH?<*n,. ..$9!B 9!"S#!B"y!ԓ mI y!C#!HhN//// a&OmgZ/9!/9!alPJmr$9!ւRaG/N$XfL 9a"S#arf< 9agHxaX 9agHxa`Jg/9!N%@X`j/9!/9!Ba P$@O JfL 9a"@S#arf 9agHxaxX 9agHxa<`f( 9a"@S#arf0 9agHxa(X 9ag HxaXR$9!R 9!Ԑ!lf#!JffHzHyc a Pp`& rg//9!/9!a"pJmBL0$nBBv G`J| ffvJ!gLJfB 9,S#Sk y Rp `HyHx a .P|gz`J!gDJ!gJ!g4HzHza`J!g"R/HzJHya 0O + fB| fXJ!g> 9,S#Sjm y$Rp$`HyHx$a -hP|gp`| fJ!g 9,S#Sjm y^Rp^`HyHx^a -P|g 9,S#Sjm yIRpI`HyHxI`J!gJ|d 9,S#Sjm yMRpM`HyHxMa ,lP|gt 9,S#Sjm y-Rp-`HyHx-a ,"P|g*|Ć yL0(g 9,S#Sjm y^Rp^`HyHx^a +P|gr?|g"|@ 9,S#Sjm  g yRB`PHy/`> 9,S#Sjm  g yRB`Hy/a +(P|g0& *,S%FSj/ a ʲX$` RBR|f* g /9!Hza F|#!j P+ gHzHxa L |N^NuNVH8&nI(4l# !JgJHzf/a 6PJg.BB/a $@O Jl/Hz@a r#!P`"4l#!/ a"0lXg / a XJfLN^NuNVH88(.6yJ!fjHn/ a |PJf< . c <#! d <#!/a ~x#!XJ!f#!!#!I`6BE/"9!҃// NO JlHzHxa րJf/9!/9!/N$O nl/9!Hza r#!LN^NuNV/./. /.akN^Nu$NetBSD: atalk.c,v 1.5 1999/01/06 05:57:29 abs Exp $????*%huNV nJ f B0(g f < =`* < B`"B0(/HzHx2Hy!a <!N^Nubcast%dNV nJ f B(g f < `* < B`"B(/HzHx2Hy!4a <!4N^NuNV nB(g g ` < B`* < =`"B(/HztHx2Hy!la L <!lN^Nu%d-%dNV n0( 2( @g?Bg?BgHzHx2Hy!a `?BgHzHx2Hy!a <!N^Nu%s%s.%s.%sNVH00$n&. $rāG!B rre0; N"&0TB`~// a6`// a/HzHx2Hy!a XO`P// af/// aXO.HzUHx2Hy!a (O` / a/Hz0Hx2Hy!a Og6/ af/HzHy!Ee:NXr2/Hy!NXHsa <!L N^Nu-%sNVH<<*n$n *.x؎2-j=A$rār//GN/HzHxdHy!IN&0*O @g.F@m=@//N/Hzrd/"!/NրOg r…// N/Hz1rd/!/N <!L<J!gHzONX 9"@S#Sk y R`HyHx a #^P"9" gHzHzNP"9" HzHzHz&Hz0Hz3Hz6 Jg < /NBdhOJ" g / HzlNP"E///Hzb$KNHxHy!N/ J" g < /NO.Hy!N/ J" g < /NO 9"@S#Sk y R`HyHx a "jPJfLL(%d)%10lu %10lu%8lu %5lu %8lu %5lu %5lu %4d %5dNVpH>< .*. fHzia z`Jg //aD`HxHnr/K NO Jf*.rJ!g*Hz>HzAHzDHzHHzLHzLHzMI(NO`4HzkHzmHzoHzqHzsHzHzHzHzHzeI(NO(J"g HzHzNPJ"_g HzHzNP 9,S#Sk y R`HyHx a `PJgJftHxHnT/NO JfHxHnh$/a yDB.*.XO 9"Pg//a PJfPB/a d&@P.f*B$n`/.HnHzNO JfHzHzNHzHzNO`bx.&< %Hx$// NO Jg` .&B$ B+|eb0; N&XBXXXXXXXXXXXXXHz8Hz9NHz.Hz9NO`/./.aL/HzN/+E BN/HzNOJ!g .6gHx$Hnz/N/.zN/HzHzN .Of`fHx/ E N/HzNHx / N/HzNO `8/+Hz$z/a /a/HzN/ a/Hz_NO$`B+G"B) g fx:&< %K"BB)HzhHzN$@P`BB+/HzWN$@BPG"TdJfSdJf SdJgFԋ&ASk&p JoI/B//NO QBBSd| $F`@ 9"@S#Sjm y R`HyHx a XP Sn$nJ!g/./.HzNO `/././././.HzNOJ"g2n/ HzNPJ"_g /.HztNP 9,S#Sk y R`HyHx a PJfVJfL<|LN^Nu%s%s: %s: unknown interface %7.7s in %8.8s %6.6s out %5.5s%5.5s in %5.5s%5.5s out %5.5s %5.5stotal %7.7s in %8.8s %6.6s out %5.5s %5.5s in %5.5s%5.5s out %5.5s %5.5sbytes%10.10s %8.8s %10.10s %5.5scollserrspackets%8.8s %5.5s %8.8s %5.5s %5.5sdrops %10.10s %8.8s %10.10s %5.5s %8.8s %5.5s %8.8s %5.5s %5.5s%10lu %8.8s %10lu %5.5s %10lu %8.8s %10lu %5.5s %8lu %5lu %8lu %5lu %5luNV,H? max ip packet size %lu with header length < data size %lu with data length < header length %lu with bad options %lu with incorrect version number %lu fragment%s received %lu fragment%s dropped (dup or out of space) %lu malformed fragment%s dropped %lu fragment%s dropped after timeout %lu packet%s reassembled ok %lu packet%s for this host %lu packet%s for unknown/unsupported protocol %lu packet%s forwarded (%lu packet%s fast forwarded) %lu packet%s not forwardable %lu redirect%s sent %lu packet%s sent from this host %lu packet%s sent with fabricated ip header %lu output packet%s dropped due to no bufs, etc. %lu output packet%s discarded due to no route %lu output datagram%s fragmented %lu fragment%s created %lu datagram%s that can't be fragmented NV/ .g@HxpHn/a=/. HzE(NO .f r"Am/a=//.HzNO .f r"Am/a=//.HzNO .f r"Am /HzNP .f r"Am /HzNP .f r"Am /HzNP .f r"Am /HzNP .f r"Am /HzNP .f r"Am /Hz)NP .f r"Am /Hz&NP .f r"Am/aO 9"S#Sk y R`HyHx a P&fL0N^NuActive ISO net connections (including servers)PCB%-8.8s (state)Foreign AddressLocal AddressSend-QRecv-QProto%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %8lx %-5.5s %6ld %6ld () *.* NVH00$.&. Je(gHzE(&JNXJ!gHzNX 9"@S#Sk y R`HyHx a ٨P 9" gHzHzNP 9" HzHzHzHzHzHz"< hJg"< hp/NBe(OE(J" g 9"f /HzNP/9"/9"HzHzNOJg(09"Fg HzHy"F?BgaHzNO`"9!<&n&. HzB/Hz>HyKFN/(<  DN//Hz/Hz%HyNO(. DN//+Hz/Hz'HyN/+ DN//+ Hz/Hz)HyNO4. DN//+Hz/Hz(HyN/+ DN//+Hz/Hz"HyNO4. DN//+Hzn/HzHyN/+$ DN//+$HzN/Hz&HyNO4. Hz4/Hz0HyN/+ DN//+Hz/Hz(HyNO,.H DN//+HHz/Hz HyN/+L DN//+LHz/HzHyNO4.X DN//+XHz/HzHyN/+P DN//+PHz/Hz HyNO4.T DN//+THzh/HzHyN/+` DN//+`HzH/HzHyNO4. DN//+Hz$/HzHyNHz/HzHyNO(.D DN//+DHz/HzHyN/+@ DN//+@Hz/HzHyNO4.\ DN//+\Hz/HzHyNHz/HzHyNO(. DN//+ Hzt/HzHyN/+$ DN//+$HzT/HzHyNO4.Hz:/HzHyN/+ DN//+Hz/HzHyNO,. n2/HzHyN/+(Hz/HzHyNtO$ ((@X$@P Ѐ//P//Hz/HzHyNO R|l/+lHz/HzHyN/+tHz~/HzHyNO$.p DN//+pHzZ/HzHyNHzH/HzHyNO(., DN//+,Hz$/HzHyN/+0 DN//+0Hz/HzHyNO4.4 DN//+4Hz/HzHyN/+ DN//+Hz/HzHyNO4.| DN//+|Hz/HzHyN/+x DN//+xHz|/HzHyNO4. n2/Hz HyNHz%Hz/Hz5Hz>HzB/Hz=HyNBO0*<e,IE//// EX/Hz/Hz.HyNO$R|l/+NVH 0$nHzHjB*/G NO *f J@gHzB*HrBANO J@g&HzB*AB*HpB*/NO *g0HzrB*C B* @B*HpBBNO 9"@S#Sjm y R`HyHx a *L N^Nu%sNVH0< .*n$n $ ԀC!(IJgRc:Ge %lu/%lu mapped pages in use %u Kbytes allocated to network (%d%% in use) %lu requests for memory denied %lu requests for memory delayed %lu calls to protocol drain routines NVH8<&. . $. hg /9Hz`Jf/9HzHya `(JgHxHn/E NO `-|E JgHxHn/NO `-|HxHy"A/NO JfHxHy"D0/.NO JfHxHy"X/.NO JfEh$ JgG"AB 23 PJf/Hz&<("CN$BPK"FJg:I"ABGh Jt gx+ / 44 /Hz"CNO PPJfx*"9h̲o2BG"A(MJf0g/ 4/Hz"CNO "9hTRnE"(L9H"/I"G""T/ Hz"CN"9"D\(9"Dh (9"$Ԁ"9"Dؒ"DL9"DD L9"l AO JgC A"LB`B/"lx /Hz+"CN/9"AHzK"CN/9"AHz]"CN/9"AHzp"CNL<N^Nu$NetBSD: mroute.c,v 1.13 1998/07/12 03:20:14 mrg Exp $%lu%cNV/ . br ` brkt `rmttoā//HzHxHy!8a r <!8$.N^Nuip_mrtproto: symbol not in namelist no multicast routing compiled into this system multicast routing protocol %u, unknown mfchashtbl: symbol not in namelist mfchash: symbol not in namelist viftable: symbol not in namelist Remote-Address Pkt_in Pkt_out Vif Thresh Limit Local-Address Virtual Interface Table %s%s %3u %3u %5u %-15.15s %-15.15s %6lu %7lu Virtual Interface Table is empty Traffic In-Vif Out-Vifs/Forw-ttl Hash Origin Mcastgroup Multicast Forwarding Cache %s%s %3u %-15.15s %-15.15s %7s %3u %u/%u Multicast Forwarding Cache is empty Total no. of entries in cache: %d NVTH?< .*. ..&.JfHzTa `HxHnn/a.O .nfHzQa `rg/Hzka x`~JfHza f`lJfHza T`ZJfHza B`H-y"F^r#"FHx @$//aBBZBD$BO tԊKG"JgxBnZ=D\I BJfHz`Hz~Hza |O /N//*B//.ZHza /*2/*."Bg /*&NX` < )/Hza O(RDrRԁKRGRER DclJf Hzxa ZXHxHnj/aHxHnf/aBBOJjg˾fbHxHnb njHpaO JbgI BCr-IVK(BJfHzHz9Hz^a |O HxN/.V/.baD/.zN// HzTN:.//.a./.~N.HzFNBDO,BZn0BBE42(g//Hz5a \O RDB0ZoHz"a BRX-nrbfPRfcJfHza X`/Hza  PHza #^"FL<,N^Numrtstat: symbol not in namelist multicast routing: %ld datagram%s with no route for origin %ld upcall%s made to mrouted %ld datagram%s with malformed tunnel options %ld datagram%s with no room for tunnel options %ld datagram%s arrived on wrong interface %ld datagram%s dropped due to upcall Q overflow %ld datagram%s dropped due to upcall socket overflow %ld datagram%s cleaned up by the cache %ld datagram%s dropped selectively by ratelimiter %ld datagram%s dropped - bucket Q overflow %ld datagram%s dropped - larger than bkt size NV/ / .&n fHzBa `LHxHn/E NO .fHz=a z`"rg/HzWa d` JfHzla R`Hx4Hn/ NHzsG(N/.E N//.HziNO.N//.Hz}N/.N//.HzNO.N//.HzN/.N//.HzNO.N//.HzN/.N//.HzNO.N//.HzN/.N//.Hz0NO.N//.HzNN/.N//.HziN$n&nN^Nu$NetBSD: ns.c,v 1.11 1998/07/12 03:20:14 mrg Exp $dropresponduseroutputinputspp??? Active NS connections (including servers)PCB%-8.8s (state)Foreign AddressLocal AddressSend-QRecv-QProto%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %8lx %-5.5s %6ld %6ld %-22.22s %-22.22s %d %sNVH?<..gZHz/. a 6dPJWIDHxTtԎ//I NHxT/Hy!a O $A!O gB*HxT//NO !gHzza d`J!f 9!f Jy!gHxHy"/9!N$9!O gJgHxdHy"g*HzHz 0n>/a.Hz0n>/HzNOJn4g*HzHz0n4/a.Hz0n4/HzNOJn6g*HzqHz0n6/a.Hz}0n6/Hz~NOJn8g*HzAHz0n8/a.HzM0n8/HzNNOJn:g*HzHz0n:/aR.Hz0n:/HzNOJn< .zJgHHxHn/aHzI(NO .g Hz/a.Hz/.HzNO .g Hz/a.Hz/.HzNO . g Hz/aٸ.Hz/. HzNO .xg Hz/aْ.Hz/.xHzNO .tg Hz/al.Hz/.tHzNOB|܎K XB&FE$$gJg HzNBX8//NPRrlzBB&FE$gJg HzNBX8//NPRrlL<|N^Nuin transitat destinationUnknown XNS error code 0%oNVH00&.". Gh$9hg"BCh K0A g RC $fJf,E oEz/HzHxtԎ/a RO` E $s Jg/ /a*.//HzGa >L N^NuNV n#iD#iH#iLHyiBaN^Nu$NetBSD: route.c,v 1.36.2.2 2000/01/21 00:17:37 he Exp $Routing tables rt_tables: symbol not in namelist Netmasks: NVH 8$.HzG(NXJ" fJigaJ`JfHzN`~HxHy"` /E NBO I"` gRHxtHn/NO JfJ" g6J"f.HzlN` 9"gf/adr#iaL/.aPRrlL|N^NuInternetXNSISOAppleTalkX.25 %s: Protocol Family %d: NV/". UteN0; NFFF&.FF>FFFFF6 < b`" < k` < o` < s` < }`BJg/Hzx`/Hzva $.N^NuAddress%-8.8s InterfaceMtuUseRefsFlagsGatewayDestination%-*.*s %-*.*s %-6.6s %6.6s%8.8s %6.6s %s NVJ" gHzHza PHzHzHzHzHzHzHxHxHzHxHxHza JN^NuNVH 0$.HxHy!x/G NE!xO c B@/ /N L N^Nu%-8.8lx => (root node)%sNVH 8$.G I"E"HxHy"/NO JTlJ" g/Hza P9"g*J" g < >Jg < 9/Hz~a b`Jig*Hx|Hy"L/NHy"La6OJ" gZa`THx,BB/9"a.aO 9"S#Sk y R`HyHx a P$f`2J" gJig/Hza avP$/9"a/aLN^Nu mask (%d)%6.6s %8.8lx : %8.8lx %d refs, mk = %8.8lx {(%d),%s , ->NVH?<&9"A"JPl6E"Jg$Hza HxBB/a.aO` %.16s%s expire %10lu%c recvpipe %10ld%c sendpipe %10ld%c ssthresh %10lu%c rtt %10ld%c rttvar %10ld%c NVH 8&nHn/+ IN.E N$P +g Hn/N.`HnBNXO.2k4/ //EnNHxHxB/+0N.NO. 2k4/ aR/+82k6/ HzE(NO +Pg/Hz`HzHzNPr +OgrL 9"@S#Sjm  g yR`Hy/a P + (.$. *J"FfpJglJfB/a$X gb g ` g`v` v`a "F f JfJgHx/a` @PJg$PJgHx/ Hy!a O `f$ |/Hz4HxHy!a AO`JDf(b/ |/Hz HxHy!a AZO`dJf.d/b/ |/HzHxHy!a A(O`2BDd/b/ |/HzHxHy!a @O//Hy!Ee:NX,</Hy!NXE!Hra L|N^Nurtstat: symbol not in namelist routing: %u bad routing redirect%s %u dynamically created route%s %u new gateway%s due to redirects %u destination%s found unreachable %u use%s of a wildcard route NV/ / .fHz a f`Hx Hn/aHz"G(N0n/E N/0n/Hz NO 0n/N/0n/Hz N0n/N/0n/HzNO 0n/N/0n/Hz!N0n/N/0n/Hz0N$n&nN^Nu*.%xH*.*any*%02x%02x%02x%02x%02x%02xH.%xH%xH.%s%sNVH80 n-hE$-h 6.Bn(. .fBJnf`HzpHx2Hy!a >v`Hx/ HyiG&NO Jf$< xE`Hx/ HyiNO Jf$< |E`hB./B./B./B./B./B/HzHxHy!XENA!XO$ 0f <!dcR 0g$JCg?BgHzHx Hy!HNO`B9!HHy!H//HzHx2Hy!NHy!ad <!L N^Nu0H.NV/ n-X-X-X-PBn-y!tHnaN$Hx/Hza VhJfV $.N^NuNV n` fn amRfN^NuTP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0)$NetBSD: unix.c,v 1.17.4.1 1999/08/20 05:00:54 cgd Exp $file table read error: %sNV`H <$.IbHy!xBHx/9"`a$OJf/9"`a/Hza `~"@X#!| y!xAA#!$IcZ*@G$Jj g> j f6Hx/ /aO Jf ", bphЂeJg // aPG$E$!eL<LN^Nuseqpacketrdmrawdgramstream#0Active UNIX domain sockets NextrefRefsConnInodeSend-QRecv-QTypeAddress%-8.8s %-6.6s %-6.6s %-6.6s %8.8s %8.8s %8.8s %8.8s Addr %8lx %-6.6s %6ld %6ld %8lx %8lx %8lx %8lx %.*sNV`H8&nHx4Hn/+E NO Jf .gHxjHnb/NO JgBJjLg%j O `n *"*IfЀ%@//a$P *"*/ /HxВ/NO+ g"Hzva ˮ @/Ba$La"Hxa zѪ+ f& *g/Hx /a O Jgn+ g6 *g0 R 0 g&fЀ%@//a6$ @ * R *LN^NuNV/ /$n . $.%@/a$B%B $.$nN^NuNVH80 n&n "P" Ҩ S&+9"qg$cnSxgfcbgRbcRR`ܲcJBSxg@c0"n . Bx JoBA"dJgRSJn|ld*YBE"p E"UlB.E@Gռ Є$jR/2./NPJl(`& |m$/2(/NJgB`A 0(L |N^NuNVH?<.. BB-y"qgBB"n*)()Jf"n")g "G )f"nJ m/ /.EN*@/./N @O`"n*Q"G Q"nJm&/ /.Ex-HN&@/./N(@O n`\"n&Q"G(Q"nJgHcBE"dJ gRbc*BE"dJ gRc`&A"n*i (@"G i $M,JlJlB"nJ gLEfJgBB/ / -HN& n`/ / N&PJg "nJ(gD`"nJ$gf/ / EN&// NO`k"n1HIl"n1H`$+I,`B+"D1IB,1I`JgJghcBBccB"EJ gRbcB"EJ gRbcc["n1H"D1fLc`JgHcccB"EJ gRbcB"EJ gRbcPc f`Jg$c8(n$n &nrfBE/ / aFJo"K L"""" L   $ K)X)X)P`& jR( , *ڀrl / //aO rl/ //anO $ Jg>Jg://aPJn"B D""""r؁ԁS`"B E""""rځԁS`Srg"B D""""r؁ԁQBCSd( & $ Jg"D B""""rԁ؁SfL|N^Nur%s: disorder on %s NVH8 (. BBo<$nHz/a2/aO Jf//9"qHza RO XRn LN^NuwNVH?<&n(. I`(BB-K`vB&K$LHzZ Ђ/3 a$PR~lHza,/a$/Hx/ ar/aBO Ђ/3 NXR~l nX RR lpЄ耰n|B,$L`Hz Ђ/3 a2$PR lpЄ~&nHza,/a$/// a/aBO&E` Ђ/3 NXR"lr҄~‡ n n'(R~mBo*L$KHz:/a*PRn/.// alBO o$K/aXRnL` ug ygC ~AF`|-Fߘ`-| |J*gR`"fHzJBHxa`O ` XXR&E$SJg / *n|NXHx0aX(@|)F BBBBB(B$B R{X*nxG"`Jf &E/aX*ntJ|g BA"`C" I&@CJ,fJgS .f6RBK"`J gBA"I&@A*ntJ,fJgSJfJg()H`|(B/ / a^$@O g ,g&E/`RJgBK"`J gBC" I&@C*ntJ,f .f6RBG"`J gBA"I*@A&ntJ,fJgS)I )HHx/ / a$@O Jg *E/aBX/ &n|NX`:|-Mߔ`J*fgXR&E-kߌ`|#"q`J*g R"q`xnHzpBHxaDO `^J*g R#"q`NnHzgBHxaO `4|#"q`*I/&n /Hz^Hy-IpNHx"npNOJgVRJf`LR-Jߌ`DHzBHxaO `0XR*D U"q` XR&D#"q`,.ߐ*n߈&D+lRߐXRmlJg/ aXA"q(PJg\JfNJfHJfBJ(f$Hx/ /NPO.HjLaUHxZ/Hna OJgHx//NO REIRnh L0*.&n 9"r,R#"rJfaRB/a 0#"DPl/Hza p` Hx Hy"r8Hx BaOJf/9"Da pp`BSBk'y"rl'y"rhA"r`'P &9"rL98"rpֹ"s'Crd"rt$L(L (.*. $.&.B///9"Da ///9"Da $Og@EN @|g,JnN @ `p/a "~ ሂ BBHBg `j j>f`"RJg.$0>"~ ሂ BBHB Ё` а>// a dPJf(J g j$0>` * j (* b`ڍJg* 0\&~"ቆ"B@H@`&0\Jgt jJg0$0>"~ ሂ BBHBg `z>fr"RGռJg.$0>"~ ሂ BBHB Ё` а>// NPJf$(J g j$0>` j а>`B(*cGռ&ք"RJ g2 j$0>"~ ሂ BBHB Ё` j а>// NPJl(`Jo*RbcF(J g2 j$0>"~ ሂ BBHB Ё` j а>`BL&.6 < F`6 < Q`. < Z`& < f` < q` < y` < ` < N^NuLANGUAGELANGNV/ HzEN @XJgJf:Hz]N @XJgJf(/. N @XJgJfHzN @JgJf < $nN^NuNV n"n Jf SN^NuNVHx/. /.a/a &@XJg4$$KK// / NO ~gf/ a X  g& gJg// a ͌`/ a `Hx$a f(@ E!LXg()D)C VID)@ g* +$|"ቄ"B@H@`$+Jf.J g* +$~"ቄ"B@H@`$+)BJ g.$+ "| ሂ BBHB Ё` Ы )@J g.$+"~ ሂ BBHB Ё` Ы)@J g* +$|"ቄ"B@H@`$+)BJ g.$+"~ ሂ BBHB Ё` Ы)@ `:Jg// a PE` / ENX/ N EB`/ a `RjhL ЄA* d <Ԁ//9jlNPJg#jl#jt"9jp$9jx$y"//ҹjl/a .O %. 9jpЃ#jp$9jx$y"//.йjl/a ~O %.ٹjpRjxR+ g/ a XJgHy @Hx/9jx/9"a 0 LP` /a tXJgFJfBB 9"g"9"̲jhg$HxHz8BaO #"#jh"/a$.N^NuNV n` cp`Rf/9la N n BN^NuNV//". й"XSe(/a t n g$"9"XLAJgԁ `B$.&.N^NufstatNVH<0&.$nJ"Xfa xl"#"Xfa !2| c"A I LAJg#"DG$ #"Hb."L<䈱f RbHy" (."9"D d$Ԃ#"D e$BE,& #"H"L<䈴f RbHn/a$PfBB 9"g,9"ܼjhg$HxHzXBaO #"#jh"/a й"D#"P/$y"T/ /a pVPO."P`\#"P"J"g #"P""9"T y"P fJg&/ Ђ/aPJ"g /9"TaX" 9"t#"tF̀gLJgH/9"( 9"g*9"jhg$HxHzBaقO #"#jh"/a p L. NV/ /$.g/9"$ 9"g"9"jhg$HxHzBaO #"#jh"/HyEFNPO."$ 9"g"9" jhg$HxHzyBaʀO #"#jh" /HyNO `/9"$ 9"$g"9"(jhg$HxHzNBa.O #"$#jh"(/E(NP 9",g"9"0jhg$HxHz2BaO #",#jh"0/NX 9"4g"9"8jhg$HxHzRBaɨO #"4#jh"8/NX 9" 9l"n $1 Hy"Hz/NPJVIĀ/NƀP 9l"R#lRn`Hy"Ba&PHya XrfLa U> @/ 9"g"y"jhg$HxHzܽBaO #"#jh"/aPpJ",f /a nNqMemory exhaustedNV//. /.a b$Pf HzaV $.N^NuNV//.a KJ$Xf HzaU $.N^NuNV//. /.a L$Pf HzzaU $.N^NuNV//$. n vr 0,$&N^NuNV//$. n vrꊃ,$&N^NuNV/". n t $N^NuNV n "npЈ ٰdN^NuNV npЈBdN^NuNV nr҈ F dN^NuNV n "npЈgB`dpN^NuNV//&.B` Б//aPJf\R y" "Hm"H"(m. )Ѐ#@o y" (//a y" PR А//a $.&.N^NuNVp#"(#"$# ",N^NuNV nL(rN^NuNV nL(rN^NuNV nL(rN^NuNV nL(rN^NuNV nL(rDN^NuNV nL(rN^NuNV nL(rN^NuNV nL(rN^NuNV nL(rhFN^NuNV nL(rN^NuNV nL(r N^NuNV/".Bt gt fp$N^Nu:blank:]:cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]NV/$./a *X"8b//9"4/a ЦJWID`B$.N^NuUnfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [NVH? , ,:4b , ,6 , , , ,` , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,bJf BJ"8f HzvaPXr` Jf "9"'f 9"<~g g  f`Jf"9"$f 9"8g gJo, y"4 )g`~l y"4 \f ()gJy"&lJo, y"4 |g`~l y"4 \f (|g g\JoV y"4  fH`dJg@9"&f4B"@#"< <`Jg9"%f#"< <`Jg9"%f#"< <``Jg9"%f#"< <`:Jg9"%f#"< <`Jg|9"%fp#"< <`JgV9"%fJ#"< <`$9"$ f(ff J"@f#"< <`Jf9"'f J"@f# "< < `^$9"$ fff J"@f# "< < `" 9"$ g @ftB"LB"HJ"8f < PVg/aMX y"4B$GR"4S"8 yL0gdE#"H` y"HAA#"HJ"8f < PVg|/aMjX y"4B$GR"4S"8 yL0f`~,g(Hz$aM0X~,fZ` y"LAA#"LJ"8f < PVg /aLX y"4B$GR"4S"8 yL0f` #"H"L9"&fF~\g HzaLXJ"8f < PVg/aLX y"4B$GR"4S"8~}g HzXaLdB"@# "< < `^ 9"$ f @f` 9"$ fJf g~#"@# "< < ` 9"$ @ fbR"D~#"@#"< <`$9"$  @ f* 9"DffS#"DB"@#"< <`JftԎ/a9"'g4J"8f < Pg:/aI(X y"4B$GR"4S"8J"8f < Pg/aHX y"4BR"4 9"8.S#"8~-f~f < Pg/aHX y"4BR"4 9"8.S#"8~]fS"4#"8`t~\f:9"'g0~f < Pgf/aHTX y"4BR"4S"8J"8f < Pg4/aH"X y"4BR"4S"8`$ mLGl// NPJ",g2 yL0g / y`g/ y0p/NPRl$D~]fxJg/aX9"&g /Hx a"PB"@/`bB"@J",gf yLgXzڎ$/a.// GN yLO 0g / y`/ y0p/NP/aB#"<` `R~la ~#"Hx a>O R"Hmⴹ"Ll&E$//aHxNHx NOR"LmN#"P`/aN#"PX"9"P zd.L d * R(1.*1.!!R`Fc * R(3>*3>!!`( * R(1.*1.!!R *"R T*0>RR -n~oD *"R U(0.*0.##RRm` *"R T(0>*0>##RRmL<XR"-nBGo m 0< o g o^Hn$,-0܂/EPN/ HnN m0"n )O>o//0>aZ m0!>P m0Hp(/.NP"-Rn|"nBB"Dl"$nHnQ./ZaO R"Dm/ HnNBBP"n$)o$ nX"P |?F~0‡gxRn|+F,B(Hxa+@$B/Hn/ a/.EN/.N/.NO.N/.N/N/.NL q/0./0.aO R t 0>*n "m0mR*nlHm*n J4g,B`Hnט h/0>/0>aHO R*n m$mB(.ׄ*nhHuHHx a>PJg4B*nt -o&$ nטX"P ~?F~0‡g|RnBBC" nh fR~d~e.B*nt -o $ nטX P~gzRnBBHnט/. *nHN-@LOJgBHxHnט/. N$@O`$nLJgHxBHnט/. *nHN*O`*.LB&nh"yLB," 3hg> A~ f *n+J(`*Cf~_f *n+`n *n+LR~dXR~dPRׄ..ׄהmBׄG..ׄהlE/PNXRׄ..ׄהm/.טN/.׈NL< N^NuNVH><(.$n *< oNB"j8o> j@ 0,g/a $ j@` jH 0,g/a $| jHB,X"j8RnB8(.&. &n*.J",g/a $Xf Hza)`XB",Bc.B(yL$y"B D4g `RRRb/ a/ //E6N/a / aB BBBB|#",/ //NO$`/ a/ //a/ a// aL|N^NuNVH 8&n/IN/+ NBP(l k$/0NXER(m/+$NBX"+o k0 0.g /NX"+Rn/+0NBX"+8o$ k@ 0,f kH 0,g /NX"+8Rn +Dg/NX +Hg/NX +Pg/NX +Lg/NX$kTJgG$*/*N/ NP$BJfLN^NuNVH00$.&. g/a TX$@`Jf`Jf `F/a 4&@XJfHja $@X`Hr/a $@PJgJg /Hsa L N^NuNV/.BarN^NuNVH8 $.&. /a ($BXJg/// a BO Jf `RJfBLN^NuNV .g/a >N^NuNV/ nJgJg$H/a BXJf$nN^NuNVH0<(n*n Jg/ aF*@XJf/ a` .B5BJg$L/ /a0PJfdXRJfBJg4G,$L// aPJfXR`/a YSXg$BJf  @Hh/ a (@Jg),B,`/ a X `BL< N^NuNVH<<$.(. JgJgHxa (@XJfB`|B$BJgr&<nKBI//`0pJgA* R&ERfRRJfd$I/Hi&CN"@PJfJg// / a(@O JgRRJf L<B$,2 B So`"l:$I1f S)@>$,2R B Sn`4 ,.-@&@JgHn/+a'l2'l2//+/+az/,./+/+a$kO JgB/+/*aPJf +l%@Jg +l%@$jJf&k Jft l.&h Jg( k"+ (l'@"l'A&k JfErFABYQBASd/ l./(ad$,BgBB"JE: B$ R o`BC: J"R o$,Bgr:ҌB$C A"Bl`A:"C ٰlBLN^NuNVH?< n*h2Jf . `Ļb~f/. h:I//. a `I:$h:-JB*-G-h> n E 到d,. ܮBB`>B(f.2|m*&nW$W$BSSfRlmeBB(B48(B4Xg(B4((B4HB(B4gvB(B4B(B4B(B4gHB(B4B(B4dn,. ܮB(B4 mXBB(B48f>(f02|m"&nW(W$DSSfRll `". lBL`&CI`l (.fJ( g^ ( .gL$K(P/a E Xd e//a "Pg6&// a&@RP/N @XJfB/a >bXJf `/a >P`/a BL $n(9"t*9"x,9l̺l`l\&$l*ȴo &"҈"r Ј% % Rn䜂`‘ȶo"҈"r Ј% % Rn؃`"9l "xѹ"t#"xL|N^NuPOSIXLY_CORRECTNV/ /$nt#l#"x#"tB"hHza n#"p -f t#"lR`$ +f B"lR`JgB"l`t#"l $.$nN^Nu--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument NVH?<(. ,.BlJlgJlf ///.a,~#l#lO y"hJgJfx 9l̰"xl#"x"tl#"t~"lfd$9"t"9"xgg/aX` g#"t 9l` 9l.R#lRl"D q -fJ(g#l"x 9l̰ghHz"D/1 a :PJfF 9l.R#l"9"x"tgRg/aX`R#"t#"x#l 9l̰f 9"t"xg"#l`"D q -f(f.J"lfp`z#lRlp`h*J* ~-G`BJg -WIDA#"hJg 9l"D q (-g$JgJ(f(I//aPJfBBz(y"h` =gRf$nJgL 9"h"L/ //a O Jf$$ "h/a Xg:Jf*J* `vERJfJgHJfBEe:Jlg" 9l"D/1 /HzHya vO/9"hNѹ"h`Jg< 9l.R#lEe:Jg~Jg R#l`JlgH"D q (-f//Hz{Hya O` /I/"D/HzHya O/9"hNѹ"h# lp?`~ffRl"D# lRl`LJlg"D/1 /HzQHya O/9"hNѹ"h# lp?"F :f8p:`2/9"hNѹ"hJg"n" mJg B` - `Jg, 9l"D q (-g y"hI//aPJfrJlgN 9l"D q (-f/9"h/HzHya ` /9"hI/"D/HzHya # -"hRlBlp?`Z y"hR"hI$C//aR&@ y"hPJfRlJg :f>Jlg*J"pg /"D/HzT` /"D/HzbHya #lp?` Wf< +;f2BBJg#l`\ 9l̰fFJlg/"D/HzHya #lt?"F :ft:I`v(J*~-G`"D# lRl&yl#"h` =gRf$nBJgL 9"h. ///a O Jf$$ "h/a bXgJf(J*`:|ERJfJgPJfJEe:Jlg" 9l"D/1 /HzgHya O/9"hNѹ"hRlp?`JgEe:JgHJg R#l`Jlg/"D/Hz*Hya vO/9"hNѹ"hp?`<~fT 9l̰l"D# lRl`6Jlg"D/1 /HzHya O/9"hNѹ"h`/9"hNѹ"hJg"n" lJg B` , `B"hpW` +:f y"h +:f Jg#lRl`BlB"h`dJg#l`H 9l̰f2Jlg/ "D/HzHya T#lt?"F :ft:`"D# lRlB"hI L 9"gHn*E/ / /aj&@OJg*E/ Hx / a (@O Jf(EdAS gSe*n"mHnBB/ / Hy"a0OJf``^*EHnBB// Hy"a&@OJgz/ Hx / a d(@O Jf(EdAS gSeJgB9"Hy"|$ ,/B// Hy"a-x$@OJm y""PJ" f J"(g`gJ"(gJmB"<"BJg3 yLCHf. 3_g&g Љ3 yLC8f 3_fJo0*AHy"|/ Hr/ Hm-Aa."@O".JnBgDR*AHy"|*B/ / // *AHm-Aa,$@ y""PO".JlBGbB`*n*cR* L Ћ/Hx /a Z"RJf" n dAS gSe Lg X-HJgB.*nu .+g .?fT.`S`0.I +gv@I ?gv"nfTJgJg`v gJ Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ V",ez"n(< JgB)$n2`)IJg*n-.Ig`pv.fjJ.gdd^JgB$n2`IJg*n- Ig`0v f*.f" EHh/ Hx $DN|O $ V`$ V EHh/ Hx*DNO &B`v g Ѐ)@A* c)|/,/N"(Pgng8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ V",ez/ & //p(< HJ.gp/$DNBVOJ.f`v g> Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ V",ez/ Hx/Hx*DNVO`* `v g Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`nB.&.ථg`v g Ѐ)@A* c)|/,/N"(Pglg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀"T( v"Ѓ",$et* $ Rd gX Ѐ)@A* c)|/,/N"(Pgβg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez"KR np ^fp"n ^f R-@"@-I`v g Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez Hx B/ a O +f.g+BB`"nJ.g -fV ]fn -fH" Ue$A [g6Ae [f*A ^g ]g/ /././.Hna`4 -fH )]g@gZRA Ѭ/ /././.HnN$OgL/.a `.g" [f :fgRB."ngBE-JB`$ .b.*n(R."n`B."@gRJg $n2 :f n ]g .谮fB.K-MB5 :fX n ]fLHz/ $<ռ$BNPJWD.Hzs/ NPJWD.Hze/ NPJWD.HzW/ NPJWD.HzI/ NPJWD.Hz;/ NPJWD.Hz-/ NPJWD.Hz/ NPJWD.Hz/ NPJWD.Hz/ NPJWD.Hz/ NPJWDHz/ NPJWD.Hz/ NPJgHz/ NPJgHz/ NPJgHz}/ NPJgrHzW/ NPJgdHz/ NPJgVHzq/ NPJgHHzW/ NPJg:HzO/ NPJg,Hz// NPJgHz/ NPJgHz/ NPJfx*ngR&.ථglBJ.g yLCf:J.g yLf&J.g v gv gJ.g( yL0g0  Ar€p$n2J.g yL0f@J.g yL0f*J.g yL0fJ.g" yL0g0 &r€p㨁3(J.g yL0f \f8gX-HJgn*n$nr.p` ]f .Rg+g BJ3fBSCSgJ3gB+`.f4`.f`.fr`Jnmf` . g` nf/.a ۊp`zRBvЃvUen0; N dZddddddd d xZdd dddddddddddddddddddd >dddddddd Ld dddddddddddddddddddd dddh.fRR"nf2 $@E //.a ڲ-@Pgx .Ѐ-@"n nC *n؛! n"nA"Jg R#`B n"nA& # n"nA#Ќ b n"nA T#`j g8 Ѐ)@A* c)|/,/N"(Pgg, &AJg .ހJg *ڀJg ,܀$ V",eBRBB-KB`.f JJf.f :`Jg`v g| Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez FHs/HxaO nJf.f /.a pp``E-J(.$A "T" & *@ֵH-C uHJgA.`B nA *$@ڲ( -r(B b IH.Ә.`v gF Ѐ)@A* c)|/,/N"(Pg켲g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ V",ez` 0.@f V.f ^`v g Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ V",ez/ KHh/.Hxa BVOJg KHh/Hxa O . `j g Ѐ)@A* c)|/,/N"(PgHg, &AJg .ހJg *ڀJg ,܀$ V",eVB-K` .g . g ". Ufg :|-M4|-J nK-M-nf Jf` RJg B$n2B yL0gTB"HBJlB*n$MK *BK -M ng"RJg $n2B1f ,f ng~RJg B*n5B yL0gTB"HBJlB$n*JE $BE -J ng"RJg *n5B1fJl-|`-nJmL nB$nn8Jf, \f d ng xRJg B*n5 }gJf/.a p ` Jf.f $.g* Jf`v g * Ѐ)@A* c)|/,/N"(Pg蠲g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ V",ez/ & //Hx a VO`x vlzx`v g x Ѐ)@A* c)|/,/N"(Pgg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ Є",ez/ /.$ Z(< rvl T` W//Hx$DN&B/ /.Hx/HxNZO(vl$.S/ EHh/ Hxa PZ/ /$K/ /Hx*DNZO$`-n ngBRJg B$n2Jf nc (\g`.f* `v g Ѐ)@A* c)|/,/N"(Pg|g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`.f0* `v gh Ѐ)@A* c)|/,/N"(Pg޲g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`>.f`v g Ѐ)@A* c)|/,/N"(PgBg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`.f`v g0 Ѐ)@A* c)|/,/N"(Pg䦲g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`.fZ`v g Ѐ)@A* c)|/,/N"(Pg g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`j.f`v g Ѐ)@A* c)|/,/N"(Pgng8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez`.f"`v g\ Ѐ)@A* c)|/,/N"(PgҲg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez `2.f`v g Ѐ)@A* c)|/,/N"(Pg6g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez `.fD.B.b/A// /(aOJf* `v g Ѐ)@A* c)|/,/N"(Pgdg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ T",ez`.f&Jg B*n5Jgx$FBE fh*F g`"n I *gR ^gL.g \f) +g4 ?g..g4.g {g`" \f ){f* `v g Ѐ)@A* c)|/,/N"(Pg4g8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ T",ezB, S`v g* Ѐ)@A* c)|/,/N"(Pgߠg8 &A .ؐЁ-@Jg .ހJg *ڀJg ,܀$ R",ez$FR ."@fߴJg KHh/Hxa*O Jg|/.a p`/.a p `/.a p`/.a p`/.a p `/.a p `p`/.a ɰp`p`.g~`h g Ѐ)@A* c)|/,/N"(Pg`g, &AJg .ހJg *ڀJg ,܀$ R",e/.a )KBL<(n&l$T* ڬvBO-O|-FBHxB/ a uNO ,@g f0$.JgIv*BS-M n$p,`R | |e00 NvF<Vpp<vvvvvNvj,`LB*`(B$SkBA("l^2 gSQBBSd`B nA( lB$SkBA("l^2 fSQBBSd` KC"  fRl`f KC"  gRl`B+ ItFASQBBSd,f@ `J,m `*IኄE(Jn g fR*IኄE( .g n fS-@`*IኄTԊc`".fD ymxK 刐e> 爟 //./a O -@g .Ѐ-@". n!R` p`X,JgbTB`ZT*IሀTJfFYx``X`8T`2a oB$E`$IBL<|N^NuNV"n n ".gpB !n!n`BBBBN^NuNV .//./././/. BB/.aN^NuNVH?<(n*.&.$. $l&l,.܅ ЂJmmJl$D`l$Jg$Jo T g f,fJnhtJg",f/ aX~f p`H `BBB`JoSR`RSJgܼoJ,mJo(n ."@` Ђn  B"n Jg4lNY*nu..J2xf6BBSl,3J2f `lBJ2fBSlJ2gք`BJgn *n5`*n 58Jg3`AJg@Jmf JgJ,l4/.(/.$//././/. / atO Jl~gJfpLJg6Jf(`,BBBBBBBBBJm .ЮmvdD <" r nX*nX(.X$nX"nX"$&DX&*XReJfJ g-n -nB B&n -K,.ܮ-F贮nԮ -B-n`-nԮ-B,.Jo&nn*n -n`*n-nܹfgBJg,. b &ncr,.ܼWDgR` &nܷVDJgHJgJgP|-F-Mvd<(nX$nX"nX nX"(Re`JgLJfH*n-nܻ e b-nvd$(nX$nX"nX nX"(ReJ g&n+fBfZ .R|d&n &`|&n &&n /EN'@ /N'@JgJgp&nB`H|fB .R&n c4&//+E*N'@ //+N'@JgdJg^&n "g2 k  k,.ܼf &M ` Ю &n "v$."nX(nX` "<" &n $kgf&n k|!<%<`PJg e e `Ю%<&n kJg  e e ` Ю!<XXR&n " c .̰bh&.̲c&n "k k|!<#<Re &nܷg,.&`& `B | F|e00 N<zz& R v vv  <JBJgLB`&nܷgX*n-nܻg&n3f8Sf`&,.ܼg&*n-nܻg fSfJfR6|-K b@&nA|XRc`&,.ܼg*n-nܻg&n+f"JgB&n 3 g`  g&nJ+lJgB&nJ3f `lJgfJfR|-F bB&nA|XRc`( ,WDf,.ܼg*n-nܻgJgB&n3`BB爰c4r‚gJWDBIJgJf|-F b&nA|XRc`|-LB&n |f/ /.HnaBIO B&ng&n 3 " f `&n 3&n'B&n' B&n3 B3 BB-F fBT-L`&B&ng&n 3 " f `&n 3&n'B&n' B&n3 Bg.Sg(B&n3 fBSg&n3 gJf.<-|`BAB&n3 g Sf NAd BB-HBR b d g `( f"r n(I዆ T-@JgT-@ n-HJl f (f (f &n3 gX3 BB,ЁcBBB "n n(.؀$n &DX e"XXR, Ђb .,R-F @R(I዆V-@$.("n" .Ȑ @RG* cX E ymxG 刐e 4 爟 //./a nO -@g  .Ѐ-@$.("n"b"bR (n$.Ԁ$n n!R . n&BX! R . n! RR"nc n!R . n! R . n֮! R . n! R` B&n 3\$<" g &n"3\(g $@BJg ecvBJg e SID$.䰃g$`,.ܼg *n-nܻg&.ܖ l&Jg/.// / a6O`// / a "tO Jf 4Jf&6|-K b&nA|XRcfg&n 3\g $n$g䴊ff`(Jg g`gJf&n+g` - f `4f&n+g` f&n  g ` v  f n&n+f` \Jg g`gJf <`,I዆T$.("n" .Ȑ @RG* cX E ymxG 刐eN 爟 //./a O -@g* .Ѐ-@$.("n"b"bV $.Ԁ(.؀$n n!R . n&DX! R . n&BX! RR"nc n!R . n! R . n֌! ` ,I዆T-L LdHJf,R-F @R d0Jg谮d& f B(B(Ҁ-A fB($.("n" .Ȑ @RG* cX E ymxG 刐e 爟 //./a O -@g .Ѐ-@$.("n"b"bV $.Ԁ(.؀$n n!R . n&DX! R . n&BX! RR"nc n!R . n! R . n֌! R . n! R`,I዆T"L Td] bV` \d f"@` Ѓ-@g g&n+gx  frv  g) @"H (f(fH)Y b> WIDB(爰c 0rƒg JWIDJf` f n( (f0B)B(l(1|g&D+ fVBJ)gB-DBBBZEBg&n+o"F fRRimB)fT`L fLBJ)g(*BBEA&E+of R)nB)g &DB+f|U ,g | ` .,S-F nU&@S-KS"0 ,S-F$0 bV "n$n .&@S-K n$ Y .,S-F n" .&@S-K n" YScB,I዆I8`t$.&"n" .Ȑ @RG( cX D ymxG 刐eH 爟 //./a O -@g$ .Ѐ-@$.&"n"b"bV $.Ԁ&.ր$n n!R . n&CX! R . n&BX! RR"nc n!R . n! R . nB R . nB R`$.&"n" .Ȑ @RG( c\ D ymxG 刐e. 爟 //./a jO -@g .Ѐ-@`p`$.&"n"b"bV $.Ԁ&.ր$n n!R . n&CX! R . n&BX! RR"nc n!R . n! R . nB R . nB R`<,I዆,JoSTCT`JfB,B,`,I዆,JgSCC`dX`,I዆TA8-H,I዆T nC`Jg g`gJg풻gAC" f&n` .Sf &n+`I 1WDf&n` .Sf &n+`I 1WDf`Jg g`gJggAC" f&n` .Sf &n+`I 1WDf&n` .Sf &n+`I 1WDf0`zC" f&n` .Sf &n+`I 1fJg g6`g,Jg$Af&n` .Sf &n+`I 1f`Jg f `gJg~AC" f&n` .Sf &n+`I 1fDf&n` .Sf &n+`I 1fbgZ`,.ܼg*n-nܻgC" f&n` .Sf &n+`I 1fJf|-F b&nA|XRc`x,.ܼgz*n-nܻgC" f&n` .Sf &n+`I 1g6Jf$|-F b&nA|XRcR`Va U8 .g$,S-FS n"0 g*A&@S-KS(p ,S-FS-p &@S-K.0 ".Ⱦb` $.Ԁ$n"n .,S-F n" Y .&@S-K n$ Y .,S-F n&B& YScBJgHdPB b d g `8 f2rA-H(I዆A8-HJg g` g e8b0-n`&JfpL g//HnaC͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@NVH?0&nBBFm|,E`Jڂ"FS~g>BA" ~(0 "9m|  0 #m|QBBSdHx@// N$O nlp`V n g>An" ~$~Fć(0 "9m| ~ 0 #m|f n F Fm|BL N^Nu$NetBSD: md5.c,v 1.2 1997/10/17 11:37:09 lukem Exp $MD5 ("%s") = %s NV/$./a c>Hn//a//Hza$.N^NuMD5 time trial. Digesting %d %d-byte blocks ... done Digest = %s Time = %ld seconds Speed = %ld bytes/second NVH0 *.BB&E`.؀ CS|g"BgԁQB@SdHx //NO Jnm n n B`pL|N^Nu$NetBSD: sum2.c,v 1.6 1997/10/17 11:37:23 lukem Exp $NVH> *.BB&E`؀ CS|gBԁQB@SdHx //NO Jnm0 "BAHA$ԁ B@H@ n Ԁ n B`pL|N^NuNV/./. /.aN^Nu@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $NetBSD: ifconfig.c,v 1.50.2.2 1999/06/18 17:42:19 perry Exp $instinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0ipdstbroadcastmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupinetAadlmu'%s' requires argumentSIOCDIFADDRSIOCAIFADDRSIOCSIFFLAGSNVH 8$.&n aB"|B",E`rЁr4e0; Njt~r#"`6r#",`,r#"`"r#"x`r#"|`r#"t`a#Hz/ /NO rf. 9DG J"xgJ",f J"|fJga#J",fJ"xg\E .rmrf/a#"Xf NJ"g y"(`9o]"B""aBaJna#>Hx/Hy"INSB"O Jo/a"#"XgXS y"Jf2yo\#"` 0h#"HxHy"Hy"NHy"aOJl Hxa$JfBBaBa y"Jf#oX"AoX("B""JoEmJg//aɖPJgEJfJf J"gE j JgB * f$rm/HzHxa=B/+NSX`//NP"*"SXJn|a J"4gZHxHy" y"/(N y"/(/(/9"a OJl"a & @r1fJ"l HzapXJmoDHxHy" y"/(N y"/(/(/9"a OJl HzGa$XJ"g.Hy"/< i/9"a pO JlHzHxaBadNqNV/ /$.EoXJg//aPJf ` EJfB$.$nN^NuNV/$. 9og:rg/9"a XBHx/a{#"l r#o`#o$.N^NusocketSIOCGIFFLAGS %sSIOCGIFMETRIC %sNVH 0$n/9"an$9"XlHzHxa/ /< i/GNO Jl/ Hzap`f0j#"0/ /< i/9"NO Jl/ HzqaB"P`#"/ /< i~/9"NJlB"`#"BL N^NuSIOCGIFCONFNVH0<&.-| IA)H/9"a 9"XlHzHxa/ /<i$/a lO JlHzHxaė˷lLK B$l* cG(`G Hx/ /NO Jf *f/ aXmL< N^NuNVH?$.N^NuSGIOCGIFMEDIA%s: no link type?NV/C"f~BBBBBBBBBBHxHy"tԎ/a//<(i6/9"a "OJla B @rgHzfHxal#"9"fHy"HzLHxa3$.N^NuSIOCSIFMEDIANVC"gp 9""#""9"8F#"HxHy"Hy"a`A" "Hh/< i5/9"a XOJlHzHxaN^Nuonly one `media' command may be issuedmay not issue `media' after `mediaopt' commandsNV//aX 9"gHzHxa2jrgHzHxa2V&9"$rFār/./arr㫄#"$.&.N^Nuonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'NVa 9"gHzHxa1gHzHxa1/.rF¹"/a,#"N^Nuonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'NVa 9"gHzHxa1gHzHxa0/.rF¹"/a#"8N^Nuonly one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %sNVH<*.a& 9"gHzvHxa08fHzHxa0$ 9"$rFā&rƁ(/aXXrd/HzwHxa/脃r㨄#"LNVAo (grF®gP (f < N^NuNVH8 .Ao"(g<$xFĄvƀCoPg pFf pf `P ("f < ,LN^Nuunknown %s media subtype: %sNV//&.$. //HyoaO rf//a.HzHxa,$.&.N^Nustrdup,unknown %s media option: %sNVH< *.B/. a.(XfHzHxa$E`2//Hyq`aHO rf//a|.HzHxa+BHzw/N$Pf/a {R L<&.*.BJ g/a/HzaO /a/(< ' K(Jg <  /HzNEq`OJgGqdIqcPgrF’ |FfR" gJ f>Jf Jg < -/Hz7NP/ Jg < /HzN O PPJf |g/HzNL<|N^Nu%s: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTflags metric %d mtu %d address:%c%02x%s: no media types?mallocSIOCGIFMEDIA media: status: activeno carrierinsertedno ringunknown supported %s media: NVH><$n(. Hy"HzI(NHzB09"2/Hz#a O 9"g /HzNP 9"g /Hz NP 9,S#Sk y R`HyHx a!PJglJohHzNBXo"B/p Jop:/HzNO RRn 9,S#Sk y R`HyHx a!PBBBBBBBBBBHxHy"tԎ/a//<(i6/9"ENOJm .fHy"Hz av&P`/a u*XfHzHxa|0-E//<(i6/9"NO JlHzHxa|HzNBHx/.KNO,.g 9,S#Sjm y R`HyHx a XP 9,S#Sjm y(R`HyHx(a PBB/.NO 9,S#Sjm y)R`HyHx)aP 9,S#Sk y R`HyHx aP.gHzNXpF|@g&m| g `0|`g`(.gHz`Hz`.gHz` Hz`HzNX 9,S#Sk y R`HyHx aPJ"|gjv ".BBoPG($EpFf6Jf/a/HzNxO Hz)NHxB/NHzNO".XRn| ֆ o/a tzX$y"Jg*Hx jNXJ",fh9"g^Hy"ah`REoXJgHGo]"GB jNXJ",f9"g jf Hy"aXEJfL<|N^NuSIOCGIFADDRSIOCGIFALIAS inet alias %s -> %s netmask 0x%x broadcast %sNVH0<(nJ"xfHxaNXJ"la {z @r+gHzHxaxG"$KBB"B"B"B"B"B"B"G"HxHy"/ KN/ /< i!/9"&<"CNOJl*EN @r1g0N @r/g$Hza0XHxE/ HkaO Jg$<" %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sNVH?EN @r1g N @r/fJgB"FB"DB"BB` HzraXHxHy"Hy""EN&L/+.<Z"GN/HzK(NHxHy"Hk"ENO$Hk/< i%/9""CNO Jl0a w @r1g HzHaDXB"FB"DB"BBE"h` E"h$9"3gpHy"/< i"/9""CNO Jl*a w @r1fB"FB"DB"BB` HzaXHxHy"Hy""EN/,"GN/HzNO/HzNP9"3gxHy"/< i#/9""CNO Jl*a w @r1fB"FB"DB"BB` HzaNXHxHy"Hy""ENO ,g/"GN/HzcNO 9"S#Sk y R`HyHx axLR`HyHx>a$LHxa gL$XfHzrHzoHxam/*HzHx/ar$%B$.$nN^NuNV/ /$nJf JWID`B jJg/ a8JgJft $.$nN^Nu|&=<>+-*/%:()NVH0 y"$PJfv`tX#"gZ*f$$< 1I//a&PJg:#"`D =f*J*f$ g` v`v`v `/ a#"v#"L N^Nusyntax errorNVHzHxaNqNV/ / 9"rf a, 9"`&r fENa$r "gaN `a$.$nN^NuNVH?<(< 1 DN&@r "ftԎzڎ.<MPK*,<h&a DN(@/ EN/ NB/,/a(4OJg Hx///a/HzWHxaB/Hx/+/ GNOJf8".Ђf.Jk"k$nB2 k/`"".ܒ/a`JfBa`Hza$@.N/ N/ FN&JO r "g, L 9DЃ#DJf 3 -@RDJfa$9DJ,f(Jg& 8/ Hza tHzHzHxacG,Hx@/.a2$@PJg BJf .İd(A-HJfadJf(/ a$. 8Hzla` $@PJfHz`Hxa Hy"////*Hna@&/a ]@OJl HxaJ"lHz/Hxa Jg^HxHnHx/</ENOJl HzarTXHxHnHx/</9"NOJl Hzar&X/.aBBBBX*<rGx(E$S|da d @| ` |"ꊃ,R|dx؎// Hxa ̕O &E|g-| ?BHn/a O XR|dJfa#^$lHzHHxaaBtHn/<f~/9"ENHn/<f~/N////aO(JfHx /a \PBa}NqNVH<0&n(. 2+0@8gp`^gVEN @BHx&//a _($O nN @z#VI` E///NO JoրJfBL fBB`Jg ~Jf8 9.S#Sk y R`HyHx aPBauNqusage: dmesg [-M core] [-N system] NVHzHya dHxauFNqNV/./. /.aN^Nu$NetBSD: compile.c,v 1.19 1998/12/19 22:12:11 christos Exp $NVHy"aD @BB/9"aa y"O JoA /a#"X 9"R/a#"N^Nuunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandNVH?<*.B,< ^HxHy""FN$@PJfJgHzHxa `\Jg:S ~b B yL0gRS ~cJg #gJgHx(< d&"DN(@"E"* ,?BI/HzanO Kr,JgtHx"DN)@// G XN$@O Jg(S ~bB yL0g RS ~c ,fvRJg(S ~bB yL0g RS ~ctHx"DN)@// N$@O Jg8S ~b.B yL0gRS ~b`B`BBJfHzHxa&PR&MggG fJfI/HzHxaO +l//I/HzxHxaO +~ e 0; NZpr"RJg(S ~bB yL0g RS ~cJ,\ID`(RJg(S ~bB yL0g RS ~c(& zڃJf`h,JfHzHxaP C& RJg(S ~bB yL0g RS ~c ;gvJg ,I/HzHxaO `RG WJg(S ~bB yL0g RS ~c \g,I/HzcHxaRO RJg(S ~bB yL0g RS ~cJg,I/Hz=HxaO N)@ `BRG YFJg(S ~bB yL0g RS ~cJfHzHxaPHz/ N)@ PJ"g ~)G`HxHx / a)@O ~fa TT @/am\// HzBaPO`RJg(S ~bB yL0g RS ~cJfHzq`Hz`>RJg(S ~bB yL0g RS ~cJfB `HzZ/ a )@ P`RG YFKe:$< ZJg(S ~bB yL0g RS ~cHz / N)@ / NO JfHzHxaTP/ "BNX`RG Q2K RF$< SJg \fHzHxaPHx "DN @)HHh/ N$@O JfHzHxaP/,HjN/,/"BN$@OJg(S ~bB yL0g RS ~c ;f`DHlHja $@PJg(S ~bB yL0g RS ~c ;fR* `JgHzIHxa6P`zL( [g&f C-I I`* nf  T` \f\R n`g`R . @JfzB$.$nN^NuNVH00&n$n S ^f^R ]f]RJg~C ]gr [fLIv.g v:gv=f6RRTI ]fg0IgDRRR ]f괁f` \f nf RRRRRf ]f R& R`BL N^NuRE error: %sNVH0 $n $//.a&Pg/a XJfB`THxa$XJg.B//a 0O Jg//a/HzHxaz R ("c#" L N^Nu123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionNVH?<$n(n f ` RBHsH/a)@ `B)y"&</K d&N,BX&F* ` \ffRI/HzaxPJg:\ItԀ lJgc/HzHxa4O o6)B`0 &g \f"\`gH fHzHxaPfr؋ $<"G ^ n փ/N,XHx$B/ NPJf0HzHxaBLHxHx / a'@ O vf a Kd @/adl// HzBa` .`I/HzHxNO R`4L< N^Nutransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthNVH80&ng \fHz4Hxa\P(// EN&@PJfHzI``&/HkN&@PJfHzP`BS ~bB yL0g RS ~c/Ee:N$/NPgHz1Hxa B`>Hxa "@pFASQB@Sd D$CJg BJf n L N^NuNVH><$</*< d&*EN(XI,< ^`jEH& LS ~b*B"yL1gRS ~c` \fRf (\gB`(  n Ԃ/*EN(XHx/ *FNPJfHk/a L<|N^Nuunterminated regular expressionexpected context addressNV/ / $n&n  9n 0lF $g6 /g `V \fPRHk/ ab$@PJfHz~Hxa :B `8r& R`.r&Hx Hn/ a#'@ .`HzbHxa B$n&nN^Nuwhitespace after %sNVH00$nB&JJg B yL g0văRJfBJg/. HzHxa O R// /a .a FrL N^Nuundefined label '%s'NVH 0$n$. g*Ire0; N6>6>~R"`L * fB`@/a%@XGf/* HzVHxa O /* NX` //*aJP$RfVL N^Nuduplicate label '%s'NVH08(nB l ` Ђ$ԁRBf vA"G $SJg:f. j/( /, azPJf/, HzHxa O $RJfHxa$@$%B%LB &L N^NuNVH00&nB KBg Ђ$ԁRBf vA"$p Jg.f" j/( / az PJf v%C *`$RJfBL N^Nuunused label '%s'NVH08BI"$\Jg4G$J f j/( HzHxa O / NX$BJfRplL N^Nu@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.10 1997/10/19 23:05:14 lukem Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %sNVH00&.$n a BG`rЁ | ]|r/e00 N`j~r#"`Jr#"/9$FHx` t/9$FBarP`$r#"`HzHyaHxa\Hz/ /NO rf 9DE J"fJf g/HxaXPaJg/a#"0Pf(a ?l @/aXt//9"Hz0BadO"y"0 )"S#ASj / aX` QBRrgJ/9"0/aLPJ"g BB`ZHn/9"0a$ y"0P( gREN @Jg"N @ `r#"B`r#"`p/aW//9"HzhBaO/. /.// aR"O`/9"0a y"8#"8X hJg f#("0# a"`D#"Hz/a=#"0Pf(a > @/aW //9"HzBaO"y"0 )"S#ASj / adX` QBRrgN/9"0/apL N^NuNV//$.&. Hx a @!B!CB"ysP"#sP$.&.N^NuNV/$.Hxa^ @B"ysT" #sT$.N^Nu$NetBSD: misc.c,v 1.6 1997/10/19 23:05:15 lukem Exp $%sNV//.a 3$Xfa < @/aU/HzBa $.N^NuNV/". . Jf/a`,//a 4$Pfa <| @/aU/HzBaz $.N^NuNVH8 (.&. 9"/ aXJg.-IvCe0; NrFtj$6NF y""9"Ge:n0 Ѐ#""@C //9"a`#"P y"$y"A$B(`&v#"`B"\Jg J"g/- Hz`v#"``J"`fG"\"SS/ Hx K"`Q/a$@O Jg$"S(S &/Hj/a 8pO `\HxE"D//*Hy"X`bG"@E"DA uJfHxHxHz/ -HNO nB//Hy"XNO`@Hx`BG"\//+Hy"@a ~O`/- Hz`/9"Xa $X`J"f(J"`f Hy/9"\Hx/9"XaROaHxHy"XaPJfBaRBB"``aBHy"Xa^PJfG"\C-IAtJ"fJ"`fHy/Hx/NOBaQJ"`f>Hy/9"\Hx/9"XaR@O`J"`fG"\(SS/ Hx $<"`Q"B/a$@O AtJg-S(B S& &Hy/Hx"B/NOJg&`G"\I-LAtJ"fJ"`fHy/Hx/NOahBaP y""9"Ge:n0 Ѐ#""@C //9"a:#"P y"$y"A$v%(% (/- N%(R"X`/ ab"X`J"gB"*m`J"`fG"\EvfDHxHx /- a+@O f&a 66 @/aO>//- HzBa0O//+/-NO gNa 5 @/aO//- HzBaO`$*<"@G"\E"DC-IAI-LtԎC-I.<"d(Y,<"h <"H"<"L(EJf.HxHxHzU/-@-A-Ha O n". ."n (n("B""`(n"G((D"F((n"E(&(@#"`"G(A""F""P(E("n$(@"B((A"n((D#"P`/HzbBa4L Ba(Or%A` //*a(P$Rf4$.$nN^NuNVH8&nB"$k(JJf"kJfp`"kJg+gP f A"\/HxB/(/)aJf`rf"9"g `J"g+r#"` f A"\/HxB/(/,aJf`PJgR"#"XJf8HnaoXRm/.HxafB"L N^Nur+wNVHzHx/. /.alN^NuwNV < "9# # g < /B/. /.a:N^Nuusage: %s remote-file [ local-file ] local: %sRETRNVH?<..BB .zfz-E n !htpzmHzHn HnaFO Jg*zmHzHn Hna$O Jgzl n /HzJ/9"a\` n *h((Hha՘XJfz#"߈B`$n &*JgJ"gr"jg(B yL0fBRg0gJfB"jE Jg*B(yL&y4gI RRf n !JJg#"߈N^NuEditing modeNVHzHy"/. /.a #"߈aN^NuPacket tracingNVHzHy"/. /.a#"߈N^Nuusage: %s [ on | off | bytecount ] mark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). NV/ / .$n rfJ# xWID## x`rg/HzV`XHz/*GNPJg^Hz/*NPJfB# x`NHx Hn/*aO Jo nJg/*Hz /9"aXr#"߈`r## r## x/9# xaH/Hz /9"EFNOJ# xg/9# Hz/9"NO /9"Hza 9# xgB"#"߈$n&nN^NuVerbose modeNVHzHy"ߴ/. /.a#"߈N^NuUse of PORT cmdsNVHzHy# X/. /.a#"߈N^NuProgress barNVHzHy"/. /.a#"߈J"gB# xN^NuInteractive modeNVHzHy"/. /.aZ#"߈N^Nuusage: %s [ on | off | gateserver [ port ] ] %s: bad gateport value. Disabling gate-ftp mode - no gate-ftp server defined. NVH 0$.$n rl /Hzh`rmJ"WID#"`rfHx//a`$Pf$|-HxR/(r/a%B.Hz6/a/OJg|+J# pg>/9"/au"y"P )"S#ASk Q R`/ Hx aPrlB/9# Hz//aO`B//aO /Hzar#"߈Hxa0JoHna*:Xf/HxN/HxNOrfHz_axr#"߈`B"߈L N^Nuusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: EOF received; login aborted. ACCT %sLogin failed. NV/ / n .rmHzXHn HnaO . n Urd/Hz9/9"a`/(HzJG ^NPrfrmHz4an n !@RX n /(HzNPrfmn/9"Hz as/9"aHy(HxOE/ aBOJfHz/9"anr#"߈`h/ aB2 n !J RX n /( HzN4|Prg/9"Hzas`"Jfrf n /( HzNr#"$n&nN^NuPWDPWD command not recognized, trying XPWD. XPWDNV/ /$9"ߴr#"ߴHzE ^NXrf" "߈f/9"HzardHzN#"ߴ$.$nN^NuLocal directory %s getcwdNV/Hx$/a&PJg/Hz/9"a` HzapB"߈$.N^Nudirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sNV/ n rmHzHn HnaO n Jgrl/Hzq/9"aJr#"߈`L/(HzmE ^NPrf4 "߈f(J"ߴg/9"HzFapP n /(Hz\N$nN^NuRMD %sRMD command not recognized, trying XRMD. XRMD %sNV/ n rmHzHn Hna0O n Jgrl/Hz/9"ahr#"߈`L/(HzlE ^NPrf4 "߈f(J"ߴg/9"HzEapP n /(Hz[N$nN^Nucommand line to sendusage: %s line-to-send NVrm:HzHn Hna`O Jf n /Hz/9"ar#"߈`/. /.Hz֎a|N^Nuarguments to SITE commandSITE NVrm:HzHn HnaO Jf n /HzA/9"a(r#"߈`/. /.HzaN^NuNVH<<*. (nHx/.G/ (< DNB.O rlj/ Ke:N$0|//,Hs( DN/NԀvOo:$KP b. (R"<//Hr( DNS/NԀORnB./ HzaUP` BaWnXrgL<0G"BA# \Jg|mRRJf$ngDA"*<# \BBJg""E|m0f to` RRJ0fJfRfB <"L |N^NuNmap off. mapoutusage: %s [mapin mapout] NV/ / .rf$B"/9"Hzag#""߈`rmHzHn HnaO Jgrl" n /Hz/9"ar#"߈`r#"#"߈Hx /9# GnN$@PJ"gR  g## Hx / N$@PBHx/9# Hy#GNO  fR  gHx/ Hy"N$n&nN^Nunmap: unbalanced brackets. NVH?<(.*DE#B8|zڎrABYQBASdJg"DJg&EAg $g \fPRRgN`n 0o@RRg2Ivր"R-R|܎Jg gRf"F#RR`gJgJgRJgRRJfxJf Jg"EB<,<"*FBE"gBG" [g$n $g` \fJgRR`RR $f\ yL08gLRR 0f DJgJf`I~Ї"EJg vIgرf`Jg ,gBI ]g \gj $f^ yL0(gNRRR 0f DJgHJf`>I~Ї"EJg. vC-Ig"nf` JgXRRRJgJ ,fvJg>8|SSJgHRRg*A ]g \f JgRRRRRRfJf/9"Hzhac| `RR ,g ]g^SS`B yL0gBRR 0f DJg4Jf`,I~Ї"EJg vIg رf`RRfB "FJg L"pzgPp `L"y" )*S#ESk Q R`/ Hx a|(Pf|.B.(G`2f|/B.G`$//G/ aB3(O R .~f<-KHna:XJg6 .g Hx// aB./.aиO/ a &,Xfp`0aer*@/a*/.<"GN$@PJghIռBHz $ P/NPJg@Hz/NPJg2*e*///aXO Jf/ad// aeXO /"GN$@XJf/a 8/ /. /aO fp U// HzHx$/a>`Hn/aWOJm>zz . @f|/Hn/9"aVPrfvHx/ aeBL< nJgg&H*KBEI %fgB yL0(Dgjgf0HDgZB& Rfgr`r`r҂B0fg"ACh`"ACh`"ACh "CVVV`RRfhBL<|N^Nuparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid port `%s' in %s `%s'parse_url: user `%s' pass `%s' host %s:%d path `%s' NVH?<&n$.*...(.,. Jg J gJgJgJgJg JgJ$fHzHxaqr"B""n$B"DB"GB"EB"FBQHxHz / ENO Jf^"BB"F2"`HxHz/ NO Jf\r"B""F2"`HxHz/ NO Jf ^r"B"`l/ /. HzaO "E g/ab"EBX"G g/aN"GBX"D g/a:"DBX"n$ g/a$"n$Bp`Jg|Hx// &<n"CN-@Pf/ K z2N(@`B$@Hja(@/ / / aB2Or"BfR/.K z2N"n$".@/ "CN$@PJg@r"BfB""E"B/ N"D"Hx:"E/"CN$@O JgB/ N"G"X`"D"Hx:"D/a,$@PJgJ JBHx Hn/a$SO b nJg/ /. / HzHaO`"F2J# pgR"n$ f < _/"FB0/"D f < _/"G f < _/"E f < _/Hz /9"akBL/a n>O Jf,nRf&/ a~// ".N҂/a,OJgVHzeHn:a"$@PJf .:g/aB:XJgHn6HnRHn2Hn.Hn*Hn&Hz /anO |gz&e* n2Jg"Jg n6JgRJgNHz/aXPJg/ a& n>O g yL0g / a-@XJg /.aXBHzBHn"/.au8-@Og ZJ"g"@ n"1 g fK-M"B1J"fJ"gJ# pg/.Hz/9"a\.O HxHz/.ENO JffHx Hn>*nHma"[I#"ߔ#"ߘO Jo n>JfJ# pg"//HzI/9"a[O`HxHzD/.NO Jf*nE$X/Hz./ GxN @O Jf*/Hz./ N @O Jf/Hz4/ N @O Jgz-ExJfHnXaz-@XJ# pgv|glHna/Hz/9"aZO`HHx Hz/.NO Jf**nE / a-@XJ# pg/ Hz`HxHz/.NO Jf@*nEHz/ aPJf^RJ# pgHz/9"aZZP`HxHz/.NO Jf:*nEJg /.a"X/ aN-@XJ# pgj/ Hz`PHxHz/.NO JfJ*nEJg /.aX/ a-@XJ# pg/ Hz/9"aYO `Jg/.aBX /n ,l4 g` gn 1g` g`Jg*nJfHz`> 9"˜R"˜zlHz,`$ 1f@J"ߴg/.Hz0/9"aXO /./././.a-@O`J"ߴg/.Hz/9"aXO /.a,-@X`/.Hz/9"aXO Jg*nJfHz`| fE".F .J` E".* ..JgFHz/9"aX8Hy(Hx HnXaOJg.XI y py f.BB/// /.aOJf/././/.a-@/aw/B/aYO g/aBX`Jg /.HzF`Hz[`B .-@Hze/. a.PJf -|`*n |fHHxHx aX.-@Hz+$. R/a-@Of/Hza`>-|f`0Hz/. a|-@Pf/. HzaV` -|Hy"0aXJg0 .g/.HxaWP .g/.Hx aW`Hy vHxaWr-@B# B#$(9# [IHxawHxa-@O`,"."Bӹ#$*9# ۀ## /./Hx/.a˘O"fJ# xglJ"fd`B"y" ),S#FSjm Q#R`/ Hx#aRP"9# [I؁׀ 9# "9#$l/9"aXJg"/.Jg o </Hx/.ax$-B"OfJg/.Hx/.aO JgHzv/.aPJf&Jg/.Hx/.aO JgHxHn>/.a$@Hz(/.>aOJfJ# pg, [I//Hz/9"aTOJfJ# xgJ"f$9# &9#$Jor"9# [Io4"y" )*@S#MSjm Q#R`/ Hx#aQ@P"y" )*S#ESk Q R`/ Hx aQP*n- gHz`Hxau*/.aD/.HxEFNO .g /.Hx NP fnzgfB$X/a-n`Bd/.*nNB//. acOf(Hna /a/Hz/9"aSPO*9# ,9#$D@l Ba{XB`PHz~aX`B/ Hzf`2/. Hzsar`(Hzt` Hz`Hz!aX`/.NHzaPa`Jg /.a` .|g /.aXJgJg /.*nNXJ g /. aX .Fg/apBFX .Jg/a\BJX .Ng/aHBNX .Tg/a4BTXJg /.aX .*g/aB*X ..g/aB.XJg /.aXJg /.aXJg /.aXJg /.a .L/9"Hza'`HxHy"0aۆNqInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'fetch_ftp: user `%s' pass `%s' host %s:%d path `%s' dir `%s' file `%s' *?[]{}%dCan't connect or login to host `%s'fetch_ftp: unknown transfer type %d dir `%s', nextpart `%s' cd%s/%sgetmgetNVH?<$.BBԛBBBn|zHxHz/aO JfHnHnHnHnHnHnHz:/a\O ~g$"nJgJg nJgJg nJgJf /Hz0`/ E߬N/.NP .gHx;/a$@PJgHz / GNPJfz`BHz/ NPJg4Hz/ NPJfHza8X`// Hza$O `B`6~-G/G z2N-@Hx:/aL$@O Jg B/ N-@X nJgJg(nJg8Jg4Hx// a$@Pf~f KI`JgB*J`*L~f Jg/ aގXJ# pgr n".Jf < _/ f < _/ f < _/B0./ f < _/ .f < _/ .f < _/Hz/9"aMO$BBJ# gH~f@JgJgHz(/ ay@PJVIDJgJgHz/ ay PJg~-GJ"g BBaXP-y-nBr0.g*?BgHzHx$/a-BBrO$9"JgB"v֎//a[#"P 9"g ~f./././.a`O Jf/.HzNaP`~g~g`BBaP`BBaP`/Hz6HxaP"JgJf~f"Hx// a&@PEܞJgB/ NX` 9# pg. AFf < _/ f < _/Hz/9"NOJg.-| -LBB# |/HxaLPJ# |g(KJffJgJf|`Jg"/ / HzHx$/a P*BO-| -MBJfJg($9"B"-| /Hxa#"`ZJ"ߤf$Hx// a $@PJg R#"ߤ`#"ߤ-y"ߤBJ#g/Hxa` /HxaP 9"߈$L<,QЀ~fB .g/aBX .g/aBX .g/aBX .g /aB L.%s %s netbsdFor more information, see http://www.netbsd.org/index.htmlNetBSD is a freely available and redistributable UNIX-like operating system.`%s' is an interesting topic. NV/ /$.HxHz/ENO Jf^\Hz/ENPJf HzHz`Hz /NPJfHzHz9Hz/9"aI`/Hzn/9"aHB`XHxHz /NO Jg0HxHz/NO JgJ#g"HxHz/NO JfBBB/a`/a~$.$nN^NuNV/ BHy"a8XJgJ"g BBa< .R`Hy >.HxEFNHy >LHx NO .lHx: ."n /1 ä́PJgjB"˜r#" ."n /1 ax$@X 9"ߤg$Hz/aזPJg y"ߤ |gB"ߤJo .$@R .R-@JgpJ"grg BBad $nN^Nu$NetBSD: ftp.c,v 1.41.2.1 1999/06/22 21:02:42 perry Exp $%s: %ssocketconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockoptNVH?<$.6.B".<""GBB"B"//apPJg,<""FHx/`^/a(@XJf&/9$Fa//HzaXr#"߈`,<""F l/, //aPO./Hy"œa˾B9"ÛO #"œ"߰BHx"FB/a`(O lHza0r#"߈`X3"`GN @rg*<lKJg lJgN @&"G/EZN$N @ /Hz$"EN lC)I/, /(/aO "G/N/Hz /9"aE"/NOBHx"FB/a(O l*Hz"ENr#"߈`Hz"ENr#"߈X`pHxHy"/awO Jm r-AHnHy"t/aO JlHzar#"߈XK`r-AHxHnHxB/GNOJl HzNaXHz[/EN## tHzI/N## OJ# tgJfHz-a&X`0J"ߴg/9"߰Hz /9"aCO BaXrl4 9# tKg /aߎX 9# g /a|Xr#"߈`>r-AHxHnHx/</NOJlJ# pg Hza 9"߰`/NBL PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUITNVH08&.BJ# pg/9"HzENt ԎHx/HzzG NOJf /9"Hzf`Hx/HzdNO Jf/9"HzVNP`///9"aFO "y" )"S#ASk Q R`/ Hx a>PJ# fHz ar#"߈B`HzpHxIFN$@Hn //9# aE/9# Hza/9# ar## O. X/a*PJWID/az&@XJgrgHxNX/ HxN L N^Nu%c%c%c421 Service not available, remote server has closed connection. %s:NVH?&P "߈g fa5pJg grg Hx*nNpЅ`"R`D/.Hxa=#"߈BL/. Hz/9"a9/.HxN/.HxN/.(nNz#"߈`n#"ߔ#"ߘatJg@/.HxEFN/.HxamOJ|g /.|Hx NP|#"߈`JHy"a2XJfL*9# # gHzh/.EռNPJgHzW/.NPJfp$9"|fB/9# /.a O `6~n0zm*|n$B/9# /9# (n8l/ a OJl/. Hza6`/9# /9# HzaO zfl-| !xJg/./.HzaO `/.HzdaPzgJ/.HxEFN/.HxakOJ|g /.|Hx NPJg/.(nN`/.xa-@XgHxaX@HxHx a7-@|O 9"zgnV|mN~nFa @BE`"[Iӹ#$*9# ۀ## $ //(n8l/ aH&@O JoԋJnJ# xgJ"g\J"ߔj|`R"y" )*S#ESjm Q#R`/ Hx#a3,P"9# [I$.&.ցՀ-B-C .".$9# &9#$l/9"aBXHx/ (n8l/ a(O n J# xgJ"g J"ߔj$9# &9#$Jor"9# [Io4"y" ),S#FSjm Q#R`/ Hx#a2RP"y" ).S#GSk Q R`/ Hx a2$PJl/. Hza~PJl~`L$n`V| fJ# xgJ"g J"ߔj .".,9# .9#$nj"y" ).S#GSjm Q#R`/ Hx#a1P/9"a}&9# [I .".҃т-@-AXJ# xfl(n, f ,*S)ESjm(n T R`/.Hx a1PB~߹#$*9# ۆ## ".(A ,*S)ESj m  g (n TR` //a0PB~߹#$*9# ۆ## *,S%FSj/.a:X(` RBR~f~J# xgJ"gJ"ߔj| .".,9# .9#$o4"y" ).S#GSjm Q#R`/ Hx#a0P"y" )(@S#LSk Q R`/ Hx a/P(n, g/. Hza6P(n, g.a @z g HzaX## ##$HxaSXJg /.(nNX/.a2Ba|/.HxEFN/.HxafOJ|g/.|Hx NP`/.HxEFN/.HxafrOJ|g /.|Hx NPJ# f ~#"߈` 9m/az#XJg /.àXBa|#"߈XJgJg /.(nNX,9# .9#$D@lBaY#"B# B# LTN^Nu receive aborted waiting for remote to finish abort. NVBa_B"B/9"HzaHxHy",aNqreceivedRETR./netin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sNVTH?<-n lBhBdB\"9# [I-@-A# ""B# B#$B#"ߔ#"ߘ-y"t-y"pHz/.atPJWID-@ .gZJ"ߴgRJgLJlg(Jf (nl -g/.lHzG/9"a/lO Jg/.Hz4/9"a/NO J"g .g/./.l/.a` B`BXBTBJ" f .VID-@Hy",aXJgpJ# gBaXJ# f 9m/az#XJXg/.XHxa/PJ\g/.\Hxac#t"#p"`HzdHx$<F(BN-@XHy )jHxK zjN-@\OJf"Hz./.laPJg(nl |gHx/.laPJl4Hx//.lat$@GN @PzgN @| g/.lHzaF`JgBHxlg < 0Jg .l` < 2/aJ&@PJg/Jl6/.lHz{a/.XHxa.b/.\Hxaa|#"߈` LJ"fVa\ @~ f@Hx/.la@PJl,/.lHza/.XHxa./.\Hxaax`XJ"g\a @| fN/.la-@lXf>`J"g2/.la-@lXf"/.XHx(BN/.\HxNz#"߈` .f|"gBBHxah`2 9"谹"g B/ahPB/.aH\#"ߔ#"ߘPa Jg(/.XHxa-&/.\Hxa`~#"߈` Hy",aXJf  .g* 9# "9# *g//HzaJO |f Jg/./.Hza(O ~g` /.HzaPzf vHzaR-@dXgJfHzp/.la .f@/. /.HzڋaO vgDBaXJ# g2Ba\`&BaRXJ"WID/ENXJ# fH .f:/. /.Hz'a\O vg BNXJ# gBaXHxN`J# gBaXJ"WID/aVXJ# gBBBBBBBB y# t4(HA vrꊃ,Hx /aؒPJn$l Hz;a}XJ"gv#"߈a BEJNBNPJ"gBaXHxaXJ"gv#"߈/.HxaL N^NuresetNVH00ABBBBBBBBG$H y# t4(H vrꊃ,B/ N$PlHza|v#"߈a ` Jg Ba~XJnL N^Nurunique: can't find unique file name. NVH8<$nHx// aԀ&@Bv1PJgBHxg < 0Jg ` < 2/K/N$PJg/Jl(/ Hz׳a|.B`/9"HzbaB`/ Hy"քa Hy"քa2&@"ք.O JfVEIRrdgRRB 9fv0`RBHy"քN$Pm" 0f .f1` RSSSJg <"քL<N^NuLost control connection for abort.%cABOR NVH80&nJ# f&HzadXJ"gx#"߈a `ZHxHxHxHzlHx&/aHxHx/ y# 0h/aHO(xg HzGazXHxHza/9# aB/9# a[ABBBBBBBB y# t4(HE"x„0| ꊁ,OJg0+H"„$ꈅ Hx / a PJn$l Hzaz2XJ"gx#"߈a Jg00+H"x„ 2 gHx/2k/ ahLO JnBEАNXxf ("߈fBNXBNL N^Nu@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.40.2.2 1999/06/25 01:15:32 cgd Exp $tcpftphttpftp_proxyhttp_proxyno_proxyFTPSERVERPORTbad $FTPSERVERPORT port number: %s (ignored)ftpgateTMPDIR/tmp/FTPMODEpassiveactivegateautounknown $FTPMODE '%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbAadefgino:pP:r:RtvV-bad port number: %s (ignored)bad retry value: %sRetrying in %d seconds... NVH08-n-n anHzXHzXadz @PJf 3"`3 "Hz0Hz4adR @PJf 3P"`3 "HzEN##Hz N##Hz N#"By# HzN$Og>Hx Hn/aD"SO b nJg/Hza`RP`3# Jy# f(HzHzac @PJf 3# `3 # v## #"#"#"߸#"ߐ#"B"ߴB"B"B"ߤB#B"B"B#(## al#"Hz^EN#"Xf # 5"HzKN$XgHzE/EռNPJfv#"߸B"ߐ``Hz)/NPJfB"߸B"ߐ`DHz/NPJf v#"`,Hz/NPJfv#"߸#"ߐ`/Hza^PHz/9EռNPJfv#"߸B"ߐ`Hz/9NPJfv#"HzaP @#"XgJf # 6>"J"g y"JfHza^xB"XHza$XgHz/aPJft`BG(2k/ EN#"#"6kf/ NPJgv#"ߴJfJ"g#"a+Jgv#"`vЃv5e0; Nl|XB"ߐB"߸`Pv#"`Dv"ߜR# p`2B"`(v#"`B# `B"`B"`#$F"ߤHzs/9$FaPJf#"`v#"߸B"ߐ`Hx Hn/9$FaA&"SO b nJg/9$FHz a\P`z3"`rHx Hn/9$Fa@##O o nJgJ/9$FHzHxa v##`,v#"`"v#"ߴ#"`B"ߴB"`a Hzm/./.aO vfBHxB/9"a) 9D"nC -IB# B"v#" v## Xan$Og /az(@XJfa/a(@XJg #s`/,/axPBE tvN/ Hxa=O JoHx:"n/apPJg/./.a^PJm/a}Hy"aXJgBa}Hy >.HxEFNHy >LHx N-y"n-Q-i-iBO`8J"fLB"/Hz=/9"a`/9#aOJ"fHn"nHiaP 9#fB#a7DHy"aXJWIDg"Hy >.HxEFNHy >LHx NO/ajtX`NqNVBa6HxHy"aNqNV/ Ba6fXJ"gb y# Jg&Hx0h/a/9# aFB# O 9m$Hx/an/9a^:r#O B"HxE )NXJ"g6 y# Jg&Hx0h/a /9# aB# O B"B"߬BN$nN^Nuftp> NV < ?$N^Nusorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. NV/ / JfxJ"fn"y" )"S#ASk Q R`L/ Hx a,P`:S-@A#0 0 fJgB0` f/9"Hz(aPE(`rgd *"S%ASj/ alX-@` RBPR .r g,`B"ߌHn/9"a&@PJg .fBBaoP ."S-AS 3 g c/9"Hz~a0P`JgE#0/./ / aUO .B2/ Hx Hn/9#(atOaJ#g y" P/a$@Xrf /9"Hz`fJfJHx: y" P/a PJf$ y"//9#/9"a6O Jg/9"Hz`J* gJ"f/9"HzaLP`jB# y"//9# jNPG FJ# g:J*g4"y" )"S#ASjm QR`/ HxaPfxJ"fHErGe:J"g"/9"a/aٮ/9"aMO Hy(HxHy#0NO Jf BBam"PHy#0N-@XfRHzHxEFNHzHx N$n&nN^NuNVH<0&nJfB`Z `VBBBE}X"RJg: Kf JgRgJf l$r& `fRE"RJfpzm L |g | g `.8|-LJf a| fHy"ڌ/GNPJgHy"ڌ/9"߰NPJgHx./9"߰a~$@PJgB// NPJf6 9"߰(J/ Hy"ڌ/aRTO Jf"߰A"ڌJ2gxHx./a~$@PJgt// NPJff$ /Hy"ڌ/aRO JfHA"ڌJ0(f:`$|gL|gVm|g$A`|g|gA`aJg(D glHy"ڌ/aLPJf`*D gHzN/a.PJg&Hn y"ڄ0h/aHXPJm f a2Jgx(nJfnHy"ڌa,X(X`ZHn y"ڄ0h/aH PJm fRaJg**GJf"Hy"ڌa, *X`J"f4` | g| f2"y"ڄ )(@S#LSj/ aFX"` QBR|f|g| f/9"HzaZ`> y"|gA I"E B`R|mB"y"ڄ )(@S#LSj/ aX"` QBR|g yL0g|g~B| g2"y"ڄ )(@S#LSj/ atX"` QBR|f|gN y"$<"Jf.#""`> y"AKI")R"`I" A K" 5 R+ y"AI"$t gTG"y"ڄ )*@S#MSj/ aX"` QBR|g  fJgfBRRff"/9"Hza`Hy"ڌHzNPaJg(| g"`aJf`HzENHz`h/9"ڄaV`/9"Hzad`H/9"Hz%aR`6/9"Hza@`$/9"Hza.`HzENHz6NXO."ڄapL/. Ee:N&@/NG$ /a&//. Hz//a-C |O /. HzE ^N$PrfZJfHza-@X/.HzN$Prf0:| nJfHza-@BX @Jg0/HzN$PrfJf .g/HzNPrgxHza*9"ߴXJg ~#"ߴ`B"ߴ(9# xB# xJgJ"WID/aʎX < ]XJg"BB///HzuaO < ]Jf 9"߈$L<,QЀ~g Jg&",JgJ"WID/aX#"ߴ## xHz/a@#`/a(O J`f"Jf/9"Hza `& ]`/9`HxHy"aO Jf/9`aB``Hx Hy"akN @JgB <"L N^Nu%s %s? Interactive mode: off. Prompting off for duration of %s. NV/ /$.J"gJ# f/. /Hz/9"EFN/9"a.Hy(HxHnaO JfB`V.I y00  @ngn @ag `4 @pf.B"/9"Hz,a`r## /Hz./9"Np$.$nN^Nu%s: not foundNV/ /$nJ# gzBBBBBBBBBBBtԎ/BHx/aOJfJf/Hza6\/aB` n/a\$/a~p$.$nN^NuSIZE %sNVH<(9"ߴtvJ# pfz#"ߴ/.Hza:PzfRHx Hy",ai2 @PJgHx HnHhaݬ$& ngh yL0fTtv`NJ gHJ# pf@/9"Hy",aP"y"P )*S#ESk Q R` / Hx a2#"ߴ "L#"#"#"#" .|lѹ".(߹" BahJg/./.aP//U\# 9"ߔ"9"ߘ//aP//T aJlBzdlvd/HzsHxK-M/ a$@tԹ"OJoD L"L<QЀHz9/Hz2/Hz,</Hra`O n"nB " ` |e(&~$ z "  @"ARB,<npBJfp /G3HI// /Hz[*</HraO,."-FA&n +" !@l SB@(A/a@$XJfHzHxa#N^NuNV-n BBBBr-AHnHn/.aJm .`pN^NuNV/./. /.aJN^Nu@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $NetBSD: route.c,v 1.30 1998/10/23 05:36:42 lukem Exp $botched keyword: %sUsage: %s [ -fnqv ] cmd [[ - ] args ] NV .g/HzaRP/9HzHya Hxa?Nqfnqvdt/dev/nullsocketNVH 0$.$n aXrmBaXG`rЁr7e0; Npzr## `:r##`0r## `&r## `r## `r##`BaXHz/ /NO rf$ 9DE aT##J# gBHxHza(`BHxHxa :## O J# lHzHxa fJ# gp `/a%XSr'e0; NPPPPznJ# g / HxaP/ /a P`&/ /a(|`a`/ /a` /ap`BL N^Nuroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) write to routing socket, got %d for rlen%-20.20s done NVH?<$.(n B# PB/9# aP~lX~f T -fHha$DUX~*e0; N`V~t~j~## P`8~## P`.~## P`$~## P`~## P`~ ## P/aX~-G~-GBB~-GBBBHnBHxtԎ/GFNOJlHzHxa .gp/a~$@XJfHzHxaBBHn/ Hx/NOJlHzHxa/Hz/a-`, ܮJ# g$HzG(NXJ# Pg(TR/ HzNPBcBBK(BJ# g 8// aP* g 9# Pg *KfJ#f|%E4// /9# a"B0O nFRJ# fVJ# g // a:P`BGJI &* g/ N`/ a.Hz`NBHsN/HzNNHzRNOB0b0Lr## Pr#h`r## Pr"#h`r ## Pr*#h`xr## Pr#h`dR#`ZC`RC`Jr## |`>r## `2R# `(r` C`C`C@`C`C`C`SG `f "RR/ aXBX/Hx N`SG `f "R/azXBX/HxN`SG `f "RR/ aTXBX/HxN`zSG `f "R/a.XBX/HxN`TSG `f "RR/ aXHnX/HxN*,`(SG `f "R/aXBX/HxNO R# `SIf "RR/ aX/ X/NP`"R/aX` 9#f,Hn/Hxa*`f(Hn/Hx`/aXJfDJ# f*Hz/aKSre&J# fHzHzHza HO B#`B/HxatO SJnJ# gzJ# gBrJgrJ#fr8|EK t`XN @r3g N @rf^r# PfT"DJgN nJgF$("BJg:X!B/( B/Hy# aO RN @B/"GI/N&@PJf"G gfBa/6N @$J# fp/ < Jg < //Hz%E(*JNO"DJg6/HzNPrl&Jf2r# Pf/9#a>/HzNO Jf HzNXJgHE(rgmrg ` r7g` < #` < 0` < =` /a-X/HzNLPrfa\`N*/ /a\p`"L<bM/HzNO p J*%lpL/ *B"L<bM/HzNO p *%gpL//**HztNO p *%gpL//*&HzXNO J.gBa䑪.Xp *%gpL//*.Hz0NO J# g/ az`\pF gRHzNHy/* HyNO 9.S#Sk y R`HyHx aLR` / Hx>aL N^NuNV/ /$.E Jg//a2"PJgPJf *$.$nN^Nu%s: inet %s; %s: atalk %d.%d; %s: link %s; %s: iso %s; %s: xns %s; af %p: %s; NV/ n$. B(Ure0; N"zf6T/(a//HzT`xB(/B0(//HzJa``/a//HzD`HHha//Hz>`4/( /(/(a//Hz/a^O`/a//Hz"aDOHyaf$.N^NuNVH?0$n&n B* ڀBBB/B/ aA`c b Ix؀`: b Ix؀`$ b Ix؀`Jf|`~R|e,0;*N$0..t&`t &ր`vBB`l>< L N^Nu$NetBSD: show.c,v 1.8 1998/10/23 05:36:43 lukem Exp $UGHRD M@dmCXLS1@2route-sysctl-estimate%ssysctl of routing tableRouting tables NVH0 r-Ar-ABBr-ABBBHnBHxv֎/EFNOJlHzra Hxa/.a$XfHzdHzaHxa < `" < ` < ` < ` < `BJg/Hzx`/Hzva$.N^Nulink#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s NVH?<&n..tԎ*BBB+rgm rg`rff B0+/HzxHx/a]O`" +fTB+I*< dJ+gBB//Hz ",*.*"$%A%B * g loʞJo// aPJf j "lA $<%H "[I&*%C|fB`nHz/ a>-@//*N(@&l0+O y#Jg?BgaX y#BJg ?Bgar7@Jg|`B# L0&n$n "+ l@$< J#g /aX#d0*gJ#g ?BgaXm2*J#g?BgaX`0fJfp`&9# y#2*JfJgB*Xz` B*X|$PJfJg **`**Jg ?BgaP`0n2"[I*+,+n bABJgBgR /fB`RnJWIDL |N^NuNV ./. //a$N^Nu%s NAME=%s DIRFILE%s=%s NVH0 $.$n /.Hzao/ a&nHza@/ /$/aOvd\#bT/ a$@/ aRPJg<(.*. GBBBBBBBBBBBBBn/I N$@0XJ#g ?BgaX@ @@WID < Jg < /Hz.K &N/a *O J#g,* fB`HzaXJf`2HzaXJ#fHxN-y|-| ܂|-F/ /a O g ##`HzNXJ#fHzaXJgl/9BHxa##O gX/9/HxaO JgJ#g0Hzy`"Hx/9#a jB#PJ#g HzpaXJ#fHzM`./9#N$@0XJ#g ?BgaX@ @@gHzDE &nNHzVaPJg$9#/9BHxa##O f Hz-N`//9HxaO f Hz N`a,|-| -B y#0p*Hh/ a y#Bp*/9#NO "y# y# 0g Hzag,`>/$/a ///9#E NOJf HzafHz=aB#B` y#SpJJg/9#Hz/aO f|gHz/9#/NO /9#N$@0*X"9#g?BgaX"9#R@Jg ?BgajX5@a 9# y#Rp /Hz1NP|g/Hz6aPJ#f HzNapL<|N^NuNV .BBBBBBBBBBBBBn|-| -@B-n -nHn/a.a DN^NuNVH<<&.". xdB 9#c6d0c*GBBBBBBBBBBBBBn|-| r-C-AB-n/K N$@0*XJ#g ?BgaXgZ0*$9#g?BgaX$9#" @Jg/aXxz:%D%E a0/ / I NPgp`6//$/a/N$@// aHOJg / / Nz`BL<K J#g /aX"n #@/.r/.n/ / NOg`"n )0f,.n..rD@lB#/)/)/.za/.zHzaWHza{vO~fv"n /)a&"C )") X$9#I(K g//a&P$9#,.nrJg //aP"C#@#A HzN|##N`H y#"(t[I.Lt&G$F$L( L& ( r..n-GnXjR|lpL<@N^NuPARTIALLY TRUNCATED INODE I=%uNVH?<"n )0f-i/ "nNXf `F-| "n/)/)aPJgp`" y#/(0"n/)a|*@S -y#$n,*0[I&E(FP l*$*t[I( LD Lր Lր&C(DR m"*t[I, Ld-F-G$ L(ծ LѮ .".*.,.c "n$)t`Fz|ݮ..߅-G/ / *.,.. ܌ۇ//B|ݮ..߅-GaO$J#g6 mC,& $Hc/a $Xb|/ /9#a|P("n f~ y# (top mC & EHcN$Jg<"n/)HzHx/a5//.a0OJg B|`B#Xb/ /9#a|*P -&ք$@cB$ gVJ#g /aFX"n#@J f / "nNX`/././. /.aOgz˭`"n )0f*.gB#/)/)/a/Hz&aSHz@awO|ft"n/)a$@ *"* X$9#g//anP$9#*.Jg //aNP%@%A Hza|##a~ϭp`"* , ..-GXbz˭pL cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock->fs_fpg %d NVH< "n* ڮ #\cp` y#((& LD8"L$(F L(Ё"ҨoRШlJ#g// Hz.E(N y# L("(FƁL(8ЃШ//HzN`x RLHl0J#gb// HzE(N y#/(/HzN`8&n(. +"+ J#g//a:"@$AP`"@$A y#v֨0[I"(0[I//* , ܃ۂ//aO$| dt (@Hl$aT$@XJg"Ly# y#A $ B BBzf%E`BB%D +"+ J#g //aP%A %@ /Hk(Hj$a2 9#O #Tf2|dІ##T//9#a##PfHzHxaoT 9# y#! R#L|N^Nucannot find inode %dNV/$."Ly# y# p Jg g PJf/HzHxan $.N^NuNV/ / J#gF 9# y#E Gb/NXY#d/9#N/9#NB#B#$n&nN^NuNV y#|N^NuDIRFILE%s %sCLEAR (CLEARED) NVH00&n$./+an$@XvfH0J#g ?BgaX@"< , @@f"< (//. HzaJ/+aOJ#fHzyanXvfNJ#g HzeaLXS#D/ / a*HxHy# / aO "y# ka`B#L N^NuNV/ / &n$k( J#g /aX fB* @HhHj/+,aòp`p$n&nN^NuNV/ / &n$k(Jgd/+,HjaPJfP J#g /aXrd6 J#g /aX#b J#g/az'@ p`p$n&nN^Nu I=%u OWNER=%s %u MODE=%o %s: SIZE=%qu MTIME=%12.12s %4.4s NVH00$./HzG(NPvd#b/aP$@HzN *pPJ#g /aX/a5 @XJg/Hzc` *pJ#g /aX/HzINP0J#g ?BgaX?BgHz+NPJ#gaGr/HzNP *"* J#g //a(P//HzN *O J#g/a-@X`-@Hnad @HhHhHzNL N^Nu%d %s I=%u BAD STATE %d TO BLKERRNV/ $n/ /. /.HzaGHza`O y#2 g n g` n m`&``2I/Hz{Hxajj$nN^NuNVH80"n&. Jg y# 1g B`^2|$I 9#c J# gRbg$ g$n @g ` g` y#` y#/ a&@HxavPJ#g /aX'@(f y#`XJ#g?BgatX`06HnaMF .XJ#g /a@X'@'@ '@ y#"(4[IJ#g //aP'@'A y# (4x J#g /aX'@hR#DaJ#g y#`x  L N^NuNV/ /$nBBBBBBBBBBBBBn|-| -J/ a$Hn/aHxHy# /axO a y#S#D$.$nN^Nu@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.33 1998/07/26 20:32:43 mycroft Exp $B:b:c:dfm:npybelenumberAlternate super block location: %d conversion levelmodebad mode to -m: %o** lost+found creation mode %o NVH88$.&n a#BE/ HxaPPJf-n-n/ HxatPasp#Xx##B#0I`xЄx7e0; Np (tHz/9$FEռNPJf##0`Hzo/9$FNPJf##0`B9#XHx /9$FHz@Hxba|##4/Hz3aJO`B9#XHx /9$FHz5HxcaF##tO`R#`|B9#X`tHx/9$FHzHxma"#@OA(Jg/HzHxae$/HzNP`(R9#B9#`R#`R9#B9#`ajHzX/ /NO xf< 9DG faBHxHxEFNPxgHy YHxNPJ#g(Hy YpHxNP`BBB/aC.aO SJnJ#hgv/aNq-%c flag requires a %sNV/$./.Hn/a8 nO gJg/. /.HzHxac$.N^Nustarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** NVH80$.J#gJgHy YHxa^P/9#/a=(PJ#gJ#g HzDa>4X/aGJXxg>JfJ#g0Hz"a=`"J#f4"y#C/ HzG(Na B`Z L)$)F"‚L)Ё*کBJg&֩o(2|$l^ y#d " 㨁0(RnR y#"H,m&( (S"(4ЁLA*ڀo&x$l^ y#d " 㨁0(RnEBBBBBBBBBBBBBn|-| BB#B#DaB y#`*Bl |d/ /alP y#RRmR"H,maB#L|N^NuPARTIALLY ALLOCATED INODE I=%uCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %u(%s) of size %qd bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUEINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%uNVH?<*n/ a$@0X$9#g?BgaRX$9#, *"* Jg//a(*P`(*JfHx0Hy#4Hj(G&NO Jf&Hx Hy#dHjXNO JfJRf .* gL/ Hza5Hz1aYO ~f&/ aHxHy# /aO a2`B# y#`6## y#&(0[I "҃тBSe @f.B"<d J#g//HzaO `tJ#f fzHzaXX~fh/ aJ$@ y#"(4[IXJ#g //aިP%@%A y#*(4[IJ#g/<aޠX`0<4a0&y#rҫ0[I&+0[I//҅ф//amO&l"J#g///HzaO` `g fR fJ#pg.gBr;eJhg/9#8 *(I J#g/aX&y#.+d/G/ /9#a`OJgHzOHxaVJ#gB3X/// / HzAa8O/ a$@// Hj(aBhNO&y#"+([Ib J(f>Jhf8 "BVч&~ lr҃vl +tL8S~m~ և"`6A( 0g*J#gFE(J#g /aX/Hz`TR~ lB~ևJoL$+tLB8RJn`X y#1nLHxat @XJf*B#Hza2Hz+aUPJfHxal!M #L##L @f..f y#` y#/ / a.P` y# y#`~ J#pg0*J#g ?BgatX @f 0*J#g ?BgaVX @g/ aߞ$@0*X$9#I g?Bga$X$9#Jg /aX%@pJ#g/<aX`p5@0*$9#g?BgaX$9#Jg /aڪX%@tJ#g/<aڜX`p5@NB#B#"n #M/ / a y# (4~ "n L)$#@$ *hPJ#g /a4X"n ")$g/ *hJ#g /aX// Hz:a0OJ#fHz_aSXJf`Hz=aX/ a0$@"n )$XI J#g /a٨X%@hN`d/ Hza/ y#HzaSrO ~f2 y#/ aHxHy# /aO a`B#Lf*/Hz/+a y#%h!B##O #g$RJf y#Jg "9#fp` RSJn L N^Nu$NetBSD: pass2.c,v 1.25 1998/10/23 01:13:33 thorpej Exp $ROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'NVDH?< y#(SI~e0; N \Hza)HzaMPJf Hxa>HxHxHxaO ~gRHzHxaLHza)HzG J^NPJg6HxaHxHxHxaɄO~gHz:HxaLXHziNXJf HxaB#`HzRa)Hz4G J^NPJg6HxaBHxHxHxaO~gHzHxaKHzNXJf Hxa8Hxa(@0X"9#g?BgaҞX"9#@@@Jg.O/azX8a`(I/HzHxaKhJ#g y#| y#`|Hy Hx/9#/9#aC-IHBBBBBBBBBBBBBn|-|  9# y#C , *HOc$U *gCN-ID(v&<*< ~e&Hz/*a%|HzaKTO `rg/*/*$L/aXfHx/*/Hza'BOJ#g HzaX *@%@J#fHzaJX~f:/*a<(@"*BXG J#g //aМP)@)A N`B#HxB/.DaHO J#gHx@aІX`0<@=@N"*BJ#g //a>P-@V-AZ/* Hj$/"CN-j-j/.H/.D"ENOXbrJ#|gB#|*y#ؼc$UJg$NHxB/aGbO (v&<*< J#gHx@aX`0<@=@N"*BJ#g //axP-@V-AZ/* Hj$/"CN-j-j/.H/"ENOXbZ*y#ؼc$U"*gJg *g~gG J^A JfB%AHz/*/*NHzSNOJg>Hz/*/*aX * y#Sp `RHz/*/*NHzNOJfB#`2 * y#Rp *Sp %j/*Hz`/*aO Xb.a"L<N^Nu.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%dNVH?<*n$m(BJ#pg\ J#g /aJXJgD J#g /a2X#d( J#g/a&@X`&@ y#`szJ$fJgHzHja8PJf J#g /aX"-gDHzZ/a -PJ#g /a˞X$HzaEX~f~`B#J#g0 *g&Hz/-ax|HzaE@O ~g`Hz/-aJ -PJ#g /aX-@J#g|`B.|APhJ#fJ#g.|@B.X~(PJg.Hz$ P/aPJg/Hzta B#P`F0*J#g ?Bga~XoHzna bB#X`0*J#g ?BgaFXB2 Ѐo&=j/Hn/ aHzgaDO`0*"9#g?BgaX"9#B6Jg./aX`0=@/Hn/ alR$ O J#g /aɜX y#Sp /B/ aAO J#g?BgaxX`05@HzaCNX~f~`B#~$m /-a2&@ +XJ#g /aX-@J#g|`B.|zzzJ#fJ#g.n@B.X~(PJ$fB*X&P0*J#g ?BgaȘXB2 ЄnL0*"9#g?BgarX"9#CJg ?BgaZX=@J#g?BgaBX`05@R$ J#g /aX y#Sp 0.J#g ?BgaX?BgB/ a?f5nO JgzHzHjaPJff J#g /aǮX'@J#gn *gdHz/-a|HzaAlO ~f~`4B#`* J#g /aHXJgHHz$ P/ăPJg2Hz/-/+an/Hzca~'GB#O`0*J#g ?BgaXo.Hz/-/+aHzDa~'GB#O`P +gJ'@Hzc/-/+a=j/Hn/ a0Hza@fO~f~`B#R$ gJ#g/aB y#Sp p`rJfp`h*"-$ b~ *.fv~lp f0Hz/-aBHzEa?⾀f~`B#p` *. f2Hz/-aBHz a?~f~`B#p`R+A$B J#g /ałX#cHzC//-aHzBa?T`@ "9#J#gJg/a<$X "9#`$~f *f*Jg/a$X "9#`$~gf *f^HzI J^Jg /aX//-a$O J#gHxaĺX`p$|HzN~f~`Jg/aĊ @X` @,9#0hSI~eL0; N zXX~$lHzB I J^G J#g /a,X//-NHzN&fRB#`@~$l6 J#g/a @X,9#` @ 0hf$< n`J#f$< v "9#I J^G /Jg /aàX//-NHzpN&O~g J#g /apX/a( X"9#g/aP&@X"9#`&@(y#"D0Jg ?Bga6X@r @@fr "9#g/a$X"9#`$"D0)Jg ?BgaX y#1* "9#`6 J#g /a¸X/a̰&@XJg~$l/-/-(/I WN O "9#g/ah$X "9#`$/Jg /aJX/$/N/HzV/HzxaFOJ#gHzlaX`Hza;&X~g,~$l'm "9#J#gJg/a&@X "9#`&@* y#`3grHzI J^G Jg /aX//-N O J#g/ap&@X`&@ y#`sHzNX~f~`B# "9#Jg/a. y#Sp `T "9#g/a$X "9#`$/Jg/a @X` @,9#0hI/HzGHxa9Jfp`Bp LXJgJ#g/ HzaJP$, L,PЀ @AA,&", ^E#A-#pJlpЁ"Ҁ(L,H&,|$LC( ^jpЂҀ ,$o ,.,`$LC( ^jpЂІҀB.,@ҬDч.,L΁)G~##lHx /9#/NO J#gHx//9#aEO *vp ,L~g ~gV`d:|T-pV-pR", ^jpЁ-pN'| U-PpJ~)GP`$'|T l2|A'HX ,L,PA $'B\", ^jpЁ B'H`J$n$",L,Ll| ^jpЁ'Hd`f",L,Ll| ^jpЁA ~'@h",$R*@K$ 'Bl",L, ,|.,`L@ ^jpЁԀ'Bd'| U-pV +\-pR.+TpR*kd-pN`/,LHzHxa/KZ-pFHxB/ a.$O 9#p"MAA2Jg~"C2R~lK-pBBBBB l$ ,8CD. ΀"G$Ho&v$ l^ y#d " 㨁0(RnB,l /, L,$,F"‚L,ЁЬ /Hy#a3/,/9#(/a|O O K4-p:E8K<-px@؋KD-p6KH-p2KL-p.KP-p*KT-p&&6pRֶpNK-p"K-p>J#g J#g `J#g//9#(a?P*E Ug Ug/Hza PJ#gHy#a?#,X ,$L(Ђ-p ,$pl-p*E'm'F ,,Sf",Ll7@`7l 6p'@J$o .Llx8'GpBB$B'l *E -(l'@(`B(*E -,l'@,`B,0k*E -0o'@0`B0*vp:BB*vpB*DB*vp6B*vp2B*vp.B*vp*B/B Ug 6p&` *vp&Е/a+O ~Lf'| U","A. Lx"Gʲo y#1SI~eX0; Nn RS l^" UgA ` Ы\ @" l^~‡ ",`~d/ 1I/Hz,Hxa,RRnnJfJv l^" UgA ` Ы\ @ l^~" 㨁S R~d-pplB&,8oj$6pԉ  y#dl^0I爔f>" ҉ l^$ UgA) ` Ы` @ l^~R&,8RnfR& L,8|Ll8" UgAT` ЫT @R L,|Ll$,LBL,L,ҀLB",PL(Ll(Ԃ UgK9 @` KXL8A: RPJ$o"+l$ Ll(8 l^A"牔`nJoj٫$ C al^" UgA ` Ы` @B" l^~‡ r8pFBHx/6p:Ā// NO ,8Ѷp*vppm4J$ol Kh"KlBvB(+po< gR`Jg ,$l"RB(+p ~gփ`BvRnJg ,$l"R.+$߮.+߮.+ ߮.+߮ .,p$,lF"‚*vp"$5 ԁHx//6p>aO JgHz-/6pFa9VPJgzHx/6p>/A-pNPO. /9#E#/ vpNO -#pJ#gHx//9#a0,.*. Bc:G(/HzNBPB$D/HzNPRRrlHzNXbL |N^Nu$NetBSD: fsutil.c,v 1.7 1998/07/30 17:41:03 thorpej Exp $NV## N^NuNV 9N^NuNV 9N^NuNVHn /.Hya$DHxa 9gHzayX 9Jg /9/9HziayHxa$.N^NuNVHn /.HxanN^NuNVHn /.BaXN^Nu%s (%s)NV/$.azX @/a`//Hza$.N^NuNVHn /.Hxa HxaNq%.*s/%sNV/ /$.Hx//ab$@PJgRHn/a2PJm@ . f. *rf&Hj// HzHx Hy#a* <#` $.$nN^Nu%.*s/r%sNV/$.Hx//a @PJg&Hh//HzHx Hy#a <#`B$.N^Nu/Can't stat root Can't stat %s %s is not a character device NVH< (.BBHnHzE RNPJlHzadHzaw`$*@//NPJl/a:/Hzsaw` .H `fL".XfR/a$Hn/NO Jm . f `H/Hz"awT`8 fJf/a$vX`f/a @XJg Jf$v`J LO JgB/E fN##Pl"ap @/a//Hzao`J#f/HzaoPJ9#fHx/N##Pl(z##J#g Hz|aXHzaopXJ#f Hzxao\XB#B#B9#x##B#B9###B#Hx ENI#*L(Hx N##Hx N##Hx N##OJgJ#g J#gJfHzHxa /9#BaD @PJg ((##8##`##8##HxE @NXJfJ#4f jJ#f `Hn>/9#/aO Jg FHzatXJg 4BjlB L.$.ZF"‚L.VЁЮF*.##4BNXJfRjmĶjm&HzDHz^HzwHzHzHzHzam` B/9#4HzaPJ#g y#(I/HzamP 9#gB y#(gHJg& < ,|J#g < ,z/Hzap` NJ#fJfHzaX y##$#\*(,L(X##$(0[I h0A zڀ[I$D&E y#*(t[I-D6-E:~*.:LT-E.-D* .6LѮ* .:LѮ*".*$..( * ڂف$D&EQBGSdzd\Hz+aHzFaPfB y#BHx //alVO J#gHx//9#a*O # y# (XJ#fHza`XzfDHx /9#/ahO J#gHx//9#a%O ## y# (HF"[I$(8&( Yg6BL<N^Nucannot allocate buffer poolNVH88B#B# y#/(0EN$XfHzHxaz##(B9#,r##B#$C###" y#(<LhH0rmxBof(J&IHxN$@ y#/(0N$PJgJfrm/. / / aP(`B vr₃1(`. vЀr䂃1(` v悃1(` Hz~a"$.&.N^NuNV/./. /.aN^Nu@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $NetBSD: sync.c,v 1.9 1997/11/05 21:19:04 cgd Exp $NVaaBaVdNqNV/./. /.aN^Nu$NetBSD: ar_io.c,v 1.13 1999/03/03 18:06:52 christos Exp $Failed open to read on %sFailed open to write on %scan not gzip while appendingFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s.failed to open directory .failed to open directory %sNVH80$. 9xvg /at8X 9\xg /a6Xv#\B#hB#B#BpB`B# 9xe40; N XJfB\# d#`|HxB/a#\O lb/HzIa:^ @/BaO`DJfv#\# e #`,HxHx/a#\O l/Hz`x#pJ#g/9\axX`vJ#gHzHxa7Jfv#\# e #`HHxHx/a#\O l,/Hza9 @/Ba"O`# ej#`` 9\lp`\Hy#/a.XPJl2/9#Hza9H @/Ba/9\a5v#\`: 9# @f2/9#HzBa/9\a4x#\Bpp` f*Hn/<@8m/9\a4O rJgr#``R `f v#``@HxBB/9\a4Ovxfa8t @xf v#``B`J`gBpxf 9####v#h`J#g 9xxfBHzab#xPJnHza7 @/Bavp` 9tvfB/9#a #tPJn"/9#Hzsa7 @/Ba.p`/apX 9`xeN0; N"" "#~##~`8vf 9#g###`"9#L S }bf##` # #xgv`g`xf>$9#g6"[I///9#@/9# (.*. 9hm 9`|gl |fD@l\HzHxax`>Jo@HxBB/9\E,NOJjHza*4 @/Hxaƺ`j |dlHzHxa`BBB///9\NOJjHza) @/Hxa``aJo##Jo&[I////aO,gHzHxaŐ`V=|////aμO-AHn/<m/9\a% O Jl(/.Hzja)8 @/Hxaž|#hp` |#hBL|N^NuUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blocksNVH?0B~hfF$E`րHx~//9\NO JnlHza' @/HxaĀ`=|~-G*],//<m/9\GNO JlHza' @/Hxa4`\=|~-G//<m/9\NO JlHza'n @/Hxa`Hx~$//9\EN(O nHza'. @/Hxaô`Hx~//9\NO JnlHza& @/HxaÀ`=|~-G//<m/9\NO JlHza& @/Hxa@`h~#hJg<"LDJgHzHxa”`B=|-A//<m/9\NO Jm `/.Hza&P @/HxapL N^NuUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again NVH <$/Hy#HxEGNO JlHza" @/BatO a B/HxNO JlHza" @/BaDO J#fJlgJ#f/9#0HzG8E#HaLJm y hHNJm y h NJmaJmJ#@g aJmpI `*/ av&Xm&n/ aXJg (*|**`J# fJ#gxHnHjaPJfdJ# g(J#g>(*8nJ**@n@(*|**`J#g(*@n"(*|**`v(*8n (*|**``/ au(XJmr/ ax &Xmbo,/ a(*|**,*tڪxن//aO `(J#fJ#gpHnHjaPJf\J#g>J#g (*8nB**@n8(*|**`(*@n"(*|**`(*8n (*|**`J#gHyHjax##P *zg| gQG Rxe / a;V`/ a>|&X(*|**,*tڪxن//NPJl / aXJ#gJ#g 9(S#Sk y R`HyHx aJPB#`/ a9$Xl,(*|**,*tڪxن//ah/ alO ` yHn// h@N&// a9pOJ#gFJ#g> 9(S#Sk y R`HyHx aPB#Jf(.*.,*tڪxن//aP/ NXJg y h(NBHy#Hxaa~a aqL|xN^NuUnable to open %s to readNVH<<$nz-E y((zf aJmaF.Jm y h,NJm y*h0J#@g aJm&. I `f/ aXJfVz-EJ# g/ a$XmDn4/ aGXJg/ alXJm" *zg z gz fDBB/* a-@O l,/* Hza @/Hxa/ aVO`/ at$$XG ,lHn/ N/ a*O `JnJ#g*/./ aCPJlHn/ N/ aO `ZJ#gHyHjadz##PR#/ N$XlHn/ NP`&vJo\J#gFJ#g> 9*S#Sk y R`HyHx aPB#Hn/ NP` yHn/./ hDN$Hn/ NOJ#gFJ#g> 9*S#Sk y R`HyHx aPB#JmL .".Jo//aPJm, *t"*xJo//arPJm / NXJgJg y h4Na(BHy#Hxaa8O J#gaaE(L<0G#H$yaJmfJg yg//HzlHxaP`B y hHNJm0 y h NJmJ# g aJm y$( g a(JmJ#g"/9#0Hz)Hyax##O E `\/ a|XJf*J# g/ aXJmBnJg/ aXJm.(+|*+,+tګxن//aPxg / NXJg y h(N$&aB//a PJm2J#g J#gHyHzaB#PHx/ aL |N^NuNVJ# g aJm&a dJm y hHNJm BHy#HaN^NuCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sNVH?<~-GE#HHx /9#D(/aI&(DO ,/g/RB,< zڎ//9#Da2PJl"/9#DHz&a @/HxaX` . @g/9#DHzHxa`jaHJm^a?JmRa`JmFJ#@g aHJm2a K `~-G/ ayXJfJ# f J#g */WID lHjHzHxa O `/Hr/ a9B.//a\BOJf>J# gJ#g".*8n$`J#g.*@oD` .*8o6/ a@>/ aPJm*/ am"Xmn/// apVO Jl/ aX`J#fJ#gF/HjaPJf4J#g J#g .*8n.*@o` .*8oJ#gHyHja~##PR#J#(g / a1`/ a2"Xn.J#gBJ#g8 9.S#Sj` *~g2~ g,Q~e / a0`/ a4"Xl/ aX`BB/* a-@O l,/* Hza  @/Hxa/ aXO`/ a.$XG ,lHn/ N/ a,O `r//./ a// a/:Hn/ NOJ#gFJ#g> 9.S#Sk y R`HyHx a\PB#/ NXJgBHy#Hxaanaa>jLJga>Jm&<B$FJfrgHzHxaxP// a PJoԀn&GJm4I$KB RK 刐/Hy#l t NPJl:XXJlJfrg\HzHxaxPSJo(/Hy#mHy#laj&<$BO `d&<$FB`VHzYHxa2pL (.*. Jol$9#p#tJn/9a:$Xlp`J&[I D"EEG "o B"C$ / B/9#tNչ#t"[IO JnBL|N^NuRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveNVH?8&n,. (nB(+H*+LJol 9#p#tJn/9a,XJm&[I D"EE "o B"C/ /9#t/N$O o"[Iչ#tJnJl /+ Hz`*.g /+ Hz`LHn/aPJl(/+ Hza @/Hxa`&()Ep`$.+8g/+ HzHxa()EBL|N^NuUnable to obtain block size for file %sActual crc does not match expected crc %sNVH?<*n(n -mH-mLGv-C.<BHn/ a,PJf .g2.`.$n$%n`/ HzNa @/BaO-G$nBB&.(.D@l"9#p#tJn a"o([I-C-D n"n " o C"D/ /HnHn/ /9#t/ a(6$OoRJ#g$"Sk$ y#tB܀R#tQBASd`չ#t"[I(.-D&.(.D@mH .g&-H(-LD@l// / a(O &.(.D@l$n(fp`*J#g &.fg/ Hz(HxaBL<`N^NuFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sNVH?<*n4|6|B. Xx-D8|$-P&-T*x"E*x "驰HfLT`\zʀ-Ev֎//.aPJf .g (@`/Hza @/Ba"O-L`ZJg//9#l/.a,O `$// HnHn//9#l/.a&,Of0"[I( * ځـ$D&E/9/9#l/. a$O nJl$//- HzZa @/Hxa~O`p " (-H*-Lg //- HzI`D//. aPJl/- HzTa @/Hxa,`*-8g//- HzN$HxHxHlFN"v 'BO .HxHlNN$HxHxHlVN"'B,HxHxHlfN'@O .HxHl^N$O xl&S&// aPJlp`pnЂxv /BE RNPJm + f (+HLf6B B+ +H"+LBBx "B'@t'Ax`@/ a$XJmz +H"+LBBx "B//NPJmH/ aLN^NuNVBr|N^NuNVr##agN^NuFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sNVH>8(nHxHx/ ah~O Jlp`h(RG ,UzdB,J#g2HxHx/ HxqE ۴NOJfHxHxHn/,`.HxHx/ HxqE ۴NOJfHxHxHnBNOJf ,|grm zg`| mzz nt ,H",L$&BB|$&B)Bt)CxHxHxHk6//a$OJgH/, Hz.`TBtBxHxHxHk6/, `BtBxHxHxHk6BNOJfHxHxHk/,NOJfHxHxHk/,NOJfHxHxHk/,$NOJfHxHxHk/,(NOJfHxHxHk./,8NOJfHxHxHk&/, NOJfhHxHxHk>a /NOJfHHxHxHkF", z ꨀ/NOJfHxHxHkNa -/NOJfHxHxHkV",, ꨀ/NOJfHxHxHk^/NOJfHxn/ E RNPJm0/HlNPJm"pnЄz| /BG 6NPJl /, Hzr`Z ,z g |gz fB`b|fZ/, Hl NPJm"p z |,[I//NPJl(/, HzEX`(a @&/+/+/aO JgJgp`//NPJfBL <&.,. *.$Cx /fRKn`BtԎ//I NPJgHx/aUPJl/x`|BG/J#-n .$L<,bMЀ-A`/HzaԌ @/BaqOHn/aPJl/Hza^ @/Hxap$.&.N^NuUnable to set file uid/gid of %sNV/$././. /aO JmB`/Hza @/Hxapvp$.N^NuCould not set permissions on %sNV/$.". //aXPJl/Hzaӈ @/Hxap$.N^NuFile seek on %sFailed write to file %sNVH?<,... &.*n(n&GJg f x(* .$l$*JgJ$K ЂcJf RcJgf,Hx*[I///aOJj /. HzR`"&J`B// /a`O g /. Hz>aҘ @/Hxaop` `V LHy(Hx E#/aO Jg4Hx /at @PC4 Jg6B`2 yJg (#f p`8# y##C4 B/9#xHy#N#O glB$nN^NuFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sNVH8&nJ#gB#aJm"I7 %s NVH88(nJ#fHlHzaǼ`rEG/ /*a=FP 9#8f *$$<  n $< `$Hj$a//Hx@v֎/aOJfB.B/*a$B/*aOJf < /Hx f < /Hx/* / HzG(N ,UOxe "* x 言/ /Hz` /*8/*4HzNO Hl/Hz$KN", QO xe Hl HzN`Hxf Hl HzN`6 9(S#Sk y R`HyHx ai PHyanLN^Nu%s%s %s NVH0 $n 9#8f&$*8BaS2X&< m &< `&Hj8a\//Hx@v֎/ahOJfB.tԎ//*a;THj//HzvaaL N^NuNV n"n "Үcg Rb`BbN^NuNV/ n"n "Ү$cgRbcB $N^NuNVH0 nB"H c g 0fRbvfpcx b"I$AE`4 b"I$@E` b4"I$@E$ b` 7nI$@E.$ c /n L N^NuNV/"."n Ю @Stf(bJ tt e0`WSg(c`"b"0Sg c`0ScpJfB$N^NuNVH> nBB"H c g 0fRb|fγc b$&|$ "(*IrҀ[I`f b$&|$ "(*IrҀ[I`, bf&|$ "(*IrҀ[IB цځـb``. 7n(څلڅلڅلIrҀ[Iځـc /n "L|N^NuNVH>(.*. "n Ю @S|fNb~$&BBr e0`WS&|$" (*,g6c`0b00S,g c`0Scp,fBL|N^Nu$NetBSD: getoldopt.c,v 1.7 1997/11/01 06:58:44 lukem Exp $%s: unknown option %c %s: %c argument missing NVH8 (.$n .B$FJ#f.rmp`## j -fR9#`r#DJ9#g// /a>`~ y#R#Jf S#p`bI//an @PJg :f //Hz+` (:f2 9Dn//Hz&Hyafp?`# $FR#D LN^Nu$NetBSD: options.c,v 1.19 1999/03/07 01:03:32 mycroft Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZustartarsv4crcsv4cpiocpiobcpiopaxNVH 0$.$n Hx//a&n##0Pg R##0`##0/9#0HzGռNPJf / /a`./9#0HzNPJf / /a `# #0/ /a,L N^Nuab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedNVH?<*.,. BB`~Ї~;e0; N".F^lzx .H&6FN~`~/9$Fah##Xn/9$FHz=HxaZaO `~##~`~##~`#$F#~`~##@~ `~##~@`~##(~F`p~##4B``B/9$FaXJlJ`B$y$F`I~eh0; N ```(```````D`LVB`T~##<####`8B`0~##<`&~##`I/Hz'HxaY|aO RfjB`B`/9$FaXJm|B`x~##B `h~## B@`X~##B`H`@-y$FHy HxLHxHyHna\#Og`/9$FHz{HxaXHyHz}INBOK rGFE/ELHznHyNO R~dHyHzTNNP`~### #`/9$Fa ####XD@m/9$FHzHxaXalO 9#"9#B.gHxHzHxaWa8O ` ~##`/9$FHzaTPJf ~#`/9$Fa#XlHzHxaWvaP`/9$Fa(jXJm`~##`x~##`jB#`^/9$Fa*XJmH`F/9$Fa&XJm0`.~##` ~##`~##`a$Hz&//a6O ~fH"fB(9n`f f~#( `L  f~` f~#(0 ` f~#(`aJg /a Na|Xf~f #, 9~e0; N jjD 9Do F/0 aXJla 9D.R#DRn`bDnHzBaUaPS F#\#D 9Do, F/0 aXJla 9D.R#DRnBLNHyHzTNHyHzNHyHzNO.HzTNHyHzqNHyHzqNHyHzNO.HzNHyHzNHyHzNHxa@Nqusage: tar -{txru}[cevfblmopwBHLPX014578] [tapefile] [blocksize] [exclude-file] file1 file2... NV/ HyHzENHyHzNHxa®Nqusage: cpio -i [-BcdfmrStuv] [ -C blksize ] [ -H header ] [ -I file ] [ pattern ... ] usage: cpio -o [-aABcLv] [ -C bufsize ] [ -H header ] [ -O file ] usage: cpio -p [ adlLmuv ] directory NV/ HyHz,ENHyHzUNHyHzhNHyHzNO.HzNHxaNq$NetBSD: pat_rep.c,v 1.9 1999/03/24 17:00:23 pk Exp $Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sNVH0<&.g"CJfHz4`T*CI// EnN&@PJggB"CI// N(@PJf /Hz`Hxa$@XJfHzHxaBRp`BB/ K/ a_O Jg*f.GFJfHzHxa@0tP/HzHyNO $jJfL N^NuPattern select out of memoryPattern list inconsistantNVH 0&n 9g$k" gJ#4f t B`*fJ#f jJf tfv`BHka$Xf"Hz`Hxa?\ jJg/B` jJg/B/agT%@ @S"R 0/fB0%Ht%B 'J`d$@AJg( g A$PJfJg / aB`0HzHxa>pL N^NuNVH8(nB 9fJ#4glpJ#gz``$@G*g * 3/f // /a""` Hj/ /aPO Jg$jJfJfJ#WID`$)JJ#fB`/ aVJmBp`pLN^NuNVH8$n&n (nB ?g0n Jg *g,`f [gJ`^gr#gT /fN(B`JJf`BR *gJg`/ / / aO JgRJf`gI// a$@PJf`gpLN^NuNVH> n*. B !WIDgRR ]gJCJfB`H -f"g ]gIm ImvTT`IfvRR ]fVI,L|N^NuNVH 0$nBJgDHx/ HjGZN$O fd *rg rgr fBHj Hj N$O f:J#@g0/ al$Xf& *rg rgr fHj Hj a L N^Nu ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s NVH0<(n/9#0HzG> %s%s >> %s >> %s NV\H?<,.B(y/$\/a8$B.^&G$^PJg(`KMP& X`jz Юdc cڰbgf// / ///a OJlJg/HzHxa8 ` .ldg"Jg,gB/Hx / /NOJgJf(lJfnJg`gRbBfJgJg^//HzHxa7`JJg>,g6J.^f/HzHya@hO `//HzHya@NOJ.^fp`Hx //a n BL<4N^NuNVH>8 n(. (n*.&.&n$E,(cg &f D`D \f: 0o 9nItԀm\ D` \f \g &fR`@Jk/&BG, 鈐&BG $ y"p,Jg g>"iJfHxa"@XJfHzHxa/`x" y#p,!,BL N^NuNV/ n$($ L<3>/"AC 鈐"AC " y pJg"fB` hJfp$N^NuUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryNVH00$nJgdJg`Jf HxHx=a6j#PfHzJ` #g< \f *#fR/ a$ @XJf/ HzKHxa.p`&(`Hx BHja&O a L<3>/&BG, 鈐&BG $ y"p,Jg g>"iJfHxa"@XJfHzHxa.`x" y#p,!,BL N^NuNV/ n$(( L<3>/"AC 鈐"AC " y pJg"fB` hJfp$N^NuEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]NVH <*n̗JgJfHzHxa,F`Hx// a$@PJgB MJgRC= c8 ,f Jf(HB`& .f Jf6|`/ HzHx$INO `\RJfHxav&@XJfHzxHxa+`8(nJfB`&L&/<G// a ( y$pLO Jgf`B/* /*/9aO**,* f/$//9a2O f// /a"O Jg$jJfJg ,8o %@B`p`Hxa|$@XJgHxBB/9a(%@%A OJk:// /9aO f%l8$ y%pL!LB`bHzd`Hz~a @/Hxa"6O `0Hza @/Hxa"`"Hz`Hz_Hxa!|PJg/ a}TpL|N^NuCannot allocate memory for interactive rename tableNVJfHxHxa(#PgB`HzHxa pN^NuNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryNVH80&.(.JfHzvBa ^B`Hx/. /a >$ y$p,O JgLGռ//NPJg$jJfJg./*/NPJg/*a{/aT%@PfHz)`ZHx az$@XJgD/GrN$Xg*/N%@Xg y%p,!,`L/a{X/ a{|XHzHxapL N^NuNVH 0$.&n JgJHx//a J y$p O Jg,//aPJfHx /*/a&`$jJfL N^NuCannot allocate memory for device mapping tableNVJfHxHx=a&^#PgB`HzHxapN^NuNV nHx/(a*JWIN^NuDevice map table out of memoryNVH0 &. yBJg L<3>/$BE, 鈐$BE $"p,Jgg"iJfJg `@J g8Hx ax"@XJg"B y#p,!,`HzTHxaBL N^NuUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNVH?<(n,. $.BBJgb", g6| ,(ȂgzF&ƂB/KN$@PJg& jJgjg hJfJgZ)h)D`JfJgHx/,N$@PJgJf*Jg&Hx awL @XJgB!l!j%H 9.R#~gGB/9NPJf 9"†fbHx/NPJf`R 9.R#~fJg4Hx av @XJg" !y!j%H)y)D`HlHz HxE=NHzKBNBL/"BC, 鈐"BC $$p,Jgfg$jJfJf`Hxau$@XJg@/.a$Xg&%D%C%n %n y%p,!,`/ auXHzHxaLN^NuNVH 8"n$. ypJgr L<3>/(AI 鈐(AI "&pJgDAfg A&PJfJg&  n n /EN/ NB`pLN^NuUnable to create temporary file for directory times: %sNV/rfdHzaXJf <Hz|/HzHx$/aX/a#Ol/HzlHxap` /avB$.N^NuUnable to store mode and times for directory: %sUnable to store mode and times for created directory: %sNVH0 $.$n 9mHxBB/ax.-@-AOJj/HzX`j". R-AB0* -@-j$-j-n///9ENO f"HxHn/9NO vfR#`/HzHxaL N^NuUnable to set mode and times for created directoriesNVH80Jm$B#dG,HxHxHx/9NOJkHxHn/9ENO xfB/././9NOJk/.$//9NO fhB/././9NOJkNJ#fJg/./aPJfJgB/././aOR#e/9av x#X#gHzHxaL N^NuNVH< n . (.Bz@lAp@$vƀBoCEcسbҮRnJgBC8EcسbҮLDL<&n(n Hx/ a^PJlp`K$ 'M z'E B$MJ,YgHxHlY/ aE/O Hxd/ / (< DNB Y&HxHxHld&< CN'@HxHx Hl|a$'@H'ALO .Hx Hl CN'@8'@0'@@B,HE(/ Hl)aOJlHxHxHlt CN$O B,(E$/ Hl aPJlHxHxHll CN$O B+ B BtBxB|BB,,Iz7e^0; NTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTpT|'Fk`z'Ek@|'F S B 0/f&B5` ,4fz'Ek`` |'Fk HxHxHlI CN$HxHxHlQ CN"z 'B,` ,2f|'Fk`z'Ek|'F HxdHlE / DN'@ B2`Hz'E +H"+L$&BB,<$&B'Bt'Cx'@|'AkBL<|N^NuUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %sNV H?<*n -|f /- Hz:`~g |g~ f|d d Hm Hz5`^$M// aj(@PJf / Hz9`B* &EBtBxg BHx/ Hne(< ږ"DN/O `HxBHnea&O (< ږHxd/ / "DNO "- S| e0; Npp\\\|5HxdBHkaO AIBBBBBBBBAQBBBBBBBBHxHx Hk|BaO`PAG~f|3`|4HxdBHkNPO.HxHkIa -/E~NOJfHxHxHkQ"-, ~ /NOJfHxHx Hk|BNO`|6HxdBHkaO AIBBBBBBBBAQBBBBBBBBHxHx Hk|BaO`b|f|2`|1HxdHm Hk"DNAIBBBBBBBBAQBBBBBBBBHxHx Hk|BavOJf`AG| f|7`|0HxdBHkNO AIBBBBBBBBAQBBBBBBBB$-H&-L "BB.< "B+@t+AxHxHx Hk|//aPOJg /- Hzk`THxHzHk&"CNHxHzkHk"CNHxHxHkd/-INO(Jf HxHxHkl/-$NOJfHxHxHkt/-(NOJfHxHx Hk/-8NOJfHx/-$a$Hx/-(a$@Hx Jf$<4/Hk "CNHx f <4/Hk)"DNO$.HxHkHx/ aXO.NOJf:Hx/agPJmHx BahJlp`( -| g~fB`/- Hz7HxaLpLO . 2 fS-@BtcPG *f.`0 ?f.`&I yLCf/aXJf\RRRe/(/(|/|^$(B4(/ NXJm.Hn/"GN$@PJf*BLNVH0 &. tԎJgr##,J#g J#gHyHx ajB#P/9#0Hz&HyEFN//.Hya OJo/a|/HzvHyNOHyHx aL N^NuNV/./. /.aN^Nu@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: ln.c,v 1.15 1998/07/28 05:31:25 mycroft Exp $fhns.%sNVH00$.$n aRG`Frhg(mr?g4rfg`,rngrsg`r##`r##`r##`a|Hz/ /NO rf 9DE <XJ#g <V##rgmJg `6rg`.a(HxHz=/a/a{B/*/a/a{&2,J#g@Hn/aPJf. . fa` @r /HzHxa^Hn/aPJg/HzHxa] . @gazBgHx//aO f/azZNq%s/%sNVH8(.$. J#fHn/aߔPJg/`JfPv֎//a߬PJf . @g*J#fZ//aJPJfJ . @f8Hx//aBPJf `R//HzVHx$/a4OJ#g/anXJla_ @rf// y#NPJg/Hzualp`BLN^NuUsage: %s [-fhns] file1 file2 %s [-fhns] file ... directory NV/9/9HzHyaHxaxNqNV/./. /.aN^Nu@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: chown.c,v 1.19 1999/03/14 19:36:05 kleink Exp $HLPRfhthe -L and -h options may not be specified together.%s%s: %sfts_readNVH88&.&n a:HzBaZXO.//aP @CJf"S## )oWID##BBI`rЁr)e0; NT\bhr|4|B`(t`"B`r##`r##`x`a6Hz/ /NO rfT 9DG rma vJ#g$JgvJgJgHzrHxarƁrIYJgIXr####J#g8Hx./EnN @PJfHx:/N @PJg B/aJX/a`/a:B/Hka&O fHzHzHxaY@BG7<`B0*6Sr e0; N8ZZ||J#fHx/ /aVO `|/*at//*HzaRtO`&/*at//*HzzaRztO`8Jg4/9#/9#/*NO JgJ#f/*Hz;ahtP/N$@XJf(a[ @JgHzHxaX@/atNqgroupNV/ $nJg$/ anX @Jf Hz/ ah` (##$nN^NuuserNV/ $nJg$/ a̞X @Jf Hz/ a(` (##$nN^Nu%s: invalid %s nameNVH0 &.EN @BHx Hn/a$N @O Jg/Hz/HxaW\ nJg/. /HzHxa| L N^Nu[owner][:group]usage: %s [-R [-H | -L | -P]] [-fh] %s file ... NV <FJ#g <G//9#HzHyazHxas\NqNV/./. /.aN^Nu@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount.c,v 1.45 1998/12/01 23:20:43 kenh Exp $unionsynchronoussympermroot file systemread-onlywith quotasnosuidnoexecnodevmtimenodevnocoredumpnoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.%s: unknown special file or file system.%s has unknown file system type.:@nfsr/var/run/mountd.pid%dsignal mountdNVH><$n&n a6BBBBK(<`|І|8e0; Nrtxzv`t|## `j`d y$FJgZ/Hna P`L|`FAX(JgHz'HxaZ/9$FN(@*y$FX``|##` |Ć`a Hz/ / "DNO |f 9DG B|g0mAWfJg`V|gAWf`DJgKW&<G`Hz/*GռNPJg Hz/*NPJgHz/*NPJfJ/ /*NPJf0*.-n(.$n&.$//.aw2PJf /.Hz"`-BBJg /HnaPJg / HnapPJfJfHz9HnaZPHz/.anPJf`J gHxHnaf$@PJfHz`BoxG HxZ& nHhL/.NO JfLHx nHh g0Jf&/*R <Sxf <S/HzcNO "FāE JfJg:/ SĀ <SJg <S/R <Sxf <S/HzNOJ(gDR <Sxf <S/HzN/,(a @O Jg/Hz`/,(HzNP <OxJg <S/NLN^NuNVH< *.HxHnaϜ(BPo@Eռ/$ nHhNPJg/ nHhLNPJf .Ђ`RnBL 9#lR##l/,a?/a)@ 9#lS##l 9#lP`(TJf 9#lR##lHxG4N(@/ a)@/a |$@HjN)@/ //a&y(#,#8O E /f& 9, @S##8Sja&@/R#vK``g .fJ*gIռJf" 9#8 @S##8Sja&@/B$ Jg" 9#8 @S##8Sja`&@JfHz/NPJgBEI J#8fa2&@B/ /9(NPJm . fx` N$@Jf> 9#lR##l/az6XJl( 9#lS##l 9#lf 9#gap`V Sʀ/a 9#lS##l 9#lXf 9#gaVJ gJ9Kg 9g /Hz)aBL<hhargument list too longsymbolic link loopremote access failednot enough memorytext busyread-only file systemno such device or addressdisk quota exceededfile system fullfile table overflowis a directorynot founddirectory nonexistentno such fileI/O errorpermission deniedinterruptederror %dNV/".$. CJQg0Qf0)Hg )`"PJQf/HzHx Hy#a` <#$.N^Nu$NetBSD: eval.c,v 1.45.2.1 1999/07/01 15:20:58 perry Exp $NV/ / ."n rl$irl y(#,#8G`@ 9#8"S##8Sjaz( @ ` 9#8"S##8Sjaz @Jf$[Jf 9#8"S##8Sjay @B"9,#8/awb$@X/ a 9#`$n&nN^NuNVH00$.v֎/axHx/aU`O GE\$<#`B/a6/NO BNXfaU/NL N^NuNode type = %d NV/ /$n$. Jf B#``r##H re0; N2P$$0:F^B/*aPJ# fn//*`Hx/*anPJ# fJ#`gr`>//*`Hx/*a>PJ# fJ#`g//*`p/*ajHx/*aB//*aaO`// aP`Hx/*aPJ# fJ#`f//*` * g//aP`/ aX`/ aX`x// axP`l/*/*aB#`P`THx/*a`PJ#`WID##``2/ a@X`(B// a`/HzaHyaO J#gafJ99gJ#`gf /9#`a$.$nN^NuNVH 0$nR#BG`2r f J#`f`J#`gvB/*N$9#`P 9# fHx/*NP 9# grf 9#d"S##dSJnB# `r# f 9#d"S##dSJnB# S###`L N^NuNVH 8(ntԎ/atG-K$lXJg0##`#Hx#Hn/ avO J# f$jJf kBB#`R#$nJgxB/*/, aB/,aO 9# gLrf 9#d"S##dSJnB# `(r# f$ 9#d"S##dSJnB# `$RJfS#/asLN^NuNVH00$n$. v֎/aspЎ-@##`#Hx//*ax&jO`@$kJg4 n/(/ a<(.B D$hJgR$RJf 9#lR##l//aY&t D$hPJgGI*<͜/*a X|'FXJg/ aXJl/NHzla D/(/*/ ENO Jf 9#lS##l 9#lKJf 9#ga:JoBNB/a/NOJm./.NX|gHxNHx/+a/+NOHx/*NPJm/NX$./+NX$RJf 9#lS##l 9#lf 9#ga DJfB 9#lR##l/a\##` 9#lS##l 9#lXf 9#gaTL<|N^NuNVH80$.&n x؎/aor&BBB XJf B#``B#`HnaXJl HzaHx/aW&Hx//aYOJfTB#l 9#ga/.ENXrgHxNHx/.a/.NOHx/axP/.a(t&'C X/ao0L N^NuPATH=%s: not found _NVLH<<*.-n NHnanKv-MzKn-Mr6|##`#B#`*E$mXJgB"jJgf cX _g yL8gBB yL` _g C(gR b =fHxHnn/ a `HxHnv/ aO $jJft nzB nrB*E/- aBV$nvXJg RV$RJf .V*@Hmal-@Z$nvXJg*nZXZ*$RJf*nZBBRJ9KgJ#lf JVo-mR .V刑ZJ9cgE (S$Sj HjalXA"P+R$nnJgXJg"9#Z/BHn j/(a$nN^NuNV/9#ha* 9#`N^NuNV/ /$n tl /*aqz`p"9#l Jo Rr cfr## ##dB$.$nN^NuNVrl n /(aq&` 9#rJ#lfr## r##dN^NuNVpN^NuNVBN^NuNV/ / rlVB9KB9QasD$y#hG0JgHx/*NP$RJfB"9#Z/al/". X/aRB$n&nN^Nu$NetBSD: exec.c,v 1.26 1998/07/28 11:41:54 mycroft Exp $%s: %sNVH<<&n*. &.Hx//aKPJg// /aa!v @(O `\xK`DSI\j4J#f,// /atEN @O rgN @rgN @(/NX/HnN$Pfrg r fr~`r`r#Hx/a//Hz/HxaNqNVH00&.$n /./ /aZGN @$O rf6aٶB/a?8/aa##4##P/ at0HxaN @ L N^NuNVH8<*n(. fB`$@$ ` %g Rg :f(J/aNA&X,oac0,n&y(g/ // a~O /// aB#P %fR##` :g Rf :fR*`B/aa@L<N^NurvNVH0 9#lR##lHx/N&@7|'J`/9#HzpNPJg /f mn`>pЎA R`(EN @rgN @rgN @*`// NPJmz . fJ#gJ/ aR/a\R/ aYB/N&@OJg kg/ /Hzap/ "FN` 9#lR##lHx/N&@Bk'B 9#lS##l 9#lPf\ 9#gTa`L/Hna$@PJfnJga.g Hx/a//HzF/9a6r"G"`B+ 2k(G()kL$K SJg00(fo @fn$/a"X`$H RJfXb 9#lS##l 9#lf 9#gaL N^NuNVH 8 9#lR##lI#$<# c6&L$TJg( jf&/*ar/ aP`&J$SJfXb 9#lS##l 9#lf 9#gaHLN^NuNVH08(n LIJg IԀJf L< !C҂ Ѐ 눐A#G,$SJg/ Hj aKPJg&J$RJfJ gjJff 9#lR##l/ av ր/aW&$@B5|B* / Hj a 9#lS##l 9#lOf 9#ga^##d L N^NuNV 9#lR##l y#d"P / aB 9#lS##l 9#lXf 9#gaN^NuNV/ / &n 9#lR##lHx/.a$@P jf /*aҮX5k%k 9#lS##l 9#lf 9#gaې$n&nN^NuNV/$. 9#lR##lr-A/. aL-@Hn/aR 9#lS##l 9#lO f 9#ga&$.N^NuNVB/.a @PJg hf/(aaB`pN^Nu is a shell keyword is an alias for %s a tracked alias for is%s %s is a shell function is a shell builtin not found NVH? $n(. ,ŕz ~f rg // a$@P n l gn gn`dJgn g g`J :g =g`6 f *@f *=gg 9#8"S##8Sk y#`$Jg4 9#8"S##8Sk y#`aT @##R# 9#8"S##8Sk y#`// a `/r‚/ y#l/(aN y#l##lO `/aX` 9#8"S##8S&rƁJm y#`aS @##R#Jg ~f =fzJgB`n 9#8"S##8Sk y#`aS @##R#`DL|N^NuHOMENVH08&n . $K&rƁg.r gn g` /g :fJfRfBJ*fHzav(@XJg`Hja @XJg(hJg`|JgFIA`g 0 f4 9#8"S##8Sk y#`aR @##R# 9#8"S##8Sk y#`aRr @##R#f ` L N^NuNVH00&.J#gG#|lvAJgL$H 9#lR##l y#t$/a$ 9#lS##l 9#lXf 9#gaӪJfA#xl B#`Y##&`Q##J#tgl y# PoT##Jf`H 9#lR##l P$/aZ y# 9#lS##l 9#lXf 9#ga y#Jf y#l!CL N^Numissing CTLARI (shouldn't happen)%dNVH> zʮ 9#8|maQ:## 9#8S##8 y#BR#(9($y#S gb" f g Hznand *f$D` fRR f *"WID$ /aXJg HjaXHja\/Hz0Hx / aOJfJfB R, //a"9# R##ѹ#8L|N^NuNV`H?<&y#, (K^eJ gK_f~ή 9#lR##l-y#t`-y#xd-y#|h-y#l*pE#$9#&9#l(90r#0"9,#8/aL(@Hn/.aݾ/ / aO%n`%nd%nh%nl####l#0(nBO`E`a @rfHx//.N$O mJor(ES-BgNJg,I 5 f 9#8"S##8SjaN&@ 9#8"S##8SjaNp&@ ."S-ASjJlbS  fR#8S $ g .m /aX .g /aX .g/a9B##`XJ fB" (//a O ## 9#lS##l 9#lf 9#gaϐL<8N^Nu%s null or %.*s: parameter %snot setNVH>8(n&. (.B*90&y#l|#0B/ aPJ#8faML @##` y#B#0##l 9(&@Jf&֮ .Y|e0; N: ,B/ /a ####8Jg` g/ HzHyaBaϐ <#g <d//HlHzaj$Kc<IB|F̄// /aO Jf"Jg fRRb`$CSbIIB|F̄// /aO JfSSJl&d" f Kc fRRbdSSc`$CSbI|F̄// /a*O JfSSJl&d" f Kc fRRbdSSc`:$K$Sc0|F̄// /aO JfNJg fRRbB`aF R" ####8"SgPڲf`H # J##,9#8 S##8SjaJ @##BR#S#R#8pL|N^NuNVH?<&n-n ~ϮI*~ʇ*KB c _gB yLf8|-LHx=/ a0&@RP.S-GJg~΃// a(P`"/ a$@XJg g JfB`xB,9#(Jg~gJgD~ή /~F΃// aXO ~ f 9#$(##չ#8`-|^eJl-|_f~ fJgRRJf`JgJgDI(n 4 f4 9#8.S##8Sk y#`aI2 @##R# 9#8(@S##8Sk y#`aH @##R#Jf~f JWIDJl @f~#g4|~ e0..(|t04zN*PPdddd/9#/a##P`Jg~F΃/(y#(/ /a"`Jf/. / a`Jg 9#8.S##8Sk y#`aH @##BR#$9#///(B(/ B/ a\OJf"9# R##ѹ#8/axX`JJf(///B/ / aOJg~Ƈ/aLX`RJf`a~gP2|I~fR`p|Ё~eJg y#l##l`~f gR`~fSJf L @##R# $@XJf`$y#4JgG^eJgG_fJgI 3 f4 9#8"S##8Sk y#`aB @##R# 9#8"S##8Sk y#`aB @##R#Jf`BJg< 9#8"S##8Sk y#`aBZ @##R#Jf`IrЁr e/a|"@XJo#n y#"$pJgG^eJgG_fJgI 3 f4 9#8"S##8Sk y#`aA @##R# 9#8"S##8Sk y#`aA @##R#Jf`6 9#8"S##8Sk y#`aAV @##R#JfLN^NuNVJ#fC#t`Hxa>:"@ y# ##B#n#n #n N^Nu NVH?<,... *FJ#g@I#t$F*, f9# f &9# X`&<&`&<#B Ьc(<n&J fRI// DNPJgJfI/Hzn DNPJVIDf JgK$M`xBHxa="@#M G&h&!IRXJfL`@&J fRI// DNPJgI/Hz DNPJfJgRB`$K` R Ьb*J`R ,Іb2(TJfJfJf2d.Hxa=8"@#M`Hxa=&"@#F G$h$!ILJg/ / a/9#aLO `""LA JgJf|// / aP 9#g/a+Jf|/L<B#tX 9#lS##l 9#lf 9#ga$.$nN^NuNV nJ#tg.JgJg/aZXJlpd/HxHn/9#taN^Nush: Can't set terminal type %s sh: Using dumb terminal settings. NV/ $n 9#g:Jg6/ Hx/aO Jg / Hz/9E'XNHz/9N$nN^Nuhistory not activemissing history argument:e:lnrsoption -%c expects argumentunknown option: -%ccalled recursively too many timesFCEDITEDITORed-16-1too many args/tmp/%s_shXXXXXXcan't create temporary file %scan't allocate stdio buffer for temp%5d %s %sNVtH>0-nz-n vBBBBBBJ#tf Hza|zf Hza|#$Cx#D`Hz/.v/.zaiO |gI|9e0; Nt~-y#<`D0|-H`:|-F`20|-H`(|-F` /9$CdHza/9$CdHza 9D nv/0 aXJf 9Dz nvA -HvJgJfJgBB.HnaXJg0BJ.g HnaQ8X##Hx/9#a-y#A## 9,R#R|lBB#HHz:aJfRJf2HxHzBE2N-@PfHxHz1N-@Pf-|^ n -fJ(f |-FBJf6Jzo0Hx= nv/a-@Pg nvXv-P @RBSz .z|g.mJg `J|zg6`@ <eJg <a"$<e`. nv" <eJf $` nv"$(` Hzza B/EN&@Hx/N(OJg( &@zozJgh 9#lR##lHz$/aR/aQ&Ol /Hz$aHz/a(-@~Pf/afHzanHxHn/9#tEN/ HxHn/9#tNO|gEJg$Jf/.HzapP/*anHX`zJg/././*aNO $`$*JgDJ#Hg /an X/a:XJ#Hg. 9#tg&/Hx Hn/aO`/.~/adPg/Hn/9#taO |f:Jg/.~a*,/.Ee:N&@$/NHsa*&//.Hz/aQXO.a 9#lS##l 9#lXf 9#ga$/a'/aMJf 9oS#J#HgB#HBL |XN^NuNVH <&n*n (n/ a$$y(#,#8X`bf@// / ahHyG&NHyNPJ#n&a##vfv####pF`$y# Jr gn Jg g$` g`R`& ###B`2| 9#&S##SJn #S##mdBBJfB yJfd"9#tg\JgX 9#lR##l/9#p v#fp /Hn/a6 9#lS##l 9#lOf 9#gaJ9ig/9#ag,/9N y#IR#L N^NuNVR#S#N^NuNV/ $n 9#lR##l yJgHxa#"@ y"!IX` p Ј!@"@#y##y##y# #Jgr ### # 9#lS##l 9#lf 9#ga$nN^NuNV y"h 9#lR##l##### # iJgrè y!QA g / a٠X 9#lS##l 9#lf 9#ga`N^NuCan't open %sOut of file descriptorsNV//&. 9#lR##lB/a`$Pl /Hzar m*Hx /a_z&/aO Jl Hza$/. /a2 9#lS##l 9#lPf 9#ga$.&.N^NuNV//&.$. HxHx/aEzO JgaHxa! y!@X y (o/aHX y!CJfHxa!v y!@B#B#r#$.&.N^NuNV/$. 9#lR##lJ gaZ##/a$#### yBr# 9#lS##l 9#lXf 9#ga$.N^NuNV y!y# !y#!y#!yHx4a @ r!ABB #N^NuNV/ $y 9#lR##l *m /a X *g/aX`a Jf#/ a y# ###### 9#lS##l 9#lXf 9#ga$nN^NuNV/$<#8g aBf$.N^NuNVa y (o/aJ yBN^Nu$NetBSD: jobs.c,v 1.29.2.2 1999/10/09 21:27:31 cgd Exp $sh: can't access tty; job control turned off NVH0 $.#gJ#DgJgHxaL## XmjvgVa|"9# gHx/aHla% @XJo#pn"y#A J1gC ` ,%fJ,gtB$y#$9#pSkJGGg0Jjo* j /(Hla$^PJgJg / Hza& EQBBSdJgj `t/ a$XJgX/ a$P"$y#X$9#pSk8(n*. (.,<\ 9#lR##la&rf. 9#lS##l 9#lf 9#gaHz|aJfn*9#DB#D$y#$9#pSk"GGg/ aXEQBBSdaD 9#lS##l 9#lf 9#gaxaRB#JgtrgnJ9QgfJgJlf ax$` l $/BaPJf&/Hxa@LPJla> @/Hza$HxE!NHxNP`TrfNHxE#hNHxNPJgJlf0aOJf&BaB/aQ8O Jg /Hz(aJgJ9KgHxE!NHxNHxN`J#Dg.rg(J9Qg JgJlf$` l $//aPrf3JgB0, $l Rl$r%A%|#J9KgJ#DgJg /a\%@X 9#lS##l 9#lf 9#ga L|N^Nutcsetpgrp failed, errno=%d NVH8 $na$ 9#lR##lJ*f/ Hxa&PJ*gJ*g&/Hxa>|PJlan @/HzaT *f, J#A   H@B@ЈDR@3#0jA  @ "( x*Jf$`xf$Jg pxgJgxf HxaDX *f/ aX 9#lS##l 9#lf 9#gar LN^Nu%d: %%%ld - core dumpedNVH?<$.EԬ`aV @xfHn/N.PxgJo 9#lR##lB$y# y#pAAcG-KIK -M|܊&Fx܄Jgv6|-K*n U$20 ЈcJC xg*f"* &n$2 xfB` xfBC A 0 ЂbJgPrJgr&nIg<Jg62y# J#A   H@B@ЈDRfBy#xٮIٮE y#pA"y#Ab 9#lS##l 9#lf 9#gaJ#DgJ9KgJ gH f@".&xFƄ xf$`Jg*$Jg"xgx g g/Hz/9aSO xfXJ#DgPJ9KgH(9# &n *KG" Ҁ Ҁ H@B@ҀD&AHkHz/9aSVO x m y 0,g /aQ(X`/Hz/9aS"O Jg HzHaQX"y )&@S#KSj/ aQBX y"P R` Q RHyaR&` Jg*E| L>>>&<<&<><<...???NV/ / &nJgV reF0; N0^`<H(<H66/+aHz.`/+aHz%` /+aHza/+a`$kJg/*alX g HzaX $@Jf`HzE؀N/+aP$jJf`/+`E p`"Ep`Ep`E` E`EBg+ 0AB.HnaXX/ E؀NpГXre+0AB.HnN`/+ a` Hz`Hza$n&nN^Nu}-+?=NVH0 BJ#o$n"y#` f`f f$$ 9#&S##SJo{I`< =fJgvăA(B`" f}`| bR#` 9#&S##SJn...`fh##L N^Nu$NetBSD: mail.c,v 1.12 1998/01/31 12:36:17 christos Exp $you have mailNVH?0(.g| ##J#g.zڎ/a X9#{f~ ޹#|-G` ,9#Z-FB#lHy#Hna"@PJgJg IpЎE RG#8RJf (/gajB(// NPJlBB$"3([I,...̒lVJfR 9#A%Hf <ن/NX"y ).S#GSj/ aKX y"P R` Q R'(R#m"##/aL pN^Nu@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.33 1999/03/27 13:46:19 christos Exp $/etc/profile.profileENVNVH 0a*BHnaxXJg 9#xrgmrg8`>rg$`6ak##r##DB#r-A`##``r##`r#xg" .gJ9KgJ#Df /9#`aH@a}TJ#xfF"y )&@S#KSj/ aI:X y"P R` Q RHyaJXHnaB#lX 9#ga* .rg| .rg .rg`G##aj##r##Da|FHna/. /.aO &n SJg& -f r-AHzOaXr-AHzLaXr-Aax$axf6ax$ax谂f$Hz!aT @XJgJgr-A/aXr-AJ9]gJ#g,BE/aD XRrd 9#g /aXJ9]fJ#fHxa.X/9#`aFNq Use "exit" to leave shell. NVH?8*.Bx؎/aZXEIKG\,<#`jaJfJ9EgHzaFXR`.Jg*J9Wf"~ WID# BB/a

a@X*y#Jf HzahHxHzaL6(@PJfI#Bt$y(#,#8*<,</`.gJg&  g 9#8 @S##8Sk`Jf \f6|`  gJg  fI// a6PJfBJg4 .\f,HxHnB ENO ~f 9#8 @S##8`dJgN.I// aPJg8J#8fap$@BB/9(/ FNt$y(#,#8O ` 9#8.S##8Sja,$@HxHnB ENO ~gxJ#8fa$@`I// aDPJg BS(dB/9(`BHy#/ FNO Jf L.`R 9#lR##lBaa y#XJg/aJX 9#lS##l 9#lf 9#gapDBN^NuNV/.arfB#&#!N^NuUsage: getopts optstring var [arg]NV . n rm Hzaprf 9#"`p ЈC#! f##&B#*BHy#*Hy#&//(/(aBN^NuOPTARGIllegal option -%c No arg for -%c option %dOPTINDNVH><,.(n*nx?BB&UJgfL TJfp`&PJg -fRJf RBztԎE/`PX( -fJ+gR ngtCE/JfT :fAB.B$ /Hz N&O `,I/HzHya/Hza@OtԎE/x?`R :fRf (:fJfd T&PJf\ :f&AB.BtԎ/HzE/N&x:O `rI/HzHya.Hzxa@px?OtԎE/`B TfX(B/ HzNE/N`BHznHz8E/NO RtԎ`pB*/HzCHx /a.^Hx@/Hz0NDB.B//. NO(gBBa-Hxam. L<|N^NuNo arg for -%c optionNV y#LJgf2"y# QJg" -fRJgX## -f J(fB`hR"n`JfI/Hz>amR :fRf ):f,Jf y# PX#JfI/HzVam##<##LIN^Nu$NetBSD: parser.c,v 1.42 1999/02/04 16:17:39 christos Exp ${tmh`XRMFB>70,"!""esac""case""}""{""done""do""for""until""while""fi""elif""else""then""if"wordredirection"`"";;"")""(""|""||""&&""&"";"newlineend of fileNID?<60,)$" !esaccase}{donedoforuntilwhilefielifelsethenif@=}-+?=NV .##gHx`BaXB#a @Jf <#`rgR#Hxa`BN^NuNVH<8(.z##$Jfa AJ0gB`BIGN$@N$zf:" Sze%E`(zfz$`Hx a @z !JB$HXJf& `Hx av @B!C!J&XzgmJg:`NzmHNzf a Jg`HR#z##$a .AJ0gT`(J#ga f`a`JgHxaR# LHxa2HxN$@r$%|QB B+J 9#SXrdR#r##$"CN$@rf4|`rf4|`HxaBa+@"CNXgb/ aHx *<"EN*@r *"CNXr gHx aHx"EN$@+Jr$%y#%y#p BX"CNrgr #fHz/9#anPJgHzmaEr##$"CN$<(Hx"EN(@$r (GX` &nX"DNHx"EN-@& nr !y#!y#p r##$X"DNrg nBr#gHxaB"BN)@ r##$"CN$@Xrgr gHx atr##$"CNEr#fBB`Hx al*@r*BaX+@B"CNPrgHxaBa4*@"CNXrgHxa`JfHxaR#/./a*@P`XHxa$y#\"F", XaF"CNr gR#"FBJg$rgHx a޸$@r$%M*JX+nJf `Hxaޒ$@r$%MLXJg/9#a^XJgrOlHzPaj/9#a'y#B 9#f##`, @ f `"rЁreB/9#/ a`a\%@ $n&nN^NuNVH <$y#Jg$<_fKVI ^G##J#gHxaB#X/* /* j rf <`g/N/NHxN @r B!y#!y#p "j#H O 9#$@JfL<N^NuNVa R#N^NuNVH80(9#$GN$ 9#$grfB#$rfa N$rg`B#$r fJ#fE& RJg&"y#f/ /àPJgHX  @JfHx/9#aR$@PJg8/ /*a\./*a##$O `J" $At Ԋ##rf##$`B#$ L N^NuNVH 0J#g:B# 9#`r##p`r##p`r ##p `J#gHxagrf.r%Aa&r>fr$`r&fr$`r`|BIVN&rgP`THxN$@BXr$HxN @##!JNXr-f y#r!A `" y#B `r$`r$` r$aDJg IrҀ%A##\`B yLf,Abi08fS#8*nLRL$a`r(far(gaB4`S#8*nLRL(nL(S#8*nLRL4|r{f&GVN&r#fN&r}fv#`4| ` gpЃrd|r_gB yLgdB`r_g yLC(g 9#8*@S##8Sk*nL` aҨ-@L*@RLa& glpЃrdb`pЃr e$S#8*nLRLa&pЃr d`2Abi08gS#8*nLRLan&`HzNV 9#rgmJg `$rg` <x` 9#X` 9#X` <yN^Nu$NetBSD: redir.c,v 1.20 1999/02/04 16:17:39 christos Exp $%d: %sNVH?<$. Bp |܎ABSQB@SdA~΂g4Hxa*Xp "EA0UQB@Sd"E"#T##T$nJg&*BpВre gJg$Ԃ&EX s(f 9#lR##lKHx B/NO rfbIN @r fJf// axP` 9#lS##l 9#lAff 9#gNN @/a//HzaLJf7(/aX 9#lS##l 9#lf 9#gaKh` /afXJfRJf// a^P$jJfJ.g #J.g #L"nJg: *(@S%LSj/ afX R"nR` R(nRRSJfSkt **S%ESj/ a(X R RQBBSd`HX- *"@S%ISj/ aX R`" R` *(@S%LSj/ aX RRRf\L ,.(. *.&BE///NO JoJn `(؀B`Jgas @rgp` Rr l L|N^NuNVH< *.(. &.E`as @rf///N$O rg L PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binMAILPATH=MAIL=IFS= HISTSIZE=PS1=PS1=$ PS1=# NVH 8G$SJg8I*f/a *"@$"%T%k%k XIG$SJfE#*f4Hza "@A "Xa&"<.Jg"<.##t $LN^NuNV-y#BHnaXJg 0|-H`A##/./. /.a(## .N^Nu%.*s: bad variable nameNVH> $n*. (.B c _gB yLfvAB"yL`vR c _gC(fJg =f$Jg/ /Hzba7&TJf| ` /a4րX/a& C"JXSk QBBSd=BJg //a P//aL|N^Nu%.*s: is read onlyNVH80$.&. /a 6&@$SXJg/*/a zPJg*gHx=/a>//Hza6 9#lR##lJ g fHx=/aR/ j NO "* xf/*agrX"*x„%A%B#tg#f9#{g HxaX 9#lS##l 9#lf4 9#g,a4`$$RJfHxa8$@%C%B$B &L N^NuNV/ 9#lR##l$nJgB/*a<.aP$RJf 9#lS##l 9#lf 9#ga4p$nN^NuNV/ /$./a @$PXJg0//*aPJg*fHx=/*aR`$RJfB$.$nN^NuNVH0 $.&. $y#hJg //*aPJg Hx=/*`B$RJf/a @$PXJg y#(F##` y#*D##` y###Ԃ"y###4QԂ#A408HJfZJfV4|K##3| y#K##!y#J#la8##lB#J#g`."ҁA~2pJg,Jm&n ЀA0pf A4p` A4p(9##@eaJf0 y#K##1J y#K##!y#`Hz6a0p`BL<1\CJqg ##4##8"G0qCP0qg8BKITBC4q| l5< Ѐ0tC0qf"G0qBC4qR Ѐ"G qfnCj0qJf&y#8$y#40q##, ##p#(B#|e0;N:Rnx",6@JZ~#(&y#8 9#4Ѐ`b/9#a## <`x <`n <`d <`Z <`P <`F <`< <`2 < `( < ` < ` < ` < ` <` <` <` <` <` <` <` <` <` <`/9#Hza8/9$Hx/9#p/9#anO`~B`b #$S#( yJ$f##,  |!F$ (й#,ePԹ##a2$@/ a"-y#XJg 9"@R#&@R$A`&y Ѐ`a8|gmJg\`|gv`B#0aZ$Jg$## 9S jR"@A`J#0f/9 aX`xԹ##av$@&y-y#`j y h#,#aH&y-y#Ѐ`HzaX`L<"n 9v" ҁA.Jpg ##4##8G0sE0rg8(<H`BK>, B(D2tz l5," ҁ(F0t0rf0sBC2qz VI* L<|N^NuNV/ / y#("yJft y (й#,b`$ #R#argmJg4`>rf8/9 a`XaUJgp`DJ#0f/9 a@X`Թ## yBB yE##($.$nN^NuNVJfHx@/9 a#P/./9aRaVN^NuNV/". 9g6Jg" y#( y!y!y#,#at##0$.N^NuNV"y##, i#### #(N^Nuout of dynamic memory in yy_create_buffer()NVH8&n Hx(IVRN$@XJf Hza|X%K HkN%@Xf Hza`Xr%A/./ aF LN^NuNV/ $nJg$fBJg /*afX/ a^$nN^NuNV/ / &n$n / a8&r'A XJg4j/ a@6J^ID'@`B$n&nN^NuNV"nJg.B iB iB(#ip#@B$faN^Nuout of dynamic memory in yy_scan_buffer()NVH 0&n$. rd J3(fJ3(gB`NHx(aL$@XJf HzaX U%@ %K%KBB%@Br%AB B$/ a L N^NuNV"nBJg IRRJf// aLN^Nuout of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()NVH0 $. &T/a|$@XJfHzaJXBc"J nRbB2(B2(// a$@PJfHzar%A L N^Nu%s NV/.HzHyaHxadNqNV/.aAfN^NuNV/. /.aBN^NuNV/.aBxN^NuNV/9 aN^Nu}ľ~] drj~;4~:zŤ6xcP2~X68 h~\8ȴ[XY>Y;Y5Y,Y)Y#Y!YYYY Y Y X X X X X X XXXXXXXXXXXXXXXXXXX}Xw Xp!ulimitaliaswaitunsetunaliasumasktypetrue:trapshiftsetvarsetreturnreadpwdlocaljobsjobidhashgetoptsfgfc-hfalsereadonlyexportletexpexitexecevalecho.chdircdcontinuebreakbgcommandNV/ <###P##LaՈ$y$FJg&Hx=/aqPJgHx /abPXJf$nN^NuNV/ B# B#B#lr#xg B#B#ahB#B#$J#TgaĐJ#Tf##E g /a>B$nN^NuNVaB#`a.ah&3B#pAB]QB@SdaaľaA# <#ɰc fRbaNN^Nu    NV/$.g>B#B#`/a8"9#ҹ#`/a6##й###/a"`B$.N^NuNVH0 $nJg"Ad00Hѹ#ve0;N28D22222L22V2Lrr/*`f/* a/*`b/*aj`^/* az`$9#`R/* a |Ԁ##``/* a<$9#`R/*a ZԀ##``/*`/* a,/*a$L N^NuNV/ $nJgP#/*a$RXJf$nN^NuNV/ / &nJfB`$y# AF0p ##re0; N2@V22222j22x2j/+a%@`/+ a|%@ /+ap`/+a%@%k`f/+ aR%@ `/+ a%@ `/+ aT%@ /+a%@`&/+a%@%k ` /+ a %@ %k/+a%@$ $n&nN^NuNV/ / $nGJg$&#P#/*a S!@$R&SXJfB .$n&nN^NuNV/ $n"y# IJgJf## $_N^NuNV .g/a; N^Nu            NV/./. /.aN^Nu@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $NetBSD: mkdir.c,v 1.21 1998/10/13 20:11:42 scw Exp $m:pinvalid file mode: %s%sNVH<0$.$n aHzBacBa&F*r?FBO G`Prmg lDrpf>x`>/9$FazXAJf/9$FHzjHxa:Hx/N&P`aHzF/ /NO rf 9DE fa BJgnB/aP @` /fBSbJg///aXO Jl6t`2//aPJm//aPrf/HzaI~tPXJf/aUNq/%s: %sNVH><&.*. (.$CKI6|܎G RHz/ NHz/ NOJWIDB//NPJgTa; @rf6 A vJg //NPJf AYJg //NPrf>/HzaHp`: . @gHxaTB//Hz&a24p` /JgFBL<||N^Nuusage: mkdir [-p] [-m mode] dirname ... NVHzHyaHxaTNqNV/./. /.aN^Nu@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $NetBSD: hostname.c,v 1.13 1998/07/28 05:31:24 mycroft Exp $ssethostnamegethostname%s NVH00$.$n a6BG`r?g rsfv`aHz/ /NO rf 9DE rla g(/a//a~rO JgbHzfHxa6Hx$/aPJgHzJHxa6pB.JgHx./ac @PJgB/Hz(a8&PBaRNqusage: hostname [-s] [name-of-host] NVHzHyaݸHxaRNqNV/./. /.aN^Nu$NetBSD: args.c,v 1.13 1998/07/28 03:47:15 mycroft Exp $imimini|m2ivmT@@irmjiomikmihm icm@@i^mskipseekofobsifibsfilescountconvcbsbsunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %dNVH8JgN *f4$HhaDL8Xd4Hx"aK //9#@HzHxa`/9#@HzHxaL $.&.N^Nu$NetBSD: conv.c,v 1.8 1998/07/28 05:15:46 mycroft Exp $NVH <"y#Jg( 9#X y#PStgBQB@SdK#I#P*G#E#T&$#e Ba($L<N^NuNV 9#Tg##N^NuNVHy*HxadNqNVHy*HxaNNqNVHy(Hxa8NqNVHy(Hxa"Nq@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: dd.c,v 1.12 1998/08/19 01:32:44 thorpej Exp $NV/ /$. a\/aaHyzHxEFNHy{HxNHyyaO`a 9@"S#@Jfa8BaIvNqstdin%sfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVNVH<f"R#"& c g/"y#/ /+a'P Ы##L0G#`CfHHx 9#l$L9$#\///9#ha!Oz|f/9#dHzHxa"E#\&$9#lBJg//9#L/9#ha O Jo+gf&S`Jf$ 9@|d S#@`Hz(HxaT9#g"Jf/9#dHza2xa\P`z/9#dHzHxa!L |N^NuNVH88 9#fFB 9#$L9$#///9#a |Ovxf,/9#HzHxa!tgB=|-y#Hn/<m/9#aO Jl/9#Hz9Hxa!,BG#ԴdE#I#//*/aO Jnl/9#HzHxa =|x-DHn/<m/aXO vf/9#HzHxa RdBE#//*/aO g/9#Hz}Hxa p Re`ReNLN^NuNV/./. /.aN^Nu@(#) Copyright (c) 1987, 1990, 1993 The Regents of the University of California. All rights reserved. $NetBSD: update.c,v 1.6 1997/10/17 13:59:42 lukem Exp $sigactionsetitimerNVH 0$.$n ar-ABG`aHz/ /NO rf 9DE g/aJ-@XrgaBBa -|BBBBBBHnHxa4OJlHzFHxa-n-nBHnBaO JlHz HxaBBBBtԎ/HnHxaǶO EV/NX`NqNVaJN^Nuusage: update [interval] NVHzHyaHxa:NqNV/./. /.aN^Nu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $NetBSD: umount.c,v 1.24 1998/04/17 01:19:42 fair Exp $AaFfRh:t:vonly one -t option may be specified.nfsgetmntinfo/etc/fstab%sNVH<0&.$n a*BaBG`rЁr5e0; Nltp~t`ft`br##`X##`Lt#$F#`>r##`4AJgHzHxaZ/9$FN*X`r##`aHz/ /NO rf 9DE fJg`Jf Jg J#gaJ#gJfHzaz*XBrgzm Jg`rfHxHna&PfHzIa+xX`~SJox/$ nHha:O J#f./9#/atPJl/Hza(P`&HxHz/.aO JfJg9#fBBBBB|Bn/* j/tԎHna|Br-AHn//Hx/</a$@O$JfHzar`a$r-AB j/./.BHy/HyHx/ PNO JgHzH/ a`8 R"h / iN j/ hNBL\N^NuNVH< *.(. $nJ#f(HxHy#ax##PfHza&`&9#Sk$rf:/ y#HhaNPJf Jg 9#Ђr<Ҁ$ 9#ЂrLЁ`VrfG//9#NPJgHx./N @PJgB//9#NPJgXJfBLN^NuNVHxHn /.a&N^Nuumount -a[fvF] [-h host] [-t fstypelist]umount [-fvFR] [-t fstypelist] special | nodeusage: %s %s NVHzHzHzHyaHxa1pNq$NetBSD: vfslist.c,v 1.2 1997/09/16 12:22:47 lukem Exp $NV/ /$.$n JfB`* 9#`"//aKPJgXJfJ#WID$.$nN^NumallocNVH 0$nJfB`| nf *of Tr##B J` ,fRRf"BHia d&@XJfHza#B`, J&tEn`B',RHx,/N @PJfB, L N^NuNV/./. /.ahN^Nu@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $NetBSD: reboot.c,v 1.24 1998/10/09 18:50:35 is Exp $halt-haltdlnpq %sreboot???halted by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): %s%sNVH?<$.&n az6Hz)/9EռNPJgHz/9NPJf ~##v`BBBBE`~Ї~2e0; NflpxC`&z`"|~`J#faC`x`aHzF/ /NO ~fF 9DG gZ$KJg$ R/a(BXJfHla L*@B$KXJgG=// NHz/ NOJfB4C`aȤJgHxa,\/HzHxaJg/ /aFHzHxa^Jfa$fa/HzTHxa"O`DHx"BHz/a'O Jg/ /Hz1Hxa"O`/Hz.Hxa"O Hz+Hz(Hz-a.O JfaNJHxHxIGNP~fHzHxaxHxHxEFNHxHxNHxHxNHxHxNO.HxNP~f,EN @~gHza] NV <J#g <//9HzHyaHxa*NqNV/./. /.aN^Nu$NetBSD: test.c,v 1.20 1998/11/04 20:12:12 christos Exp $[XUROLIFC @=:7 4 1.+ (%"    !"#$%&)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operandNVH 0$.$n asHz/GռNPJf$HzS/2,NPJgHzHxaB, Sre0; N :xp` jJW` j !fJ(f jJV`z j !fJ(gp/*aX y# Jg\ hfTX##adJW`< j !f8J(f2/* aX y# Jg hfP##a&JVID`DA##/aN/a|PJWID y#JgC## IJgHz/a L N^Nu%s: %s%sNV n . JgJg//HzHxar/HzHxabNqNVH0 /.ab& y#C##/(ENPr$f*B y#C##/(N/aJfJgt `Y# L N^NuNVH0 /.af& y#C##/(ENPr#f.B y#C##/(N/aJg JVID `Y# L N^NuNV .r"g/aT`$ y#C##/(a/aJWIDN^Nuargument expectedclosing paren expectedNVH 0$nJf HzBafPr%fT y#G##/(EN/at$ y#G##/(NO r&g HzBa `"y# JgzJift y#G##Jf Hz8/aPrger g`2rgb`* y#/aJW`^ y#/a/a0`L/ y#/a`< y#/(a|X y# Jg hfa"` y#/aΞJVIDL N^NuNVH0 y#$C##/(a"$y# y#C##&(Xf HzT/aP0*@0@re0;N"4FZl//a>|JW`//a>jJV`//a>XЀD`//a>DJ^`/EhN$/NW`l/EhN$/NV`V/EhN$/N_`@/EhN$/N]`*/EhN$/N\`/EhN$/N^ID`$//a`//a0`//ar`aL N^NuNV//$.&. r fHn/a2PJf`Hn/aPJgB`n Sre`0; N*>Rfx$V VVV6DHx/aJW`Hx/aJW`Hx/aJW`B/aJW` . W` . @W` . W` . `W` . W`l . W`X . W`D`DA`<`4JfJR`^`aW` aWID`p$.&.N^NuNV/ /$.Ef*B# B`,## 0*H`//a;PJgPJfB# p'$.$nN^Nu%s: out of range%s: bad numberNVH8 $.EN @BHx Hn/a &N @O Jg/HzHxa n"B"yL1gB(R-D AR"1fJg/HzqHxa LN^NuNV@/ /BHn/.E RNPJfHn@/. NJf".IJd^ID $.8$n<$n&&C*~*E(>,<D$<h F Prf"Bg PRrlrfaz @r p`$ @g :g R @fB @f(Hx?//a*&CO :g :fBR`"DB`JfB&Bd/ E`NXrg*B/ NXrgta*rgfJfBEN/IYnN/NAh/0(NHxNGH/3(N/N/3(NO a/aa/aHzhae$O f$< Hx//adPJf `RJ.>gBHzF/HzI///aLO`BHz(///a4OHz aHxa/ENAH/0(N/. /HzHx@tԎ/aeD// aRO$rg>/ arg0 L<|N^NuC NV//&.Hz/aPrfp`/az$/a $.&.N^NuR%d NVH> ,.*. /.HzHx@tԎ/ad//aOrg$/a&Xrf`/aRa @r p`0Bo((ED///2HaO JgԀڀn L|N^NuW%d NVH8 (.&./HzHx@tԎ/ad//aOrfp`\HxHx EFN$//. Ah/0NaOg/Hx N/aa, @r p`/Hx N/a$LN^NuL%qd %d NVH8&./././. HzHx@tԎ/acT//abO xg/a"[I`prLN^NuI%d %d SNVH<0(. . $n mf:/*4R/ HzHx@tԎ/ab//aOzg/aZ` @8mg a8 @z`dHz/aPzgT/a*$XgFJo(&GD// /38a"O oJn Rn`2/a.a @z p`BoC JTTTnBL <(nzHz/. a,Pfp`Hn/KN$@PJg/.Hzl/ anO Jf$</a&BX`p .2G\Jg 2 f"S-AB2`B2 .c$B//a&P/ /N ./Hn/ l$NORHn/N$@PJf/afX/a/, L<|N^Nuw%s NVH<<&nBHz/. a(Pfp`/Hzrai$</a&Hn/ kNOrgnEK2IF/*aXb$//a&PHx/*/N/*HzR/NO./ kNRPrf/az/a.B L<0/ / a`// / a`/`:// / j$Nrg%S`$/*/ / jNO rgp// / j(N``/ / jN`R/ / j N`D/ / jN`6/ / jN`(/ / jN`// / jN` / / j NB`// abrfr &'z:`// aXrfr &'z `// / a`// / a\`// / a`// / a`X-hr%AX-hX-hX-hX-hX-hX-hX-hX-h-PHn/ arf"r &'z|`/ aB` pr&'z8L N^NuNV .". nA !A !@///(a8N^NuNV/ /$n$. *,"@³0d"*(c @b SS(dժ,$$_N^NuNVH0 $n$. j( Ђ"*,d$Jo8&*\`g//Hx/ aL j("*,eC("*,d%A,L N^NuNVH0 $n$. j( "*$c$Jo<&*\`g//Hx/ a j( *,eC( *,d%@,L N^Nu*?_-.[]~=NV/"nB yLCf/ HzaJgt $.N^NuNV nL( @N^NuNVH80(. &n$nS&.Srg4B`Sb /NXJgB/NXJgScQBCSdRc$D L N^NuNVH80$n(. &n&.Srg4B`Rc /NXJgB/NXJgRbQBCSd̸d$D L N^NuNVH>8(n$n *.&n(.SrgRB/N&XcB/NXfRbrJ8g, +3DfI` k<B@nA I 'L *,$Ъ%@O *Ъ<%@/ GDNX ft/ NX/ a@DpL N^NuNV"nB i,B )<#@m/ a"J`BpN^NuNVH00&nB Bc ,dڴb'H(pL N^NuNV nBHx/a=N^NuNV nBHx/a=xN^NuNV <N^NuEditline extended commanded-commandMove down one lineed-next-lineMove up one lineed-prev-lineSearch next in history for a line matching the currented-search-next-historySearch previous in history for a line matching the currented-search-prev-historyMove to the next history lineed-next-historyMove to the previous history lineed-prev-historyFirst character in a bound sequenceed-sequence-lead-inErase current line and start from scratched-start-overRedisplay everythinged-redisplayClear screen leaving current line at the toped-clear-screenDelete the character to the left of the cursored-delete-prev-charExecute commanded-newlineTty allow output charactersed-tty-start-outputTty disallow output charactersed-tty-stop-outputTty suspend charactered-tty-sigtstpTty quit charactered-tty-sigquitTty flush output charactersed-tty-flush-outputTty delayed suspend charactered-tty-dsuspTty interrupt charactered-tty-sigintIndicates unbound charactered-unassignedDigit that starts argumented-argument-digitAdds to argument or enters a digited-digitAdd the next character typed verbatimed-quoted-insertMove to the left one charactered-prev-charMove to the beginning of the current worded-prev-wordMove to the right one charactered-next-charExchange the character to the left of the cursor with the one under ited-transpose-charsMove cursor to the beginning of lineed-move-to-begMove cursor to the end of lineed-move-to-endCut to the end of lineed-kill-lineDelete character under cursored-delete-next-charDelete from beginning of current word to cursored-delete-prev-wordAdd character to the lineed-insertIndicate end of fileed-end-of-fileEmacs incremental reverse searchem-inc-search-prevEmacs incremental next searchem-inc-search-nextCopy current word to cursorem-copy-prev-wordSwitch from insert to overwrite mode or vice versaem-toggle-overwriteAdd 8th bit to next character typedem-meta-nextUniversal argument (argument times 4)em-universal-argumentExchange the cursor and markem-exchange-markSet the mark at cursorem-set-markLowercase the characters from cursor to end of current wordem-lower-caseCapitalize the characters from cursor to end of current wordem-capitol-caseUppercase the characters from cursor to end of current wordem-upper-caseMove next to end of current wordem-next-wordExchange the two characters before the cursorem-gosmacs-trasposeCopy area between mark and cursor to cut bufferem-copy-regionCut area between mark and cursor and save in cut bufferem-kill-regionCut the entire line and save in cut bufferem-kill-linePaste cut buffer at cursor positionem-yankCut from cursor to end of current wordem-delete-next-wordDelete character under cursor or list completions if at end of lineem-delete-or-listVi repeat current character search in the opposite search directionvi-repeat-prev-charVi repeat current character search in the same search directionvi-repeat-next-charVi move up to the character specified previousvi-to-prev-charVi move up to the character specified nextvi-to-next-charVi move to the character specified previousvi-prev-charVi move to the character specified nextvi-next-charVi repeat current search in the opposite search directionvi-repeat-search-prevVi repeat current search in the same search directionvi-repeat-search-nextVi search history nextvi-search-nextVi search history previousvi-search-prevVi cut from beginning of line to cursorvi-kill-line-prevVi list choices for completion or indicate end of file if empty linevi-list-or-eofVi move to previous character (backspace)vi-delete-prev-charVi move to the beginning of linevi-zeroVi enter command mode (use alternative key bindings)vi-command-modeVi undo last changevi-undoVi move to the end of the current wordvi-to-end-wordVi move to the end of the current space delimited wordvi-end-wordVi delete prefix commandvi-delete-metaVi enter insert mode at end of linevi-add-at-eolVi enter insert mode after the cursorvi-addVi enter insert modevi-insertVi change to end of linevi-change-to-eolVi substitute entire linevi-substitute-lineVi replace character under the cursor and enter insert modevi-substitute-charVi enter replace modevi-replace-modeVi replace character under the cursor with the next character typedvi-replace-charVi enter insert mode at the beginning of linevi-insert-at-bolVi change prefix commandvi-change-metaVi change case of character under the cursor and advance one charactervi-change-caseVi move to the next wordvi-next-wordVi move to the next space delimited wordvi-next-space-wordVi move to the previous wordvi-prev-wordVi move to the previous space delimited wordvi-prev-space-wordVi paste previous deletion to the left of the cursorvi-paste-prevVi paste previous deletion to the right of the cursorvi-paste-nextNV <N^NuNV/ $nBBHxa%@%@B$nN^NuNV/ $n/*aB$nN^NuNV n!n!n BN^NuNVH8 $nJfO BHx//* jNOBvg"*JfBL N^NuNV/ $nHxa%@|B/ abB$nN^NuNV/ $n/*|aB|B$nN^NuNV nn N^NuNV n!n  N^NuNV/ $n/*aB$nN^NuNV n/./. /(/aN^Nukey_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed NVH 8$n&n (n$.JfHz`Jf fHz/*aY`$JfI/a%@X// / /*aLN^NuNVH8&n$n (nB 2f("kXf kT 0fTf 1g/ / a6LN^Nukey_delete: Null extended-key not allowed. NV n"n JfHz/(aXp`Jg / HhaBN^NuUnbound extended key "%s" NV/ / $n&n JfJg0 j|"Hx/*/ / aOJl/ Hz/*aXl$n&nN^NuNVH08$.$n &n(nf6J g/ /aPvgB`&$j `( *gB *` *g$@`BpL N^NuNVH 8$n&n (n$.g0Jg jg $H hJfJfI/a%@X @$HRJf| * g /a.B X *rgmJg&`rgrf *g/a^X`aV~%BrgmJg `rg`%T`8/aˢ%@`*aVJJ fI/a%@ X// / /* aBLN^NuNVH<*n(n $Ug""JJg^ ig "H hJfJgH&I$HRJfJg"`&J g2/ I / aPrf JfJf*`'jB/ ap`BL<N^NuNV/ $nJgV * g /aB X/*aX *rgmJg&`rgrf *g/aX`aU2/ a$nN^NuNV/$.Hxa @r!ABB B$.N^NuNVH8(n&n $n nJgvf// / aB`ffTB@//,|a"@O * g R$@A`J+f2 l|" l|B0/*Hj/,|/ a>B` "*g$A`pLN^NuSome extended keys too long for internal print buffer "%s..." NVH8&n(n $no4R k|" k|B0Hz/+EFN/+|Hz/+N`jpJgfB// /+|a"@O , f( k|" k|B0/,Hl/+|/ aNO`Hi// a\O ,g / // aHBLN^Nu%-15s-> %s ""[]no inputNVH0 $n$. "n".Jg\vgmJg*`Dvf> <vf </Hn/a /`* jpJg4BgA Jf` aR/`Hz}//90/*aS|L N^NuNVH8"n". &.f^R@` yL08g ^Rxf?`|@`rx^f\R^`\x\f\R\`Fx ggg\R0R0R0 LN^NuNVH80 n(. &n$DgJf ^@`"HB yL08g^ f?`\@`T ^g \f\`@  gg f`(\000RJfzJg+gB L N^NuNVH 8$nHxGN%@THxN%@X%|4`%|4d%|4hHx8N$%BpaLHx8//INPO.hN$%BtaHxh//NO rZ%Ax/ afBLN^NuNV/ / $n/*TGNBT/*XNBXB`BdBh/*pNBp/*tNBt$n&nN^NuNV/ n2|$hXE yL0gRRo$_N^NuNVH88&n(kX +TB L /g R o o(B @ /g R o o trlf(@BB.tFBEBrg4mr`r"g(AB// aZXO.Hn/ aORR o.ILN^NuNVH<8$n&*X(*T**h$*dr%Al%C\/ a.X D(B&C"E ܰl/ aHx/ aK/ a=L %s NVH 8&n(n $nJgJ*fNHz$// ax kpO Jg6BB4g A Jf`//Hz/+aM`/ / aLN^Nu%-15s-> is undefined %-4s to %-7s-> %s NVH 0&n"n ".$.AB.BB. 1"f*fHzKHnHna/Hz/+aMF` kpJgRBE1f:gD/Hz HnHnNPO.HzHnHnNPO.HzM/+aL`2A JfaL/HzHnHna4PO.Hz/+aLL N^NuStandard key bindings Alternative key bindings Multi-character bindings Arrow key bindings NVH<&nHz/+KFNɕPI kX12gHj/ // N"JORoHj/ /+X/ NHzW/+NɕO kT12gHj/ // N"JORoHj/ /+T/ NHz'/+NHzN/ aO./+NHz4/ a8L<N^Nu%s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. NVH<<&n(nJfp`l*kXBBBt lJg -f(Ire0; N,H6R:2>*kT`jv`fx`bz`^/ a`/ a`$kpJg/*/Hz/+aJ2OE Jf`(I//Hz/+aJ OR t,Jf8 4,f / a`zJf/RHna$@PJf/Hz|`$@RJg:Jg/ / a6p`@J*f B 5f / / a` "` 4,fJg / / a6`/ / / a"`rgmJg\`rf/4,HnaPJf/Hz/+aI(p`Jg/// avXO./ / a5`n/// a^`V// a &Prf/4,/Hz/+aHp``JgBB/ a$XO./ / a5.`BJ*g"B// aXO./ / aB`/ / / aB`aGBL<S`4 ^f* yLgR ?g t`F‚`r`IR$ $$_N^NuNV/ /$n n $  \gnJg `* ^g`"B `(Hn ahXrfB` n `R n `$.$nN^NuNV/ / n$. $hpJg//anPJf *` E Jfp$.$nN^NuNV <tN^NuNV/ / &n/ kN$@XJgI// aXPJf'k'k$n&nN^NuNV n!|tBBBN^NuNVN^NuNV n . f !|t`!@BBBN^NuNV"n Jg n"B`pN^NuNV . rg mr`r#`B`pN^NuNV/ $n *Pg /aBPB$nN^NuNV/"."n AAHJg Rt m h! ` /a*a2$.N^NuNVH08$n&nIB/ / NPrftJ@gB@ j\08 f8Hn/ / aO Jg Afrg`.`/./ NP`aAJTf%jX\Jg g n pL N^NuNVH 8$n&n BI`&Jfa @//* aPJft`Bp`Hx/ /* NO rgLN^NuNVH 0$.&n $BEHa0`2 m>"j q fS$`R  j p JfS$p`( l/a@XJf/a>XJm / /a0`BL N^NuNVH<<&n(. B. +g / a0X +gR$k$I`R0g g fS`/ / NPrg'J,'J(BJgx"+($"D"`h/ KN/ &<"CN/ ITNO *<$<4HnHn/ "EN$@O rfB.xl kt.I// p NnDPr e0; N\lh4v(Dr'A$k,$`4/ N/ "CN/ Nr'AHx\/ ENrr0// Nr0// Npr0// NO a#L N^NuNV"nBBBJl i p BRJmBN^NuNVH8&n+Qg/9a&BB/9aO f /9aXa4`/9a` /9a(XBA`g XRxf y h/0 /a*B/HxN/Ba*LN^NuNVH 0$nBBBB-|tԎ/HnHxGGNHx$az%@BOArg"H jr! RXfB/HxNBL N^NuNV/ $n/*a{xB$nN^NuNVH08&nBBBB-|v֎/HnHxIGNBO Arg*$HHz /a(P g k!,XRrf#B/HxNL N^NuNVH<0&nBBBB-|x؎/HnHxEGNBO C* rg,B k 0<rg//1(a(\PXR"Er(fBB/HxNL Fn6"kZ$I iJgDJg@rm i4JgJf.Hy4////*auPO.atJ// / a\` j8JgzJgv i(JgnJgjHy4Hx/)8INիO E4I/NXSf"kZ i+k ($-(, +c$$k (kBoRn`p`pL< N^NuNV/ nBDB *.BHxHzaČ$O lB`Bv֎E`fJ.g`Hx//aO JfJBBBBBBHna$HxHxHx/a@Hx$//a@dxO Hx$//NO |$g/a@r L|N^Nu$NetBSD: login_tty.c,v 1.7 1999/01/11 23:10:26 kleink Exp $NV/ /$.adB/< ta/a?O rfp`0B/EY^NHx/NHx/NOrl/a?B$.$nN^Nu$NetBSD: getrawpartition.c,v 1.3 1997/07/31 00:01:23 jtc Exp $NVr-Ar-Ar-ABBHnHnHxHna@Jm .`pN^Nu$NetBSD: getmaxpartitions.c,v 1.3 1997/07/31 00:01:18 jtc Exp $NVr-Ar-Ar-ABBHnHnHxHna@*Jm .`pN^Nu$NetBSD: fparseln.c,v 1.6 1998/12/09 14:35:03 christos Exp $NV/$."nJfp`B n ` IfRScp$N^Nu\\#NVH?< n,.͙JfA((BJg"nRHn/.a&@PJg nJgJgL$KЈcDf2I// / aRO Jf -@B @JfJWID`R n ЈbJgJ~ g S 3 f-@ @Jg0Jg$EfI// / aO JfSt nJfJf@Hp/ a9$@PJf/ a9BB`(J/./ Hua6O B5JfgJgJgI// akhPJg$L&LJgrAghg RRfJgTgPWI ~€f ~Ҁf ~Ҁgg g"~‡JgRR`RRJfB/ a*@J g"n " L&+"+`$p< gN~΀$ +Sf*+1g'C'A/ a>&+ k"$p<BX` R k"$p<B~ gBJ+1mJgz"j1If1f:0k $Ԉ f~$"j j "` je j c "jJg j0` j0 +Sf~`4R`0'C'A/ a &+"+XJ9$FhfB`SjBQtBFSdl'C'ApL<(.*(E##E& HzKN&@XJg /gXHzNXJgHx/`JHzN$Xg /a.Hx//aZ/O ,</HzR` Y`RHx/ / KNO (Rg6" g :f"Bg" g :fRfJg (ʲcRfBJgg /g/ aXXJlp`B|/. /Hn|aYN$O fPHx/.|/N/.|aVO c( D (:g&DGd :gSedB+ DB( .|g/a&|g R`pL<|XN^NuNVHn/./9#acJgp` .N^NuNVHx:/./9#aXJVIDN^NuNV/ / n&n PhB.HnHn/9#a`$@O Jm/./aj SA& .`B$n&nN^Nu$NetBSD: id_subwins.c,v 1.8 1998/02/03 19:12:25 perry Exp $NVH 8(n$,Ԭ&TgL k"k Љd6", c* k"$p l" p2k hA%HRRe&SfLN^Nu$NetBSD: tty.c,v 1.10 1998/01/30 04:33:37 perry Exp $NV/ /B#̈Hy$F|Ba"XPJgB`#$F|$C#$F$C#$F$C#$F$C#$F$C#$F$C#$F$C#$F$C#$F$C#$F$C#$F$CA$CEr’$B9$E  $Fh##(##,##0##4##8##<##@##D##H##L##PA#TC @"CB9#I##X##\##`##d##h##l##p##t##x##|##̀A#̄C @4"tŨhgJ f@" (@@!@Y##̄Hy$CpJ gp/Ba@JWID$.$nN^NuNVJ$Fg B$Far##$F##̈##X#̄Hy#XpJ gp/BaJWIDN^NuNVJ$Fg B$Fa|BB$FB#̈#$C#̄Hy$CpJ gp/Ba~JWIDN^NuNVJ$Fg B$Fa r# <#(J#̈g <#X##̄/pJ gp/Ba JWIDN^NuNVJ$Fg B$FaB <$CJ#̈g <#X##̄/pJ gp/BaJWIDN^NuNVJ$Fg B$Fafr#d#4$Cr#/9#̄pJ gp/BahJWIDN^NuNVJ$Fg B$Fa rù#dù#4ù$CB/9#̄pJ gp/BaJWIDN^NuNVJ$Fg B$Fay#Zr#\y#*#,y$C$C#$F/9#̄pJ gp/BaJWIDN^NuNVJ$Fg B$Fa:y#Zrù#\y#*ù#,y$Cù$Cr#$F/9#̄pJ gp/Ba$JWIDN^NuNV/ HyabXJ# fD 9$CL9$F`Ѐ##$ c # #$/9#$a## XfB#$/9#$B/9# HyaHyB/9$EdENHyB/9$EN$nN^NuNVr#$FaDN^NuNVHy#̐BaJWIDN^NuNVHy#̐pJ gp/BaJWIDN^Nu$NetBSD: tstp.c,v 1.12 1998/01/30 04:33:35 perry Exp $NVH0 BBBB-| v֎/tԎ/HxEGNa~BBBBO -|B/HxNHxBaa*B/HxNL N^NuNVHzvHxa(#N^NuNV/9Hxa N^NuNV/ Hy#̼BaVaP y$FlJgHJ(1l$HyB/9$Ela# y$Flh0O BB"(S//(/(aOHyB/9$EDENHyB/9$E,NHyaBHxBHyaO(.$F|pJ gp/BaNJWID$nN^NuNVaHy$F|BatHy#̼pJ gp/Ba a/9$FlaBN^Nu$NetBSD: refresh.c,v 1.10 1998/02/03 19:12:32 perry Exp $NVH0<(nJ$Fg B$Fab y$Fl3#3#BBWID##f>",c60B$l"$r*g ,Ѐ//*a%@P",RB0Bb ,."f y$Fl(1fJ#gtf y$Fl(1gXHyB/9$Ea!By#By#O J#f y$FlvǨ.BB/aX/ a(X ,.vƀ)C.J9$FfTJg8 9*@S#Sk y R`HyHx a\PJ#f/9$FlalX",,1gLJ#fDBBɲc&l"$A0B spgRRB0BbJ f lV䀰l / a rX",BBJg6B$l"J#f y$Fl h""p r#h$l" rpg`/ / ahPJg$l" r h2l b $l"2l r h ,Љc $l"$r"j j"QdvǒRB0Beb y$Flf /,/,:y#/ :y#/ aD`,0gn:y#!M:y#!M09#l 3#29#l3#J@m(2y#dJAm0Ad)I:y#)M`XBB`NB`X&,֬ /*l/ :y#/ :y#/ a y$Fl&,֬!C*l !MOHyapL< N^NuNVH?<*n.. BJo< m" p|(g,B0y#Hh8y#/ (H/ a$Ry#By#O$m" r| h2m (k e`B r| h P-HpJm -nS-@,ܭ-FJ#gG` y$Fl h"(n p Э hG r|"hCJ-I -@|ͮ|̀ $9$FgHJ#f@$m" r| - hC  @ f"d U @ g r|, -FJ#WI&ƀJg 9$Eg2HyB8y#/ 8y#/ /aPO.aO `HyB/9$EaHx8y#/ 8y#/ BBa`O `TJfTHx/ /.E&NO Jf:n4`TJ#fTRnHx/ /.NO Jf`,ܭ //.8y#/ 8y#/ a3#<m3#O*.R`$n>$y$FlJg"-$- Ђfm(n @ f j" p| hC"<e: @ f Ud  @ g j" p|& Ԃ$/9$F(ANXb -Ѐb -Sfr y$FlEJ(1l HyB/9$ElN y$Flh0O HyB/9$FN<m3# RmA BTT Rl`B$y$Fl(Eg4J*1m\ 9$EHgTJ$ElgLHyB/a y$Flh0`*J*1l( 9$Elg HyB/a^ y$Flh0O R$-bj"- SfFJ#f< -.g0 y$FlJ(1l6g0J9$Ef(HyB/9$Ela y$Flh0O -.fJ#f6(ET(nI 9,S#Sj:mB  f,`:(nI 9,S#Sjm  g yR`Hy/a>P"- Ё y$Fld$ AHh mHh/8y#/ a*0- mS@3#0-mS@3#`b Sb -1fJ#fX(ET(nI 9,S#Sjm  g yR`Hy/apPT`J(nI 9,S#Sjm  g yR`Hy/a"PJ$ELgb(EgZ 9,S#SEjm yR`HyHxaPHyB/9$ELNO TTJfHx/ /.aO Jf0y# Э gj8D3#2L$F`mJ9$Eg<9$FbSF3#`4 -b, @ Hh8y#/ / / aT0-mS@3#Oo y$FlJ(1l HyB/9$Ela y$Flh0pL<,.(n*n y$Fl*(((&. JoJ$EgJ$Eg J$E`f.J$EgJ$Egrm V"FdJ$FXgHyBHl/ /9$EKrNPO.GNHxBB//ENO.B/9$ENHxB/ BBNO 9$E`gHyBB//NPO.NO ` BoHyB/9$FXNO RnHyB"F/)B/9$ENPO.NHxBBB/ `J$E`g,Jf(HxB/ //ENHyBB//9$E``.J$Eg>HxB/ //ENHyBB//9$EaPO.a|O `J$F0g>HxB/ //ENBOovHyB/9$F0a:O Rn`VJ$FXgBJf>HxB/ //ENBOo,HyB/9$FXaO Rn` aEHxB&LHkB/ NO 9$Eg$HyBB//aPO.aO `4J$F$g&Bo&HyB/9$F$arO Rn`axHx//BHkN`J$Eg8J$Eg.J$E$f.J$EgJ$Egrm V"FdJ$FTgHyBHl/ /9$EIrNPO.GNHxBB//ENO.B/9$ENHxB/ BBNO 9$E$gHyBBD//NPO.NO `$lHyB/9$FTNO RkHyB"F/)B/9$ENPO.NHxBBB/ NO.B/9$ENHx//BBN`BHxBE8Hj//GNO 9$E$g"Fg 9$Eg(HyBB"D//a"PO.aO `bJ$F0g"$lVHyB/9$F0aO Rk`8J$FTg*"Ff"$l$HyB/9$FTa\O Rk`adHxB/ BHjNO 9$Eg&HyBBD//a~PO.aO `0J$F$g"$l$HyB/9$F$aO Rk`aHx//B/ NL<|N^Nu$NetBSD: newwin.c,v 1.9 1998/02/03 19:12:30 perry Exp $NVH<8*.&. ". .Jf*9$CJf&9$F`B////a&@OJfB`X&Bk BBoF(؄IF k"$p,B"jBoA BTRTn//*N%@PRn L *. 9#$9$F`nLBѹ###"9#n&RLB8׹#LB##J9$EfJoJ$Fg^ 9$EgHyB/azO `@ 9,S#Sjm y R`HyHx a&P 9$EgHyB/aO `8 9,S#Sk y R`HyHx aPSJn>B#"9$C$S 9#lR###$9# 9$Cn&S###o*(9#J$FfJ9$FfB#/an##X$Cmv 9$EgJ$FgHyB/a6O `8 9,S#Sk y R`HyHx aPSJ$FfB#$Cl 9##oJ9$FfJ$E f##J9$Fgb/9#/9#/9$Ea$ 9$F`SO #g"//ą.E@NPJo/BN`HyB/aT`/Baz######L|N^NuNV".J#gS#`@ 9"@S#Sjm  g yR`Hy/aN^NuNVH?< .&n ####*y#& .9#(J$Eg9$Eg y#$l^" Ԁ`$9# Bn* l^"l^"@Jg Jg爑`("H`" mJ9$EfJ$Fg$"B`"BR y#"jD Јn *9$E f$o HzB/9$EaB#B#`J(9$Eg` R"9$C(BI oHJoJg@HzB/aB#,9$CS##O B`J$E f#op` y#J9$Eg l^" $ԁ`$"CJ9$FhfJ$Ff(9##mJ9$E|g(y##l RmlpJ9$EfhJ$Ff` 9$EgHzB/aO ` Hx aXJ9$E|g, 9$EgHzB/aO ` Hx azXR#B#(9##l^R## 9$EgHzJB/alO ` Hx a2XJ#mJ9$FhfJ$FfB# 9#(#m 9$EgB/aH`6J#mpS## 9$FgHzB/aO ` HxaX&9# #n`(S##HzB/9$E aO J#m 9##n&9# y#J9$Eg |lE`, 9$E@gHz8B/aZO ` Hx a X##Hx/9#N$ y#Pl&9# |l$F`lJ$FfJ9$Egv 9$E@gHzB/aO ` Hx aX## y#&l>S## 9$FgHzB/aO ` HxanX&9# y#m±oJgJ#g S#`"y$Fl 9# i" p 9# h0 I0 IrF©.fD 9(@S#Sjm  g yR`8Hy/aP`& 9$EgHzB/aO ` Hx aX 9#,R##J#m R#m"J#g #### 9#L L< fffg Ѐ AA Ѐ &ր`"lr҃|† ЀIfHy#HaJЋX$<#HcjHy#H/ a4pЂLh:~ B``x lPxcl0 L< Q Ѐ0$AE $AE 刔 L< fffg Ѐ0 L< fffg Ѐ$AE" ҁ0$``IlVIԀ`PIԀ`FR`B L< fffg Ѐ$AE Ѐ $Ԁ`"lr҂x„ Ѐ`RIfVB <#T` <YLN^Nu$NetBSD: touchwin.c,v 1.8 1998/02/03 19:12:36 perry Exp $NVHx/././. /.aN^NuNVH0 $n&*BoHx"*S/B// aTORnpL N^NuNVH0 $n&*BoB"*S/B// aORnpL N^NuNVH8 $n&. ".$.Jg j" p<x0j ҈Ԉ"j" q< f"x j" p< h j" p< h ` hd "j" q< h c pLN^Nu$NetBSD: putchar.c,v 1.7 1997/07/22 07:36:57 mikel Exp $NV". 9"@S#Sjm  g yR`Hy/aN^Nu$NetBSD: move.c,v 1.8 1998/02/03 19:12:28 perry Exp $NV/"n". .mJm deB`$#@ ) i" p tŐ#A i" pŐp$N^NuNVpN^Nu$NetBSD: w_pow.c,v 1.5 1997/10/09 11:35:48 lukem Exp $NV' $.&. .U'u//a v(*O|Lg*'uEdNPJf//NPJf \8 "`Hx'u//a*L|. N^Nu$NetBSD: w_exp.c,v 1.7 1997/10/09 11:34:37 lukem Exp $@.B9I-0QNV'H8.U'ua $&PxLgN'uaPJg:LC?@C@~7<unY?33333?mo?UUQ&M?t`A?͆Je?~(JEN?UUUUU>fl?Vj%,Ak>f7ir?.B9?.C \a l9<Ge+? :? >/[?Ge+?G`>T ]DNV'H?<.T&n(n.t-n-n K"L.$I*., $ f T ]D/[f7ir#( JLf (HyHzaRP` v-Ctcm -|`-| JLf-|-|`9T.ttLg HnanXJf JLf HyHzdaR>P` v-Ctcm -|`-| JLf-|-|`9T.ttLg Hna XJf 6JLf HyHzaQP` v-Ctcm -|4`-|:JLf-|-|`9T.ttLg Hna fXJf JLf HyHzaQ6P` v-Ctcm -|4`-|:JLf-|-|`9T.ttLg Hna XJf .JLf HyHzaPP` v-Ctcm -|i`-|mBBJLf Hna XJf HyHzaPZ` Jt-Bvcm -|i`-|mJLfV-|G-|XJfJLfHyHzaFPa" @v! ``t-Bvcm -|i`-|m.t 9Ltgvf-|?B`HnaXJf a @t! .".L . N^Nufrom: @(#)log.s 5.1 (Berkeley) 5/17/90$NetBSD: e_log.S,v 1.3 1995/05/09 00:56:09 jtc Exp $/T't "Nufrom: @(#)support.s 5.2 (Berkeley) 5/17/90$NetBSD: s_scalbn.S,v 1.4 1997/10/10 10:40:40 is Exp $/T/@& 't "Nufrom: @(#)floor.s 5.1 (Berkeley) 5/17/90$NetBSD: s_rint.S,v 1.3 1995/05/09 02:48:48 jtc Exp $/T't "Nu$NetBSD: s_matherr.c,v 1.7 1997/10/09 11:32:53 lukem Exp $NVBN^Nu$NetBSD: s_lib_version.c,v 1.7 1997/10/09 11:32:40 lukem Exp $from: @(#)floor.s 5.1 (Berkeley) 5/17/90$NetBSD: s_floor.S,v 1.3 1995/05/09 02:11:19 jtc Exp $/T" < `</T't "Nufrom: @(#)support.s 5.2 (Berkeley) 5/17/90$NetBSD: s_copysign.S,v 1.3 1995/05/09 01:46:33 jtc Exp $ /"/Jo kNuNufrom: @(#)sqrt.s 5.1 (Berkeley) 5/17/90$NetBSD: e_sqrt.S,v 1.3 1995/05/09 01:28:27 jtc Exp $/T't "Nu$NetBSD: kvm_file.c,v 1.12.2.1 1999/08/20 04:59:09 cgd Exp $can't read fileheadcan't read kfpinconsistent nfilesNVH<0$n*.$*`.wg4f.Hx6//ENPO.d/ DHh6NO R$.Tm L<$N^Nucannot read allproccannot read deadproccannot read zombprocNVH><&n,. *.(. (kHxHn/./ K8NOrgHz`// /./// &<߼"CN$@OJmHxHn/./ NOrgHzR`>"D/ / /./// "CN$OlBHxHn/./ NOrgHz'// ap`. Ђ/AAAHt/./// "CNJlBЊL<|N^Nukvm_getprocsproc size mismatch (%d total, %d chunks)_nprocs_allproc_deadproc_zombproc%s: no such symbolcan't read nprocsNVH88$n&. &n *g/aBXJmBx-Dx-D-C-KBBHnBHxtԎ/GFNOxg0/./ a%@Pg*BBHn/Hx/NOxfHz// aB`2"n L<(BA.AA ЀgHx/ Hz// a`-B`-|-|-|-|BtԎ// aPJg,"BJ.gAC A Jf/Hz// a|`RHxHn/./ aOxgHzr// aL`""nAAA Ѐ-@// aP%@Pg/././././ // a-@ n *LN^NuNV/ $n *g /aB$nN^Nuout of memoryNV/ /$n/./. a$PfHz// a $.$nN^NuNVH?<&n$.*.|-F n̴$eĴ(d(+@f$ R| op '@D// aN'@@P`0&R +Dl("ҁ o '@D/// a@'@@O Jg\J4f/+,/ a'@4PgB'k,HxtԎ/rҫ // / a-@OrfHnHn/NO .fB`4/.//./ / a$OgJm/ /*6/ a&JfB LN^NuNVHz/./. /.aNN^NuNVHz/./. /.a2N^Nuinvalid address (%x)NVH? ,.$n (...&.*JgPHn// /aVOJf/HzB/aB`*$".Ad$///NO ڂ؂f LN^Nu$NetBSD: kvm.c,v 1.63 1999/04/01 09:53:09 mycroft Exp $NV .PN^Nu%s: NV// . &.tԎJg4/HzHyaZ//Hya^HyHx a7 `//Hx".P/ab$.&.N^Nu: %s : %sNVH0 . &.tԎJgD/HzdHyEFN//Hya^Ha` @/ah/HzHyN`J$nP//Hx/ a/ ayZ$a @/a(/Hzj"</Hr(a|L N^NuNV/ /$n/. a$Xfa @/a/// a $.$nN^NuLseekNVH<0&n*. $.&.(.EN @B////a(*OprfN @JgHz// apr` "L 0&n,. *.(.$.&.EN @B/////aW8$OgN @Jg Hz// a8 L |N^Numd init failed/netbsdexec file name too longbad flags arg/dev/mem/dev/drum%s%s: not physical memory device/dev/kmemNVH?0$n&. $.*.,...Br%A %A%A%ABal%@,B0B4B8B@B\B`BHBLBPBTBX/ aXJgHz`6JVIDg/avX c Hz`&<O rgHz// atO `Jf$<}Jf*<B//G fN%@ O l/`Hn/aBPJl/` . fxHz/aPJg/Hz// aO`/HzN%@PlHz`NB//N%@O l/`8Jf / afXJlRBB/N%@O l@`BB/N%@O l/Hz // aO`/ aBXJf/ a vXJm ` JgHxHj/aO / aBL N^NuNVH <$nBBHx G/ /* / INOr f, . @f  frfHx / KN @%HH B4./BHxHn/* / NO rf . @frrfB0.Ԁ%nL/./ N%@PPgd/B/.//* / NOfHԀ/BHxHn/* / NOrf(B0.Ԁ . @frrf %BXBTB`, *Hg/aBHX *Pg/aBPBLpL<N^Nualready has a dump headerdon't use on live kernelinvalid magic in cpu_hdrNVH>8$n$. &.JHgHz// aR`@JmHz`//HxHn/* / GNOzf . @f  gHzuB/ aB`%nL/./ IN%@PPgB|܃ۂ///.//* / NOf|(*LP"B҃т%@T%AXB///* / aOz|gHHx / N @%HHPgJ1|  jH1| jH|!F jH / a ZXJf `, *Hg/a:BHX *Pg/a&BPBLpL|N^Nuclear_gapNVH00&n&. $.n`.Hz// aPp` SE"@/BNPrg SJnBL N^Nuno valid dump header(s)kvm_dump_wrtheaderNVH<8$n&. *HgJPfHz// aT`$/HxHx /ItNOJg jHB4("BHi// G"NO zg-| *LV(Qzʀ-E/HxHx/NOJg jHB0(Ԁ"@Hi// NO zg/Hx/*L/*PNOJgd .ԀL/// NO zgT-|-n/HxHx/NOJg$ jHB0(Ԁ"@Hi// N"pg `Hz// apLO JgJaP @BB/./ a>//HxHn/* aJOtgB`Hz:B/ alp$.$nN^Nukvm_readshort readno valid dump headerNVH?<$n.. *n*.JmLa @B/B// /*aI(OlHzB/ ap`c Hz// aV `JHgJPfHzr// a8`HzP// a`f, Jg`Hn// a(O gGIDJA d(/./ N$&N @B/////* N(Omg܄ބf L<&n*. "kPE k\(h JmHzB/ a~`v )cHzB/ af`^$,((r &ƨB1($*AK "4 gª n҃ )`/HzFB/ aBL<|N^NuNV/ n". B$(TҨXт$N^Nu$NetBSD: kvm_m68k_cmn.c,v 1.8 1998/06/30 20:29:39 thorpej Exp $NVN^NuNVBN^Nuvatop called in live kernel!NV/ / "n&iPEJmHzB/ a@B`& VAreAj/./. /*8/ N$n&nN^NuNVH?<"n $n *PBBB-IB$@AdK`I\-P-h(.gd$&,I .".𒃑e$*.֮Յ .".𒃑d -IB`((*(ۮ,.݄-FAKRxl .".$n**TҪXх(.ҮфL$@OJf< +eJf0(kR//// / a ~(@OJgzJfJHfJg("+ +,[I"G"#F, [I#E#F |d`rdX*S"GIEpDn"@ @ `$%|()|IEzЅRe +g /an$X +g/anBL i 0Њ-@`(*. 0\Ѯ,. 0l fR i"0  PglbF (g|b gr`T 8gJb 0gZ`< @g2 Hg`$ xg(b `g b Xg"` hg pg`R` G5r` S/./ /// N(/././// NO(f" R$.S///// -ANO".Jg///// aXO&`l G5r` S/./ /// N(/././// NO(f" R$.S$C`$C&///// -ANO".Jgf` & ///` G5r` S/./ /// N(/././// NO(f" R T h 0E$ `,R"R T h 0,Ԁ 0, fS///// -ANO".f///// a.&O`B l  ,[I!!`  l  ,[I!! $nm Lc(n  f "n)f$d(nI"@C8Cf _gcI(@I8Cf _g`b -f-g4cL  f "n)fI(@I8Cf& _gc"nI(@I8Cf4 _g.`R$0$0  f`x-DRJgJfWI* `S U h$0  Xgb& Hgb 8g:`x Pg`j pg b hg`P xg.`B& m$ 0("0( xzg"0($0( e /ҭ // aԖO Jf U h g ARXf" ҂ R`/./Hk// / aTOJf" G( `T m*.!\" RR`: m"nf" RS`(n!/ / KHh// / aOJf4Hl/Hk// / a`" RG($ /.//// / aOJf U h 0, gR"R 0,Ԁ 0, fS` m-p(-p( *[I!(!(/./Hk// / aJfh m!(!(`T m-p(-p( *[I!(!( /./Hk// / aJf m!(!( BLp `/+$a^p `/+EN/+$Np `~/+$a]p`nB S'J(|'F "J'I,z'E (C 'I0z'E pL(Њ'@4|'F /(B/a O `(R////+/ a (@OJgzfJHg$Jf S (DR/a\ '@Xgr`*  @!|!| !|R SDoJHf +f/// /+/ ax$@O`d -LoFJf"@Hia['@X -LJo$Jg`//Hl// a (@OJg$B/// /+/ aH$@OJf< +eJf0(kR//// / a (@OJgVJfJHfJg("+ +,[I"G"#F, [I#E#F |d`rdX*S"GIEpDn"@ @ `$%|()|IEzЅRe +g /a[X +Eg/NX/+$NBL i 0Њ-@`(*. 0\Ѯ,. 0l fR i"0  PglbF (g|b gr`T 8gJb 0gZ`< @g2 Hg`$ xg(b `g b Xg"` hg pg`R` GH` S/./ /// N(/././// NO(f" R$.S///// -ANO".Jg///// aXO&`l GH` S/./ /// N(/././// NO(f" R$.S$C`$C&///// -ANO".Jgf` & ///` GH` S/./ /// N(/././// NO(f" R T h 0E$ `,R"R T h 0,Ԁ 0, fS///// -ANO".f///// a.&O`B l  ,[I!!`  l  ,[I!! $nm Lc(n  f "n)f$d(nI"@C8Cf _gcI(@I8Cf _g`b -f-g4cL  f "n)fI(@I8Cf& _gc"nI(@I8Cf4 _g.`R$0$0  f`x-DRJgJfWI* `S U h$0  Xgb& Hgb 8g:`x Pg`j pg b hg`P xg.`B& m$ 0("0( xzg"0($0( e /ҭ // aO Jf U h g ARXf" ҂ R`/./Hk// / aTOJf" G( `T m*.!\" RR`: m"nf" RS`(n!/ / KHh// / aOJf4Hl/Hk// / a`" RG($ /.//// / aOJf U h 0, gR"R 0,Ԁ 0, fS` m-p(-p( *[I!(!(/./Hk// / aJfh m!(!(`T m-p(-p( *[I!(!( /./Hk// / aJf m!(!( BL` hg pg` gb g$ gJ` gP gZ`nIfd1`X g fJ1`> ~~e21`& f 1` f1`~m1` "牒 mE~mB R0*g1`13&" 3I€3JfJgS"D`13 Ђ3`l1gfr$0L`҂ Ё$0  f`*13" Ё m 0  g Ё3`13RRf LJgHx2/(tԎ/azB.O ` /Hz~Hx2tԎ/aO`$(/aH&RXJgHj// ayB3 L N^Nu0%dNVH 0&n$. EJg6/+/*avPJgE Jf g/Hz/./a ` <RL N^Nu$NetBSD: regcomp.c,v 1.13 1998/12/13 12:21:46 drochner Exp $UyU:U9U3TU9TTU9TTU9TTU9TTXU9TRT7U9T1SU9SSU9SSU9SS|U9SuS^U9U90123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumZZZZZZZZZZZ~Z{ Zw Zt Zl Zi Z\ ZY ZO ZL Z< Z9Z6Z2Z.Z*Z&Z"ZZZZZZ ZZZYYYYYYS Y!Y"Y#Y$Y%Y&Y'Y(Yn)Ye*Y[+YU,YN-YA-Y:.Y0.Y*/Y"/Y0Y1Y2Y3Y 4Y5Y6X7X8X9X:X;X<X=X>X?X@X[Xy\Xi\XT]XI^X7^X,_X#_X`X {W{W|W}W}W~WDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNULNVH8<*n&. GxFȮ rgg -cp`$` /a D$XHxQIN$@Xp Jg  @A  '@/N'@ BXJf/ a=p `T'J&ւ'CBBBCHI BBRr l%|BBB %DB(B,B0B8$n,. BBzIw`^Jg"/ jHh/>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>X>>>>>>>>>>>>>>>>>>>>>>>>>>>>*Te Hx/ aP lRD l$(Dx m A !,//P TR`& TdI yL0g Hx / aPI// a&P T"H",c c* ?g$ {fpRchI yL0gTR(Jg Hx / aP +gn *g` ?g {g`/ lHh/ $n*. (.,*tB R *c` ^fVR$B/</ a8 j( jR,O R`(CcIfIg// a`&BP  @ *b *Jg.S%@B/< / a jr( jR0O *f Hx/ aDL|N^NuNVH><(n(, TIRz\f TeHx/ a P TBCR )g\n&z.gPm z*g`z[gj (g|` {gbn 9n 1m` }g` l(g / a X`B/<(/ aO `p/ aX`dHx / a V`T lRD l$(Dz m A !,//:]]NVH>8&n/ a $@B" ZXd"HxHz/a`O Jf B/<`," Zd,HxHz/a2O JfB/</ a\` S +c ^f I&z Lc ]fR& R*(]*]`> -f>R& R*(-*-`"cCc -f ]g/ / aP S +c8 ]fΰc. -fR& R*(-*- S +c R ]g Hx/ aPJf" k(g`$(SkHBB R0H*g, yL(g/aIXg R*08*QBBSdJ g / / a PJgp k&(Sk6B R0H*gFH*` H*QBCSd k(g R*F( *J g / / a P/ / a P|f/ / a n// a/ / a `/ / a b//<0/ a L|N^NuNVH88$n&n R "jBcIx-gx[fRBc` Hx `B :g =gz`T$e Hx/ aP R -g ]f Hx/ aP/ / aB R"jPbHx/ aP R"jcGc :f ]gvHx`|T$e Hx/ aP R -g ]f Hx/ apP/ / a R"jPbHx/ aPP R"jcGc =f ]fT$`Hx/ a`v/ ImN R *Xc, -f&Rc ]g$ -fR$t-` / NX`l Hx / aII´mB S+0+RlLN^NuNVH0<*n(n $ B"-c$yLIg C* Ib$UGJg*/ //aO Jf SJ2g G SJfJf Hx/ a"`D$kgB T,0,f$kJg/ / / aLPO.aEXJfL< N^NuNV/ /$n Hx=/.aB R*0*$.$nN^NuNV/ /$n R *bHx/ a|P R *cCc [f .fT$`IR`>Hx./ aB R *PcCc .f ]fT$` Hx/ aI$.$nN^NuNVH0<*n&n (U L"-c,$A&RcIf"C ]gC*" IbڲbHx`8&HE Jg"/ / /aLO Jf RJ3g\JftgHx/ axB` *`IL< N^NuNV"n yL0g y`f0 ` y0IN^NuNVH0 $n$&*A$A%Hn|]B./ a $%CL N^NuNVH 0$n$. j&h8(g& yL(g/aNIXg // ax`&BB/</ aJ3(f j7(R4L N^NuNVH0 $n$&*A$A%H|^| |]B./ aJ$%CL N^NuNVH8<(n$n &n&.*lJfxlpfp` xl"T f "V`"҃xe0;N(000Lv)J`|/ Hm/ k!@BPo( k$h l^LШ%CRn kJg hJg/BHp(aԦ` BHx / a"k 爐 iA l^LHة 爖p@B(BB L N^NuNVH00&n$n "k") 爐 iA &"iBcB R*F0(*RbpЃf kS L N^NuNVH?<"n i&n.+&G + "牒 kG-K&G(+$Hd|KII.f@gb g( Hgt`d pgjb hg``P xg`FJfER`HY` g.A"  `g g f8`ʳ@o$ 'I@ f` k@JgFHha'@ jX" Hg Pg` R`l S fJgt($$_N^NuNVH8 .". $.v n D"B` (礂LN^NuNVH8 .". $.v n D"[I` (礂LN^Nu$NetBSD: fixdfdi.c,v 1.3 1997/07/13 20:01:44 christos Exp $NV.T\88 l &<Jg&Hx//aB/Hz"Jg"R//aO`4Hx//anB//Hz"n/"Jg"R//aüO$/Hza)8Hxa./.ENXJg/.NXBB/a)X .L0,. *.(./.a&d @XJf`\B`ZB$hGpJg"& r"mHx//aO XRJfB,B$K g////aOJgRr"lpL |TN^Nur/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than ownerNVH?<*n ..|JfHzPHzNaBP(`BJg././/./arOAJf /NB`P/NXrf@JLfJg2B/ax(@XJgHx/,*/aD /a|"</Hz/a"az$az&/, GWNO. /ai/,EWNHzp/ad(/N/NOJgBv֎//aNPJl$<`\ . g$<`B//a4`.a PJl$<`" .gg$<`pg$<Jg#$C`/aYpL&B|XJg|/.xB/Hka$O`( z//N`p -fb+g @g A`/ a @XJf`*p`($hJgHx/Hnaz$O JgXJfB$nN^Nurcmd: address %s not listed for host %sNV/ HxHxHna#$@O JgHx/Hy#46LVVX"LLL`bv0 Q> @`Pv(`Fv (؀`8vB`.B-A > G* ~dLCAJgB`.RBxd TT`RbB <#АLN^Nu$NetBSD: iso_addr.c,v 1.8 1998/11/13 15:46:55 christos Exp $NVH>0 nE#* (<#BBBB#B#B#B#By#`c b I&@C`: b I&@C`" b I&@C` |Jf|R|e,0;*N$0..t& `t & ր`tBB`jA#<  L |N^Nu0123456789abcdefNVH00 nC#EB$ ԀB)c8GA#B.Rvd TT`RbB <#L N^Nu$NetBSD: inet_netof.c,v 1.6 1997/07/21 14:08:05 jtc Exp $NV/".m t`  g ` B@H@$N^Nu$NetBSD: inet_makeaddr.c,v 1.7 1998/11/13 15:46:53 christos Exp $NV/ .". te t` b 4HB4 ` bሀ`$N^Nu$NetBSD: inet_lnaof.c,v 1.6 1997/07/21 14:08:02 jtc Exp $NV".m `  gB`B0N^Nu$NetBSD: herror.c,v 1.14 1998/11/30 20:15:41 thorpej Exp $}hHNo address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): NV/ / nE$ Jg&Jg"$/aP-@-|r-AEX/9$Fap$/a&%@P$r%A" $AHj/HxaE$.$nN^NuResolver internal errorUnknown resolver errorNV .l <N`.m <f`A 0 N^Nu$NetBSD: getservbyport.c,v 1.6 1997/07/21 14:08:00 jtc Exp $NVH00&.$. /9$Fta XG`fJg//* a:PJgN$@JfJ$Ftfa L N^Nu$NetBSD: getservbyname.c,v 1.6 1997/07/21 14:08:00 jtc Exp $NVH0<$.&. /9$FtaXK`@//IռNPJg$kJg&//NPJgXJf`Jg//+ NPJgN&@JfJ$Ftfa L< N^Nu$NetBSD: getnetnamadr.c,v 1.13 1999/01/20 13:09:57 christos Exp $NVH?/ aXJg."nX"/ aǮGX~##@RQ>BCSd6Jg"nBJg ~g` y#<##8B#D` y#< PC##8B.ė$HB .g RR .f~f 0fJ.gR| "<K=JgR/ JgS// "ANO JgA(`A(B$.// N-@(BPAR~lz/.a##DX#< <#Br#$F/.HyHzHzHzHnaZrf B$F .`BN^Nu%u%u.%u%u.%u.%u%u.%u.%u.%unetworks.byaddrNVH8 nX$(xfdJ#(fHy#(aXJgJB 9#,g /arXB#,r gASB@fxgZmJgz` xg*xgp`/.HzJ$/aePO `p/./.Hz+$/ae.O`N/././.Hz $/aeO`(/./././.Hz$/adOHy#0Hy#,/a./Hz/9#(aOJf /9#,a& n gp` x#$FpLN^Nunetworks.bynameNV// n&J#(fHy#(aXJfp`jB 9#,g /aXB#,Hy#0Hy#,/a./Hz/9#(a0OJf /9#,a($ n gp` r#$Fp$.&.N^Nu NVH< .##8Hz/KqN$@PJfB`B`R g gHz/ N&@PJgB/ ay##Dr##@ <#H##<(@XJg6$Kg0 g fR`#d(Hz\/ N$@PJgBJfB <#8L<N^Nu$NetBSD: gethnamaddr.c,v 1.14.2.1 2000/01/08 17:50:49 he Exp $gethostby*.getanswer: asked for "%s", got "%s"filesdnsgethostby*.getanswer: asked for "%s %s %s", got type "%s"NVH?<,.-nB#*n x gm xg `6xf.-|j`-|k"nB8)-DB0)$<#լ-B"< -AG xf/// / /.a$Om/."nNXJgG(xgxf4/.ax$RX n .##"@-I-@I#B##-|#l"nB##BB .SJoc/././ / /.a$Om/."nNXJg/ EkNB6T/ NB2\/ -ANB4TO ".xfxgxfxf#դdHx&// / /.ah$Om/"nNXJgt .(/Ee:N$RX nRծ/N$RXn8 n.//.a .##Ђ-@`x fxf~Hx&// / /.a$Om/aXJg/a$RXn n//.a-n"n-IP`ƼgDpЃxd/EN//N.Hxa./.HzHx%aO`HAx gmx`xg`T/./.NPJg /./.`/././ / /.a$OmP/.aXJg@Jf ##`#դd(`txg/.a~$RX oR`ծ`/./9#NPJg"/./9#HzuHx%a$O`#fP&<#Jf .##/aRѮX ."Xx-A ЂbR`@ #e`2"nX"// /aO ծ`aJfR .SJo cJgtJgB"nBgxlf/Hy#laPJ#fB/.aD$RXnV nN/./.a* .##Ђ-@P9.gHnHnHy#aB$F <#` x#$FBLHy#/ HxNO Joj9.gHy#Hy#arpP`rpA#l #B#p###### `R g g## <###&@`g0 g fR`#դd&Hz/ N$@PJgBJfBB$F <#L<N^NuNV/ n$B9.g Hx/a,PJfHx/a n gp` r#$Fp$.N^NuNVH0<$.&. BaXK`2f,//INPJg"$kJg//NPJgXJfN&@Jfa L< N^NuNVH80 nX((X&($BaJXG`f// j/aRzO JgN$@JfaN n gp` r#$FpL N^NuNVH< n"n IKGEp BQB@SdPP IL<N^NuNVH 8 n&n (ntfRt fJt!Bt!B $hJg6 S trpЁoB`&//aX$tՓtՔPJfLN^NuNVH?<$.K#, B##l#r##r## *<#l&<# <###&@IqBHz/N$@PJf FJfB`B EX /X/aP`R g g$ Hz`/N$@PJg  fxB F f*`//aPJg #դd&$ JfrJg:g6 g fR` gR#դd&Hz9/ N$@PJgB`B EB <#L<|N^Nu%u.%u.%u.%uhosts.byaddrNVH0 B nX$h&(J#fHy#a|XJfp`B*/B*/B*/B/HzHxE/ aMO 9#`g /a@XB#`HnHy#`/ ad./ HzT/9#avOJf//9#`a$Jg n p` r#$FpL N^Nuhosts.bynameNVH8B nX&(((J#fHy#a| XJfp`l 9#dg /aކXB#dHnHy#d/a./Hz/9#aOJf//9#da:$Jg n p` r#$FpLN^Nu0123456789abcdefNVH88$n JfHx!aܺ$@XJfB`J/.tԎ/aBBIC&B JB8(TTRxlB2 LN^NuNVH< $.*/aHxB/ad(Om^$E`///aO Hx//N&O nEN @$/a N @ XJm /. /a`BL< . *.ȺcHBB(@V&@T$@R"@*nBXX "X H@B@BX|*XbL<|N^NuNV nBB gE#!|ͫ!|!|2Tv N^NuNVH<<$n*n (."*5 Ҁ%AcR zѪt@b@// Hr8INO Hj/ GNP`Hu(/ NPz@ԅp?ЂbB`BI/Hu(Hr8NL<2LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGCNVH><(.&n J#fHza?##Xf #DŽ#|eJfJg4 X`(v*<#KE#$<xHx// NO E | ԆR|lJfG/3LIN @XJgJf/N @XJgJf Hz6N @XJgJfA)Hx/$"BHqXNA#B0(O JfbvE#$<#X/N @XJgJf EHx//NBE O | ԆR|l`Jg$Hx/ $"BHqXNA#B0(O `Hx// a^$@PJf0vE#t ԅHx/ /NBE O | ԆR|l`v* /fARR /gJfB`I# tm$// HtRN ЂB4R&JO  /fR /g` /gRfJf|m&$E#G HxHr(Hs(NO |lJg/a`vE/NXR|laL<|N^Nu%s/%s/%s/%s/%sNVH0 HxHyxHy#arvO Eռ$</HyxNPJg4HyHyHyHyHyxHzHxHy#a<` r ԁRrl <#L N^NuPOSIX%s/%s/%sNVH>0&.*,<X(؆/G#$ԋ/EռNPJf `Hz/NPJgHz/NPJftrf` 9L&<䶀g/aͶ#LX 9&<ضg/a͖#X 9&<g/av#XHxHsX$Ԇ`ZAt/0<//9#HzHx$/a;Org mr`.r`*/a@XJgHxHy#$</a `BL |N^NurBSDCTYPENVH<0BBBHz/.aD$Pg/HxHxE/ GNOrfhHxHz/ a9O JfN/HxHxHnNOrf2 .rf&/HxHxHnNOrf . fHxEN&Xg CB//.Hx/NOfЀ"@HiN(Xg D0//.Hx/NOfЀ"@HiN*Xg E0//.Hx/NOff/a` 9LX g /axX#L 9 g /aZX# 9 g/a<#p`/EN/N/N/aBL f\Jl"M yL0g^vf?` @`-B $&N^NuNVH0 n$n &.$`RI//I//a @OfB L N^NuNVH8 n$n $.&.(`I//I//a @OSreJgB/I//a @B LN^Nu$NetBSD: utime.c,v 1.8 1998/03/30 14:51:42 kleink Exp $NV n JfB`-P-hBBpЎ//.a(N^Nu$NetBSD: usleep.c,v 1.16 1997/11/24 19:56:32 kleink Exp $NV nB?b&B 눐A -@BHnaZB`aJ @r pN^Nu$NetBSD: unvis.c,v 1.14 1998/12/02 19:33:28 thorpej Exp $NV/././. /.aN^NuNV/ n". "n.g" [tdpJfp` te0; N$pBt\ft`p`pЁtle0; N22, &`t`t`t` `f ```Z`T `N `H `B `<`6Bp`zt-ft`Dt^fft`:Bp`^t?f`Bp`DpЁtet"B`&Bp` BpЁtep`Bp$N^NuNVH08$n&n & BIg@BHnI// NOrgmJg`rg rg`R`R`p`"fHxHnI// NrfRB L N^Nu$NetBSD: uname.c,v 1.5 1998/08/18 23:52:31 thorpej Exp $NVH8<(nx-DE-D$<-BBBHn/ Hx/ GFNOxWIx-Dx -D-BBBHnHlHx/ NOxfvx-Dx-D-BBBHnHlHx/ NOxfvx-Dx-D-BBBHn$ /Hx/ NOxfv`F"B .*@S-M"`* bxd `B nRK-M"S Axfx-Dx%D-|BBHnHlHx/ Nxfv L<N^Nu$NetBSD: ttyname.c,v 1.15 1998/08/26 00:38:40 perry Exp $/var/run/dev.dbNV\H0 $.Hnt/ahPJm&v֎//a PJf$. gB`BHxBBHza \$@OJgjBlAlB-Bl!n-HdAdr!ABHn\// j NOJf$/.`/.\Hy=aŜ/ jN <8`/ jNX/aL PN^Nu/dev/NVH 0$nHza$Xf`z/aT <8`lG`N"PfFB("@HiHhHy=aHnHy8aE8OJf"Rf "jg/N @XJf/aBL N^Nu$NetBSD: __signame14.c,v 1.1 1998/11/30 20:45:40 thorpej Exp $ܴܰܬܧܣܞܙܕܑ܌܈܃zuplgb]XSNKFA:5/*% PWRUSR2USR1INFOWINCHPROFVTALRMXFSZXCPUIOTTOUTTINCHLDCONTTSTPSTOPURGTERMALRMPIPESYSSEGVBUSKILLFPEEMTABRTTRAPILLQUITINTHUPSignal 0$NetBSD: siginterrupt.c,v 1.9 1997/07/21 14:07:32 jtc Exp $NVH< &.x؎/B/EGNO JmzJ g6A$F$Szda @z ` zrꊃ,zˮ`6"SzdaÞ @z ` z A$FzB//NLn( -gnJg +g` Xg` og ufE` F`(~ȇg6rf"g FĀg FĀgFāgBg g g Ȑ` FĀ` @Ig` ` \\\`LN^NuNVH?<*nBJgF|-F-F-F-FtԎ/HnHxGGNBEVN./NFB/HxN8|O.0al$@XJg&Jt$ԋB yL0grHxB/ a(@O Jf`  bRB gg$n ag`( og ug`E `E ` E8`|R`R +g -g =g/ aB`T =fBEBBI| e0; NBJ`zD$`Jg |gD `Jg |gED`|mF`2|I-I`|I`xJgpbRXC$ Ԃ// a @PJgE "Ё"Ё"HABAЁD"@C E &HC($ ///I// a.$@BO =f2|-I +fxJgrbRXC$ Ԃ// ax @PJgE "Ё"Ё"HABAЁD"@C E &HC($ //./HxX/ a$@BObRXC$ Ԃ// a @PJgE "Ё"Ё"HABAЁD"@C E &HC($ /I//I// a.$@O`Jf =fJfz =f2|-IܴbRXC$ Ԃ// ap @PJgE "Ё"Ё"HABAЁD"@C E &HC($ ///I// a$@OJgtbRXC$ Ԃ// a @PJgE "Ё"Ё"HABAЁD"@C E &HC($ //./HxX/ a*$@O`R`fTB/ a Lvug8`-Jg!A`!| \p+Jg & Ɓ!C`h& Ƃ!C`^Jg&gvgv@v!C` |!Bv+f(`v-f(` v=f( \$&N^NuNVH80 n$HG`xXg& 1j\\\JgI"x+gx-fBBBC`\\Ix-f FĀƀ`x+f F€ƀ`xXf F`Jg-B!A\\Jg+B!B\\Jg~XB!C\\`lL N^Nu$NetBSD: setjmperr.c,v 1.6 1997/07/13 19:46:14 christos Exp $longjmp botch. NVHxHzHxaN^Nu$NetBSD: sethostname.c,v 1.8 1998/11/13 12:31:52 christos Exp $NVr-Ar -A/. /.BBHxHnarWIN^Nu$NetBSD: raise.c,v 1.6 1997/07/13 19:46:10 christos Exp $NV/.a`/aaN^Nu$NetBSD: pwcache.c,v 1.12 1999/01/19 08:32:34 mycroft Exp $NVH8 n&.B$. SxgIҀQBBSdLCLN^NuNVJLfJ\f HxHx=a]#LgB`R\pN^NuNVJPfJ`f HxHxa]H#PgB`R`pN^NuNVJTfJdf HxHx=a]#TgB`RdpN^NuNVJXfJhf HxHxa\#XgB`RhpN^Nu%luNVH80$.&. JLf aJm L<3>/"AC 鈐"AC " yLG$SJg o$fJgxfl X`JDfHxa+PRDXJfHx(a0$@&X/a* @XJf*Jg"%B$/Hz@Hx $ X/ax$Jg*B`(Jf ` %B$Hx /$ X/aB*#x$ L N^NuNVH80$.&. JPf a(Jm L< 툐刐" yPG$SJg o$fJgxfl X`JHfHxa?2RHXJfHx(a.$@&X/a>@ @XJf*Jg"%B$/Hz>Hx $ X/ax$Jg*B`(Jf ` %B$Hx /$ X/aB*#x$ L N^NuNVH<&n*n / a{$@XJgJgJTf aHJmHx=/ / a yTI $TO Jg(Jo$Hj/ aLPJfrg*$B`JDfHxa)2RDXJf(Hx(a$@(Xf/ a(L @Jg@*B`:Hx / HjaB*#/ a(" @Jgr$ (%@$*B`r$pL<N^NuNVH<&n*n / az$@XJgJgJXf avJmHx/ / az yXI $TO Jg(Jo$Hj/ a@PJfrg*$B`JHfHxa= RHXJf(Hx(a$@(Xf/ a; @Jg@*B`:Hx / HjaB*#/ a; @Jgr$ (%@$*B`r$pL<N^Nu$NetBSD: popen.c,v 1.22 1998/07/18 05:04:35 lukem Exp $r+-csh/bin/shNV/ /-n Hx+/.aPJg0r-A-|\HnBHxHxaj(OJlHB`B"n rg wf"nJ)fHnasXJla @r B`ZHx a-@Xg as$rgJg&`/.a/.EN/.NB`$y#Jg/*ar/aP$RJf"n rfD/.EN .XrgHx/ak/.NO Jg8BHxakP`(/.ENX .gB/ak/.NO B/.HzqHzpHzoa[6HxaYh n rf//.a$@/.`/./.a$@/.a"n#J#B"### $.$nN^NuNVH 8 .$y#Jgg&J$RJfJfp`X/a4XI`a` @rfBHn/*N$O rgJf##`&/ apg .LN^Nu$NetBSD: nlist.c,v 1.13 1998/07/26 14:18:18 mycroft Exp $NV//BB/.a1&O m/. /a$/a `p$.&.N^NuNVH8 (.&. BE// ZNPrf RrdpLN^Nu$NetBSD: isctype.c,v 1.14 1997/07/13 19:46:04 christos Exp $NV nL(rN^NuNV nL(rN^NuNV/".Bt gt fp$N^NuNV nL(r N^NuNV nL(rN^NuNV nL(rN^NuNV nL(rN^NuNV nL(rhFN^NuNV nL(rN^NuNV nL(rN^NuNV nL(rN^NuNV nL(rDN^NuNVrTIDN^NuNVpN^NuNVpЮN^NuNVp ЮN^Nu$NetBSD: initgroups.c,v 1.16 1999/03/31 12:19:32 lukem Exp $NV/r-AHntԎ//. /.a4//.aeJ]I$.N^Nu$NetBSD: __glob13.c,v 1.10 1999/02/07 12:19:37 lukem Exp $NVH8 &. $n"nfBBfB(D%D %nB$ B"U g4c4BJg,0c&`BJgx\fBJfp\S@@0bBPJm / /aR`/ /a LN^NuNVH00$n&. $ R{f j}fJjf`0 .`2G`Hn// /a(OJgHx{/N$Pf// aL N^NuNVH?<".*.*n( D$n g0ڲf,B&AT" `8 @[f$K`J@gT0 @]fJ@f&J` @{fR` @}fJg ST0fJfJ@f//aR*`B$A"JeB6~[gm~,g6`h~{g"~}g `Z"J`J@gT0 @]fJ@fD$I`@R`8,.(n / (//a8$@*&DO `r?gm r*g`r[fB4r!fTJRgHx]& T/a,PJf6[r!fvU`r6[r!f6!B4$CB R-fB4*r]g 6-BXB4r]fl6]`(l6?`lg k*g 6*`BB4Jf6BS/ /aPJf^ f* , f f/ /aJg2`2p`.,f$HyHx/ l"lAHp\aըBL|N^NuNV"n n //alN^NuNV nJPg/. / //a`BN^NuNVH08&.$n n(nB2JAfBR/ G/ /aO JgB`,gL j/gD . @g, f*/ / /a$O Jf . @f4/BRR/ /ar`L&J"H0 @/gJ@lt6T0fJf"$K I20 @/fN4T02 @/g`Jg:t$/Ee:NR///az yl /N"@C($ O` ylB kJgBJg>Vrā/Ee:NR//+/a, yl!B/+N"@C($ O` ylB yl!k!k !k!|^ kJgBJg>Vrā/Ee:NR//+/a yl!B/+N"@C($ O` ylB kJgBJg>Vrā/Ee:NR//+/ad yl!B/+N"@C($ O` ylB k Jg6Jg2Vrā/Ee:NR//+ /a yl!B /+ N` ylB yl!k$$###L N^Numaster.passwd.bynamepasswd.adjunct.bynameNV/ 9trfBtaQJflJ#fHy#a1XJgRHnHz/9#EZNO Jf r#tp`.rg"rfHnHzo/9#NJfr#t 9t$nN^Nu##:NV/ / $naN&@r -Argr0-AHn/ /. aO Jfp` ylJgN 9#f%hf %h yl (g %@ yl (g %@ yl ( g%@ rfHzV/*a\PJg|HnHn/a_Z./Hzy/9#aWlOJfP c-|/./.Hy#|aŞHzHnGNOJgHzHnNJg%@B$n&nN^NuNVH0 $nJ#faTJfp`X&*Cr2gm r1g2`r3gX`x 9#rfp`R##HxHy#`<$R/ a^j$Xrlp// Hna4R-BO `(-RHxHnHnar-AO `a>C-IHna $Xrfr2fr##J#fr2g y#/ hNB# L N^Nupasswd-%upasswd%uuidNVH00 nX&(r2gm r1g@`r3gR`| 9#rfp`/HzHxHy#aR#E`6Hx/Hy#aE~O `/HzyHxHy#ajEhOG$A!l`argR|2HxHn/a8-Gr)A/ aXOrg(BlJ#f y#/ hNB#X ypJg/ hNBp La/&nK 9#d*##//9#an##Pfp`$y###Jf##JfHx/ Hy#INXHx/ Hy#NXHx/ Hy#NX##O$Jf##Jf##Jf##JfHx/ Hy#NX O dHx/ Hy#N`r##pL<N^Nu$NetBSD: getpass.c,v 1.12 1998/02/03 18:23:45 perry Exp $w+/dev/tty NVH>0 nX*(X&h(J$tfp`/aJ$@$ T/a}@&PfHzHxa CHj//a{O -C-B y$tBHnHn/ h N$/a~&OJgo |f p`|gv/.av"&pJgpL |N^Nunetgroupnetgroup.byusernetgroup.byhostNVH8 nX&(X$h$J$pf Hy$pa"Xgpxg`x2gmx1g ` x3g`$<`$<`$</`a)rBHn/ /aIv.///9$paAOJgxg`p` g/a}p` g/a|pLN^NuH@lookupNV/./. /.Hz&HzHzHzBarWIDN^Nunetgroup: Syntax error `%s'NVH <$n(n $."RJg #gJg(B yL0f  fK$ R"@Jf&I (f&/ a*B*Xf/Hzva{p`p`Jg: yL0f&B R  gK$(g yL0g"Rg8E/ az^(XfHzHxa/ / /ay TB0p`JfBL<N^Nunetgroup: Cycle in group `%s'NVH0 &.$. //aPJg/a{/Hzaz(`//a0BHx1Hn/a.OJf .gv/az`l-nE^HnHnHnNO JgnrgD`0,.$. *.(.&.//aPJg/ay/HzRaxB`//aBHx1Hn/aOJf .g/ayn`-nEGHnHnHnNO Jgn rg`rgZArf~/.///N$ nO g /NX n (g /NX n (g/NX/.NXJg~`////./aOJgb/.Np`/.N`a$L |N^Nu%s.%sNVH00&n$n &./aw<$XfHzHxa}"<j JgJg / JgJg /Hz//a L N^Nu(%s,%s,%s)NV n (f < / (f < / f < /Hz/. /.adN^NuNVH0 &.$. Jg/aCX$@`4|Jg/aCXE ` V///a&/.Hn/a$/awpJVIL N^Nu ,NVH<0*.(. &.$ng$/ //G`N$O f:/ /BN$O `BJf$/ B/G6N$O f/ BBN$O gf/aC$&$BXGa`:g *,fJ28g28I/Hz`a&PJfR` /avp`// N$@PJf/avBL #|Hx/a $.N^NuNV"yJg4 n "y n "y n  y# p`BN^NuNVH<*.(. $.&.J$tfBHxBBHzah#$tOJgJf(Hx3//` JgHx2///a^OJgp`6Jf0a t&B///a./a$Hx/a  `BL nX*(X((&J$ f"Hy$ a "Xgp|g2p`,JgJgHx/Hy$abO `/Hz*HxHy$aOE$ BBHnHnHy$a9.Hy$ <*Jg <*//9$ a1$Og*|f .g^/am`T .gT/am `H n"nB1Hx/.Hy$aB/.al///a"pJf8p`2J$ fEB 9$ gBHnHnHnHn/9$ /Hzn/9$ a$O.$ NXJgJ|f(B$ .g/NX .g/N|#$ `r .g/NX .gd/N`\#$ #$ `6HnHnHy$ Hy$ Hz/9$ aOJg /.N`"n nB0Hx/.Hy$avB9$ /.N///aLOJgpL|N^Nunsswitch.conf group_compat database can't use '%s'NVJ$f/. HzHxabr#$pN^Nu.%-.%.!).+.-.compatnisdnsfiles.grscancompatgroup_compatNV/./. /.HzHzHzHzfBanN^Nu: NVH< nX*(X((& 9$ grg brg`///aO rgJ` 9fB$ `/BHxaj$/9ajBOrfJgJg//9$aPJfv`긹$fh`a/9$HxHy$aCfO Jfp`Hx Hy$aPJf$Ep`rg/9$NXr g`A$ +fV9$ :g nJg f r#$ `r#$ -HHzHnaR/a#O `///aO JgpL(<2t&<@`F(<2tHB&<`4(<2$<vHC`"$<@v`/ Hzad <vBPlHxHzad P$L( n"/ Hzad($< P`$< //HzHxHy$ a n n <$ L<(n$. ,.B rFgal @r `Hx(ac&@XJg KBBBBBBBBBB'F 'B$gr'A$/ EC^NX c/ NX` <// a PJf2BHzW/ *<A"EN*@O Jg;|4BBJgz/a0^XJg/// "EN$@Bj4%MC@%Ir«$// / a 5@6O @f5|6Jg%B$ `BJf$ (`"D#J( XRJfJgrd/// a $O BHz/ "EN @&O g>!B S1| 6+'fBBHzla'@lr$ `2akR @r /a / ac2P/+ac&X/ acBL<|N^NuNVH0<*n(n 0,&9@$$@HjG@/ /-&< CNHx// a>$Og&fJ+gR/a.$@Hj// CN9J& -)@)@+l, L< N^NuNVH 8(nB g.$@GJj4m" *f *$@/NXJj4l/ NX ,Gg/a vX ,g/NX/,NX,'f&/,aNXJg aj @$/,aeX/ NXJfB` ai @ pLN^Nu..NVH0<(n$TJg,&f&JB2+:7|:vfB/ / aV7@6`*vfh0+6@ @bZHx/ / a.7@6O @f,'fBBHzHa'@ O lai4 @'P7|6`Xk8`P j6fvg",$$g:*j, g0*9g /* adX ,g /a B5|6 `h ,gfgA)A$/a BXBJgF,'fb/*aXJgRah @%Pj8&lJg8 k'h&kJf`$Hx/ a)@Pf,&WI& `&lB` K&kEJg/NXJk4f&,'f/,a6XJfx/ / a`0+: @g @fZHx/ / a7@6O @f:,'f2BBHza'@ O lag @'P7|6`k87|:$l"kJi4f i$f i /gB0)$/B0+&*@HmHk@/ afP`&h/NX k4f/ Nag @BBB`B0+$ lB0Jk4f,'f~/,a"`d0+8gB,'f./+ aXJgEN @$/+ abN @ `(/+ ab~`&f ,'fHzaJg l&`bpJgp7@6( L< N^NuNV .re n 1@:B`af8 @r pN^NuNVH00&n$. g gaf @r `$Sae @B+&f0*6 @ f *` @f +g/aX f k&t`tJj4f j /g+'g // aP'@`@BBHza&O m(// a.'@/aO Jf/aa6 +`BL N^NuNVH?<(nB(pJ,'lp/"D/)a-@Pf$r f"D3|6ad @"D#P`pr f B2|-I`, ,$rf"D&)0 ,$fUr-A` vB ,$BJfr f\fJ"n/aXJg8Jgr fadn @"D#P"Di8BadT @-P ,$`r-A ,$`B"DJi4f i$f i /g "DB2)$*A`g"l-IR/R",-A"D0i4R-HBBBB`,'f$ +.fJ+ g + .gB+/Hk/ aF$@O JgefHu(/ a PJg4GN @$Jg / a[PX/a/.alN @ `r-A,'g "l-I",-A2M5I$%T5n4 +fj8Jg$Jg5| 6%n`5| 6"D%i`JgJg*+ g Jgp@Њ,'g *%@5| 6`bG?,'g&%jB0*&"@HiHj@/.aaO `C@%IB/ / N45B6O JoS@ @c BfSBJf* ,`"E#J* R/.a&@XJfB/.a*XJg // aP,'g .Sc-@"nBJgXr gJfb ,$"DJi4ff:/,aXJf`(f"HzaXJg"D3|6l&B`0Jfr f"D3|6`J grd /// ar, L#$G$Hz/NP"<CJg"<C&Hz/ a @PJgJg g/GrfN#$ XHz/ a~ @PJgJg g/N#$$p`E&JHzj/ aJ @PJgJg#$ g #gHz@/ a @PJgJg#$Hz"/ a @PJgJg#$Hz/ a @PJgJg$<$"B"gI$ BK$$BHz/ a @PJgJg g2/GrfN(XHz/ a @PJgJg g/N*XHx"B/HnaX-@O I$Kռ$`6( `,/ aXvf EJg// NPJgX fJfHzPJg/+af2//*axPJf ///*aO Jf ".o$RJfBLN^Nuyp_match: clnt_callNVH?<(.&. ,.*.*n(nBJg4BB/aXJf"Jg&CJg/aXr@eJgJfp`Hn/ahPJgp`/Hy$D.<ռ&GNPG-KEJfJ/ / ///aOJg4("R/a9*Xg//./a8j"U TB0B`,-D-C-F-EBB&nB"n i\ h/9/9E/ Hy9PHnHy7Hx/)\ PNO Jg.RfHz n/(\aBP nr!Ab`/.a$Xf^(&TR/ a8*Xfp`t//./a7O "U TB0/Hy$D&GNPJf/////aFOJft/ Hy9Pa1P/.aO Jg g /a9B LfJjf0ve 0;N v` v`v`v#$FpL N^NuNVH?<&n(n..BBBK,-fargna5 @Br#$FB KJg .fRRJfBd (.WxȀJf$/ a @XJg// /./. /a`vb*// /./. B/ aOJn&9$Fr-AJf J-m`Jf-g~BEfJgr// /./. // aOJna4 @r=g| 9$Frgmrg`rfR`rfR`R-fRXJgJgJf// /./. B/ a8Jn$rg#$F`Jgr`Jgr#$FpL/ a6&@XbJSrg 3.f/ / / a^B3O `D(M`@/ Ee:N&@/NG P c r#$Fp`*// Hz\/ aO/././././ aL<N^NuHOSTALIASESrNVH0<&.9.fBHzaXJg0Hz/a2$PgB.GKr`$KJgI(yL4f,EJgI4f LRJgI0gJgB// a0LPJfRI"yL(I1g IRI0fJgvAJg0I1f$RJgI4fRJg I1gBB9$DHx/ Hy$Da\/ar <$D`/Hx/ NO Jf/arBL< N^Nu$NetBSD: res_debug.c,v 1.23 1998/11/15 17:40:36 christos Exp $rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%dNV". [ b0; NLV`jt~ (2<FPZdnx <oS` <oX` <o`` <og` <oo` <ow` <o|` <o`v <o`l <o`b <o`X <o`N <o`D <o`: <o`0 <o`& <o` <o` <o` <o` <o` <oO` <o` <o` <o` <o` <o` <o` <p` <p` <p` <p` <p `| <p'`t <p,`l <p1`d <p;`\ <p@`T <pE`L <pI`D <pQ`< <pY`4 <p^`, <pc`$ <pm`/HzHxHy$Ha <$HN^Nuicmpigmpggpsttcpuclegpigpnvp-IIpupchaosudpNV/". Ste0; N"*2:BJRZbjrz <s`t <s`l <s`d <s`\ <s`T <s`L <s`D <s`< <s`4 <s`, <s`$ <s`/HzHxHy$`a <$`$.N^NuNVH?0*... $n$.,.G (ȮJgJg Jgg/. /aPSkPBJgJg/// aV$@`Hj/ a*E/ a6E8O lB`&QBBSd g Jgg /Hx ax L N^NuNVHy/.aN^Nu;; res options: %sNVH00$n&. Hz/GFNPJfE$t *g/at/Hz/NOԂf/Hx aL N^Nu;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed NVH?8&n.. (.9/farg8t ԋ, ܇I g fgBB0/A/0 DA(/0 Hzp/ar/Hx a:O g g/Hx;a P g gHz_/EFNPJ+l HzR/NP+g HzD/NP+g Hz6/NP+g Hz(/NPJ+l Hz/NP+g Hz/NP+g Hz /NP+g Hz/NP ggNB0+/Hz/EFNB0+/Hz/NB0+/Hz/NO$B0+ /Hz/NO g g/Hx aPB6+g ggHz/aPSkB ggHz/aPeJ gg/// /ah$O` HxHn/// aOJmԀJg e gg"/a::/a*/Hz/avOTe gg"/a?Bga /Hz/aBOT gg/Hx aPQBCSdetHz/Hx B0+//// EN$OgTeJHz/Hx@B0+//// N$Og.e$Hz/HxB0+ //// NOJg`Hz`Hz/aˎLN^NuNV/. Hx/.aN^NuNVH<*. . (.Hx&//"Ү//an$OlB`"J.f/Hx.a` //a ЂLT-K,EO g g/.(Hz/aO KFgg/a/Hz/NO/EN/Hz/NO Sree0; N@@H@@@"@\**\*|dRTrgrfbC0 Krf/.0a!/Hzu`rf/.0a!&X/ NT?BgBB/HzG/NO`|`v/Hx a//. / a`vIx/Hz'aBPJg@$o<*. BBB*n"UI @$yL&J2gI I RI @3f3gRI2f @3g*AK A "RI @2f3gRI2f @3g*DKL A (RI @2f .f\RI3gN*@AK A&RI2g,*@K  *CK & RI2g K& RI3fRI2g3g KRI0fIE|2e0; Nffff 鈐*AK "鉒*DA 눐A  CE`6$| 鈐*AK "鉒*DA 눐A 爕`I|2ez0; Njrrrrrrrrfrrrrfrrrjrrrrrrrrrrrrrjrrrrrrrrfrrrrfrrrj|`|*E*`*EBRI yL0fRI0gRI0f*n* L<|N^NuNVH?< .Bx|||BB-@/az$.ԀHnHnEN(@HnHnN"@O". n Ј~f"f ~f* , `~f ~f, * `B` n -f xK-M M +f K-M M"HI$yL2g((JG I*AG R n"HI4f .fLK-M MI"G$yL2g.C & փR nI2g*CK& R nK G *CK LH&"I2f2$yL"Jc.R-G AR"I1gI2g""yLcK-M MI1f䴈cHnGtN@X n"I$yL2f,"Jc.R-G AR"I1gI2g""yLcK-M MI1f䴈c~HnN@X n"I$yL2f,"Jc.R-G AR"I1gI2g "yLc$K-M MI1f洈c HnN@*n R B n  ~"H B@H@ X "H B@H@ X  B@H@ pL BGGN/ErN*Pf*9.BFN/N(Pf(9.BGN/N&Pf&9//// /..~Ẇ//././ /.~_̇//./././.Hz/. alZ 9ODg/aX 9g/aX 9g/a . L#$@ <$D#$8&@Hz'/ N$@O `*g0 g fR`$d&Hz/ N$@PJgBJfB <$4LN^Nu$NetBSD: getprotoent.c,v 1.6 1997/07/21 14:07:58 jtc Exp $r/etc/protocolsNV 9fHzHza#`/ao".$CN^NuNV 9g/a; BB$CN^Nu# NVH<(n*n *.BBIg(<$MG yL0f|=g/Hza"Pg|g.mJg`|gF|gf`|Jgct`lJg Rc 舁RRRt`DJg Rc^ 䈁RRRt`Jg c<RRRB`aIf.|=fbI|gl|g,`TJmPp`NJg yL0gIf|=fIJg yL0gIfJgJ58g`pJf L<|N^Nu$NetBSD: verrx.c,v 1.3 1997/07/17 21:33:24 thorpej Exp $%s: NV/ /$. /9HzHyEFNO Jg/./HyaO HzHyN/.a Nq$NetBSD: warn.c,v 1.3 1997/07/17 21:33:28 thorpej Exp $NVHn /.a~,N^Nu$NetBSD: waitpid.c,v 1.6 1997/07/21 14:07:50 jtc Exp $NVB/./. /.a+>N^Nu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~NV . y00 HN^Nu$NetBSD: syslog.c,v 1.22 1999/03/16 14:00:58 is Exp $NVHn/. /.aTN^Nusyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console NVH?<$.*n B @Jg/HzHx#arO r&9ga0 @-P fHna{`E, &</HzZ// .<"GNOb <&<aEHnHnaF/Hz// a,nOb S9g* Jf #g"/9Hz// "GNOb S9g$a/Hz// "GNOb SJgrd:Sd S((D$<gPG %f4 mf.RR/.a/HzI// "GNOb S` rdSRRfB/./// aVHOb S& 9g2-EĚ"C-I-|}r-AHxHnHxa, O J$( fBr//9aO B///9aPOJld9gZBHxHzwalZ$O mBHx>/aN$@R-JƖ-C-|r-AHxHn/a+p/aL/.aȰ`0"n"D .DL *.(. J$(f#$(J$(fHz y$(/aΦ#$(Pg 9$(gJ$(f|#$("@`Hn/9$(aJ"@PJfV 9$(gN/aXJf/9$(aB$( 9$(,X#$( @XXJf a B`NHz4`b .B1".|f B$(`ZB yL0f :g #gJ$(g 1\f|#$(` 1\f|#$(` ap`B$$B`THn/9$(aI"@PJf4 9$(g,/aXJf/9$(aB$(BX`,:`$ .B1 I` :g \gRfJgB""A B` |g :gRfBBB/Hx/Hn/a$VO|ea RL|N^NuNVH88Hx=/. /.a$@O Jfp`Hxda"@XJfa @x p`vd I`PJgT ^fR :gBJg<` \fR :g Jg b*Br` 7nI(@I.$ Sg /n`IRx2e0; Nfxr~lfxr~l`. `( `" ` ``:` `RSf &HHkd/ a"@PJgvdA :fB $Sxg// aè"@Jgz n LN^NuNVH 0Hx=/. /.a&@O Jfp`Hxda"Xfa. @t p`b2|d A`,Jg0RSJf$HHjd/a "Pg2|dA :fB $@Stg//a"g n L N^NuNV/Hx#/. /.a6 @Jfp` 0f R xg Xf R2|` 2|`2| B`oN L$ԁR b IrҀ` b IrҀ` b IrҀ` n B$.N^NuNV/ /$n :gR :f*B*//.aB$.$nN^Nu$NetBSD: execvp.c,v 1.11 1999/02/04 18:17:16 kleink Exp $PATH/usr/bin:/bin:/usr/pkg/bin:/usr/local/bin:.execvp: : path too long /bin/shNVH?<*nBBJfa @r `Hx// ahPJg. BBI`.HzVa.,Xf,<ׇ/a.,-FXI`bEe:JfGMt`/ N$X/ N&(؃ TX c4HxHz#HxEN// HxNHxHzHxNO$`// E/ GN/(// Hr(NB2HOGR/9$F/. /NO N @ rg*m rg`r g rgz`2|-I`B"n Jg IRXJf "@Hiaj$@XJg$%G/"n HiHjaƜ/9$F/ Hz?N/ adO`NreHR/aUX`8HzHna,&@PJfJgN @r `N @JfN @r Jg/apL<&.$n *n,.*.(nBJg6Jg2&EBBB&FB/a[XJfJgJg/ a,Xr@dp`fHn/aVPJgp`N-C-JBBBBB"n i\ h/9/9x؎/Hy9HnHy84Hx/)\ PNO Jg.RfHz n/(\as BP nr!Ab`^/.aT$Xfn&F&"R/EN*Xft`&F//./aO "U SB0("R/N&E&Xft`//./anO &E"S TB0/Hy9aN/.aYO Jg g /aBX&E g /aB L<|N^Nuyp_next: clnt_callNVH?<(.$n ..,.*n*. (n$BJg8Jg4&EBBB&nB/aYXJfJgJg/ aBXr@dp`rHn/aTPJgp`Z-D-J-G-FBBBBB"n i\ h/9/9v֎/Hy9HnHy7Hx/)\ PNO Jg.RfHz n/(\aq.BP nr!Ab`V/.aR*$Xfr&n&"R/EN*Xft`&n//./aO "U SB0("R/N&E&Xft`//./axO &E"S TB0/Hy9aX/.aWO Jg g /aBX&E g /aB L L< fffg Ѐ$AE Ѐ0S$Sn` SoSe/./.Hha L"+ANRo AJf`&B`"po"HAmRn3 *@E E J/ / /Hnah)j ", A *JЋ! *J)K(L<N^NuNV/$.aHy$)B/a <$)$.N^NuNV/$. /B/.a $.N^NuNV/ /$. $nJ$)f$r#$)Hxa#$(Xg/aX/ /9$(//.aJg %|(` 9$(f %|(` J%@($.$nN^NuNVHy$)B/.aj <$)N^NuNV/$. /B/.aJ $.N^NuNVHy$)/. /.a* <$)N^NuNVH?<&n*nBBJg"S n,Jm&$I) J-L nfzBJfJn(n(l FozJgXJoT&(S" 3 JR9 Jf:E RC J$A) N QR9 NfR"o&QSQ RQg(n"l`Sj^"L<.E(؆HDH Ѐ(DIJ "鉒 鈐$ . ԀjQSJm`R Qn L< ҂~ Ѐ+A 爐Ё鈔 L< ҂ Ѐ+A 鈐刔ԅ*$X L< I$҂ Ѐ 爐+Bl^+B*<G` L< ҄ Ѐ$EJlS"JAAA$ S&l& T L< QԂ 䁒҃$S&l&T L< QԂ 䁒҃* JmpfH L< Q"$Ԃ(AI (AI 到f CI A 鈰f2|l+E+D ЀЉ @Bm - .R+G lR+D B +n $L .Дi J-@//.Hn"n N/./a:OJf ..Ⱦg*IQBBSd~؇QrBCSdj`/./.Hn"n N/./.a"Og* SJmxJlS`Jo p娑`pѮ` .mf .".Ҁ-A^ID..އDf$-A/./.Hn"n N~"n" .`pLBR +*S'ER&Sg&SJn/ aXJf"S yL08g܂`X$l& B0f4BSRSg&Jn/ azXJf"S yL0(gB܊R`SK-M c(<RB$nJgB"SBpЃzMe00; N&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&Jf~B gB`HAZ>0zHB`8AJ>0zHz`z lP`JlJzFą` g< .Rf2~B +*@S'MSJoR`/ aXJfSfgcp/ B*/a`\B*zxgzXfS/ /aPf B/B/.*nNO f.gX l !A`fg X l0`X l `SK-M c(<RB$nJg SBpЃz:e0; N||vvvvvvvvvvB`0JlXzFą`$ gJB`  f4BB +*@S'MSJoR`/ a@XJfSfgZ g"cB/ "/a&Pb`B"AJzegzEg/ /-HNB"P n/ /NPfJBB/.a\//TPg X lh`g X lt` X ldR܊` .fp` .L0"nzڎ$EBx  0fxR xg XfxRgP&yLI @3g LA`&|f*Dg"A gA`A&Rf .f Yc$R`tJgI yL0fp`$$$ BBc EpFRb L |N^Nu#Id: hesiod.c,v 1.18.2.1 1997/01/03 20:48:20 ghudson Exp ##Id: hesiod_p.h,v 1.1 1996/12/08 21:39:37 ghudson Exp ##Id: hescompat.c,v 1.1.2.1 1996/12/16 08:37:45 ghudson Exp #$NetBSD: hesiod.c,v 1.9 1999/02/11 06:16:38 simonb Exp $HESIOD_CONFIG/etc/hesiod.confHES_DOMAINNVH 8HxIN$@XJg~ n HzGNXJf <!O// aPJm^HzN$XgB *g /aw2X/aCfT/N"@%IPg. B .fR/HiaDB`8a @r g /avX *g /avXJg/ avpLN^NuNV/ / $n/*GNX g/NX/ N$n&nN^Nurhs-extension.NVH><(.*n *./ $&/aHx@/InN$@OJg<&.r"C#Ar#A Hz/. a{*Pf6HzErN"C"HzN"C#@PJgJfa{ @r `"CBB(,<r`f$D #gZ gR gJK`R g g$ ` =gR g fBI yL(H0f =fRI4f =g&JI4fRI0gBHz/NPJgHz/NPJf2Hz/NP$CArJgX/ N$Xfaz @r `Hz/NPJflBgP(CPrm\$KJg ,gRfJgBHzW/ NPJfr`HzH/ NPJfr(R&Jfrm"CA,BRrl/Hx/"FNO Jf/aX"CJg )g faz& @r p`BL<|N^NuNVH?<9/fa8|g2Hx$/BBBHx/./. Ba6F&O$mHxG/ //a/j&Olay @|= `B<+-FB4+E -KBo8/./ aA"Pm C cayN @|( `ERn ."@Hiao(@XJf0ay @| `Ray @| `ax @|( `BBlB-L/./ aA"PmAp ЈbP&., 2*FB2ኄ2B2ሀ2 E ( ؀b|f|g$D`Zaxd @|( `D/ao"n"Xg:&@XRc*B$ ԃe// / amO $Bøb޸bBRm.l BGo$L/NXRn/ N` JgB| `aw @| / aoBL`Drg.e rg*r`2rgrg`$B`"p `p`p`p `p`p ` p`p`pN^Nu$NetBSD: yplib.c,v 1.33 1999/01/31 20:46:12 christos Exp $/var/run/ypbind.lock/var/yp/binding%s/%s.%dclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDNVH?<*. BB nJgJfp` BHzIa $Prfp `Hx/.<q&*GNPrf,<*FN @r#g /akN`/akDa&@ 9 Xrg>g:$y$CJg*I"j\Jg i/ hNX$/ N$BXJfB$C# Jg*EB$y$CJgHj/.aPJg$RJfJf6Hxfae$@XJfp`HxfB/ aO r%AXBbvJbfHx/.Hz8HzDHx$/aB/a$O rgHx/*GNPrf*FN @r#fK-Mr-AI-Lr -AHxHn/a> nO g /ai`GFBBJBNBR|GA5hH%PJ5jHV/ai`F/aiXJg/ ae` *bRre>ABBBB||-|r-ABBHnHx/<Hna>&@OJfHza\XJg/ ae` k/9/9$/Hy8HnHy7zHx/ PNO Jg8Jf$RfB/.HzHyaO k/ hN` k/ hNGFBBJBNBR|G BX5hH%PJ5hVX XAr%AbHx@/./NO "j\GFIXJg i/ hNXr(/ /9/9Hx/</ aMJ%@\OfHz a r%AbX`PHxHx/aоO rf HzaJg $$C#$CJg*E*BLJJ\J|K Jclnttcp_create: out of memoryNVH<<&n&. (.$.J$*Df#$*DHx IN*@XJgHxdN$@XJf&HzaQz #$CaZ @#$CX`Jkf.Hx/// a7OJ@f/ EN/ N`7@"BJlpHxHxHxaB"B"B/a@<"B OmHx/ /a*bO Jl(z #$CaZ @#$C"B zg/`z%E`B"B$B B%[ K%X%X%P BHnaBa0"9$*D*R#$*DR*.Ȼ*.̳-EBz-E-C-DBHxHj0GL/ aC Hn/ aGO JfJgj"B/aU6X`\ jP/ hN%@H jPX hJg/ NX+|E+Ja@z*HyL^HyKv/-/././ a+ `Jg / aPXJg/ aPBL</./.Hz`R/.a&Hz/ /NԀOJg/Hz`/.Hz/ /N` /./.Hz` /./.Hz/ /N L N^Nu%s NV/. /.a/HzHyaN^NuPPPPPPPaPGP.POOOOOOrOROPJg\HxHk/aCJO JgDHk/ENPJg0Hk /NPJg"/ HxHxHkHk/a&"pJfBL N^Nu$NetBSD: moddi3.c,v 1.5 1997/12/30 07:58:36 mikel Exp $NVH8B$.&. .".JjD@xJjD@Hn////a JgD@ .".LN^Nu$NetBSD: res_send.c,v 1.16 1998/11/15 17:40:38 christos Exp $NV#N^NuNV# N^NuNVH< n-X-X-X-PBB 90oԀ/N8T/NTPff/ /aHPJfp` SJnBL"n־Qf`vJmJg2EJga,BHxHxN#O mB~0gJfNJfJJf&Hx/./9aO Jm~#B/. /./9a!O`bEJg6|BBnHxHn/9aBaFh @BO Hx/.B/. /./9NO g p먌`&9$. AEJoLy80Jnv-y1|( "CC /HxHnN$O laE @~g`Jf 2|-I` aE @B~-GHn$/B/./ /9a.:-@Oo2|-I>"n־Qfl9.f/a\XJgT9.f&..Hsx/ ."@ / /aBOJg$~g ~g~fp먌aJg9/f+g2|-Ia`Jg9/gJf 9.faJ gJBBHn/./ /. /./. y NO~ev0; N nR~)m\Jg .`TR0mzR(mbaDEJf&Jf N @~= `N @~< `N`aD `N @ pL`8HxHz/ NO Jg$HxHzw/ NO Jfl ` g Rg fJfvLN^NuNV".lpF@ g pF` <N^NuNV/BHna# a".$.B0$.N^Nu$NetBSD: res_comp.c,v 1.13 1998/11/13 15:46:56 christos Exp $NVH?<..,. (nxʗ"n& ֮B LJgB z?Fg g^`Gn~gct. ЁchESkdBz.gz\fK cF\¼Sc8BASj`4Jl (Rz?…P Gbc T np`BJfTBJl( Le Jfjb JgBp`B L . b2~HBBB-@`8".$. &.(.쀄 cB`,~HBBBዂ-DJg LpL<$n(n &n,.*n&z/ / aPJgL(crf>$L(JfH rg b>rg`6Jfp`\/aj&(XfHzraB`>/B/arO BcJg// N*ֆPRbrf /aTB L<|N^NuNVH> ,.(.*.$n&. Bc//NPJfB` օRbpL|N^Nu$NetBSD: send.c,v 1.7 1997/07/13 19:58:06 christos Exp $NVBB/././. /.a VN^Nu$NetBSD: strtol.c,v 1.13 1998/11/15 17:13:52 christos Exp $NVH?<*n ,.$n"yLB I0(fr-6|gr+fIJgrfr0f xg Xf *IT|Jf | r0f|*<Jg*<LFXJg JoRDBB`^oJmPJgnfl x&<`xL8`.mf lx&<a# @r" "yL`xL8ւB1(grԁ`g8|A(g8|A($`rJg .Jg S* LB/aHn/<f~"D/a|%FO`B"D$aV( `Jg / aXJg/ aBLOga @%P0r%A,p`JfJgK-M*$F-y$F-y$F-n-n-R=|/.HxHnaO rg>JfHتڪ B?oR B?nnBfn:r%A,p`TGN @r`Lv֎G`a @rf"r-AHn/B/*\/*`/N$OmJl&GN @r#gHN @%P0r%A,p`rd,"j` jX"QfHx//*`G/ av֎// a OJgxG,/ /a PJf>*n U"h /./ iNPJf r&r%A0JgVr(/./ a`DJo>*n U"h / i NXJg&S`|$.r-A// a-Br%A, *,L<`N^NuNV n"n h","0"4N^NuNV n"n hA8r /./NN^NuNVN^NuNV/ / n$n"h . Sref0; N J*:"$*#A$#B(`H")$$)($%B`8"$*#A#B `(")$) $%B`$ J  `B`p$$_N^NuNV/ / &n$kJg rg /abX j< hJgHj8NX/ EN/ N$n&nN^Nu$NetBSD: bindresvport.c,v 1.14 1999/01/20 11:37:35 lukem Exp $NVH80(.$n r-AJg *g2a @r. p`EHxB/ a|O JjfJr-AHnHnHxB/a$Omr-AHxHnHxB/a$Oml/./ /ah$O JjfPGN @&JlHxHnHxB/aO`pЎgHn/ /a O JlN @ L N^Nu$NetBSD: auth_none.c,v 1.11 1999/01/20 11:37:34 lukem Exp $`,hr|NVH 0&y$*TJf"Hx@Hxa,&@PJfB`#$*TJ`@JVID-@ iHn/ hN`$ iHn/ PNJgJVID$p`B$nN^NuNV/. /.a`N^NuNVH0 $n"n ".gl$văgv$ vf2 j// / hNO Jg6Jg: j/Hy$*X/ hN`FJf8 j// / h NO JfB`&Jfp` j/Hz/ h N` vWIDL N^Nuxdr_bytes: out of memoryNVH08$n(n &n$/ / aPJgf&crBfX rg b0rg6`DJfp`>Jf/a$(Xf Hza`/// a`Jg/aB`BL N^NuNV n Hx/Hh/.aRN^NuNVH08$.&n &.$n(n/ /aNPJg `gP jJfJf B`//N`//NL N^Nuxdr_string: out of memoryNVH 8&n(n $T tgb tfJg/ a-@XHn/ aPJgh .b^"R tg b4tg<`HJg@Jf/aD$@(Xf Hzfa`$ .B2/./ / ar`/ aLBp`BLN^NuNVHx/. /.a4N^Nu$NetBSD: warnx.c,v 1.3 1997/07/17 21:33:30 thorpej Exp $NVHn /.aJN^Nu$NetBSD: vwarnx.c,v 1.3 1997/07/17 21:33:27 thorpej Exp $%s: NV/ /$./9HzHyEFNO Jg/. /Hya>O HzHyN$.$nN^Nu$NetBSD: nsdispatch.c,v 1.9 1999/01/25 00:16:17 lukem Exp $filesNV"n n //alN^Nunsdispatch: memory allocation failureNV/ $n *Cf("@Hi@/*a%@PfHzHxaHx/. * jHpRaj$nN^Nus%s (%d source%s): %s [ SUCCESS=continue UNAVAIL=return NOTFOUND=return TRYAGAIN=return ] NVH08$n"* <vf <///HzsI(NBOl&L j/0.HzaN j.Pvg`HzMN jX0.f Hz<,.*n /.a @XJg "h((`"nBJg IRPJfBBo^I&IBBJg $M//aPJgE R$ԂJfB Ѓ uJgHn/5/N"O f PPRn fpL<|N^Nu$NetBSD: err.c,v 1.15 1997/07/17 21:33:21 thorpej Exp $NVHn/. /.aNq$NetBSD: strcasecmp.c,v 1.9 1998/02/03 18:49:17 perry Exp $NVH 0"n&n B$yB02 rfB JBJfB`"40 pgB0r B+  L N^NuNV/ / nJg>$n&n "y`SJg(BB01 qg0qB+  `JfB$_&_N^Nu$NetBSD: bsearch.c,v 1.9 1998/11/15 17:13:51 christos Exp $NVH? ..,.$n*. (.g0$ L&ր//NPJf `Jo *چ$S(fBLN^Nu$NetBSD: printf.c,v 1.6 1997/07/13 20:15:18 christos Exp $NVHn /.HyaN^Nu$NetBSD: fopen.c,v 1.6 1998/02/03 18:41:11 perry Exp $NV/ /Hn/. a@x$Pg*a$@JgHx/./.aO JlBj B`F5@5B %J%|$%|,%|.(%| .gHxBB/ a( $.$nN^Nu                   !$&'()*+,-./0123456789:;<=>?@ABCDFGHIJKMNPRTVV  EFBFF216+-.::+&%/ /F!()*!!# F;;;;;<;=======;;<=======;================================;;  :9876543210/.-,+*)('&%$#"! ;;;;;;;;;;;;;;;;;;;;;;;;;<=<643210.-,+*)('&%$#"!  ;;;;;;;;;;;;;;;;;;;;;;;;;$NetBSD: nslexer.l,v 1.3 1999/01/25 00:16:17 lukem Exp $nsdispatch: memory allocation failurefatal flex scanner internal error--no action foundNVH?HR\f <`4 <`* <` <` <` <` <`/9$Ca&@XJfHzSHxaDIe:`"B2 yL0g y R/ NXb#$Ct <` y$CI`/9Hx/9$Cp/9$CaO`B`X $C$S$*l yJ$f#$*p ~!G$ (й$*peJԹ$C#a/a"-y$CXJg 9*@R#&@R$A`<&y`an~gmJgZ`~gt`B$*ta jJg$#$C 9S jR*@A` J$*tf/9aZX`Թ$C#a$@&y-y$C` y h$*p#a&y-y$C`HzaX`:L<"nt" ҁG&0sE0rg8(<BK, B(D2tz;l5<" ҁ(F0t0rf0sBC2qz;WIDf y$: X$:JWI* L<|N^NuNV/ / y$*l"yJfr y (й$*pb^$ $CR#a?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~NV . y00 HN^Nu$NetBSD: strerror.c,v 1.11 1998/11/15 17:21:49 christos Exp $NVHxHy$:/.aVN^Nu$NetBSD: strdup.c,v 1.9 1998/10/13 20:27:55 kleink Exp $NVH8(./a&R/a4$Pg///a `BLN^Nu$NetBSD: exit.c,v 1.8 1998/10/18 14:36:30 kleink Exp $NVH 0&y$FxJg"$+SkE, RYNQBBSd&SJf y$ClJgN/.a:Nq$NetBSD: fwrite.c,v 1.8 1998/11/15 17:19:53 christos Exp $NVH8(. &.-n$L(-B-BA-Hr-AHn/.aJg &LD0 LN^Nu$NetBSD: fread.c,v 1.9 1998/02/03 18:41:12 perry Exp $NVH?0,. ..$n&L8fB`` LF`V *lBB*(.$Gd(///NO Ւ؂/ a&XJf$*e///Nג L N^Nu$NetBSD: fileno.c,v 1.7 1998/11/20 14:44:14 kleink Exp $NV n0(HN^Nu$NetBSD: ferror.c,v 1.7 1998/11/20 14:44:14 kleink Exp $NV nA N^Nu$NetBSD: __strerror.c,v 1.14 1998/11/15 17:21:49 christos Exp $libcUnknown error: %uNVH8 $.$n (.BHza&Pd2/ y/0,/Hx/aO ./ a B2HO `,/Hz/<Hx/afO .// aIO/a* LN^NuNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGCNVH <(nJg*Jg$Hx// a PJg / a` HzGN$@XJfEHzN&@XJfGC$ Kg :g %fRIr(ev0; NRn`nnnnnnnnnnnnnnnnnnnn|nnnnnnnn|nnnnnnn| KJg$c ` LJgc`c `cRfVB/NXrfgR"BJf8pL<N^NuNV/ /B/.a`$PrgHn/a2PJg /a `hBB/HxHx/.Ba $@/aO rf /.Hx`* fHxaט @XJg !n`/./ ap$.$nN^NuNVH<< n(n &.(.zfa @z `pЪЊд(`$PG jSmx Ј"jR*AK$ (fLpЪ I"s( г( @Sm> Ј"jR*AK$ (gj AS`"ARl`Jl A`"AR`a @zS L<'ƐyZJ3ŻşŇfD0ĶģĔĀjH6$ôÒ}jW<Value too large to be stored in data typeNo message of desired typeIdentifier removedNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0U$NetBSD: mmap.c,v 1.10 1998/11/15 17:23:00 christos Exp $NV/. /.B/./././. /.HxBab N^Nu$NetBSD: index.S,v 1.7 1997/01/04 03:26:21 jtc Exp $ o/ gJfpNu Nu$NetBSD: strncpy.S,v 1.8 1997/05/13 19:27:26 jtc Exp $ /"/ g o"@gSfNuSgB`$NetBSD: qsort.c,v 1.10 1998/11/15 17:13:51 christos Exp $NVH?<&.(.ff~VID`zB~ ez(C$L.( Ђc&LdP/ $K/ *nNPJo~-GJf (&`*~m""L K " Sf`""L KSfĵdef// *nN"PmPfH~-GJf *n$*`.~m""J n " Sf`""J nSfĵddJfx(F$L.( Ђc&&LdP/ $K/ *nNPJoPJf . @ga& @~ `HxHx/.a3O |gHx$aŮ*XgaB8|f(@G/ /.a8PJmR.gDBHxHz.Hk 9$;R$;#@$*&*#B#C #j"vƒA$;"!`pL N^NuNVH08&n". tA$;I $TJgg(J$RJfJgr&*f *"* $+&+gHB/* /*/a$*&* 'B'CBOJo/ ahXJg &+m(/ aPL N^Nu$NetBSD: readdir.c,v 1.12 1998/11/13 12:31:51 christos Exp $NVH0 $n *m*#flBBJf:*#f2HxBB/a%@%A/*/* /al%@Oo("* j &fB4( S&* lB` ҂%AJgt (f *#fb L N^Nu` <N@eNu$NetBSD: fdopen.c,v 1.8 1998/10/13 14:07:04 kleink Exp $NVH<(.Hn/. a&Pg8BHx/a&$O m""z…zgpga @z B`Pa @Jg1C .gfC1C 1D!H!|$!|,!|.(!| L f* af" +SxeHx Hz k NP@g tOE` +"ҫ(L@B// a PJf"+ AD + pA "+V'@/BHk8a`dO Jg , g/`/</ a&P'J0BJg DD'@4x'D$Hx$a @XJfEN @$/ a`\!K!|`!|^!| !| !|!|!|x ` Jg /+aX/ aN @ BLN^NuNV/ /$nJg/*aD$/ a~ `p$.$nN^NuNV nJg h (rfaX @r pN^NuNVH88&n$. (nvB8'|'| x 'D'|x'D'|'|4'y HxBHkDEGNPO.@BHkNO Jg.Hn/a7 PJgB`'n /.a '@XJgj g/a '@r'A X n2 ,g'@4 ,g'@ ,g& ,g& g ga@ @x B`'l// aJWI( LN^NuNVH80$n . SLj4Rxcp/G VNv$AD"R! !%@ x%D$B/x x// aOJgp`L S%@0%@(ԂS%B,"<(*R%Af /<"+҆//.aO JgB8*XT`|J@f B/ B0/`J @bf//.// / a:$On~rf.-KHn/ aPJ@gPB/.?Bg/ a&@OJg$kB6t(- nBr eDr b $n *(,R%F((R*ʪ0&,*쫶mL *n$//HjaO Jg%BHx/*aR j!<Pfp`LRR,*(R/a,"* XlAD! %@ *,d %@0%@,/// arL|N^NuNVH00&n$. &./a<$@XJg&/// a/BHr(aUB/aJ& L N^NuNV/ $n/./. j N,(o0$nN^NuNVH08&n$. Hx/+EDN'@PgHx &+/N"@PJfEN @$/ axN @ p`&Bo k &+I !RRnBL N^Nu$NetBSD: bt_open.c,v 1.13 1998/12/09 12:42:46 christos Exp $NVPH>0*.&. &n(.a$Jg-[h K-Xl-Xp-Xt-Xx-X|-X-Pphf".xg  bnff .tg |lX`|-FtJ|f-|9|Jf-|:" .f.-B`&-|9|BlBh-B|-Ft-|:"Bx  g fHxGN$@XJg HxB/ aS$O |%Ff%ntBx%n|%n%FHx$N&@%KXg KBBBBBBBBBtg|B'J'|'|'| '| '|'|/D'|JgD ||g$mJg`|g `|/.//a*%@fO m`"|Ɔ|fa%@f|g|HxHx/*faO |gHn/*faPJf,.ԌgfHxHn/*faO Jm|ft 1bf |ͪ`|-ndAdhhhnd-n`A`hhhn`-n\A\hhhn\-nXAXhhhnX-nTAThhhnT-nPAPhhhnP 1bf|fx".  bbfZ$. |FfJ-Ax%nj%n`LJxf*-nx b-|x xc-|x.kf| BjB|%nxn"nlJg".xS g FC -@l nxA c-@l"@ *nC$ L@ |ІLnt@5@r @b5|r//*n/*fBaE$Ogn*f/ HyhHy/aFTO/ aX|g>gj@gjJl `Jar @|` af @|O Jg, *g /aBX *f|g /aX/ a$BL |4N^NuNVH8(nBB/aF$@O JgB/ /aHB`EN @rf|N @BHn/G>N$@PJg`Hn/N&@PJgPrfH&BB7|7lpr'A /,nB/ aNfHx/ /EA(NHx/ /NB`pLN^NuTMPDIR/tmp/%s/bt.XXXXXXNVH8 Hza XJf </HzHx$/a r-A-A-A-Ax؎/HnHxEGN/a &O rg /a XB/HxN LN^NuNV-|B.rgrg ` <` <`BN^NuNV/ n$hJgB/*/aFrBO *f *f`a6 @r p$nN^Nu$NetBSD: bt_get.c,v 1.9 1997/07/21 14:06:32 jtc Exp $NVH 0 n$hJgB/*/aEBO Jga @r p`nHn/. / a9P&@O Jfp`PJfB//aEp`:BHj^/.BB/ / a;$O*gB//aEf`%S L N^Nu$NetBSD: bt_conv.c,v 1.8 1998/12/09 12:42:46 christos Exp $NVH8 n"n(g2J f / a`"-Qnnn-innnn-inn n n -i n n nn=inn=innB0)xЄ&p xfBBBcfBE2 Ѐ=r02APhhhnnnXPhhhnnnXg\RPhhhnnnXPhhhnnnRBBb`pxfhBBBc`BE2 Ѐ=r02APhhhnnnXPhhhnnnXgRgZPhhhnnnXPhhhnnng\XPhhhnnnXPhhhnnnRBBbLN^NuNVH<0 n"n(g2J f / a0`"B0)zЅ(p zfBAAcfBEBG4 Ѐ62A8PhhhnnnXPhhhnnnXg\RPhhhnnnXPhhhnnn=r**RAAb`pzfhBAAc`BEGB642:A(PhhhnnnXPhhhnnnXgRgZPhhhnnnXPhhhnnng\XPhhhnnnXPhhhnnnB0=r   RAAb-Qnnn-innnn-inn n n -i n n nn=inn=innL 0(.&n *.Ba>&$D` R XgBRf *Xf9 A |l *Xf9 "Xf($< L"AC Ѐ0& "Xg zfaA  zgR`a$ Rd< /f0BHn/a"PJf . @f/`SeJg4HxHx /a&O m p`a`a @|g@`vJgHx/aPJl`Hn/aPJgaH @|WID`:$BBg0 zfa` yL0fR``a @| BL |N^Nu$NetBSD: hash_log2.c,v 1.7 1997/07/13 18:52:05 christos Exp $NV nrBcҁRbN^Nu$NetBSD: hash_func.c,v 1.8 1998/12/09 12:42:50 christos Exp $NV// . "ng$^ve0; NrdVH:,"҈B A"҈B A"҈B A"҈B A"҈B A"҈B A"҈B A"҈B ASf $&N^Nu$NetBSD: hash_buf.c,v 1.8 1998/12/09 12:42:49 christos Exp $NVH><&n*. *nBBBJg$mJg gJf>t`: +S&ƀ "+ k(p 4<$@, ŕ$FxȀBJfJ0ftJfD/ // al$@O Jg B/JWID///*/ a,JgB`4Jf., )<`$ R!j j %kC$'J j L<|N^NuNVH><(n*.BD&lJf+gBHxEN&@XJg/, N'@Xf/ aB` ,gDS)@`: S!k k J f +g k0+J@g 80 g B|́//+ /+/ aOJf+g< ,S"+ $Ā,, l pJ0gf0,g|!,`B,*KJgBB$mB*J*ft6 fl j0g480*gBB/* /*/ aOJfB B* R!j j l%h$ l!J j Jfz'n BJg "E#KB+`|'lC&)K k L<|N^NuNV"nA . Щ S")rop#@!H N^NuNVH88(n(. &. ,f `p`$@$ gpJ f*g.Jg**g Br€//* /*/ aOJfJg, *Gg/NX R!j j / N$lX`$R`BLN^NuNV/ $n n BB B("P#h"h""j!i "j#H"h"$_N^Nu$NetBSD: bt_put.c,v 1.12 1998/12/09 12:42:47 christos Exp $NVH?< n*. ,.B(hJgB/,/a1BO ,ga @v p`x~g b&vf`,$ ga @~ `B"E")"F$) ЂB8,rd丁dbHn// a+O vgpЎ-@tԎ~-GHxHn/KNHx"EHiHnNv*O"."F$)҂B0,rdpHn// a*O vg Q-@tԎ~-GHxHn/KNHx"FHiHnNv,O"E")ҮB0,re$vf B/,/a. &@O Jg8,`pJxgHn/// a-@OfHn// a#-@O gj"n&Q8)vfJgJB/ /a/Dp`Jg2,g*?Bg/ // a O~fB/ /a/ `"F )"EЩ2| E& ~Ƈ$CB0+B4+" Tc&?Bg/ /./// / aOJg`,pЂKDc B2Ѐ/A/HhNO TkB2A0+J7@1B0+E"E$"F$"E/)// N"F/)/"E/ N,$ O f&,f0,@bR@9@Jxf@Jf"B2B0+~ЇSf$v)Cx9D`JfJDf~)GxBl)S|Hx/ /a-O v f"nB0)/ Q// a vBLB/ // aO Jf(4*// // NO~gH0*fxSjJ@fB0+~Їg8Hx/ /a&O JfB`,B/ /a&x`B/ /a&j`/ / aPJgpL<*n*. t&ԍ`$B//a$&@O JgP8*B6փIB048E*gHj / a!(P|gB0+|І|f@f7|7mp|'F `/ / aNPJf/ / a!PJg`t Ԓ|ĆB0+A/ /Hp(ajk648 LO 0S@ @g2AcB0TQB0+|І∐D` 2(AcB0S@fUkHx/ /a%O ` -Rg"@]+IR$@]`Jf|"Ef"Hx//a$B`2B/ /a$p`"B// a\PJf// a Jgt L<|N^NuNVH<<*n&n(.-$ f(*-f B0-f// /. / aOJfN&փIB048E*gHj / afPzg *gp ВHr/ aFPzfp` *Вt ԀząB0+A/ /Hp(ak2t8 L0S@ @g2IdB0TQB0+zЅ∐D` 2(IdB0S@fUk-$ f*-fB0-dSmBL<B/ /NO -M=CJf HxBB \//Hn/ aJf+BL<N^NuNV/ / &n$n *g.B//a @O Jg4!jHx//a!(O *g.B//a @O Jfp`!jHx//a B$n&nN^Nu` <N@eNu`tpN@eNu`d <N@eNu`P <N@eNu$NetBSD: strncmp.S,v 1.11 1997/07/24 19:10:41 jtc Exp $ / g8 o"og.f,Sg$g"f SggfSg g fSfNuUINu$NetBSD: bt_split.c,v 1.10 1998/12/09 12:42:47 christos Exp $NVH?<*... *n&n&.(.BBB=n"t"Gf/HnHnHn//a:`/HnHnHn//aO(@JgB2.A0,D9@1B0,E"EJ)l"$/+// -|"nNO `6$$/-// -|"nN/+// "nNOt"GfN"EJ)l*/././/a`(Hx/ "E/aO `r/././/aOtgt&ԅ-B`((.*nB/"E/a(@O Jgr2*RA=Ap tg:e tg`tgtg`B0-C-Iv ֑tƂ`B0-, ܀v "F֑tƂ"E$iJgp"F)ffJf AcZ"DB0)tЂt01 D-PA -H"F-Qt Ԇ-BHnHnN-@p ЮtPc&`B` v`a!jB2,B4, B TcL. tf/HnHnHn//a`/HnHnHn//alO(@Jg2|-I`:pЈ0nHc$B2Ѐ/ Ht Ht "nNO TlBp tgbe tg`tgtgV`B2.A0,C9@1 00 E//./ "nN%UO `B2.A0,C9@1 00 E"FG Jf$`$X$"F) .f // / "nNO "F)g4//a >Ptg`0.gG03 E`$ nB0(tЂt00EG/a *$"D%QB2.0,C9@7 03 E/ a$%UP`0.gG03 E`$ nB0(tЂt00EG"DB0)tЂ$%QB2.0,C9@7 03 EB0-Ђ$%U`aJgt"Gf4"EJ)l/././/a`/././/aOtglHx/"E/ajHx/ "E/aZO"E )Rg$]#BR$@]`JfHx/."E/EA(NHx/."E/NB`PHx/"E/aHx/ "E/aOB/."E/EA(NB/."E/N"E/)apL)pG=GO=GBFBEBDB0,~Ї=@EcNBBnf $.B`p G~g4e ~g`~gL~g^`z=D"n=s$nt Ԓ`B003 E *Вt Ԁ~ć*~Ƈ`.nfT@3@ .LBHj^/.HjV/// a\$O(*gB/./a`%n LN^NuNVH08&n(n n .Sve0; N@@JgJfap~ @v p`Hn/ // a`tE?`B0($0B//a`O B//N @O JgB0(vЃgp g(Bl`rB//a p`dtE?`B00$0B//aO B//N @O JgNB0(rҀgp g(B0(vЃS@9@BL N^NuNVH8<&n*n &.BBE*gHn/ Hk/ a`B//I?N @O Jgxg x gT`*fP4*RBB2B0(xЄ∰f$(B//aO JgLB//N @JgPBB``*g@*;j`J4*f<$(B//aO Jfp`*B//N @Jfp`B0(xЄ4SB*;BBL<N^NuNVH8<*n&. $.$n/ // a&@O JgZJg-f@-S=k$S`~ nI?(gB/ /a"O B/*/N$@O Jf n"xfB//a `&B0*xЄ7@S@7@/ // aO Jf<(n S"TgB/ /a -S=kO `=k0+fJfH n(g B/ /a n"B"3n`\B2+ SB0(xЄ∰f:$H(jB/ /a 6O Jfp`(B/ /a $@Jfp`Bk&"B"3kBL<N^NuNV/ $n *g/adBB*$@$%n 5n@$$nN^Nu$NetBSD: bt_search.c,v 1.11 1998/12/09 12:42:47 christos Exp $NVH?<&n*nC&'IRtBB//a $@O JfB`'JBF>*pЇ8gL* P4J6B7C //. / aO Jf*gr* `Jo <RF4SBJ8f*gb$ P+fLJFfJg/ /. / / aOJf2" 2(AB0*rЁ∰fJg/ /. / / aZJfB7F `B6gSC kR kR1C\RB0A00 $2B/ /a 2O `L*"jR+I/*p ВHr/agR"B#j"`"B#jp В"BL<N^NuNVH8&n n"PJhfJf)fp`B)g"B0(A00 A(f"`&B0(A00 A(gr ҈` I -L-PJg(HkbE^/ Hn// a"OJgp`-RHn/. kNLN^NuNVH? n$n ,*$*(d$"P RS~g$BBg  `RRQBBSd LN^NuNVH< n$n p&*"$((d""P RSzgfRRRQBASd c RL<(n n ,.zڬn(&(K=p`؅&JHn/ N$@PJfp`j$BBr%A BjBj$Ad$//HjNO Jg'RHx/ /aO `"F"fHx/ /aBL<|N^NuNVH 8(n&n Hx/ HnENHxHkHnNB/./G?N @O$Jfp`R(gB//al`:tԬnE=>`B/./N @O Jgĕ-h// NPeBLN^Nu$NetBSD: bt_page.c,v 1.9 1997/10/10 21:08:53 is Exp $NV"n n B!ij#PjrHx//aN^NuNV/ / $n&n *jg(B//a @O Jg&j%hjr` / /a<$n&nN^Nu$NetBSD: mpool.c,v 1.10.2.1 2000/01/15 16:23:15 he Exp $NVH8 &. $.Hn/aWPJf . gab @x B``Hx(Hxad$@PJg$%JBC A "PPRxl%n "B///./.a%A%B%C LN^NuNV n!n !n !n$N^Numpool_new: page allocation overflow. NV/ / &nrfHzHyaa/ a$@BJgb +%@ n R| *SrC$%If#J` Q!J"%K%k f&` k!J'J *$n&nN^NuNVH00&n$. eaaZ @v`"`D&`|// a$@PJg *SvC Rf#j`!j jg $%If#J` Q!J" jf'j `!j j g!j%K%k f&` k!J'J*`/ a$@XJfB`"+ L/B//*/+aOgJma`^ @vO `%B| SvC$%If#J` Q!J"%K%k f&` k!J'J kJg/*/*/+$N *L N^NuNV"n A(.ABN^NuNVH8&n$S"JIg: jf'i `!i "S i f&`!i/ NX$S"Jf/ NBLN^NuNV/ / &n$Sg$*g/ / aPrfp`$jf/+aJVI$n&nN^NuNVH8&n"+ e$Sg*ftg/ / arg *SrC Rf#j`!j jg0 jf'j `!j j g !j `8&`"`$jfzrҫ/aU $@JgI%LR`BLN^NuNV/ / &n$n k Jg/*/*/+$NO "+ L*/B//*/+aOgp` kJg/*/*/+$N*B$n&nN^NuNV/". StP"n Qgf ` PfB$N^Nu`\0&n,. (.ȼo$Bz"KEB6"4 ꠂ@2RnB037L |N^Nu$NetBSD: isinf.c,v 1.6 1998/11/14 19:31:01 christos Exp $NVBK f fJ gr N^NuNVB . f J WID N^Nu$NetBSD: strlen.S,v 1.8 1997/01/04 03:26:27 jtc Exp $ o FJfЈNu$NetBSD: memchr.c,v 1.9 1998/03/26 23:53:36 cgd Exp $NV ..Jg nf S`SfBN^Nu$NetBSD: strtod.c,v 1.32 1999/02/06 16:01:22 kleink Exp $NVH0 &. C$< qJg#`t $@Hja1 @!C!BBB L N^NuNV"nJg )A$< "!N^NuNVH>8&n*. &.(+E"J $L(ԃB@H@L"BAHAЁ&BCHC<HF<"RnJgFm6(kR/ a$@ +(@HlHk Hj a/PO.aP&JE%LR'D L|N^NuNVH<0$n&. (. P"L<89ЀBplЀRm/a @!nz!Et Xl*E GI"@HiHx /N @O RnR`"E `I"@HiHx /a @O Rn L 8&n(. &$+ Ы*R +lRЀm/a$@CBXoBRnA +I & |Ȇgt B 騀""䩶b"g R`"ضbS%E/ a L|N^NuNV/ / n$n *"(g `&tԈ"BE a""g pc p`eB$$_N^NuNVH?<$n&n / / a$PfBa(@~)GB`Jl (J$K&Lt`B/*a(@)B **EK\, +GK -MCB&"(  A$BBHBJlBCHCBDHD ЂXX$BBHBJl23HXecH"  @$BBHBJlBAHA ЂX$BBHBJl23HXb`SJg)E L~9mB~m"n(IC "AC -I`~m"EC\ (AI * RRI~/m-JIfRIJf.`RRI~0gpЁ~e-K-FB"AA` (AA`RJgtݮro4 R~m"n(IC. އ-G`~m "EC\* څRn R~m"n(IC A -H`~m"EC\ A *BRIpЁ @~ dt~eg~EfJf JfJg-KBRI~+g~-f2|-IRIpЁ~ en`RI~0gpЁ~eRtԁ K`~9m"BC, (AI $ RI~/m ~m No:|N`*BJg. D*G``&nJfJfJf&n`Jf-J$ ~lt.@Jl N^NuNVH?<*n .-*noB`*n E-JS,Ih*nG"KAh R,L@`-FgBB" L$ԅBAHAL B@H@(؀*BEHE" $ԃ&BCHCJlBAHA Ѓ&BCHCJl23BXdJf`SYdJg*n+G/. /.aJmR-FBB"K$n," $ԅBAHA B@H@(؀*BEHE" $ԃ&BCHCJlBAHA Ѓ&BCHCJl23BXdAhJf`SYdJg*n+G .LSBSk B-B` D-BBJmB-n&.׮`&.藮-CDBv dB~vlYB2|-Ivej"n0;N "@&Dv-C2|-IxB`//U('t"$//U `//T@('t*,&n0//U8\//U (8xoZ.<@$0|//T//U#'t"$//T//U #'t*,`//T@('t*,0//U8//U (8Rmv`//T&.0T#>'t"$x.<@$0|`R//T//U#'t*,//U `//T@('t*,0f( #0gR`8&n* , -n-n .mvm A"n0TJl6Jn0BBJm>t-Bt`4t-Bt`*t-Bt` t-Bt`t-Bt&-B`Dt-Bt#-BBBHnHnHxHna Jtg .f8` a @t p`&BBHnHnHxHna rg". $.N^Nu$NetBSD: isatty.c,v 1.7 1998/10/13 15:05:02 kleink Exp $NVHn/.arVIDN^Nu$NetBSD: ctype_.c,v 1.14 1997/07/13 19:45:45 christos Exp $ ((((( AAAAAABBBBBB ` <N@eNu` <N@eNu$NetBSD: tcgetattr.c,v 1.4 1997/07/21 14:09:16 jtc Exp $NV/. /<@,t/.a|N^Nu$NetBSD: bcopy.S,v 1.13 1997/05/15 16:07:31 jtc Exp $"o o"/ mj mX gSg2U g"S""""""""QB@Sd gS"QgSQ /Nu mX g Sg3 U g"S# # # # # # # # QB@Sd gS# QgS Q /Nu$NetBSD: malloc.c,v 1.16 1999/01/29 08:11:36 kleink Exp $NVH< (. 9$C0*.(. BJf /a~`Jf /aB`$EY f |B*`&Hx/ GN"Pl/9P/ N"Plr Vt y$C<&cY`C($ Jg.Jg Tr᩶oY`A"ed `2/aX/a&XfB`g d ///a L |N^NuNVH0 $."n BE$BB ZJgg gR PJfRvlpL N^Nu$NetBSD: stdio.c,v 1.9 1998/11/15 17:19:53 christos Exp $NV/ /$n/./. 2j/ a @Jm"[IӪT$*PՀ%BP`j $.$nN^NuNV/ $n* gHxBB0j/a(Oj /./. 4j/ a$nN^NuNVH0 $n/././. 0j/a$&prfj `j %BP%CT "L N^NuNV n0h/aVN^Nu$NetBSD: fwalk.c,v 1.7 1998/02/03 18:41:16 perry Exp $NVH08(nBG0Jg.$k$+SkJj g/ NXEXQBBSd&SJf L N^Nu$NetBSD: getpagesize.c,v 1.7 1997/07/21 14:07:11 jtc Exp $NVJ$CDf8r-Ar-Ar-ABBHnHy$CDHxHnarfp` 9$CDN^Nu` pN@eNu`pN@eNu`p6N@eNu`pN@eNu$NetBSD: lseek.c,v 1.6 1998/10/14 11:25:19 kleink Exp $NV/././. B/.HxBaDN^Nu$NetBSD: sbrk.S,v 1.7 1999/01/14 22:48:20 kleink Exp $ 9TѯpN@e 9T#TNu`($NetBSD: sysctl.c,v 1.8 1998/11/18 20:51:51 kleink Exp $/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinNV/ /$n". n"n .tg/.// /// a`Jga @t`tftf$JgtWd$tX"JgnHxXHz3/a^`\Jg tep `t"BJg *Utej0; N0&008<@ZHPPPPPPPPTZ B`@ `t`t ` `  ,`B`t ` `a @t p$.$nN^Nu`` <N@eNu`L <N@eNu$NetBSD: cerror.S,v 1.9 1999/01/14 22:48:20 kleink Exp $/a. @ prNu$NetBSD: bcopy.S,v 1.13 1997/05/15 16:07:31 jtc Exp $"o o"/ mj mX gSg2U g"S""""""""QB@Sd gS"QgSQ /Nu mX g Sg3 U g"S# # # # # # # # QB@Sd gS# QgS Q /NuNV <$FN^Nu$NetBSD: skeleton.c,v 1.14 1997/10/20 03:41:16 lukem Exp $$NetBSD: nsparser.y,v 1.3 1999/01/25 00:16:18 lukem Exp $compat/etc/nsswitch.conf%s line %d: 'compat' used with other sources%s line %d: duplicate source '%s'NVH80(.&9 y$C  fSG$CPJoNHzk/ENPJgHzW y$CL/NPJf&/HzHHzWa`N//Hz4Hzpa`:Bl/ y$CL/0.aPJgRmA$CX /Hy$CHaL N^NuNVH8 $9$Fft7F` 'nԂ 'o$<' 9$C&9$C(؄//E*N @PJgN#$CA:#$C //9$CN @Jg*#$CA<#$C#$F 9$CЄU#$DB`pLN^Nusyntax erroryacc stack overflowNVH8<(.&. *n$ntJg/.//av8$O m^JgBpfB-mBB-mBB-m / HnHxHx/-`/ BHxHxBaI*&@OJg$kJg -gj%mgm`|  *zF%EJf @ %@`%BJgIN @BHxBB/aOz|fPN @|fFf,j Hz/a3%@Pgp@%@"<p g"<%A`:pg zg `j Hn/arPJf,.fj'|&'|'| '| '|֞'|,'|BHx/a @O Jgn"( z|fz…|!F Hx`B//aO Jg(-g * fHx/ jNPzg `p` * fHx/ jNPrg&j`a& @r p` *gd& * f/ / jN$Pfb *geHxHk/ a $(@O Jg*$%K /./ / / / a $O*gB//a`%T L<N^Nu$NetBSD: rec_get.c,v 1.10 1997/07/21 14:06:44 jtc Exp $NVH 0 n$hJgB/*/aLBO Jf n P&PJfa @r p`xc * gp`b/ / jN$PfRHxHk/ a &@O Jfp`4/.BB/ / a$O*gB//a`%S L N^NuNVH?<&n,. +bc0"+^f /aX` //alP'@^fp`'kb-k^-k*+cpKpI$+$k^B`/+N&X~g Sf꾃gJg/+// aO BHn// NOJfR~gbbB`kpLC2C4XXXTlB003 C7J03JCX@7JUD6*nS8*F-BL*",8"AR)I8Jf ,(RRL@4o/ a.`/ / /aX`p`BL<<&n*n "n(.(k&+ zgJfBU`Jg$I<$n*n &n8B0<2 &:2:42 m5:/-/B0HrINk5:/+/B0HrNTD45:Br:B20+X@m@5B05 L<|N^NuNVH 0&n$. lJ/+ aA8E,$Xg2HxHxBAB20*/// aOJf ` /aBL N^NuNVH8 .". $.v n D B` (欀LN^Nu$NetBSD: hash_bigkey.c,v 1.9 1998/12/09 12:42:49 christos Exp $NVH?<&n n$k-P.("n*Q,)B002 Q@Jg-|B" 2(A$l$ =R"n:2B//.B0Hr"nNծB6R5:R4B4 VЀ2@5*B05 5:/ /.a&@OJg&B6Jf^02:gR$l$8:2:D5:// B0Hr"nNœ5:B0r B05 O `5:$k+B002 Q@JfB002 Q@JgB-|>$l$8f "nfSDB0:2 DB4// B0Hr"nNB6R5:R4B4 VЀ2@5*B05 O Jg$5:/ /.ah&@PJfp`$$k`5:+B002 Q@JfRBL<&n"n .(n*. i p f2BBB/ 640:// a:|"@OJgZ ip hg p f"@OJg i$I8*4(BC`B0Jp f:40 6(B$I8*B/ B000 // a9"@OJft`B20 K(B0()@Jg PfB R$|'F(`~B/ B000 // a9 @'H gj|'F( hJPfLR$B `B/// / aN)@O|g4B0 f/B0Ъ//+a͜(B`ax @| pL<|N^NuNVH<<$n*n &.(.&mB0+(j :- kf~$Ԍ *g /aX/a%@XgJgr%A( Sf B R$`vB/ B003 // a8z @%H Og hJPfDR$B `:B/ B003 // a8>OJgJ/Ht8// a$Oo4B0 f/ B0+Э/֪/al `aL @r pL<0(.,. *.&n $.BHnHn//aOJfN/././axO VIDHn/a7@ Pg"B/.?Bg/a6.'@Of p`B FJg E(!B$h4B02r 0r RBB05 RBB0Br 45 B0YH5 &'F n$h(2 AcD4*B00r 2r 0U@4XH5 B05 /./a @JgT5B` nJg&`'HBL |N^Nu$NetBSD: rec_put.c,v 1.11 1998/12/09 12:42:51 christos Exp $NVH08 n(n &n$.$hJgB/*/aj^BO *g"+ *gzeⰪbc.J^f /aX`//*^aP%@^g%jb/+//*^a"+&*/B*/Ҫ^/ap-j^-jO` -S-kv eZ0;*N4RR$4RR>R4*$g4&j `@ T&PJf86|t`0 T&PJg`& T&PJg b p`a6 @v p`c * f/ / jNPvg *Rd|*g4/*a"-AXg *-@/B*//aoO `"BB`BHn/*/ ahOJfn *Re*g /.atX/HnHk/ a2OJf v f%K jB/ / B/ a"L N^NuNVH>8(n(. &n&.B0,rd$9p$5p$/G\$(PT$#PT$ Y$$x$T$X$ X$)t#c#r#r#(#$#^#b#b#g#g#ll#n#x#}#}#@## 4# # # #z (#t (#n (#h <#d <#Y #P #K .#G 7#A A#= E#7 y0#. ~#* #$ z# # # c# d# d# d#>H"B"B"G"X"X"b"fP"hX"hX"}","""P"P"!!1u1e1^1K1G131,110"" e j   ky JKYdu f   bvz!w" (F2R r u'g<<p%[)]*())*{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVqQ:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular file (use -f to see it),,aѨϨϊb @πuBьP%cεd`Κ΄ejV6fgќ͸͆hmJiѤ*jѼ̺kH,lHm8̭̟̓n"4|kKo@Ov5pHP,qr!Ѹˠs!\gJS!d:*t$TBu"<ʼVw!Ѱʐjx$^DXA yzɴɕ"TɌ?Ā (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done|332-V@?yI?accddfhlLnNqqrSt|TtvlVg1b9^ZYbA hKAa0X(g)2)-)()$)!)(g)2)!)5555????5      ބt|(l           #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-Ќ CCзFвfЫvУVНuИuБsCopyright (C) 1989, 1991, 1992, Free Software Foundation. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. $lRЌ`iH\]MZI;VJ;SKQ NLLfAN8<4OQ0PLx+QЌb#<(<< <<  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ 00123456789abcdef0123456789ABCDEFNLN LN LN LNM N M N M N MV: ?t2t0t.t,t*t(t&t$t"t {! &  )''  +, #$"%%(*  >i? j] a"5:; )% ek/09#!Uw'&`d834xr(LJc6vzX2MNK7*1+,=.-Cl !uvmno0"p(,).qr:+ q, , ,n , X c; X X X X ,g u\c , , , , , ,S{Wd ,) X F*nq ,nn k )X L  F>>%a$ FXn Xch-)c F FX F X X >>>>>c> .n F > F F F7aan ;> nanaaa67 \9 p&KP/ KGppJ c:; ;`p } p ? z *tFcHILObvFb g`[A[P^<5^'g6gA&PbbggwAg$A$OAbbAADA\]_[\_\^A%&g3[$$@b$'$$4$[\]g'$WXY_U\b@Vx@z@@@@AA@QFEQ@GW\]USTV'X$@$@#@@@'@ ff@RYZRDH#OIX#Qff@O@f@#Q=#[{|^5Sg6Pf gbSSORb@}~DAAAgfAA_\AAAAAAAAAAAAAAAAAAAAA$$$$$[S$$$$$$$$$$$$$$$$$$$$$@@@Q@@QFEG@@@@@@@@@@@@@@@@@@@@@@@@R@@Rf@@f@@@t@@@@tt-ffttttttSZSS /12888>8t 88BR888888y&V58@6$V8V*8LM8t88888888/   8ut/8V8ttuuuu Ns8s8tt!888sss|s||o|%o79;8Ouoo8888888888ss;8s8Oo88|sV**oVVsO EF*O)s,-0OG2OOOOOOOOuOuu;**s*usOsOOO|sOs#||oWssossO*WW**OOOOO*W* .51*364*{W{{{{WW{  {{{{{{{{{{yyyyyyyyyyyyyyy@@@@@@@TTT@@'T'@@k@@@@@k@@@@@@@@@@@@@@@@@@@T@@@@TT@@<<<<<<^< _`abcdefghij  _`abcdefghij <<@@@@@@@@@@@@@@@@@@@@@@'BBBBBBBBBBB<<<<<<<<<<<<<<<<<B<<<<<@@@@@@BB@CCCC@C56CCCCC _`abcdefghijC BBBBBBBBCCBBBBBBB@@@@@@@@@@@@@@@@@@@@@ppppppppppCCCCCCCCCqq qqqpCCCCCCCqqqqqppq56qqLMBBBBBBBBBBNpppppppp}}}B}ppppppp}}}}qqqqqqqq~~~~qqqqqqq~~~~}5 E6'LMJ~BBBBBBBBBBBBBBBBN56KLMJ}}}}}}}}}}}}}}}}~~~~~~~~~5N6~~~~~~~LMJ EF56GHILMJ5N656'LMJLMJ ENF"GHI(+N/P N5 6  EF56GHILM EF56GHI EFN EFGHIGHI  h hhhh h EF5h6GH 6@@@@@@'? hh6hl lhhhllhhl5 6l  lm mmmm m @@@@@m @@@@@  llllnnlllll nnnnmmmmnmmmmmnnnnnnnnn),)$)!,;$,) (,+[-D;D),:;&,!? $;>(:;+-;/!")]),,];]m([]q( q!{)$,](;+]-(/,<,,,!"{;;p%^|]*]{!/($ ,(;;+-/({}([;;;>;;%!"(*+{-!/;$34)((/+^-/{!}$((+-/{{){{,;))>);)^|:;{)}?{(, !$,( ]+-{ ;> | {#$  {!"   !"#$ |   !"#$     !"#$   j !"#$ ,!"#$%&  :;>?346 EFHIJKLM !"ij|5ef@lSTUVWX+,!$l(p+;-t>#<>cks,| :;>?|#, :;>,#D:;)>,|:;    mqr5|@]!&|STUVWX { lp t"'(+/!"#$m efl   ,), 02;>    !$%()*+,-!/&!$:;<(>?+-/!|$%)*+,-/]^:;<>?)!,$0(2+-{|!$%]^()*+,-/?:;<>?{|!$%()*+,-/]:;<,>?:;>? {|!$%]()*+,-/:;<>?{|   |] !"#$   {|!"#$ !"#$     !"#$ !"#$   !$%()*+,-/   !"#$:;<>? #$   !$%]()*+,-/ !"#$:;<>?{|!$%()*+,-/]:;<>?!$%()*+,-/{|]:;<,>?:;>?{|!$%]()*+,-/:;<>?{|   |!$]^()+,- !"#$:;<>?{|   ] !"#$   {| !"#$   !$%()*+,-/  !"#$:;<>? #$   !$]^(+-/ #$;{|,   !;$>()+,- !"#$:;<>?{}!$(+-/];|!$(+-/{|;  !{$}(+-/ #$;{}!"#$ {}   !$(+-/ !"#$;!"#${}!"#$!"#$!$(+-/;!$()+,-:;>?{]!"#$!$(+-/{|;!$%(*+,-/:;>?!$(){,!$^(+-:;<>?|]!"#$  {| !"#$!()+,-:;<>?]!"#$  !$(){|, #$:;<>?  !$(),] !"#$:;<>?!"#${|!$%(]*+-!/$(+-;<>?{|<>  !^$(+,- !"#$:;>?|!(|+,-:;<>?  !$(|, !"#$:;>?  !$|(, !"#$:;>?|  !$(+- !"#$;<>?!"|   !"#$|  !$(+,- !"#$<>?A  !$(+-/ !"#$  !v$|()+- !"#$<>?{  !$(+- !"#$:<>?!|$(+!-$(+-;<>?<>?!| $(+-/ !"#$!$|*| ! $(+-!"#$ {!$(+- !"#$<> !$(+- !"#$:? |  !"#$ !"#$!$ (+-/),!"#$:;?! $(+-/]!"#$! $(!{+$-/(+-!"#$! $(+-/ !"#$!$(!+$-/(+-!/$;(+-/!$(+-/ ),!"#$ :;#$?!$(+-/]!"#${ ),!"#$!"#$:;?]!"#${!"#$!"#$!"#$  !"#$), #$:;?!"#$]  { #$   #$Z VP?#(J,D?#E;-7?#*f04-2(#1?# *6 65?# 2(?# ?# ?$ J?#4?#,v0./?#+ 3?#)?# b?#?#*?#+f?#"?# 2?#  R?#$R?#$,y?#&q?#'k)(END OF FILE)<x]A$iE*    B  h            F  n  ?LILILKLILLKLILILHDLHLJ2LILJLILILJLIW/dev/ptyXX\^:   }) 0`8AdP.Q/tmp/EdDk.aXXXXXXL\\,[[\[[\z[[[[].[[_[vFPFP*0 XXX,,x<<uuuuuuuuuu{uu um ug@u`uZ @%s: can't read disk label; disk type must be specified......W7Y[[*1=?P?).0@0#DF^FSTUfSTUf<<z!H<*> tpB|$"Cc{.mmR*9*s,\?# !"$'(+-.03569: f  > z  ~ f m  f f  d  b g$ggh X O @ 1    0 ) $      T C C ) UGHRBD M@dmCXLS1@2 #   ʷ ʤ ̨ ̘ ̈ x f Q D 7 *    ˹ ˦ ˕ ˅ t b S B 1 @   4 !A !G !B !b !C !c !d !rE !mf !Zl !FL !9F !+F !&" !i !n !x h s q r e v q a V H w O NT O Nn O N O N O N O N O N O O O O$ O O@ O OZ O Ot ? u  4 p  4 j 4 ^ 4 Z 4 T , i ` E ) v Q -  N  Y  T  K f A f =  8  2  +  %       h  n               @         f  &  &  x \ ' * i@i""<  @ @ `  N I B =# 5# )# %# $ $  $ $ % % % % & & ' ' ( ( ) ) * * + + , w, s, m- d- a- \C RC MD BD <E 2E -F "F c c  d d e %e # &           @ @ @ ~@ x@ n@ i` ]` Y""L"l"\ A{}abcdDgGhHilnNpPqrs tw xy !:#="4"8 i   |  u s m k# 8  send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle command line editingset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandset socket receive buffer sizereceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileset socket send buffer sizeshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode C{ B ` @u B ή 8s B L 1s . (t B , #t B t; B z9 B tT B t|  B t B t u B u B J uC B u]  6 up  u B u B < z9 B u B t B Td z ļu B ķv B  IJvS B  ĭv ī F Ħv B Ġt; B Ĝv Ě 6 ĕx  Đv B čw  Ćw) B ~w8 | wwN | L rw{ | L lw  p hw | L cw B [w  b Vx  Qx" O J Ix" O J Cx6  r =xh  8x B 1x B | ,t B Td 'x  y B  y] B V y B y B y V { . z B H z9 B zX B ( zs B ¢ z z z  z B 1& {  B ûz B R õ{0  R í{W   å{u B à{ . ×y- B x Ò{ B Í|  Æ|7 B > |S B h x|g B $ p| B ^ i| B c| B L ]| B v X| B R}  B M}* B E}D B B Cv ī FU I I I I I I I|0123456789abcdef  ^ 6  X 8 pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD         ~ v r m d ^ T P L G C > 7 2 ) $       ! " # $ % & ' ( ) * + , -  ... ...?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@8888~ ߠ  ,  l 6 F L ` l  6 F n  l l 4 6 F n  l x 4 6 F () +*' . '' 6* ߿(001b'05 '' 6 F@I/IIHHHHHHH@HHH HH@Ht HlH` HZffsOO#8 #@#DefIi}mvnpsixav^VXENCDa=b5u(qd!!!!}mu=IUa!/   !"#$%&'()*+,-./012                                                                                     unblock and -DNO_CONV?v@ ŒxV`0XL:zV`Ljtň~6\ФHԂ^TtrѪҒnԞ NN\L|LMPNQNMLR QRKLJJS,KK^TTdRRM"MPRlRRM~MNSSOJQRF{GF3IJDEzk8$9@OiYPC0ST:?~w6QC7<>U~vXbR;Y=BbPA(RQMvN</CHVWT@KL'R>&5,߳ߤ-l]%-)0޽ޯ4sc#&.1ݹݨ(݋u3OB/ 2$ܩܖ*xe+D5 ۸ۤۆy bS 4% ڦڙ ylB5ٳ١نx"\N6) عتؔ؁!bN 2' ח׊ug=)֥֎S<ռբ1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RYK"""Q"7I: UH""@""NG"PTW""D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""6H8H@;5vB6OF? fwdbck:!!~!{!n!k![!X!C!@!,!)!!!!             | y g d U R @ = + (   }zjgYVIF0-!!!!!!!!!!!!OAOBOCOD77#>>>>> =@====== ==== ==@====== =@=z=o=d=\=U=P=I=D=>=8=1=*=#@=@= = =< <<<<<<<<<< <@<<<< <@<<<<~ > /tmp/mygate where is the IP address of the default router. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 elif [ "$_mp" = "swap" ]; then echo /dev/$_dev none swap sw 0 0 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. You may also wish to take this opportunity to place NFS mounts in the fstab. This would be especially useful if you plan to keep '/usr' on an NFS server. __fstab_config_1 echo -n "Edit the fstab? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done install_sets # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab ifconfig.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done # Enable rc.conf if [ -e /mnt/etc/rc.conf ]; then cp /mnt/etc/rc.conf /tmp sed 's/^rc_configured=NO/rc_configured=YES/' /tmp/rc.conf \ > /mnt/etc/rc.conf fi # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link..." else echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." fi if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." else echo -n "Making devices..." pid=`twiddle` cd /mnt/dev sh MAKEDEV all kill $pid echo "done." fi md_copy_kernel md_installboot ${ROOTDISK} ) unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 TZif!`POGx,ppHp*` .zL5ppX ϒ4ЊrN$pKp\xC DxZhYvCpfB_|O_1   PMTWESTWETCESTCETTZifxL 4LMTWAT# $NetBSD: services,v 1.31.2.1 2000/02/12 16:51:52 he Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 8.2 (Berkeley) 3/26/95 # tcpmux 1/tcp # TCP port multiplexer (RFC1078) echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp # File Transfer Protocol ssh 22/tcp # Secure Shell ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp # name-domain server domain 53/udp mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp # Trivial File Transfer Protocol gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink kerberos 88/tcp krb5 # Kerberos v5 kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp # Remote Procedure Call sunrpc 111/udp auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap 143/tcp imap2 imap4 # Internet Message Access Protocol imap 143/udp imap2 imap4 snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp mailq 174/tcp # zmailer MTA xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp nip 376/tcp # Amiga Envoy Net Inquiry Prot. nip 376/udp # Amiga Envoy Net Inquiry Prot. ldap 389/tcp # Lightweight Directory Access Protocol ldap 389/udp # Lightweight Directory Access Protocol # # UNIX specific services # exec 512/tcp # Remote execution biff 512/udp comsat # Biff the dog login 513/tcp # Remote login who 513/udp whod # Remote who shell 514/tcp cmd # Remote command shell syslog 514/udp # System logger printer 515/tcp spooler # line printer spooler talk 517/udp # Talk protocols ntalk 518/udp route 520/udp router routed # RIP timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon rdist 541/tcp rdistd # rdist daemon afpovertcp 548/tcp # AppleshareIP protocol afpovertcp 548/udp # AppleshareIP protocol remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # ldaps 636/tcp # ldap protocol over TLS/SSL (was sldap) ldaps 636/udp # ldap protocol over TLS/SSL (was sldap) # webster 765/tcp # Network dictionary webster 765/udp # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp cvspserver 2401/tcp cvspserver 2401/udp rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. # klogin 543/tcp # Kerberos `rlogin' kshell 544/tcp krcmd # Kerberos `rsh' kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos4 750/udp kdc # Kerberos (server) udp kerberos4 750/tcp kdc # Kerberos (server) tcp kerberos-master 751/udp # Kerberos admin server udp kerberos-master 751/tcp # Kerberos admin server tcp krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' eklogin 2105/tcp # Kerberos encrypted `rlogin' # # Unofficial but necessary (for NetBSD) services # supfilesrv 871/tcp # SUP server supfiledbg 1127/tcp # SUP debugging # # other common ports # nfs 2049/udp nfsd # Sun NFS nfs 2049/tcp nfsd # Sun NFS X11 6000/tcp # X Window System ircd 6667/tcp # Often used IRC port (also see 194) hunt 26740/udp # multi-player/multi-host maze-wars # # Netatalk (in-kernel Appletalk) services # Note: The running kernel must be configured with "options NETATALK" # and software not included in NetBSD, such as Netatalk version 1.4b2 # or later, must be used to take advantage of these services. # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol < . ..= 0> 1? 2@ 3A 4B 5C 6D 7E 8F 9G 10H 11I 12J 13K 14L 15M 16N 17O 18P 19Q 20R 21S 22T 23U 24V 25W 26X 27Y 28Z 29[ 30\ 31] 32^ 33_ 34` 35a 36b 37c 38d39e 40f 41g 42h 43i 44j 45k 46l 47m 48n 49o 50p 51q 52r 53s 54t 55u 56v 57w 58x 59y 60z 61{ 62|63#!/bin/sh # $NetBSD: install.sub,v 1.25.2.5 2000/02/04 23:02:41 he Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation/upgrade script - common subroutines. ROOTDISK="" # filled in below VERSION=142 export VERSION ALLSETS="base comp etc games man misc text" # default install sets UPGRSETS="base comp games man misc text" # default upgrade sets THESETS= # one of the above local_sets_dir="" # Path searched for sets by install_sets # on the local filesystems # decide upon an editor if [ X$EDITOR = X ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi fi getresp() { read resp if [ "X$resp" = "X" ]; then resp=$1 fi } isin() { # test the first argument against the remaining ones, return succes on a match _a=$1; shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } rmel() { # remove first argument from list formed by the remaining arguments local _a _a=$1; shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1"; fi shift done } cutword () { # read a line of data, return Nth element. local _a local _n local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi eval echo \$$_n } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { # return first character of argument local _a _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir local _file _dir=$1; shift for _file in $* do if [ -f $_dir/${_file}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}.tgz ]; then return 0 fi # Try for split files if [ -f $_dir/${_file}${VERSION}.aa ]; then return 0 fi done return 1 } twiddle() { # spin the propeller so we don't get bored while : ; do sleep 1; echo -n "/"; sleep 1; echo -n "-"; sleep 1; echo -n "\\"; sleep 1; echo -n "|"; done > /dev/tty & echo $! } get_localdir() { # $1 is relative mountpoint local _mp local _dir _mp=$1 _dir= while : ; do if [ X$_mp != X ]; then cat << __get_localdir_1 Note: your filesystems are mounted under the temporary mount point \"$_mp\". The pathname you are requested to enter below should NOT include the \"$_mp\" prefix. __get_localdir_1 fi echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __get_localdir_2 The directory \"$_mp/$_dir\" does not exist, or does not hold any of the upgrade sets. __get_localdir_2 echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir="" break ;; esac fi done } getrootdisk() { cat << \__getrootdisk_1 The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the standalone installation program. Available disks are: __getrootdisk_1 _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo "" echo -n "Which disk is the root disk? " getresp "" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo "" echo "The disk $resp does not exist." ROOTDISK="" fi } labelmoredisks() { cat << \__labelmoredisks_1 You may label the following disks: __labelmoredisks_1 echo "$_DKDEVS" echo "" echo -n "Label which disk? [done] " getresp "done" case "$resp" in done) ;; *) if isin $resp $_DKDEVS ; then md_labeldisk $resp else echo "" echo "The disk $resp does not exist." fi ;; esac } addhostent() { # $1 - IP address # $2 - symbolic name # Create an entry in the hosts table. If no host table # exists, create one. If the IP address already exists, # replace it's entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/^$1 /d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2 $2.$FQDN" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface link-layer medium # $6 - (optional) interface link-layer directives local _m _m="" if [ "$5" != "" ]; then _m="media $5" fi # Create a ifconfig.* file for the interface. echo "inet $2 netmask $4 $_m $6" > /tmp/ifconfig.$1 addhostent $3 $2 } configurenetwork() { local _ifsdone local _ifs # _IFS=`md_get_ifdevs` _IFS=`ifconfig -l | sed ' s/lo0// s/ppp[0-9]//g s/sl[0-9]//g s/tun[0-9]//g'` _ifsdone="" resp="" # force at least one iteration while [ "X${resp}" != X"done" ]; do cat << \__configurenetwork_1 You may configure the following network interfaces (the interfaces marked with [X] have been succesfully configured): __configurenetwork_1 for _ifs in $_IFS; do if isin $_ifs $_ifsdone ; then echo -n "[X] " else echo -n " " fi echo $_ifs done echo "" echo -n "Configure which interface? [done] " getresp "done" case "$resp" in "done") ;; *) _ifs=$resp if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" fi else echo "Invalid response: \"$resp\" is not in list" fi ;; esac done } configure_ifs() { local _up local _interface_name local _interface_ip local _interface_mask local _interface_symname local _interface_extra local _interface_mediumtype local _interface_supported_media local _m local _t _interface_name=$1 _up=DOWN if isin $_interface_name `ifconfig -l -u` ; then _up=UP fi _interface_supported_media=`ifconfig -m $_interface_name | sed -n ' /^[ ]*media autoselect/d 4,$s/[ ]*media //p'` # get current "media" "ip" and "netmask" ("broadcast") _t=`ifconfig $_interface_name | sed -n ' s/^[ ]*media: [^ ]* \([^ ][^ ]*\).*/\1/p'` if [ "$_t" != "manual" -a "$_t" != "media:" -a "$_t" != "autoselect" ]; then _interface_mediumtype=$1 fi set -- `ifconfig $_interface_name | sed -n ' /^[ ]*inet/{ s/inet// s/--> [0-9.][0-9.]*// s/netmask// s/broadcast// p;}'` _interface_ip=$1 _interface_mask=$2 # Get IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "IP address? [$_interface_ip] " getresp "$_interface_ip" _interface_ip=$resp done # Get symbolic name resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Symbolic (host) name? " getresp "" _interface_symname=$resp done # Get netmask resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Netmask? [$_interface_mask] " getresp "$_interface_mask" _interface_mask=$resp done echo "Your network interface might require explicit selection" echo "of the type of network medium attached. Supported media:" echo "$_interface_supported_media" echo -n "Additional media type arguments (none)? [$_interface_mediumtype] " getresp "$_interface_mediumtype" _m="" if [ "X${resp}" != X"" -a "X${resp}" != Xnone ]; then _interface_mediumtype=$resp _m="media ${resp}" fi echo "Your network interface might require additional link-layer" echo "directives (like \`link0'). If this is the case you can enter" echo "these at the next prompt." echo "" echo -n "Additional link-layer arguments (none)? [$_interface_extra] " getresp "$_interface_extra" if [ "X${resp}" != X"" -a "X${resp}" != Xnone ]; then _interface_extra=$resp fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ $_up != "UP" ]; then ifconfig ${_interface_name} down if ifconfig ${_interface_name} inet \ ${_interface_ip} \ netmask ${_interface_mask} \ ${_interface_extra} ${_m} up ; then addifconfig \ "${_interface_name}" \ "${_interface_symname}" \ "${_interface_ip}" \ "${_interface_mask}" \ "${_interface_mediumtype}" \ "${_interface_extra}" return 0 fi else echo "Interface ${_interface_name} is already active." echo "Just saving configuration on new root filesystem." addifconfig \ "${_interface_name}" \ "${_interface_symname}" \ "${_interface_ip}" \ "${_interface_mask}" \ "${_interface_mediumtype}" \ "${_interface_extra}" fi return 1 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Set up the hostname. if [ ! -f /mnt/etc/myname ]; then echo "ERROR: no /etc/myname!" return 1 fi hostname=`cat /mnt/etc/myname` hostname $hostname # configure all the interfaces which we know about. if [ -f /mnt/etc/rc.conf ]; then ( # assume network interface configuration style 1.2D and up . /mnt/etc/rc.conf if [ "$net_interfaces" != NO ]; then if [ "$auto_ifconfig" = YES ]; then tmp="`ifconfig -l`" else tmp="$net_interfaces" fi echo -n "configuring network interfaces:" for i in $tmp; do eval `echo 'args=$ifconfig_'$i` if [ ! -z "$args" ]; then echo -n " $i" ifconfig $i $args elif [ -f /mnt/etc/ifconfig.$i ]; then echo -n " $i" (while read args; do ifconfig $i $args done) < /mnt/etc/ifconfig.$i elif [ "$auto_ifconfig" != YES ]; then echo echo -n "/mnt/etc/ifconfig.$i missing" echo -n "& ifconfig_$i not set" echo "; interface $i can't be configured" fi done echo "." fi ) else ( tmp="$IFS" IFS="$IFS." set -- `echo /mnt/etc/hostname*` IFS=$tmp unset tmp while [ $# -ge 2 ] ; do shift # get rid of "hostname" ( read af name mask bcaddr extras read dt dtaddr if [ ! -n "$name" ]; then echo "/etc/hostname.$1: invalid network configuration file" exit fi cmd="ifconfig $1 $af $name " if [ "${dt}" = "dest" ]; then cmd="$cmd $dtaddr"; fi if [ -n "$mask" ]; then cmd="$cmd netmask $mask"; fi if [ -n "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr"; fi cmd="$cmd $extras" $cmd ) < /mnt/etc/hostname.$1 shift done ) fi # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route add $hostname localhost # /etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route add default `cat /mnt/etc/mygate` fi # enable the resolver, if appropriate. if [ -f /mnt/etc/resolv.conf ]; then _resolver_enabled="TRUE" cp /mnt/etc/resolv.conf /tmp/resolv.conf.shadow fi # Display results... echo "Network interface configuration:" ifconfig -a echo "" if [ "X${_resolver_enabled}" = X"TRUE" ]; then netstat -r echo "" echo "Resolver enabled." else netstat -rn echo "" echo "Resolver not enabled." fi return 0 } install_ftp() { local _f local _sets local _next # Build a script to extract valid files from a list # of filenames on stdin. # XXX : Can we use this on more places? Leo. echo "#!/bin/sh" > /tmp/fname_filter.sh echo "while read line; do" >> /tmp/fname_filter.sh echo " case \$line in" >> /tmp/fname_filter.sh for _f in $THESETS; do echo " $_f.tar.gz|$_f.tgz|$_f.${VERSION}.aa)" \ >> /tmp/fname_filter.sh echo ' echo -n "$line ";;' \ >> /tmp/fname_filter.sh done echo " *) ;;" >> /tmp/fname_filter.sh echo " esac" >> /tmp/fname_filter.sh echo "done" >> /tmp/fname_filter.sh # Get several parameters from the user, and create # a shell script that directs the appropriate # commands into ftp. cat << \__install_ftp_1 This is an automated ftp-based installation process. You will be asked several questions. The correct set of commands will be placed in a script that will be fed to ftp(1). __install_ftp_1 # Get server IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP? [${_ftp_server_ip}] " getresp "${_ftp_server_ip}" _ftp_server_ip=$resp done # Get login name resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Password? " stty -echo getresp "" echo "" stty echo _ftp_server_password=$resp done cat << \__install_ftp_2 You will be asked to enter the name of the directory that contains the installation sets. When you enter a '?' you will see a listing of the current directory on the server. __install_ftp_2 _sets="" while [ -z "$_sets" ] do resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server directory? [${_ftp_server_dir}] " getresp "${_ftp_server_dir}" if [ "X$resp" = 'X?' -a -z "$_ftp_server_dir" ]; then resp="" fi done if [ $resp != '?' ]; then _ftp_server_dir=$resp fi # Build the basics of an ftp-script... echo "#!/bin/sh" > /tmp/ftp-script.sh echo "cd /mnt" >> /tmp/ftp-script.sh echo "ftp -e -i -n $_ftp_server_ip << \__end_commands" >> \ /tmp/ftp-script.sh echo "user $_ftp_server_login $_ftp_server_password" >> \ /tmp/ftp-script.sh echo "bin" >> /tmp/ftp-script.sh echo "cd $_ftp_server_dir" >> /tmp/ftp-script.sh # Make a copy of this script that lists the directory # contents, and use that to determine the files to get. cat /tmp/ftp-script.sh > /tmp/ftp-dir.sh echo "ls" >> /tmp/ftp-dir.sh echo "quit" >> /tmp/ftp-dir.sh echo "__end_commands" >> /tmp/ftp-dir.sh if [ $resp = '?' ]; then sh /tmp/ftp-dir.sh else _sets=`sh /tmp/ftp-dir.sh | sh /tmp/fname_filter.sh` fi done rm -f /tmp/ftp-dir.sh /tmp/fname_filter.sh while : ; do echo "The following sets are available for extraction:" echo "(marked sets have already been extracted)" echo "" _next="" for _f in $_sets ; do if isin $_f $_setsdone; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f; fi fi echo $_f done echo "" # Get name of the file and add extraction command # to the ftp-script. if [ "X$_next" = "X" ]; then resp=n; else resp=y; fi echo -n "Continue to add filenames [$resp]? " getresp "$resp" if [ "$resp" = "n" ]; then break fi echo -n "File name [$_next]? " getresp "$_next" if isin $resp $_sets; then echo "get $resp |\"pax -zrvpe\"" >> \ /tmp/ftp-script.sh _setsdone="$resp $_setsdone" else echo "You entered an invalid filename." echo "" fi done echo "quit" >> /tmp/ftp-script.sh echo "__end_commands" >> /tmp/ftp-script.sh sh /tmp/ftp-script.sh rm -f /tmp/ftp-script.sh echo "Extraction complete." } install_from_mounted_fs() { # $1 - directory containing installation sets local _filename local _sets local _next local _all local _f local _dirname _dirname=$1 _sets="" echo "" echo "The directory at the mount point, \"${_dirname}\", contains: " echo "" ls -F ${_dirname} echo "" echo "Enter the subdirectory relative to the mountpoint, that" echo -n "contains the savesets: [try this directory] " getresp "" if [ "X${resp}" != "X" ]; then _dirname=${_dirname}/$resp fi while ! dir_has_sets ${_dirname} $THESETS; do echo "" echo -n "There are no NetBSD install sets available in " echo "\"${_dirname}\"." echo "\"${_dirname}\" contains: " echo "" ls -F ${_dirname} echo "" echo -n "Enter subdirectory: [try other install media] " getresp "" if [ "X${resp}" = "X" ]; then return fi if [ ! -d ${_dirname}/${resp} ]; then echo "\"${resp}\" is no directory; try again." else _dirname=${_dirname}/$resp fi done for _f in $THESETS ; do if [ -f ${_dirname}/${_f}.tar.gz ]; then _sets="$_sets ${_f}.tar.gz" elif [ -f ${_dirname}/${_f}.tgz ]; then _sets="$_sets ${_f}.tgz" elif [ -f ${_dirname}/${_f}${VERSION}.aa ]; then _sets="$_sets ${_f}${VERSION}" fi done while : ; do echo "The following sets are available for extraction:" echo "(marked sets have already been extracted)" echo "" _next="" _all="" for _f in $_sets ; do if isin $_f $_setsdone; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f; fi _all="$_all $_f" fi echo $_f done echo "" # Get the name of the file. if [ "X$_next" = "X" ]; then resp=n; else resp=y; fi echo -n "Continue extraction [$resp]?" getresp "$resp" if [ "$resp" = "n" ]; then break fi echo -n "File name(s) (or "all") [$_next]? " getresp "$_next" if [ "x$resp" = xall ]; then resp="$_all" fi for _f in $resp; do _filename="/${_dirname}/$_f" # Ensure file exists if [ ! -f $_filename ]; then if [ -f ${_filename}.aa ]; then _filename=${_filename}.\?\? else echo "File $_filename does not exist. Check to make" echo "sure you entered the information properly." continue 2 fi fi # Extract file echo "Extracting the $_f set:" cat $_filename | (cd /mnt; pax -zrvpe) echo "Extraction complete." _setsdone="$_f $_setsdone" done done } install_cdrom() { local _drive local _partition_range local _partition local _fstype local _directory # Get the cdrom device info cat << \__install_cdrom_1 The following CD-ROM devices are installed on your system; please select the CD-ROM device containing the partition with the installation sets: __install_cdrom_1 _CDDEVS=`md_get_cddevs` echo "$_CDDEVS" echo "" echo -n "Which is the CD-ROM with the installation media? [abort] " getresp "abort" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo "" echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # Get partition _partition_range=`md_get_partition_range` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [a] " getresp "a" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__install_cdrom_2 There are two CD-ROM filesystem types currently supported by this program: 1) ISO-9660 (cd9660) 2) Berkeley Fast Filesystem (ffs) __install_cdrom_2 resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the CD-ROM if ! mount -t ${_fstype} -o ro \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi install_from_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive local _partition_range local _partition local _fstype local _fsopts local _directory local _md_fstype local _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo "" echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition _partition_range=`md_get_partition_range` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [d] " getresp "d" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__mount_a_disk_2 The following filesystem types are supported: 1) ffs __mount_a_disk_2 _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ ! -z "$_md_fstype" ]; then echo " 2) $_md_fstype" else _md_fstype="_undefined_" fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [ffs] " getresp "ffs" case "$resp" in ffs) _fstype=$resp _fsopts="ro" ;; $_md_fstype) _fstype=$resp _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the disk if ! mount -t ${_fstype} -o $_fsopts \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << \__install_disk_1 Ok, lets install from a disk. The file-system the install sets on may already mounted, or we might have to mount the filesystem to get to it. __install_disk_1 echo -n "Is the file-system with the install sets already mounted? [n] " getresp "n" case $resp in y*|Y*) echo "What mount point are the sets located in? [] " getresp "" if [ -d "$resp" ]; then install_from_mounted_fs $resp else echo "$resp: Not a directory, aborting..." fi return ;; *) ;; esac cat << \__install_disk_2 The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __install_disk_2 _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo "" echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi install_from_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP address? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport (only works with capable NFS server)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-T" ;; *) _nfs_tcp="" ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi install_from_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << \__install_tape_1 The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __install_tape_1 _tape=`basename $TAPE` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=`basename $resp` TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=`expr $resp - 1` ;; *) echo "Invalid file number ${resp}." resp="" # fore loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << \__install_tape_2 There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __install_tape_2 resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="pax -zrvpe" ;; 2) _xcmd="tar -rvpe" ;; *) echo "Invalid response: $resp." resp="" # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a local _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediatly. # if [ ! -e /usr/share/zoneinfo -a ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath="" fi cat << \__get_timezone_1 Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "MET" or "GMT-6". Other zones are grouped by continent, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __get_timezone_1 if [ X$TZ = X ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#/usr/share/zoneinfo/} fi while :; do echo -n "What timezone are you in [\`?' for list] [$TZ]? " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone [\`?' for list]: " getresp "" case "$resp" in "?") ls ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then TZ="$_a" echo "You have selected timezone \"$_a\"". break 2 fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } install_sets() { local _yup _yup="FALSE" # Ask the user which media to load the distribution from. cat << \__install_sets_1 It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. __install_sets_1 if [ "X$local_sets_dir" != "X" ]; then install_from_mounted_fs ${local_sets_dir} if [ X"$_setsdone" != X ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp="" # force at least one iteration while [ X"${resp}" = X ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (t)ape, (C)D-ROM, (N)FS" echo -n " or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk ;; f*|F*) install_ftp ;; t*|T*) install_tape ;; c*|C*) install_cdrom ;; n*|N*) install_nfs ;; *) echo "Invalid response: $resp" resp="" ;; esac else _yup="FALSE" # So we'll ask next time fi # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo "" echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp="" ;; *) ;; esac done } munge_fstab() { local _fstab local _fstab_shadow local _dev local _mp local _fstype local _rest # Now that the 'real' fstab is configured, we munge it into a 'shadow' # fstab which we'll use for mounting and unmounting all of the target # filesystems relative to /mnt. Mount all filesystems. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _rest; do # Skip comment lines case "$_dev" in \#*) continue;; *) ;; esac # and some filesystem types (like there are swap,kernfs,...) case "$_fstype" in ffs|ufs|nfs) ;; *) continue;; esac if [ "$_mp" = "/" ]; then echo $_dev /mnt $_fstype $_rest else echo $_dev /mnt$_mp $_fstype $_rest fi done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab _fstab=$1 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype -o async -o $_opt $_dev $_mp ; then # error message displated by mount exit 1 fi done ) < $_fstab if [ "X${?}" != X"0" ]; then cat << \__mount_filesystems_1 FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __mount_filesystems_1 exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-fast] local _fast local _fstab local _pid if [ "$1" = "-fast" ]; then _fast=1 _fstab=$2 else _fast=0 _fstab=$1 fi if [ ! \( -f $_fstab -a -s $_fstab \) ]; then echo "fstab empty" > /dev/tty return fi if [ $_fast = 0 ]; then echo -n "Syncing disks..." _pid=`twiddle` sync; sleep 4; sync; sleep 2; sync; sleep 2 kill $_pid echo "done." fi ( _devs="" _mps="" # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo -n "Umounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "Done." if [ $_fast = 0 ]; then exit fi echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab _fstab=$1 #!/bin/sh # $NetBSD: install.sh,v 1.19.2.1 1999/04/13 17:20:42 is Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used thoughout FQDN="" # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_ifdevs() - return available network interfaces # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with installation? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. cp /etc/disktab.shadow /tmp/disktab.shadow while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${ROOTDISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. Loop and # get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << \__get_filesystems_1 You will now have the opportunity to enter filesystem information. You will be prompted for device name and mount point (full path, including the prepending '/' character). Note that these do not have to be in any particular order. You will be given the opportunity to edit the resulting 'fstab' file before any of the filesystems are mounted. At that time you will be able to resolve any filesystem order dependencies. __get_filesystems_1 echo "The following will be used for the root filesystem:" echo " ${ROOTDISK}a /" echo "${ROOTDISK}a /" > ${FILESYSTEMS} resp="X" # force at least one iteration while [ "X$resp" != X"done" ]; do echo "" echo -n "Device name? [RETURN if you already entered all devices] " getresp "done" case "$resp" in done) ;; *) _device_name=`basename $resp` # force at least one iteration _first_char="X" while [ "X${_first_char}" != X"/" ]; do echo -n "Mount point? " getresp "" _mount_point=$resp if [ "X${_mount_point}" = X"/" ]; then # Invalid response; no multiple roots _first_char="X" else _first_char=`firstchar ${_mount_point}` fi done echo "${_device_name} ${_mount_point}" >> ${FILESYSTEMS} resp="X" # force loop to repeat ;; esac done # configure swap resp="" # force at least one iteration while [ "X${resp}" = X"" ]; do echo -n "Ok to configure ${ROOTDISK}b as a swap device? [] " getresp "" case "$resp" in y*|Y*) echo "${ROOTDISK}b swap" >> ${FILESYSTEMS} ;; n*|N*) ;; *) ;; esac done echo "" echo "You have configured the following devices and mount points:" echo "" cat ${FILESYSTEMS} echo "" echo "Filesystems will now be created on these devices. If you made any" echo -n "mistakes, you may edit this now. Edit? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} ${FILESYSTEMS} ;; *) ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _mp; do if [ "$_mp" != "swap" ]; then newfs /dev/r${_device_name} echo "" fi done ) < ${FILESYSTEMS} # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. Note, enter all symbolic host names WITHOUT the domain name appended. I.e. use 'hostname' NOT 'hostname.domain.name'. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) resp="" # force at least one iteration if [ -f /etc/myname ]; then resp=`cat /etc/myname` fi echo -n "Enter system hostname: [$resp] " while [ "X${resp}" = X"" ]; do getresp "$resp" done hostname $resp echo $resp > /tmp/myname echo -n "Enter DNS domain name: " resp="" # force at least one iteration while [ "X${resp}" = X"" ]; do getresp "" done FQDN=$resp configurenetwork echo -n "Enter IP address of default route: [none] " getresp "none" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi echo -n "Enter IP address of primary nameserver: [none] " getresp "none" if [ "X${resp}" != X"none" ]; then echo "domain $FQDN" > /tmp/resolv.conf echo "nameserver $resp" >> /tmp/resolv.conf echo "search $FQDN" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi #!/bin/sh # $NetBSD: upgrade.sh,v 1.16.2.2 1999/04/13 19:38:18 pk Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK="" # filled in below trap "unmount_fs -fast /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_ifdevs() - return available network interfaces # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS $MDSETS" # Files that moved between 1.2 and 1.3 RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/dumpfs /usr/sbin/dumpfs" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/dumplfs /usr/sbin/dumplfs" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/nfsd /usr/sbin/nfsd" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/nfsiod /usr/sbin/nfsiod" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/mountd /usr/sbin/mountd" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/quotacheck /usr/sbin/quotacheck" RELOCATED_FILES_13="${RELOCATED_FILES_13} /sbin/rtquery /usr/sbin/rtquery" # Files that moved between 1.3 and 1.4 RELOCATED_FILES_14="${RELOCATED_FILES_14} /sbin/newlfs /sbin/newfs_lfs" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/games/chess /usr/games/chess" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/games/hide/chess /usr/games/hide/chess" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/share/games/gnuchess.book /usr/share/games/gnuchess.book" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/share/games/atc/ATC_scores /usr/share/games/atc/ATC_scores" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/share/games/atc/ATC_scores /usr/share/games/atc/ATC_scores" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libamu.a /usr/lib/libamu.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libamu_p.a /usr/lib/libamu_p.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libamu_pic.a /usr/lib/libamu_pic.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libbfd.a /usr/lib/libbfd.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libbfd_pic.a /usr/lib/libbfd_pic.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libg++.a /usr/lib/libg++.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libg++_p.a /usr/lib/libg++_p.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/lib/libg++_pic.a /usr/lib/libg++_pic.a" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/gettable /usr/sbin/gettable" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/dig /usr/bin/dig" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/dnsquery /usr/bin/dnsquery" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/htable /usr/bin/htable" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/htable /usr/sbin/htable" RELOCATED_FILES_14="${RELOCATED_FILES_14} /usr/sbin/nslookup /usr/sbin/nslookup" rm_relocated_files() { # ($n, $(n+1)): pairs of (old,new) locations of relocated files while [ $# -ge 2 ]; do if [ -f "$2" ]; then echo Removing "$1"; rm -f "$1" fi shift 2 done } # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp="" # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp="" # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. We remove all but ufs/ffs. ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" -o \ "X${_fstype}" = X"ffs" ]; then if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab fi done ) < /mnt/etc/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. Note that this fstab is only for installation purposes, and will not be copied into the root filesystem. __fstab_config_1 echo -n "Edit the fstab? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check all of the filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets # Remove files that have just been installed in a new location # from the old location rm_relocated_files `eval echo \\$RELOCATED_FILES_${VERSION}` # Get timezone info get_timezone # Fix up the fstab. echo -n "Converting ufs to ffs in /etc/fstab..." ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab done ) < /mnt/etc/fstab echo "done." echo -n "Would you like to edit the resulting fstab? [y] " getresp "y" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." echo -n "Making devices..." _pid=`twiddle` cd /mnt/dev sh MAKEDEV all kill $_pid echo "done." md_copy_kernel md_installboot ${ROOTDISK} ) unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 TZifLMTGMTTZif CATTZifh LMTWATTZif}lLMTWATTZif dfqp&` LMTWATWAST  # A C// /N v$NetBSD: crt0.c,v 1.21 1999/01/22 11:29:16 mycroft Exp $NVH0 $n &.#$g$Hx//a#Pf#`R#-| . .g HyaX// /.a/aFDNq _ .N@eNpN/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed NVH8<&.# (BBHz\HxIBNE$Oxf Hx HzKHxHxNHxHxNOHx Hn/HxNOxe HxHzHxHxNHxHxNO".$ B@Jg A f `>  g6BBJg Af `( g HxHzHxHxNHxHxNOGx&".$ B@Jg A f`h   gZ B@Jg  f`@  g2BBJg  g`  f B"< ` Br `BB//B/HxHx .ЮЮ/BHxBHxN%@O,xf HxHz HxHxNHxHxNO".$ B@Jg A g&`  g B@Jg Ag` f"n I B@Jg A f`l   g^ B@Jg  f`D  g6BBJg  g`  f ?`  ` @`"n I B@Jg A f`h   gZ B@Jg  f`@  g2BBJg  g`  f  `p Ј` "B//B/HxHx/.Q/ HxBHxNO,xf HxHzjHxHxNHxHxNO .gTBBB/HxHx/ .ЮВ/HxBHxNO,xf HxHzHxHxNHxHxNOA ## #$#,4E*RG / HxNPxfJHx HzHxHxN/ HxNOfHxHzHxHxNHxHxNx ؃#4` y4 P/(a jL<N^NuNV y4 PJg/. /. PN`BN^NuNV y4 PJg /. hN`pN^NuNV y4 PJg/. /. hN`BN^NuNV y4 PJg/./. /. h N`pN^NuService unavailableNV y4 PJgHnHxB h NO rf <&` .fB`/a?N^NuNV y4 PJg hJfB` /. /.NN^NuNV/ n.Bf JgR`$N^Nu-l0x%xopen BOOT43NVH?<$.&. a S$CXfaHz/aOPJf(XSfaHyHz/a ^RSO JfatBB/Gz>N*O lHzpa=Hxa?B.Sfa@|l`BB/N-@O lHz:a=Hxa? -ZS|l*BB/N(O lHz a=`Hxa>-Z`x` x:|-MHxHx/N&O lHza=$Hxa>Hx HzHy$<v*BN3B B$3.B0IECtATG4&#8#<# @#$D#(H#,L#0P #X#\#@`GD#d#h#l#Pp"#x#|#####$#######(###############3HxHz(HyN|#3|#3BHx B/aO$./az$9/a/Hy.<_*GN3BI| (#Hy/*</*EN3OJgE 9В`E #G(T&JmB"< ҂[I///aL//.a$9/.a /Hy*GN3B# #$O .(/.*EN3.PJg 9В` #0,9 ܹ$&JmB 9Ђ"< Ҁ[I///a//a$9/.a`/Hy4*GN3B>#@#DO .H/*EN3NPJg 9В` #P,9@ܹD&BBB/aHx$Hy/ENBHxB/aO(.Hy/NBa:Nqerror reading file header bad magic number readshort read writeNVH?0,.*. Hx Hy/GNO ~ gHzHyaMHxa9A" B@Jg Ag ` f&9(9`L" B@Jg Ag ` f&9C(9`Hz-HyaMjHxa9Jf 9` 9#A.ބ HxHh/ENO Jg$<(l$/Hy/N$O lHza7Hxa9JfHzHyaLHxa8/Hy/NO JlHza7FHxa8–f`|$<(l$/Hy/N$O lHzAa7 Hxa8JfHz.HyaLTHxa8j/Hy/NO JlHz a6Hxa8BJfL N^Nuusage: mkboot [-l loadpoint] prog1 [ prog2 ] outfile NVHzHyaKHxa7NqNVH00 nt&y$yCI3g`Cf _fRRRvlv m B <Bl <L N^NuNVH0 $n Hn/.ahHna @ (R"L<fffgЀ &(R"L<fffg"ҁ"@C Ѐ ( "L<fffgЀ &( "L<fffg"ҁ"@C Ѐ ("L<fffgЀ &("L<fffg"ҁ"@C Ѐ ("L<fffgЀ &("L<fffg"ҁ"@C Ѐ ("L<fffgЀ &("L<fffg"ҁ"@C Ѐ "L<fffgЀ &"L<fffg"ҁ"@C ЀL N^NuNV yJgC# PN 9 @JfN^NuNV/ /A rfBJgCRXJf$gE, RYNSfHzad$.$nN^NuNVJ8f p#8aN^Nu$NetBSD: atexit.c,v 1.10 1998/10/18 14:36:30 kleink Exp $NV"yJfC<# )`0 )r"l&Hxa|"@Jfp`"B"#BA! RBN^Nu$NetBSD: sscanf.c,v 1.9 1998/11/15 17:19:53 christos Exp $NVBN^NuNV/ .$. =|-@-@/aeX-@-@-|2BBHn/Hna Z$.N^Nu  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~NV . y00 HN^Nu$NetBSD: localtime.c,v 1.21 1998/11/15 17:11:06 christos Exp $WILDABBRGMTNV/ ntB(HABAB(ቀ($N^NuNVH <$yA 5C"5Jf <5" `nɳl((HGRAN"A GK J)Rmɳl6BIG*BA,A J"( (JЊ)RmL<N^Nu/etc/localtime/usr/share/zoneinfo/NVH?<*n&. Jf KJg :fR /WIDflIJg/ G~N$@/ NEPb/ $/a(Hz/E`N/ /NHx./ a?$O Jgx*BJgHx/ a($PJfJB/ aB$Pzg4HxG/ /al$@/aOJfHk(<5"DN,Hk"DN.Hk"DN"C"Hk "DN"C#@Hk$"DN"C#@Hk("DN"C#@ I,-QOz2e")*Ao n$) Bm rnJmzmtgJfjgJf` GAA"C "nC ІЇn4ʴo"CG/ "DN&XXR"C$)nʴo B CA"ClRRm"Cl^B CAR*CKN&CGJ/ -H"DN&X*KX nzeB Am"C nGR"Cm&CGJ"C l KR"C mB2"Cl4$<5*CKN&CGJ/ "BN&X/ "BN*PXPPR"Cmޕ"C")o, CAVJgI zdp`BBAR"C")nڕʲo( CAZJgI zd`BAR"CmBLvnd0b7*?vnd0c7*@vnd0d7*Avnd0e7*Bvnd0f7*Cvnd0g7*Dvnd0h7*Ervnd0a*Frvnd0b*Grvnd0c*Hrvnd0d*Irvnd0e*Jrvnd0f*Krvnd0g*Lrvnd0h*Mvnd1a7*Nvnd1b7*Ovnd1c7*Pvnd1d7*Qvnd1e7*Rvnd1f7*Svnd1g7*Tvnd1h7*Urvnd1a*Vrvnd1b*Wrvnd1c*Xrvnd1d*Yrvnd1e*Zrvnd1f*[rvnd1g*\rvnd1h*]vnd2a7*^vnd2b7*_vnd2c7*`vnd2d7*avnd2e7*bvnd2f7*cvnd2g7*dvnd2h7*ervnd2a*frvnd2b*grvnd2c*hrvnd2d*irvnd2e*jrvnd2f*krvnd2g*lrvnd2h*mvnd3a7*nvnd3b7*ovnd3c7*pvnd3d7*qvnd3e7*rvnd3f7*svnd3g7*tvnd3h7*urvnd3a*vrvnd3b*wrvnd3c*xrvnd3d*yrvnd3e*zrvnd3f*{rvnd3g*|rvnd3h*}raid0a*~raid0b*raid0c*raid0d*raid0e*raid0f*raid0g*raid0h*rraid0arraid0brraid0crraid0drraid0erraid0frraid0grraid0hraid1a*raid1b*raid1c*raid1d*raid1e*raid1f*raid1g*raid1h*rraid1arraid1brraid1crraid1drraid1erraid1frraid1grraid1hraid2a*raid2b*raid2c*raid2d*raid2e*raid2f*raid2g*raid2h*rraid2arraid2brraid2crraid2drraid2erraid2frraid2grraid2hraid3a*raid3b*raid3c*raid3d*raid3e*raid3f*raid3g*raid3h*rraid3arraid3brraid3crraid3drraid3erraid3frraid3grraid3hhil07*hil17*hil27*hil37*hil47*hil57*hil6 hil77*grf07*ttye07*tty07*tty007*tty017*tty027*tty037*tty047*tty057*tty067*tty077*tty087*tty097*tty0a7*tty0b7*tty0c7*tty0d7*tty0e7*tty0f7*ttya07*ttya17*ttya27*ttya37*bpf07*bpf17*bpf27*bpf37*bpf4 bpf57*bpf67*bpf77*tun07*tun17*tun27*tun37* iplipnat7*ipstateipauth*random*urandomscsibus0 scsibus1 scsibus2 8scsibus3 #!/bin/sh # $NetBSD: installboot.sh,v 1.1 1997/02/04 03:53:00 thorpej Exp $ # compatibility with old installboot program # # @(#)installboot.sh 8.1 (Berkeley) 6/10/93 # if [ $# != 2 ] then echo "Usage: installboot bootprog device" exit 1 fi if [ ! -f $1 ] then echo "Usage: installboot bootprog device" echo "${1}: bootprog must be a regular file" exit 1 fi if [ ! -c $2 ] then echo "Usage: installboot bootprog device" echo "${2}: device must be a char special file" exit 1 fi /sbin/disklabel -B -b $1 $2 exit $? fp`,*nK-M ,g ;ffK-M/ HjIN$@PJg ,fK-M/ / N$@PJgJf|'F'|,.D'FJ|'FN*R'ER,.D'F^BbBfK-MIؕ&</./.// a4$/./.// a"O l*nX**nX*B`*nX*B*nX*fH L< Q"$Ԃ*AK *AK 到f DK A 鈰f2|K uA"鉒 鈐R o*`RJfvJg`n 3 JD-@`:*3 JD`ZBB"+o"B(A*BK, J NgRnBBo"B(A*BK, J NfRnBotBE(n(." Ђ QJ Zf ABgJ Vf ` ѱ Ђ"3 JDJ Ng*`-AXRRm,.D'FJBNBR,.D'F^|'Fb*R'Ef|'F`$B|'FB,.D'FJBNBR*R'E Jg *nKX'M  b EJ//./ GvNBO Jg/././ N,.B2hBL"+ANRo AJf`&B`"po"HAmRn3 *@E E J/ / /Hnah)j ", A *JЋ! *J)K(L<N^NuNV/$.aHyB/a <$.N^NuNV/$. /B/.a $.N^NuNV/ /$. $nJf$r#Hxa#Xg/aX/ /9//.aJg %|5(` 9f %|5(` J%@($.$nN^NuNVHyB/.aj <N^NuNV/$. /B/.aJ $.N^NuNVHy/. /.a* <N^NuNVH?<&n*nBBJg"S n,Jm&$I) J-L nfzBJfJn(n(l FozJgXJoT&(S" 3 JR9 Jf:E RC J$A) N QR9 NfR"o&QSQ RQg(n"l`Sj^"L<.E(؆HDH Ѐ(DIJ "鉒 鈐$ . ԀjQSJm`R Qn L< ҂~ Ѐ+A 爐Ё鈔 L< ҂ Ѐ+A 鈐刔ԅ*$X L< I$҂ Ѐ 爐+Bl^+B*<G` L< ҄ Ѐ$EJlS"JAAA$ S&l& T L< QԂ 䁒҃$S&l&T L< QԂ 䁒҃* JmpfH L< Q"$Ԃ(AI (AI 到f CI A 鈰f2|l+E+D ЀЉ @:Bm - .R+G lR+D B +n $L .Дi J-@//.Hn"n N/./a:OJf ..Ⱦg*IQBBSd~؇QrBCSdj`/./.Hn"n N/./.a"Og* SJmxJlS`Jo p娑`pѮ` .mf .".Ҁ-A^ID..އDf$-A/./.Hn"n N~"n" .`pLBR +*S'ER&Sg&SJn/ aXJf"S y08g܂`X$l& B0f4BSRSg&Jn/ aXJf"S y0(gB܊R`SK-M c(<RB$nJgB"SBpЃzMe00; N&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&Jf~B gB`HAZ>0zHB`8AJ>0zHz`z lP`JlJzFą` g< .Rf2~B +*@S'MSJoR`/ aDXJfSfgcp/ B*/a`\B*zxgzXfS/ /aPf B/B/.*nNO f.gX l !A`fg X l0`X l `SK-M c(<RB$nJg SBpЃz:e0; N||vvvvvvvvvvB`0JlXzFą`$ gJB`  f4BB +*@S'MSJoR`/ aXJfSfgZ g"cB/ "/a&Pb`B"A^zegzEg/ /-HNB"P n/ /NPfJBB/.aF//TPg X lh`g X lt` X ldR܊` .fp` .L Ј"jR*AK$ (gj AS`"ARl`Jl A`"AR`ah @zS L<0&n,. (.ȼo$Bz"KEB6"4 ꠂ@2RnB037L |N^Nu$NetBSD: isinf.c,v 1.6 1998/11/14 19:31:01 christos Exp $NVBK f fJ gr N^NuNVB . f J WID N^Nu$NetBSD: strlen.S,v 1.8 1997/01/04 03:26:27 jtc Exp $ o FJfЈNu$NetBSD: memchr.c,v 1.9 1998/03/26 23:53:36 cgd Exp $NV ..Jg nf S`SfBN^Nu$NetBSD: strtod.c,v 1.32 1999/02/06 16:01:22 kleink Exp $NVH0 &. CX qJg#`t $@Hja1 @!C!BBB L N^NuNV"nJg )AX"!N^NuNVH>8&n*. &.(+E"J $L(ԃB@H@L"BAHAЁ&BCHC<HF<"RnJgFm6(kR/ a$@ +(@HlHk Hj a/PO.aP&JE%LR'D L|N^NuNVH<0$n&. (. P"L<89ЀBplЀRm/a @!nz!Et Xl*E GI"@HiHx /N @O RnR`"E `I"@HiHx /a @O Rn L 8&n(. &$+ Ы*R +lRЀm/a$@CBXoBRnA +I & |Ȇgt B 騀""䩶b"g R`"ضbS%E/ a L|N^NuNV/ / n$n *"(g `&tԈ"BE a""g pc p`eB$$_N^NuNVH?<$n&n / / a$PfBa(@~)GB`Jl (J$K&Lt`B/*a(@)B **EK\, +GK -MCB&"(  A$BBHBJlBCHCBDHD ЂXX$BBHBJl23HXecH"  @$BBHBJlBAHA ЂX$BBHBJl23HXb`SJg)E L~9mB~m"n(IC "AC -I`~m"EC\ (AI * RRI~/m-JIfRIJf.`RRI~0gpЁ~e-K-FB"AA` (AA`RJgtݮro4 R~m"n(IC. އ-G`~m "EC\* څRn R~m"n(IC A -H`~m"EC\ A *BRIpЁ @~ dt~eg~EfJf JfJg-KBRI~+g~-f2|-IRIpЁ~ en`RI~0gpЁ~eRtԁ K`~9m"BC, (AI $ RI~/m ~m No:|N`*BJg. D*G``&nJfJfJf&n`Jf-J$ ~lt.@Jl N^NuNVH?<*n .-*noB`*n E-JS,Ih*nG"KAh R,L@`-FgBB" L$ԅBAHAL B@H@(؀*BEHE" $ԃ&BCHCJlBAHA Ѓ&BCHCJl23BXdJf`SYdJg*n+G/. /.aJmR-FBB"K$n," $ԅBAHA B@H@(؀*BEHE" $ԃ&BCHCJlBAHA Ѓ&BCHCJl23BXdAhJf`SYdJg*n+G .LSBSk B-B` D-BBJmB-n&.׮`&.藮-CDBv dB~vlYB2|-Ivej"n0;N "@&Dv-C2|-IxB`//U('t"$//U `//T@('t*,&n0//U8\//U (8xoZ.<@$0|//T//U#'t"$//T//U #'t*,`//T@('t*,0//U8//U (8Rmv`//T&.0T#>'t"$x.<@$0|`R//T//U#'t*,//U `//T@('t*,0f( #0gR`8&n* , -n-n .mvm A"n0TJl6Jn0BBJm>t-Bt`4t-Bt`*t-Bt` t-Bt`t-Bt&-B`Dt-Bt#-BBBHnHnHxHna Jtg .f8` a @t p`&BBHnHnHxHna rg". $.N^Nu$NetBSD: isatty.c,v 1.7 1998/10/13 15:05:02 kleink Exp $NVHn/.arVIDN^Nu$NetBSD: ctype_.c,v 1.14 1997/07/13 19:45:45 christos Exp $ ((((( AAAAAABBBBBB ` <N@eNu` <N@eNu$NetBSD: tcgetattr.c,v 1.4 1997/07/21 14:09:16 jtc Exp $NV/. /<@,t/.a|N^Nu$NetBSD: bcopy.S,v 1.13 1997/05/15 16:07:31 jtc Exp $"o o"/ mj mX gSg2U g"S""""""""QB@Sd gS"QgSQ /Nu mX g Sg3 U g"S# # # # # # # # QB@Sd gS# QgS Q /Nu$NetBSD: malloc.c,v 1.16 1999/01/29 08:11:36 kleink Exp $NVH< (. 9tf^a$#tBEN"SXXjԹtJg /NXzghBr 9tdҁRe#x 9t$YerBt`"&9x`ҁg(R Ђe$E r(Jf/a& r(JfB`%(C XL0*.(. BJf /a~`Jf /aB`$EY f |B*`&Hx/ GZN"Pl/9/ N"Plr Vt yt&cY`C($ Jg.Jg Tr᩶oY`A"ed `2/aX/a&XfB`g d ///a L |N^NuNVH0 $."n BEB ZJgg gR PJfRvlpL N^Nu$NetBSD: stdio.c,v 1.9 1998/11/15 17:19:53 christos Exp $NV/ /$n/./. 2j/ a @Jm"[IӪT$*PՀ%BP`j $.$nN^NuNV/ $n* gHxBB0j/a(Oj /./. 4j/ a$nN^NuNVH0 $n/././. 0j/a$&prfj `j %BP%CT "L N^NuNV n0h/aVN^Nu$NetBSD: fwalk.c,v 1.7 1998/02/03 18:41:16 perry Exp $NVH08(nBGJg.$k$+SkJj g/ NXEXQBBSd&SJf L N^Nu$NetBSD: getpagesize.c,v 1.7 1997/07/21 14:07:11 jtc Exp $NVJ|f8r-Ar-Ar-ABBHnHy|HxHnarfp` 9|N^Nu` pN@eNu`pN@eNu`p6N@eNu`pN@eNu$NetBSD: lseek.c,v 1.6 1998/10/14 11:25:19 kleink Exp $NV/././. B/.HxBaDN^Nu$NetBSD: sbrk.S,v 1.7 1999/01/14 22:48:20 kleink Exp $ 9ѯpN@e 9#Nu`($NetBSD: sysctl.c,v 1.8 1998/11/18 20:51:51 kleink Exp $/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinNV/ /$n". n"n .tg/.// /// a`Jga @t`tftf$JgtWd$tX"JgnHxXHz3/a^`\Jg tep `t"BJg *Utej0; N0&008<@ZHPPPPPPPPTZ B`@ `t`t ` `  ,`B`t ` `a @t p$.$nN^Nu`` <N@eNu`L <N@eNu$NetBSD: cerror.S,v 1.9 1999/01/14 22:48:20 kleink Exp $/a. @ prNu$NetBSD: bcopy.S,v 1.13 1997/05/15 16:07:31 jtc Exp $"o o"/ mj mX gSg2U g"S""""""""QB@Sd gS"QgSQ /Nu mX g Sg3 U g"S# # # # # # # # QB@Sd gS# QgS Q /NuNV <N^Nu0@(#) Copyright (c) 1990, 1993 The Regents of the University of California. All rights reserved. $NetBSD: mkboot.c,v 1.1 1997/02/04 03:53:04 thorpej Exp $SYS_XXXXX3\55lr&4r& r&L\(BOOT43VSYS_INSTB 6 5d.|p/ | L\Q | jAP <N{ <N{NzJg <N{#_@ 9_@ g( #_@ 9_@ g ` #_@ 9_@ g g g ` ` `N{NzJgXpN{N{N{N{N{ 9_@  g g g g `N `F `> #_@ 9_@ g" #_@ 9_@ g #_@ 8gB x f A.,`| xg~`~#D#H 8#L$|5d&|NBfNN|#HN#T#X!: o2!TBNu!T.yXpNuH/NJg XLPNsNr'1NaNrNNu / oNPNuNVH88I:6<JPfv tBobG:0@ @ccF0HAxf$|V`>xf "9g$A`,xmH@B@$@`` ox$@`$@/ NXJfB BoB*x)@`)|)JB@*9@ 9B BfJg6`0, @'gxn$ @gn @g8 @gb`f @ gT @g*`X @ggLn @9g @Gg>`B @g @f66`46`.6B@*9@ @g @fRB`6` 6`6GIRBBnLN^NuNV 9Pr e00; N ((((($r`r` r`r`r#La(aa&ao~ 9D ga #DN^NuNVH8&8C: <;̰c0igCbA\0I$"xF„x骀x驀LN^NuNV/ .tfpVH@`6tf "9g `$tm H@B@`` o t$N^NuWARNING: bad date in battery clock NVH8:file No such device - Configured devices are: %s NVH<0&.&n E( BDlJgn/ //a zO JfZzg(mJg`Zzgzg&`LHxHy9Hyp`"HxHy9Hy`HxHy9Hya `XREDmHz*G߄N$DBX"9Do g/Hz2NP"9DREnHzNz#LpL 0; N4f "n`A I&AA  c&n&"n`A I&AA  c("n`A I&AA  c*"n`A I&AA  c`"n`A I&AA  c("n`A I&AA  c*"n`A I&AA  c`p"n`A I&AA  c*"n`A I&AA  c`$"n`A I&AA  c&B&` :f$H`R b( //a&n &Pm"J`A I&AA  cnR l^&n&爑(`R c b"Ix؀&B& :fR&C&`&C&B` HzapL<N^NuWARNING: BOGUS BOOT DEV TYPE 0x%x! %s(%d,%d,%d,%d): %s NVH08&nI$L 9DB@1-C2-C3-C4-C/.HnHnHnHnHn/. ad$Of> .vg(mJg`Nvgvg&`@HxHy9Hyp`"HxHy9Hy`HxHy9HyahO `/.Hzap` nAEJfp`'J/./././ jN$Of^ .APHn/./. p N$O f: .v".삀 .v稂 .H@B@ .ሂ#LB`2/ar//./././. nA/4HzLa L N^NuNV/ "n`A I$AA  c $_N^NuNVHzLaϨN^Nu320318/319/330340345350360370375380400425433???Got unexpected trap: format=%x vector=%x ps=%x pc=%x dregs: %x %x %x %x %x %x %x %x aregs: %x %x %x %x %x %x %x %x Entry point: 0x%lx NV 9Pr e0; N 8@H(0P`Xhp <`^ <`V <`N <`F <`> <`6 <`. <`& < ` <` <` <` <N^NuNV/".t grmJg`~t g t fr` 9LC5dtNmA RtNlB1/ /9PaBL 9P$R#PtfFBP`>Hx axXCOf`(A5d 9L$R#LtNfHx aB$.N^NuNV/ / &nJHfr#H/+F0kD/0+J"//HzE߄N/+/+/+/+/+ /+/+/HzNO4.N ByNByNByN3pNHx HyN Hx//ah//aO .HnHx//a| O`p`X)JHnHy9BBHx / ENO$.Szg&HnHy9BBHx /,NOQBBSdBLN ByNByNByN3pNHx /Hx//a //a O .HnHx//N| p`BL N^NuNV//$.&. rm /a JfpU`0rlpV`& ?"BJ) g n2i B`p$.&.N^NuNV nHnHy9BBHx /(aTN^NuNV/ $nHx at#x/apJgB`N yx(rBgmrg`" g g `r%A` r%A`Br #9$nN^NuNV/ "yxP yLE A SJnB)||B)|||$_N^NuNV yx(g (`BN^NuNV"yx |P)fBASJg )gn |B@)fBASJg )gN^NuNVH0 "y|$|*tĀ |P*vgBSJg*f Ѐv@Ѓ 0RvăB)mrҁ107071ppP |B@*vgBSJg*f)m1pPL N^NuNVH 0&nE:$<;̴c&0*@ @f/*a(XJgEb0*@ @gB`D#| j(rg g `r'A` r'A`B4j#9L N^NuNV/ y|B(0p0ptg2|1010fp 0#0 0!(m0)07)070ppP yL 눐A "鉒SJn$N^NuNV/ /"y|$|** BfB`4 A 0(B(T@)m1pP $$_N^NuNV/B9AgT9A 9:g S#:B`: f t#:B`&AB0g fB` 0 $N^NuNVN^NuNV 9Prgn r mr oB`/<AaJWIDN^NuNV/ / $nG AMC i( f|r#A/ ap`B$n&nN^NuNV/ nACM"qP yLE A SJn||)@)@ yLE A SJn)@) @|@| yLE" ҀE" A SJn$_N^NuNVH<<$n$. (.(n&.EAME*&jB+| Hx/ K)N|@|?*@@ BPrg `@Hx/ NB+PJgd`\Hx/ NPJmSf|THx/ NPJlR|@rf yLA 鈐ЀSJn|?Hx/ NB+ L<0BG:*<;BBcxA$p8"DN"+ R"( fJ,*܁#F,*܁#F j E(C-R Rd&|.؆|ֆRGJoL |N^Nule%d: been babbling, found by '%s' le%d: memory error in '%s' byeNVH 0$n"j%I BQBG( j T  @Rtl j B BC%I  j 1@ j " @`1@C@%I  j 1@ j " @ 1@C%IB  j1 j" @1 j1 jBpCRtl%IB  j1 j" 1 j1 jBpCRtlL N^Nule%d: card failed to initialize NVH08&n&. I 爐ANE "R jBh)g0)g$<SfB$B / a`XJgHx/Hj(a:O "R j1|)g0)g$* 2"R j1|)g0)g"R j1|)g0)g"R jBh)g0)g$<B"R jBh)g2)g6fSf"R jBh)g2)gg$"R jBh)g0B)g` / HzLaL N^Nule_pollle%d_poll: rmd status 0x%x le_poll: chained packet csr0 when bad things happen: %x NVH>8*.BGN"S kBh)g2)gB62A\"S kBh)g0)g"k kE0*lB`< xgt4gHzBHzaO  g AL"0R! g AL"0R! gHzBHza2HzaO0*@<g0*?BgBHzaB`p0*@ @g HzaxX0*B4 oB/HzaX`6Jg2YJo,"k l$//. I 눐爐 kHp a&Bj0*@5@ + ,R'F R|lB L|N^Nule_put(way before xmit)le_put(before xmit)le_put(after xmit)le%d: transmit timeout, stat = 0x%x le_put(timeout)le%d: reset and retry packet le_put: xmit error, buf %d le_put(xmit error)le%d: transmit underflow le%d: lost carrier NVH?<,.BGN(|"S kBh)g2)gB62AZ"S kBh)g0)g xgt4gHzBHzNavO  g AL"0R! g AL"0R! gHzJBHz$aHz6aO"k$ kE0*m/K 눐爐 kHp /. aO ~?m5|`0D@5@Bj0*@5@"S kBh)g2)g4 xgrgHzBHzRazO  g AL"0R! g AL"0R! gHzfBHz(aHz:a"O"S kBh)g0)g"S kBh)g2)g4B6 xgrgHzBHzaO  g AL"0R! g AL"0R! gHzBHzdaHzva^O(`,"S kBh)g2)gB6 fSJf/BHzoI߄NO JCll4gHzxBHzaO  gAL 0HR!H gAL 0HR!H gHz2BHzaHzaOg6HzNX"S kE:Bh)g0)gN`|"S kBh)g0)g Xg/+$Hza4PgHzBHza O  g AL"0R! g AL"0R! gHzBHza0HzaO +$*@R'M$R~lB$0* g AL"0R!0* g AL"0R!0* g AL"0T!0*gp0*gBHzaP0* g AL"0R!0* g BHzaZ0* g AL"0~҇!p` L7A6Bk80k00+4H(L@H D7H(7A 2HpFLAR8+27D"`BBk67k*80+0H2+4HLA7@(Bk 2HpFLAR2+2HLk*7@"L N^NuNV H?8&n0k4 Sj \,R0+2HLh$kHx;/ jN kHx=/ hNኄ"BHi/ jN$kHx;/ jNO kHx=/ hNኄ"BHi/ jN዆"CE BO* 0k80+(H"L@0+2HL҈0+0HLҫ0k60+4HL((؈(EBo k/ / hNTPRn k/// h NO R~lLN^NuNV n"n hB1N^NuNVH0<*n$n &nBJm2oHp0m4o"Bg`BSjpRR0m4n8m22m0vmRRnL< N^NuNVH8<$n j"H( g<0(HfBiH jBhE jBhE jBhE jBhE j1|B jP@ jP@ j|@ jP jB*@@A jjA@ jjA@ jjA@ j|@/ aB:j0/ :j./ BBBB/ IXNO$&j+@D2j@( g. yLK A& KB$ SJn(@D f/ aHx :j4/ :j2/ :j / :j"/ 0*(Hr L@2*4HL0j6Hp0*(Hr L@0*2HL0j8Hp/ NL<N^NuNV/ / &n . rf8Hx0k4/0k2/2+4/2+2/0k /0k"// aL`|rfHx0k4/0k2/2+4/2+2/0k /0k"// EXNO.0k4/0k2/2+4/2+2/0k /0k"// N7k7k`6Hx0k4/0k2/2+4/2+2/0k /0k"// a$n&nN^NuNV//"n$. ".B0)4HL./0)2HL./0i4&L8/0i2&L8/0i4&L8/0i2&L8// a$.&.N^NuNV/ /"n$. Hx4i4/ 4i2/ 0)4HL./0)2HL./0)(H"L@2)4HL0i6Hp0)(HL@(0)2HL(0i8Hp(/ a$.$nN^NuNVH80$n&. (.$6j$Hx/ aHx0*&4/0j2" L/0j4"L/ @L/0j4"L/0j2 L// a L N^NuNVH<0$n(.*. "jJgpJgl)@D4*@Hg, yLG A& IB SJn(@D fn'@3n@3n@3n@3n@3DA3EAjA@L 8&n$kHx;/ jN kHx=/ hNኄ(BHl/ jN$kHx;/ jNO kHx=/ hNኄ(BHl/ jN዆֫(CE :+0HEBE|0k4 ^jpЈ&B4+2H0k80+(H,L@h LЈL"k0+6H@B@|LЁBo Bo TRnR0k2$nR|lL|N^NuNVH?< n . ".&.(.*. $.$JgJg<(0HFBF~-FL hG LE| m" .C A~ή$G|ƆS~gH,.-F. |f"`"~gmJg `| g ` B``"FQBDSd`"~‡A-p"C A-p Jg*EK, -F`-EJg~ (G`Jg , ~̇-F`B-n|ͮ .Ќ*ʆ]I-@DE<..G|S|gH..-G&"K JJgN, ..|f `"~gmJg `| g ` B`` F. AJgCJfJ .S|gx~f `&|gmJg `~ g `B` ,`.F XQB@Sd`: .g4@|g ~gmJg `| g ` B``F XXSfJg@..'g|f `"~gmJg `| g ` B`` F..'QBDSdL:yBy:zBy:|By:~3p:Hx Hy:xHx//a//aǤHxHnHx//a2O0| |@|5HxHnHx//aƪHx%HnHx//E,NO$.HnHx//NHxE/ awOJ.f& rA0SQBASdA00> @!gFn @ g `T @"g`LHxHzt/ adJVv ƀ`2HxHza/ adv Jfv`HxHzN/ advJfv LN^Nurdgetinfo: rdstrategy error %d rd(%d,%d,%d): WARNING: %s, using old default partitioning NVH08(nGE7Hx/ av%|($,v)CHnHy8 *(f </HxHx/ aB)BO Jg/Hz:awB`/ Hy8aP8PJg^//,/,/Hz*E߄NHz:N2lA!\C6BBB i&0 L8'  .&R-C2Rb`J68ZBBJSg:E8dC8hB"0|Jg q' .&R-C4RbpL N^NuNVH8<&n *n&.xm/ ajXJfpU`xlpV`C C$ C C" ҁ Fh$B%C%M$J* f4 Fh(B/ / a9@Plp`:| / a$JfpY`&xgB0*ox<fpX` n!JBL<N^Nurd(%d,%d,0,%d): request status fail %d rd(%d,%d,0,%d) err: vu 0x%x, block %d, R0x%x F0x%x A0x%x I0x%x NVH00&.$. &nA9 H9B99 9Hx/Hx//aœHxHy:dHx//E,NO$.HnHx//NOJ.g.I// //Hzau.B`p9:dI// //Hz E߄NG:jO+fA:l0@0g/9:pHzNPA:l0P/6S/ 2y:h/ 2y:f/ HzNpL N^NuNVH8$n"n I" I" I I AFhA &A/ / a7@m | p`BLN^NuNV//$.&. A:x >:yBy:zBy:|By:~3p:Hx /Hx//a//aHxHnHx//aX$.&.N^NuNV/ $nHx2/*ar6BB$nN^NuNVH?<&n,. ".*.&$+BJg +~gҳ  B+  8@88By8Ѐ#8488#8A8~g`B(<,E-VK-I,HxHy8Hx//"DN//N///.Hx//NO0./NHxHnHx//NOJ.g,/+//aO Jg+ RG R op` n BL&/aX9Kg0j//Hzak8O $|GIRErlJ"f, 9L"9!L#!L9!#!r#"L N^NuNV nrmA A9J0 fB`pN^NuNV nAC9HxBBHxHy"/. HqaTN^NuNV/ n .AE9C"Hx//.HxHi/. Hra$nN^NuNV nAC9Hx/./.Hx Hy"/. HqaN^NuNVH? $n.. ,.*.$.&.EA9EHx x؎/ah8|( r@ H@H@ @B r@r CHx//Hx /// aFLN^NuNVH? $n.. ,.*.$.&.EA9EHx x؎/ag|* r@ H@H@ @B r@r CB//Hx /// aLN^Nusd(%d,%d,0,0): init failed (stat=%x) NVH <(n$n C" C" C C A> %s, Revision %s >> (%s, %s) >> HP 9000/%s SPU sys_inst> unknown command: %s NVH?> Available commands: >> %s - %s You will be asked several questions about your disk, most of which require prior knowledge of the disk's geometry. There is no easy way for the system to provide this information for you. If you do not have this information, please consult your disk's manual or another informative source. Disk to label?cannot read disk %s, errno = %d Sucessfully read %d bytes from %s (z)ap, (e)dit, (s)how, (w)rite, (d)one > Sucessfully wrote label to %s unkown command: %s NVH>&X/Hz FNHxd/ EN/ DNOJg / a(X/ / GNPIGR B6(nv!|VEW VEWBh/a1R B1@L Name of miniroot file? le0a:can't open %s can't stat %s Copying miniroot from %s to %s...Which tape device? File number (first == 1)? Invalid file number: %s Invalid device name: %s XXXCopy how many %d byte blocks? Invalid block count: %s Zero blocks? Ok, aborting. can't open %s file %c Copying %s file %d to %s...Unknown source: %s Read error, errno = %d Bad write at block %d, errno = %d done Successfully copied miniroot image. NVPH?$@PJl//HzN`Hn//HzNO`"HyMdHzNP`/9LHzN`BB`rHx(@// a>$O mg\ bz"nT iHnX///Hx/) hNOJfXg/9L/HzMNO `Jf RnJPgHzTNHzTNP/ EN/.\NL<(N^NuDisk to boot from? booting: %s -s boot: %s NVH08&n$. &.(.zڎEHx /Hk IN-CO c(<-DBHxL/ Hx,/HxHx/</aO |fp`T|Lc |H#Lp`B"g #Lp`4|І$*Ho//Hz8a28|H#Lp`//.HjLN L|N^Nubootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d NVH08/.a!J&@XJg"E& CIp$r-A-Ar-AA-H/9NPHnaZPJfS#7y# r&Hx/ n// HxHx/</ aL$O rmHza1 `HyNLHy8/ a*3NLB0,/Hx/</98av ,Oo//Hza0`prx҃-A#9Hy9Hy9HnE n5f6 f. jf& jfHxHkHja "pJf `pL N^Nucallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sNVH88&n$. &. f po`"h `8"SA<@"9L <@cf fgAb2|xg ``-B-Cx-DBIxHx/</ apO xg7@BBHxHna)x-Dx-DA 9:(R#:R Bx-D-|-Dx-DE`Hx/ Hyb(//Hy2/ aO$xgxdЊJpg xH#Lp`""*g/Hzna*nxH#LpP`xe$/9La/Hzza*@xH#Lp`<"T$S"9Lxl#Lr  @<@R#L !B!C!I LN^NuNVH<8&n&. (.$n(n /// aO zg7@$ ԮABBHxHja(Az z!EA 9:*R#:R Bz!E!C !D!n$L Ю$E萊// Hyb//Hy2/ aO$zgzdЊJg zH#Lp` "*g/Hza(zH#Lp`L<*. B/.a&PmHn/aPJf.gHza#l/a|`Hx x؎//IfN-@|O | fd".$ B@Jg Af `T gL B@Jg Af `< g4 B@Jg A f `$  gBBJg Af ` g|O`/.HzG߄N$E". B@PJg A g `&  fHx //a!( EE |ݮO /./ /NO f".$ B@Jg A g"`  g B@Jg Ag `8 f0BBJf, g"B". B@Jg f,  f/.Hz0N/./ /NOf/.HzNB|PKJgB .|R-@|e( Hx/HnNXO .g /HzN/./ /NOfB|JgHxHn|/NO |fvHx/ Hn|NO .|gY-@|X// /NO |fFJg /.|HzYNP/a$ V|Ć/ HzBN////./.aT|` /aZ|#LL<|XN^NuNV/ ."牒ANTCte f t #Lp`*f i /. / hN#LB` t-#Lp$.N^NuNV/BA nB0(C c4AbB0$N^NuNVH0<&n$ &<Il*L CNrrgVmr g&mr`r g`hrgZmrgR`Xrg `PBHx N`RdSHxNHx NHxNO `Hx N$BXcI/NXb`~&BHx `/NX`jL< N^Nusendudp: bad write (%d != %d)NVH<<(.$n GKv֮Hx/ $< BNpp;C| | D+h +PHx/ IƴN;@ D6 7h:E7E-U-j-j-j-jHx / BN;k // N7@*%n%n%n%n$-O zg"- g 9$g€Āf/-`/97/a\XO./// /aOzfp`g//HzazЅL< (.A6pB2|*< |F"L$BE," ҁ0Jg& L$CE<" ҁ 0Jg0<.SJn RL|N^NuNVH? n BBB"nJo\BBJg  ЅԀS. fUJm*B0ԀUJl`UJmBB ԀԁUJl ~g(JnJgԄ H@H"$ԁ H@HԀFB0LN^Nuarpwhohas: overflowed arp_list! arp: no response for %s NVH0<*nBG#"9#do n $gRG nvlv##dHzaXHx.E/ a4=|||=|HxHnHmINHxHnHmNO.HnHn N& Hx4HnHyɊHx./ Hyf/ aO(vf/. a/HzaHx$ X/HnNR#d ` XL< hN^NuNVH<8(n&n  f @f kfzHx* X/tԋ/a|O Jf\7|Hxx؋/& P/ENHx/tԋ/NHx/HlNO .//NHx/Hx./ / aL<,.BK6(MBBLlAH-pL&nB lh-CB`H-B kpf4 n/Hn hNPl*(#6#6#6R kmER mRLmvJg&"y6 y6"iAp"96㨁 `BL<|N^Nunetboot: no interfaces left untriednetboot: couldn't probe %s%d NVH8<&.BILJgRIxlx#Lp`Hx/ aPB 9Lo.&@KH$]B l jBCR mRn/aX&@XJf Hz2a S// hNPJg/+ S/Hz2ax#Lp`,$S)K// j NHx k"jA/1aV L<N^NuNVH 0B 9Lo.$GH$[B l jBCR mRnL N^NuNV n"P/. / iNN^NuNV/ / $n n &R!J/./ k NHx j"kA/1a$n&nN^NuNV n"P/ iNN^NuNV"n i P/././. / hNN^NuNV"n i P/./. / hNN^NuNVH 0 nrm*G$ A,$ԂEL r("P/ iNB(B` r #LpL N^NuNV nrmC A ALA ` r #LBN^NuNV n"P/. / iNN^NuNVH0 $n"*BLHx/*D/*@a~O Jnz%EBLHx/*D/*@a O Jnz%EBLHx/*D/*@atO Jnz%EXJ8f,/ aBBBN%@HOJ8fJzgmJf#B#C`ש*)ۂ#E`z[#Lpr` )")` i //// hNL y$xet"Vx„E #$ c//Hza< ` "C Q" XLN^NuNV n $Y#$N^Nu NVJ6fp#6a$Hn /.aXHzaDa"NqNV/ /BENT Eg /aXRrl$.$nN^NuNVHn /.aN^NuNVH8<(n*n &nY` Jg/NXIx%fBIxog m,xcgmJgxbgD`fxdgxlg.`Txsgm xpg`>xugxxg`*v`X$$SI/// aO Jgp``Xxȓ/` X$SIg/NXIf`EX$l Hx-NDXHx // NO `EX$Hx// NO `EX$Hx // NO `Hx0NHxxNPEX$Hx// NO `jHx%NXJgVHxlNX`JL<N^Nu0123456789abcdefNV/. /.HylaN^NuNV/$.#6 Ю S#6/./.Hy2a y6B 96$.N^NuNVH80&n". $.E& ApLBJf"I/NXeL N^NuNV y66d  R6N^NuNV/ /$n$. nJg 1fr8gp``Jfp`VBJ f %|x B(J$f%|ڒ$HxHx/*( j N @%HO fp`B jB Jl D jr!A Qrd<"jJg j$Jg|Jg/ /)adP j$/*/*(NB`R j!Bp/ jJ WIp// a j!@O f>"jJgX j$JgNJg/ /)aP j$/*/*(NB`$ jJg*BBBJ Vr€ B/ j/(aB$.$nN^Nuunknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data checkNVH> $nJgN"jJgDJg>| WI|ʆv | e"0; NBp2` *g&S%@R RB#@|R|g j| %|` j (Pc| %|`| *g:&S%@R RBR j$(Ԅ L<B Ҁ 눐g| %|`&|gF| *g&"jS%@R R|#@R j| *g&"jS%@R RBH@B@ѩR j| *gx&"jS%@R RBѩR j| *gJ"jS%@R RBѩR j%h0| p`v| "%|0 jB`\// /)aJ&O |f j| jB"j`Jf&|f& jHh/ /(aJ jO J g | "j`| *g&"jS%@R R|#@R j| *gZ&"jS%@R RBH@B@ѩR j| *g,&"jS%@R RBѩR j| *f `V& jS%@R"RBѨR j,(g| %|@ j|!F"j`| p`p`pL|N^NuNVH8 $nJg jJfp`x g jB$*fp`"R& j"(Axe 0fR`JgB`x"RSf Ѫ$%B j!Axgp`P$*&*Jg2 jJg*BBBJ VxȀ B/ j/(a h%B%C jx BLN^NuNV/ $nJg"jJg j$Jfp`(Jg/ /)a P j$/*/*(NBB$nN^NuNVH< $n&. $.(Jg jJgzgp`T//Hxa:O 0gp`8z%E0 j"( g p$Sք///(a jz BLzjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-NVH8 ". n "nJfB`FxdBEB xF 2   2 B 2 B 2 B 2 B 2 B 2 B 2 QxetJg BE: xF 2 SJf FLN^NuNV $.4..4S-G&n0e p?F`@(n0"d T`(`&n3P(n(4X0p$. cA." !DԀbt..` fp. "S &n g.t nYY YS8 . "S fS@dR4..4<(.*n(n,.*.$$n(BHxHx /*( j N&O fp`/Hn// /.HztHzHx// GN$O(fJf2rf %|2`rg %|Ut//*( j$N `/Hn///. HzHzB/. HuLN$O(f"FJfH c@rf %|t` rf %|`rg %|t//*( j$N `//*( j$NBL<|N^NuNV/ / n"n $n&n $"$$$ &4 B$_&_N^Nuinvalid literal/length codeinvalid distance codeNVH?<(n*. $l*E-U,-(, &,&l4 ,0c$"@S` )D )C*EB .ѭ*)K4/.`&)D )C*EB .ѭ*)K4/.`)D )C*EB .ѭ*)K4/.`)D )C*EB .ѭ*)K4/.`)D )C*E+F .ѭ*)K4/.`)D )C*E+F .ѭ*)K4/.`^)D )C*E+F .ѭ*)K4/.`6"l, ~ e0; Nrҳc~ d)D )C*E+F .ѭ*)K4// /*/*B*/B*/aZ-@-U,-(, &,&l4O ,0c"@S`"l,Jg~g~ $`>B*%@ %j~$"* c$BJgBS*nR 稈PbA5  jAB(ଖBf%h~$`g~΀%G%h~$`gg~$`~ $*E+|)D )C+F .ѭ*)K4Hx`"*c$BJg`BS*nR 稈PbA5 Ѫ⬖B*%@ %j~$"* c$BJg4BS*nR 稈PbA5  jAB(ଖBg~΀%G%h ~$`f%@ (A%H`~ $*E+|)D )C+F .ѭ*)K4Hx`"*c$BJgBS*nR 稈PbA5 Ѫ ⬖~$" ( * c*l,-M`-KJghJf l,f ,0",(g&Ac"@S`"HJfb)K4/.// a\-@&l4O ",0$c "@S l,` l,"H˱f ,(g&@c"AS`"HJgB*nRS*n,f-l( *.S%G~f<`Jf$,,f ,0",(g&Ac"@S`"BJfb)K4/.// a-@&l4O ",0$c "@S l,` l,"H˱f ,(g&@c"AS`"HJg8B SB`~~dQRS)K4/.// a-@&l4O ,0f~$)D )C*E+F .ѭ*)K4Hx`J)D )C*E+F .ѭ*)K4Hx`$)D )C*E+F .ѭ*)K4Hx// a~L8$n&n *.(+ &*0 *4$d$*, +d$Jg|fB'@ի j8Jg///*??z=!""\":#$^% "   `h{}[]\| /?`\  0.,+123-456*789/E()^1234567890-=[];',./ opklqwertyuiasdfghjmzxcvbn~|  0.,+123-456*789/`|\~!@#$%^&*()_+{}:"<>? OPKLQWERTYUIASDFGHJMZXCVBN`  0.,+123-456*789/E()1234567890-=;',./    `<  0.,+123-456*789/E()^1234567890+'[]*\,.- opklqwertyuiasdfghjmzxcvbn~>  0.,+123-456*789/`|\~!"#$%&^()=?/{}@|;:_ OPKLQWERTYUIASDFGHJMZXCVBN`<  0.,+123-456*789/E()1234567890+'*,./    G@ L.D:h:^::5;JT?WTWV:XPT(TBF?IJHJT(TBL?OXON>PTT(TBT?WTWV:XPT(TBT?WTWV:XPT(TBT?WTWV:XPT(TB@X?DEPBET(TBYd?^X^_N`$T(TB????*+$)%t%% !q"  +,*o8 "0 +  ",p-. (/ d0CG$HHj"jXii| |AA,,,,%%Y^p^bub 5?5sp\`| \ <VP ]!?!<p\~ |z z   PP%DDTD{|k|O|F|/x|*|L||P{{l|* NetBSD/hp300 Miniroot Installer1.7Fri Mar 3 17:13:12 PST 2000oster@zoot@` 0123456789abcdef/N `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??TZif tLMTGMTWATTZif Ύn~Qp *0CATCASTBOOT43:SYS_UBOOTB & .|p/ | L\Q | jA <N{ <N{NzJg <N{#_@ 9_@ g( #_@ 9_@ g ` #_@ 9_@ g g g ` ` `N{NzJgXpN{N{N{N{N{ 9_@  g g g g `N `F `> #_@ 9_@ g" #_@ 9_@ g #_@ 8gB@ x f A.,`| xg~`~## 8#$|&|2BfNN|#N##!: o2!BNu!.ypNuH/NJg XLPNsNr'1NaNrNNu / oNPNuNVH88I6<Jfv tBobG0@ @ccF0HAxf$|V`>xf "9@g$A`,xmH@B@$@`` ox$@`$@/ NXJfB BoB*x)@`)|)JB@*9@ 9B BfJ@g6`0, @'gxn$ @gn @g8 @gb`f @ gT @g*`X @ggLn @9g @Gg>`B @g @f66`46`.6B@*9@ @g @fRB`6` 6`6GIRBBnLN^NuNV 9r e00; N ((((($r`r` r`r`r#0a(aa&ao~ 9 ga #N^NuNVH8&8C <c0igCbA0I$"xF„x骀x驀LN^NuNV/ .tfpVH@`6tf "9@g `$tm H@B@`` o t$N^NuWARNING: bad date in battery clock NVH8:file No such device - Configured devices are: %s NVH<0&.&n E( BlJgn/ //aO JfZzg(mJg`Zzgzg&`LHxHyHy`"HxHyHy`HxHyHyap `XREmHz*G$N$DBX"9o g/Hz2NP"9REnHzNz#1(pL 0; N4f "n`A I&AA  c&n&"n`A I&AA  c("n`A I&AA  c*"n`A I&AA  c`"n`A I&AA  c("n`A I&AA  c*"n`A I&AA  c`p"n`A I&AA  c*"n`A I&AA  c`$"n`A I&AA  c&B&` :f$H`R b( //a&n &Pm"J`A I&AA  cnR l^&n&爑(`R c b"Ix؀&B& :fR&C&`&C&B` HzapL<N^NuWARNING: BOGUS BOOT DEV TYPE 0x%x! %s(%d,%d,%d,%d): %s NVH08&nI$L 9B@1-C2-C3-C4-C/.HnHnHnHnHn/. ad$Of> .vg(mJg`Nvgvg&`@HxHyHy`"HxHyHy`HxHyHyaO `/.Hza`p` nAEJfp`'J/./././ jN$Of^ .AHn/./. p N$O f: .v".삀 .v稂 .H@B@ .ሂ#1B`2/a//./././. nA/4HzLa L N^NuNV/ "n`A I$AA  c $_N^NuNVHzLaHN^Nu320318/319/330340345350360370375380400425433???Got unexpected trap: format=%x vector=%x ps=%x pc=%x dregs: %x %x %x %x %x %x %x %x aregs: %x %x %x %x %x %x %x %x Entry point: 0x%lx NV 9r e0; N 8@H(0P`Xhp <`^ <`V <`N <`F <`> <`6 <`. <`& < ` <` <` <` <N^NuNV/".t grmJg`~t g t fr` 9CtNmA RtNlB1/ /9aB 9$R#tfFB`>Hx axXCf`(A 9$R#tNfHx aB$.N^NuNV/ / &nJfr#/+F0kD/0+J"//HzE$N/+/+/+/+/+ /+/+/HzNO4.OJg 91(`2Hy/9 lN.HzNO Hy/9 l/9ar`L<N^NuNV/ /$n$. BJf"/aN#Xlp`// aJfR%|$.$nN^NuNV 9o"S#rf /9a nBN^NuNV n pN^NuSwitching to APCI console. NV/ / &n#A Hx aD$@BX 9rgnPr mJr nD/ a$Jf**rBg(mrg ` g gr'Ar#$n&nN^NuNV/ $yr#Hz2=By2@By2>By2B3p2DHx Hy22=By2@By2>By2B3p2DHx /Hx//a //a O .HnHx//N| p`BL N^NuNV//$.&. rm /a JfpU`0rlpV`& $"BJ) g n2i B`p$.&.N^NuNV nHnHyBBHx /(aTN^NuNV/ $nHx at#/apJgB`N y(rBgmrg`" g g `r%A` r%A`Br #$nN^NuNV/ "yP y0E A SJnB)||B)|||$_N^NuNV y(g (`BN^NuNV"y |P)fBASJg )gn |B@)fBASJg )gN^NuNVH0 "y$|*tĀ |P*vgBSJg*f Ѐv@Ѓ 0RvăB)mrҁ107071ppP |B@*vgBSJg*f)m1pPL N^NuNVH 0&nE$<c&0*@ @f/*a(XJgEb0*@ @gB`D# j(rg g `r'A` r'A`B4j#L N^NuNV/ yB(0p0ptg2|1010fp 0#0 0!(m0)07)070ppP y0 눐A "鉒SJn$N^NuNV/ /"y$|** BfB`4 A 0(B(T@)m1pP $$_N^NuNV/B9AgT9A 9g S#B`: f t#B`&AB0g fB` 0 $N^NuNVN^NuNV 9rgn r mr oB`/<AaJWIDN^NuNV/ / $nG A1C i( f|r#A/ ap`B$n&nN^NuNV/ nAC1"qP y0E A SJn||)@)@ y0E A SJn)@) @|@| y0E" ҀE" A SJn$_N^NuNVH<<$n$. (.(n&.EA1E*&jB+| Hx/ K)N|@|?*@@ BPrg `@Hx/ NB+PJgd`\Hx/ NPJmSf|THx/ NPJlR|@rf y0A 鈐ЀSJn|?Hx/ NB+ L<0BG*<BBcxAh$p8"D2P"+ R"( fJ,*܁#F,*܁#F j E(C-R Rd&|.؆|ֆRGJoL |N^Nule%d: been babbling, found by '%s' le%d: memory error in '%s' byeNVH 0$n"j%I BQBG( j T  @Rtl j B BC%I  j 1@ j " @`1@C@%I  j 1@ j " @ 1@C%IB  j1 j" @1 j1 jBpCRtl%IB  j1 j" 1 j1 jBpCRtlL N^Nule%d: card failed to initialize NVH08&n&. I 爐A2PE "R jBh)g0)g$<SfB$B / a`XJgHx/Hj(aO "R j1|)g0)g$* 2"R j1|)g0)g"R j1|)g0)g"R jBh)g0)g$<B"R jBh)g2)g6fSf"R jBh)g2)gg$"R jBh)g0B)g` / HzLa L N^Nule_pollle%d_poll: rmd status 0x%x le_poll: chained packet csr0 when bad things happen: %x NVH>8*.BG2P"S kBh)g2)gB62A\"S kBh)g0)g"k kE0*lB`< xgt4gHzBHzaO  g A0"0R! g A0"0R! gHzBHzaHzaVO0*@<g0*?BgBHzaB`p0*@ @g HzaX0*B4 oB/Hza`6Jg2YJo,"k l$//. I 눐爐 kHp aBj0*@5@ + ,R'F R|lB L|N^Nule_put(way before xmit)le_put(before xmit)le_put(after xmit)le%d: transmit timeout, stat = 0x%x le_put(timeout)le%d: reset and retry packet le_put: xmit error, buf %d le_put(xmit error)le%d: transmit underflow le%d: lost carrier NVH?<,.BG2P(|"S kBh)g2)gB62AZ"S kBh)g0)g xgt4gHzBHzNaO  g A0"0R! g A0"0R! gHzJBHz$a:Hz6aO"k$ kE0*m/K 눐爐 kHp /. aO ~?m5|`0D@5@Bj0*@5@"S kBh)g2)g4 xgrgHzBHzRaO  g A0"0R! g A0"0R! gHzfBHz(a>Hz:aO"S kBh)g0)g"S kBh)g2)g4B6 xgrgHzBHzaVO  g A0"0R! g A0"0R! gHzBHzdazHzvaO(`,"S kBh)g2)gB6 fSJf/BHzoI$NO JCll4gHzxBHzaO  gA0 0HR!H gA0 0HR!H gHz2BHzaHzaBOg6HzNX"S kE:Bh)g0)gN`|"S kBh)g0)g Xg/+$Hza84PgHzBHzaO  g A0"0R! g A0"0R! gHzBHzaHzaTO +$*@R'M$R~lB$0* g A0"0R!0* g A0"0R!0* g A0"0T!0*gp0*gBHza0P0* g A0"0R!0* g BHza0* g A0"0~҇!p` L7A6Bk80k00+4H(L@H D7H(7A 2HpFLAR8+27D"`BBk67k*80+0H2+4HLA7@(Bk 2HpFLAR2+2HLk*7@"L N^NuNV H?8&n0k4 Sj \,R0+2HLh$kHx;/ jN kHx=/ hNኄ"BHi/ jN$kHx;/ jNO kHx=/ hNኄ"BHi/ jN዆"CE BO* 0k80+(H"L@0+2HL҈0+0HLҫ0k60+4HL((؈(EBo k/ / hNTPRn k/// h NO R~lLN^NuNV n"n hB1N^NuNVH0<*n$n &nBJm2oHp0m4o"Bg`BSjpRR0m4n8m22m0vmRRnL< N^NuNVH8<$n j"H( g<0(HfBiH jBhE jBhE jBhE jBhE j1|B jP@ jP@ j|@ jP jB*@@A jjA@ jjA@ jjA@ j|@/ aB:j0/ :j./ BBBB/ IXNO$&j+@D2j@( g. y0K A& KB$ SJn(@D f/ aHx :j4/ :j2/ :j / :j"/ 0*(Hr L@2*4HL0j6Hp0*(Hr L@0*2HL0j8Hp/ NL<N^NuNV/ / &n . rf8Hx0k4/0k2/2+4/2+2/0k /0k"// aL`|rfHx0k4/0k2/2+4/2+2/0k /0k"// EXNO.0k4/0k2/2+4/2+2/0k /0k"// N7k7k`6Hx0k4/0k2/2+4/2+2/0k /0k"// a$n&nN^NuNV//"n$. ".B0)4HL./0)2HL./0i4&L8/0i2&L8/0i4&L8/0i2&L8// a$.&.N^NuNV/ /"n$. Hx4i4/ 4i2/ 0)4HL./0)2HL./0)(H"L@2)4HL0i6Hp0)(HL@(0)2HL(0i8Hp(/ a$.$nN^NuNVH80$n&. (.$6j$Hx/ aHx0*&4/0j2" L/0j4"L/ @L/0j4"L/0j2 L// a L N^NuNVH<0$n(.*. "jJgpJgl)@D4*@Hg, y0G A& IB SJn(@D fn'@3n@3n@3n@3n@3DA3EAjA@L 8&n$kHx;/ jN kHx=/ hNኄ(BHl/ jN$kHx;/ jNO kHx=/ hNኄ(BHl/ jN዆֫(CE :+0HEBE|0k4 ^jpЈ&B4+2H0k80+(H,L@h LЈL"k0+6H@B@|LЁBo Bo TRnR0k2$nR|lL|N^NuNVH?< n . ".&.(.*. $.$JgJg<(0HFBF~-FL hG LE| m" .C A~ή$G|ƆS~gH,.-F. |f"`"~gmJg `| g ` B``"FQBDSd`"~‡A-p"C A|-p Jg*EK, -F`-EJg~ (G`Jg , ~̇-F`B-n|ͮ .Ќ*ʆ]I-@DE<..G|S|gH..-G&"K JJgN, ..|f `"~gmJg `| g ` B`` F. AJgCJfJ .S|gx~f `&|gmJg `~ g `B` ,`.F XQB@Sd`: .g4@|g ~gmJg `| g ` B``F XXSfJg@..'g|f `"~gmJg `| g ` B`` F..'QBDSdLByByBy3pHx HyHx//a//aǤHxHnHx//a2O0| |@|5HxHnHx//aƪHx%HnHx//E,NO$.HnHx//NHxE/ a\hOJ.f& rA0SQBASdA 00> @!gFn @ g `T @"g`LHxHzt/ aIzJVv ƀ`2HxHza/ aI`v Jfv`HxHzN/ aIFvJfv LN^Nurdgetinfo: rdstrategy error %d rd(%d,%d,%d): WARNING: %s, using old default partitioning NVH08(nGEHx/ a[@%|($,v)CHnHy *(f </HxHx/ aB)BO Jg/Hz:a\xB`/ Hya4PJg^//,/,/Hz*E$NHz:N2lAC6BBB i&0 L8'  .&R-C2Rb`J6BBJSg:ECB"0|Jg q' .&R-C4RbpL N^NuNVH8<&n *n&.xm/ ajXJfpU`xlpV`C C$ C C" ҁ *$B%C%M$J* f4 *(B/ / a9@Plp`:| / a$JfpY`&xgB0*ox<fpX` n!JBL<N^Nurd(%d,%d,0,%d): request status fail %d rd(%d,%d,0,%d) err: vu 0x%x, block %d, R0x%x F0x%x A0x%x I0x%x NVH00&.$. &nA HB9 Hx/Hx//aœHxHyHx//E,NO$.HnHx//NOJ.g.I// //HzaYB`p9I// //Hz E$NGO+fA0@0g/9HzNPA0P/6S/ 2y/ 2y/ HzNpL N^NuNVH8$n"n I" I" I I A*A &A/ / a7@m | p`BLN^NuNV//$.&. A >ByByBy3pHx /Hx//a//aHxHnHx//aX$.&.N^NuNV/ $nHx2/*aVBB$nN^NuNVH?<&n,. ".*.&$+BJg +~gҳ  B+  @By Ѐ#"4&'#(A,~g`B(<,E-VK-I,HxHyHx//"DN//N///.Hx//NO0./NHxHnHx//NOJ.g,/+//aO Jg+ RG R op` n BL&/aX9g0j//HzaOO $|GIRErlJ`f, 90"9XL#XL9\#\r#`L N^NuNV nrmA AJ0 fB`pN^NuNV nACHxBBHxHyd/. HqaTN^NuNV/ n .AECnHx//.HxHi/. Hra$nN^NuNV nACHx/./.Hx Hyp/. HqaN^NuNVH? $n.. ,.*.$.&.EAEHx x؎/aL|( r@ H@H@ @B r@r CHx//Hx /// aFLN^NuNVH? $n.. ,.*.$.&.EAEHx x؎/aLB|* r@ H@H@ @B r@r CB//Hx /// aLN^Nusd(%d,%d,0,0): init failed (stat=%x) NVH <(n$n C" C" C C A A &A/ / KtNPgL f* y0"뉒 툐A SJn/ / NPJgBA/ / HzNaLB`JB$QBHx// / aJf" o BRk (!@ n| pL<N^Nusdgetinfo: sdstrategy error %d sd(%d,%d,%d): WARNING: %s, using old default partitioning NVH08&nIEHx/ aJ\2+H0| %@($+v'CHnHy *(f /HxHx/ a'BO Jg/Hz4aKB`/ Hya#PJgf//+/+/Hz$E$NHz4N(|'y'y'y'y 'y$'y('y,7y0`J8rBBJTg:E|CB"0|Jg q) .&R-C4RbpL N^Nusd(%d,%d,%d): block=%x, error=0x%x NVN^NuNVH08&n (n$.vm/ aXJfpU`vlpV`C C C" C" A A"$@%B%L$J* f / / aPJfp`4/ aJfpY`&vgB0*ov,fpX` n!JBL N^NuNV/ $nHx /*aH(BB$nN^NuNVH?8$n&n $.,.(n*(*2*H&BJg *~gԲ B* ~f//// //a`//// //a*OJf n B`2I///*//HzTaI* RG RO opLN^Nuonetbsd.gzonetbsdnetbsd.old.gznetbsd.oldnetbsd.bak.gznetbsd.baknetbsd.gznetbsd >> %s, Revision %s >> (%s, %s) >> HP 9000/%s SPU >> Enter "reset" to reset system. : %s boot: %s NVH0RgZ gT bg$n ag` dg sg`t` t`t@`t`#2LRg gRfJgBf`Hz.NLN^NuNVH0<(n$ $|G4Nrg&<lrgm.r gbm Kr`Jr gPElKrg|`r#gdmrgElK`r@gpKrgEl`pBHx aHp`|ddSHx$CNHx NHxNO `HKd>S`:Hx N&BXc,I/NXb`(BHx CNXK`/NXNr`SJnBL< N^NuNVH<<(.$n (j&l/+0aC8*@aB jHn/ /+0"Lk L+$+F‚L+ЁЫLk0x*+`Ѓ*+d/Hx/* hN$OfF*.0gt`8Lk@xHxHuHl aO pAz YQB@Sd)E/+0/ aC L<8&n$. &.(.zڎEHx /Hk I¸N-CO c(<-DBHxL/ Hx,/HxHx/</aO |fp`T|Lc |H#1(p`B"g #1(p`4|І$*Ho//Hz8a28|H#1(p`//.HjLN L|N^Nubootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d NVH08/.a!J&@XJg"E& CIp$r-A-Ar-AA-H/92HnaZPJfS,7y. r&Hx/ n// HxHx/</ aL$O rmHza1 `Hy2Hy/ a*32B0,/Hx/</9av ,Oo//Hza0`prx҃-A#HyHy0HnENO Jgp`<#2HHy2HHyHnNO JfHyHnaJVI`pL N^NuNVH<0*. /.a$@XJg(&-C$-B/9Hy0HnGNO Jf/ad //HnNOJfS,5y. $Hx/pЮ//HxHx/</ aO rlT-Br-AHnHnHnENO Jf6/.Hna|PJf&-|Hn/.HnNJVI` rH#1(pL n5f6 f. jf& jfHxHkHja "pJf `pL N^Nucallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sNVH88&n$. &. f po`"h `8"SA p"90  pcf fgAb2|xg ``-B-Cx-DBIxHx/</ apO xg7@BBHxHna)x-Dx-DA 9(R#R Bx-D-|-Dx-DE`Hx/ Hy(//Hy/ aO$xgxdЊJpg xH#1(p`""*g/Hzna*nxH#1(pP`xe$/91(a/Hzza*@xH#1(p`<"T$S"90xl#0r  @ pR#0 !B!C!I LN^NuNVH<8&n&. (.$n(n /// aO zg7@$ ԮABBHxHja(Az z!EA 9*R#R Bz!E!C !D!n$L Ю$E萊// Hy//Hy/ aO$zgzdЊJg zH#1(p` "*g/Hza(zH#1(p`L<*. B/.a&PmHn/aPJf.gHza#l/a|`Hx x؎//IN-@|O | fd".$ B@Jg Af `T gL B@Jg Af `< g4 B@Jg A f `$  gBBJg Af ` g|O`/.HzG$N$E". B@PJg A g `&  fHx //a!( EE |ݮO /./ /NO f".$ B@Jg A g"`  g B@Jg Ag `8 f0BBJf, g"B". B@Jg f,  f/.Hz0N/./ /NOf/.HzNB|PK¸JgB .|R-@|e( Hx/HnNXO .g /HzN/./ /NOfB|JgHxHn|/NO |fvHx/ Hn|NO .|gY-@|X// /NO |fFJg /.|HzYNP/a$ V|Ć/ HzBN////./.ao~|` /aZ|#1(L<|XN^NuNV/ ."牒A2Cte f t #1(p`*f i /. / hN#1(B` t-#1(p$.N^NuNV/BA nB0(C c4AbB0$N^NuNVH0<&n$ &<Il*L CNrrgVmr g&mr`r g`hrgZmrgR`Xrg `PBHx N`RdSHxNHx NHxNO `Hx N$BXcI/NXb`~&BHx `/NX`jL< N^Nusendudp: bad write (%d != %d)NVH<<(.$n GKv֮Hx/ $<œ BNpp;C| | D+h +PHx/ ITN;@ D6 7h:E7E-U-j-j-j-jHx / BN;k // N7@*%n%n%n%n$-O zg"- g 9g€Āf/-`/9/a\XO./// /aOzfp`g//HzazЅL< (.AB2|*< |F"L$BE," ҁ0Jg& L$CE<" ҁ 0Jg0<.SJn RL|N^NuNVH? n BBB"nJo\BBJg  ЅԀS. fUJm*B0ԀUJl`UJmBB ԀԁUJl ~g(JnJgԄ H@H"$ԁ H@HԀFB0LN^Nuarpwhohas: overflowed arp_list! arp: no response for %s NVH0<*nBG0"9o n $gRG nvlv#HzaXHx.E/ a4=|||=|HxHnHmI¸NHxHnHmNO.HnHn N& Hx4HnHy*Hx./ Hy/ aO(vf/. a/HzaHx$ X/HnNR ` XL< hN^NuNVH<8(n&n  f @f kfzHx* X/tԋ/a|O Jf\7|Hxx؋/& P/E¸NHx/tԋ/NHx/HlNO .//NHx/Hx./ / aL<,.BK(MBBlA-pL&nB lh-CB`H-B kpf4 n/Hn hNPl*(###R kmER mRmvJg&"y y"iAp"9㨁 `BL<|N^Nunetboot: no interfaces left untriednetboot: couldn't probe %s%d NVH8<&.BI1,JgRIxlx#1(p`Hx/ aPB 9o.&@K$]B l jBCR mRn/aX&@XJf Hz2a S// hNPJg/+ S/Hz2ax#1(p`,$S)K// j NHx k"jA/1aV L<N^NuNVH 0B 9o.$G$[B l jBCR mRnL N^NuNV n"P/. / iNN^NuNV/ / $n n &R!J/./ k NHx j"kA/1a$n&nN^NuNV n"P/ iNN^NuNV"n i P/././. / hNN^NuNV"n i P/./. / hNN^NuNVH 0 nrm*G$ A,$ԂE1, r("P/ iNB(B` r #1(pL N^NuNV nrmC A A1,A ` r #1(BN^NuNV n"P/. / iNN^NuNVH0 $n"*B1(Hx/*D/*@a~O Jnz%EB1(Hx/*D/*@a O Jnz%EB1(Hx/*D/*@atO Jnz%EXJ8f,/ aBBBN%@HOJ8fJzgmJf#B#C`ש*)ۂ#E`z[#1(pr` )")` i //// hNL y0xet"Vx„E #0 c//Hza< ` "C Q" XLN^NuNV n ,Y#,N^Nu NVJfp#a$Hn /.aXHzaDa>NqNV/ /BE2 Eg /aXRrl$.$nN^NuNVHn /.aN^NuNVH8<(n*n &nY` Jg/NXIx%fBIxog m,xcgmJgxbgD`fxdgxlg.`Txsgm xpg`>xugxxg`*v`X$$SI/// aO Jgp``Xxȓ/` X$SIg/NXIf`EƐX$l Hx-NDXHx // NO `EƐX$Hx// NO `EƐX$Hx // NO `Hx0NHxxNPEƐX$Hx// NO `jHx%NXJgVHxlNX`JL<N^Nu0123456789abcdefNV/. /.HylaN^NuNV/$.# Ю S#/./.Hya yB 9$.N^NuNVH80&n". $.E& ApLBJf"I/NXeL N^NuNV yd  RN^NuNV/ /$n$. nJg 1fr8gp``Jfp`VBJ f %| B(J$f%|2$HxHx/*( j N @%HO fp`B jB Jl D jr!A Qrd<"jJg j$Jg|Jg/ /)adP j$/*/*(NB`R j!Bp/ jJ WI// a j!@O f>"jJgX j$JgNJg/ /)aP j$/*/*(NB`$ jJg*BBBJ Vr€ B/ j/(aB$.$nN^Nuunknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data checkNVH> $nJgN"jJgDJg>| WI|ʆv | e"0; NBp2` *g&S%@R RB#@|R|g j| %|Ȋ` j (Pc| %|ȥ`| *g:&S%@R RBR j$(Ԅ L<B Ҁ 눐g| %|ȹ`&|gF| *g&"jS%@R R|#@R j| *g&"jS%@R RBH@B@ѩR j| *gx&"jS%@R RBѩR j| *gJ"jS%@R RBѩR j%h0| p`v| "%| jB`\// /)aJ&O |f j| jB"j`Jf&|f& jHh/ /(aJ jO J g | "j`| *g&"jS%@R R|#@R j| *gZ&"jS%@R RBH@B@ѩR j| *g,&"jS%@R RBѩR j| *f `V& jS%@R"RBѨR j,(g| %| j|!F"j`| p`p`pL|N^NuNVH8 $nJg jJfp`x g jB$*fp`"R& j"(Axe 0fR`JgB`x"RSf Ѫ$%B j!Axgp`P$*&*Jg2 jJg*BBBJ VxȀ B/ j/(a h%B%C jx BLN^NuNV/ $nJg"jJg j$Jfp`(Jg/ /)a P j$/*/*(NBB$nN^NuNVH< $n&. $.(Jg jJgzgp`T//Hxa:O 0gp`8z%E0 j"( g p$Sք///(a jz BLzjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-NVH8 ". n "nJfB`FxdBEB xF 2   2 B 2 B 2 B 2 B 2 B 2 B 2 QxetJg BE: xF 2 SJf FLN^NuNV <N^NuNVH?< . n $&BCHCJfp`JgBB". c"<xl\BC-IC-IC -IC -IC -IC -IC -I.P,^*\KIGEC-IBPԮւ"nQxٮԮւREԮւSGԮւBIԀւBKԀւ"EBڄԀւ"FB܄Ԁւ"GBބԀւ"nBٮԀւ"nBٮԀւ"nBٮԀւ"nBٮԀւ"nBٮԀւ"nBٮԀւ"nBٮԀւAx҄xm Jg BԀւSf <qLx x 騐Ё <qLx x 騐ЁJf:HCBC L $.4..4S-G&n0e p?F`@(n0"d T`(`&n3P(n(4X0p$. cA." !DԀbt..` fp. "S &n g.t nYY YS8 . "S fS@dR4..4<(.*n(n,.*.$$n(BHxHx /*( j N&O fp`/Hn// /.HztHzHx// GN$O(fJf2rf %|`rg %|t//*( j$N `/Hn///. HzHzB/. HuLN$O(f"FJfH c@rf %|` rf %|1`rg %|Jt//*( j$N `//*( j$NBL<|N^NuNV/ / n"n $n&n 4"8$<&B*%@ %j~$"* c$BJgBS*nR 稈PbA<  jAB(ଖBf%h~$`g~΀%G%h~$`gg~$`~ $*E+|t)D )C+F .ѭ*)K4Hx`"*c$BJg`BS*nR 稈PbA< Ѫ⬖B*%@ %j~$"* c$BJg4BS*nR 稈PbA<  jAB(ଖBg~΀%G%h ~$`f%@ (A%H`~ $*E+|)D )C+F .ѭ*)K4Hx`"*c$BJgBS*nR 稈PbA< Ѫ ⬖~$" ( * c*l,-M`-KJghJf l,f ,0",(g&Ac"@S`"HJfb)K4/.// a\-@&l4O ",0$c "@S l,` l,"H˱f ,(g&@c"AS`"HJgB*nRS*n,f-l( *.S%G~f<`Jf$,,f ,0",(g&Ac"@S`"BJfb)K4/.// a-@&l4O ",0$c "@S l,` l,"H˱f ,(g&@c"AS`"HJg8B SB`~~dQRS)K4/.// a-@&l4O ,0f~$)D )C*E+F .ѭ*)K4Hx`J)D )C*E+F .ѭ*)K4Hx`$)D )C*E+F .ѭ*)K4Hx// a~L8$n&n *.(+ &*0 *4$d$*, +d$Jg|fB'@ի j8Jg///*??z=!""\":#$^% "   `h{}[]\| /?`\  0.,+123-456*789/E()^1234567890-=[];',./ opklqwertyuiasdfghjmzxcvbn~|  0.,+123-456*789/`|\~!@#$%^&*()_+{}:"<>? OPKLQWERTYUIASDFGHJMZXCVBN`  0.,+123-456*789/E()1234567890-=;',./    `<  0.,+123-456*789/E()^1234567890+'[]*\,.- opklqwertyuiasdfghjmzxcvbn~>  0.,+123-456*789/`|\~!"#$%&^()=?/{}@|;:_ OPKLQWERTYUIASDFGHJMZXCVBN`<  0.,+123-456*789/E()1234567890+'*,./    ````G@ 0D.D:h:^::5;J\T?WTWV:XPT(TBF?IJHJT(TBL?OXON>PTT(TBT?WTWV:XPT(TBT?WTWV:XPT(TBT?WTWV:XPT(TB@X?DEPBET(TBYd?^X^_N`$T(TB????*+$)%t%% !q"  +,*o8 "0 +  ",p-. (/ d0CG$HHj"jXii| |AA,,,,%%Y^p^bub 5?5sp`<V\P|]|?<p~zz<\PP%DDTD{{{{t{i{[{S{HNetBSD/hp300 Primary Boot1.9Fri Mar 3 17:25:01 PST 2000oster@zoot@` 0123456789abcdef/2 `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`?? . ..AlgiersLuanda* Porto-NovoGaborone  Ouagadougou Bujumbura Douala*Bangui*Ndjamena Kinshasa  Lubumbashi BrazzavilleAbidjanDjibouti Cairo7*Malabo*Asmera*  Addis_Ababa  Libreville Banjul* Accra7* ConakryBissau*NairobiMaseru*Monrovia TripoliBlantyre Bamako*Timbuktu  Nouakchott CasablancaEl_Aaiun Maputo*Windhoek Niamey*Lagos7*Kigali*Sao_Tome Dakar7* Freetown ! Mogadishu " Johannesburg #Khartoum $Mbabane% Dar_es_Salaam &Lome7*'Tunis7*(Kampala)Lusaka**Harare*+HCeuta7*TZif ȓ{ˮ`)ͬϏfЩyф`ҊP6c`-P ``mﰳpy%ZYsp;Up6Ep9۾p%gYpIap+C Հ$Ep x < 1pdt(pU\np7OPHp{<pp4g p!a"z\p#D $b'p%%S&^`?sWP@zA\sBq\CE7F1 FHHIJK`LPM`NPO`PdPQy`RDPSY`T$PU9k`VdPW"WYiYbZK[D\-]&^_m`,`aV%Pbk`c6PdJ`ePf*`fPh `hխPi`jPkӲlmn~ovp^oqsXr>QsS:t3un?Z@oPA:eBO2CGD/D)FF GH'IJ KրLMNb͐OwPBQ`R"S@T U {UW]WrX?YTZ![6\=]k^_T4`ia4bHcd(ŀdڐffӼghiѦjkl|mjn\oqLpA?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    WETWESTCETCEST, . ..- Cape_Verde. St_Helena /Faeroe*0 Reykjavik 1 Jan_Mayen 2Azores*3Madeira4Canary*5Bermuda6Stanley78 South_Georgia TZif Q̕ t| @LMTCVTCVSTTZifBXJMTGMTTZifs mX#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yLMTWETWESTTZif@`шrQMf&C& %ˬB ͌$μ lМ K҅+ʠe9 Eq %S p w ܹY 4 ޢu߮ W b9m BM !6ؠ   ~ ` Bj _ S_A 3?# d F (E l  RMTISSTISTGMTTZifEGTTZif tK㠜 ɟ_pAn#)O @k"p>rP 2h䐸ՐƐ{ xhzXk?!8M:XȐK<˵òh͕ܿQgrېu3ϬRХUьf2҅YI9@)@@ @@@ܹu@ݲޢߒsrdbURFB72("E@ 6@'@@ @@@@@@z@j@cSC3#qb )Et6d'T&D 4#̠۠˰Ӯß    | l !\q "Lb #A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y     HMTAZOSTAZOTAZOMTWETTZif pK{Րɑ_bA瀣n}#Oɶ2]zp0rP2Zրǀ︀mx{hlX]?8?:X=.q˵àYܱ͕CYpr̀u%ϬuRХUьW2t҅YI90)00 000ܹg0ݲޢߒterVbGR8B)2" 70 (00 0000000z0j0cSC3#rcT  7t(dTC3#ܐ͐㽠ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   FMTMADSTMADTMADMTWESTWETTZifv\A M63#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   LMTCANTWETWESTTZif  ` P ` xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`HLMTASTADTTZif{ D_ 0?c@0ACBa0C#DA0EF*ϰFoH Ȟ@IꓰJn@KuLP@MWNl2@Ot0PL@QsV0R+@SS80TU30UW0WX0YZ[\ܰ]t|^_]@`{a={@b[c]@d;dd?@f$0f!@hc0h=iE0jk'0lm 0neo%pEqmr%sLt@u,˰u@w wΈ@x쏰yj@zլ0{L@|0}wh~p0WJ  SMTFKSTFKTTZifGST8 . ..9Comoro*: Antananarivo ; Mauritius <Mayotte=Reunion>Mahe7*? Kerguelen @Chagos*AMaldives B Christmas C0Cocos7*TZif(*0LMTEATTZif 3⫹@,*08@*0LMTEATEASTTZif58@LMTMUTTZif*h*0LMTEATTZif948@LMTRETTZifd38@LMTSCTTZifabFP___TFTTZifFPIOTTZif/ØDFPMMTMVTTZifbpCXTTZif[hCCTD . ..ECasey7*FDavis7*GMawson*HDumontDUrvilleISyowa7*JPalmer*KMcMurdoKp South_PoleTZif̀p___WSTTZif @GGbp___DAVTTZif 2T`___MAWTTZif Լv4``<___PMTDDUTTZif X*0___SYOTTZif柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď q0]V?8\@>@p @ Z0!o@"90#N@$0%8%0''١0()½*צ+,-.j/bc0@1BE2`i@3"'4@K@5 D06 @7հ8@809+:0; <0=>j0?@SʰAhB3CHDE1@EpG@GRHv@Io0JX@KQ0L:@M|30N@O\0Pz8Q;0RZS0T9UVVװWXĹY@Z[¿@\}]@^m0_@`M|0abe@b-^0cBG@d @0e+ce"0g Eg0h'i j klmun@oUưps@q5rS@st3@t0v@vމ0wr@xk0y܎zM0{p|~/0}R~gK|4 ___ARTARSTCLSTCLTTZif  ` ~^>xgXIf8+`!H`e`*`G` `)``g `` F`!`"0 #i$%.`&B' `'$(`)*ͧ`+#`,`-`.k`/j`0mM`1J`2Vi3*`46K5 `6-678Ӌ9:m;`s1?~`@\N`A^`B<0`C>`D`Ex`E`GG`HvI`JXKL:MNOdPp9`QDzRP`S$\T/`U>V`V[`W`X=`Yϣ`Z`[\`]^l`_x`UaXeb5c8Gde)egF`gՇh(`iij `k`l`m~h`n`o^J`piq>,`rIs`t)u*v v wrxyTz{q`|}S`~fr5` ___NZDTNZSTTZif  0'} ivgXI|: l+!\"L #;$+%& '@'@( (P)`0)Դ *ė  @FPbp T`T`bp T` FPFPT`FPLMTTASTTASSTUZTUZSTTZif@8@?HAFTTZiftH P'0@50̅te|V lG!\8"L)#<$, %& '`' `(@( p)@*ij0+p,p-p.p/tp0dp2p3=4Rk5r62M6T8j`869L`:;.`<5`=`>`?`@e`ABE`CcD%`ECF`G#GIIΝJxKL̕`MaNw`OnCPY`QW``Rl;`S7B`TL`U$`V+`V`XX`YZ`[\]^_`_a}`b?c]`dne=`f`gf`gm`hH`iO`j*`k1`lFm`n(og`p qQres0tEuv.`vx`xЙy`z{{Α`|`}s`~yz`U`   )*0FP 8@8@FP 8@ *08@*08@8@FP8@LMTYERTYERSTAMTAMSTTZifrD P'0@50̅te|V lG!\8"L)#<$, %& '`' `(R@( p)@*ij0*p01]2r2p3=4RO5d6216F8N@8(90@: ;@<'P=@> P?@@ePABEPCcD%PECFPG#GIzIΏJ\KqLy@MSN[@On5P=@QWRPRl@S74PTL@UPV+@VPXXPYZP[\]^_`_a}@b?~c]@d`e=h@f}PgJ@g_Ph,@iAPj@k#Pl*mPn ogPpqQres0tEuv.@vx@xЋy@zm{u@|P}W@~ylP9@                                          .*0FP 8@8@FP 8@ *08@*08@FP8@FP8@LMTBAKTBAKSTAZTAZSTTZif /l8@*0LMTGSTASTTZifۆq̕2ݨҘO R[hMX T` T`HMTBURTISTDACTBDTTZif t!aMT MXT`LMTISTBTTTZifDgGkixpLMTBNTTZifs\њgZ$[h~ [h RMTBURTJSTMMTTZif oD$_ГAb\cbppLMTSMTICTTZifxǐm6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#vwp ~~ LMTHARTCSTCDTTZif \'pZ6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#q~pLMTCDTCSTTZifm6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#cbp~ p LMTCHUTCDTCSTTZifdm 6ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#RT`~ p LMTURUTCDTCSTTZifDǑm06ip ~h!Iap"^J#)Cp$Gg%_&'I&A(+(#G<MXFP~ p LMTKASTCDTCSTTZifE iZj8ԓJB8֚>A.$9ܸʨޢ8߭8(Oi8v(/K8_Ǩ-8?I+m Ol(wѸN(W0(@8h( 8G(%~8a(`8C(B8_^A@#"~n]MG(78&(8 ( 8 ( ֩8 ƌ( 8n(98ol{8ONk~p LMTHKSTHKTTZif(їazpyBZ:#p<fp&pYݪrsߵdp|ᖗ]wp>0 p!qp p ?/ypVp ݉ ν6~pCDTCSTTZif*$wѸN(W0(7dh( 8G(c'`8C(B8_^A@#"~n]M=p-& ( 8 ( ֩8 ƌ( 8n(<vo;p_:Op8]j|~p p LMTMOSTMOTCSTTZif w ݒ d P 9``uOc`SPM3P#`P`P`hPg`fe|H lG!\*"L)#< $, %& ' P' `(P)`*P+`,P-`.P/t`0duP1]2M3=4-s5r62x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yH*0  *0LMTEESTEETTZif u  P'0@50̅te|V lG!\8"L)#<$, %& '`' `(( p)`P)P*@+P,@-P.@/tv@0dY01]3=f4RA5V62#688@089"0:;0<@=0>@?0@e@ABE@CcưD%@ECF@G#GIlI΁JNKcLk0MENM0On'P/0QWD@Rl0S7&@TK0U@V+0V@XX@YӰZ@[Ե\]^_y`_a}0b?pc]x0dRe=Z0fo@g<0gQ@h0i3@j0k@lm@nog@pqPre°s0tEuv.0vx0x}y0z_{g0||@}I0~y^@+0    **0FP 8@8@FP 8@ *08@*0FP8@TBMTTBITTBISTGETGESTTZif ˙2 0pup~~LMTTPTJSTTZif ۆq̕2tR[hMX [h HMTBURTISTTZif x`˿<&d g ix~ pbpJMTJAVTJSTTZif]Րˈoop~ LMTMMTBORTJSTTZif  h~ LMTJAYTCSTTZifhl}Ht-@@0:@UgEJ7-( v()KH*t8+~,-H.8/m0c1OH2DB831H4&8566H7.8889a:;z$?oM@[XHAP8B=HC38DE9FDHFm8GwH֠IJ%K0HLY8McN{OgHP\8QJHR?E8S+OT xU HV8VW߸X;YdZoH[8\]˸^sH_h8`V[HaK8b7c,dHe 8efg)HhR8iHj8kl mHnu>8oaHpVqqCr8s%Ht*8u4u]vhHwܑ8xHy8z {I|TH}}8~mb080818FP 8@?H ?H 18LMTTMTIRTIRSTTZifq 0<0hPPC@̓@Pte|V lG!\8"L)#<$, %& '`'x(纀)*?+0,s-d./|0m1_2P_3@P415!6778<9~:o;<=>ր?z@k[A\BLC=рD-€EFG8G{H⽀IҮJKL$MNXOwPhQXRJS:T+DU5V wVWXY0Z![c\T]^ـ_u`e aVObF@c7d'tef f;g,hoi`jklmn[oqLpbqRrCs3t$u8vzvkwx؟yzҀ{|W}~}ǹ)*08@*08@*0BMTASTADTTZif0EYPͬϏfЩyф`ҊpekZ`/pF۴4ܹ ޴΀ߤvV}J`64tҀ'O| ` 3``P `!I"]M`# $Z0`%?P& &'(P)`*+e,-G._P/{)0H1H2?z @crA\BCTC=pD,qEF SG*pG5HpIJKLpMNIOtPhQTـRJpS4T+5UV ipVWpXݜY!Z~[Up\`]^}B_u `]$aVApb=c7td&"epff-pgh`iȀjpklmnLonpbpqNrCs.mt$puOvlpv1wxMypz/{|}~vnp *0 8@ JMTIDTISTIDDTTZif΅p~~CJTJSTTZifw ry P$7` j P u #``r` `P r`!bP"R`#K$d`%+&7o`' ( s(JP)`*f+e,H-G.x/d`0X1dF`2A`3D(`4!`5$ `6`7z`7P89TP:S`;<=P>`?y@k?`A\sBLrC=PD-`EFGPG^HPIҒ`JKLPM`N-Ow~`PhQXRIPS9`T+UV MPVWPX`YZ[9P\8`]l^`_t`daV%PbF$`c7Xd'WePf fPg`hDiCjxPkw`lm`n0oq/pbdPqRc`rCs3t$PuvPPvO`wx؂yɷPz`{|;`}o~}nnP!*0  *0 LMTEESTEETTZifu{0'} ivgXI|: l+!\"L #;$+%& '@'@(P)xP)Դ *ė+ ,y-x .[/tZ 0d=1]v2rC3=X4R%5:6268$89:;< => ?@e AȐBE CcD% ECFg G#nGIPIeJ2KGLOM)N1On PQW( RkS7 TKU V+V XՐXְ YZ [ԙ\]{^_]`_ra}zb?Tc]\d6e=>fS g g5 hi jk lm nog pĐqP٠res0tEuv.vxxayizC{K|` }-~yB H$FPbp T`T`bp T` FPLMTALMTALMSTTZif u h@' 0' wufW|H l9!\*"L#< $+%& ' P'P(`)x`)0*ĥ +0, -0.i /th00dK 1]2rQ3=f4R35H626*82 8 9 :; < 0= >0? @e0A֠BE0CcD%0ECFu0G#|GI^IsJ@KUL] M7N? OnP! QW60Rl S70TK U0V+ V0XX־0YŠZ0[ԧ\]^_k`_a} b?bc]j dDe=L fa0g. gC0h i%0j k0lm0nog0pҠqPres0ɰtEuv. vx xoyw zQ{Y |n0}; ~yP0                                                58@T`FPFPT`FP 8@T`FPFPLMTAKTAKSTAKTSTAQTTAQTSTTZif u @' 0' wufW|H l9!\*"L#< $+%& ' P'P(`)x`)0*ĥ +0, -0.i /th00dK 1]2r_3=t4RA5V62#688@089"0:;0<@=0>@?0@e@ABE@CcưD%@ECF@G#GIlI΁JNKcLk0MENM0On'P/0QWD@Rl0S7&@TK0U@V+0V@XX@YӰZ@[Ե\]^_y`_a}0b?pc]x0dRe=Z0fo@g<0gQ@h0i3@j0k@lm@nog@pqPre°s0tEuv.0vx0x}y0z_{g0||@}I0~y^@+0     / 8@T` FPFPT` FP8@T`FPFP8@FPLMTSHETSHESTAQTSTAQTTTZif t ~0'} ivgXI|: l+!\"L #;$+%& '@'@()) *ĥ +0, -0.i /00dK 1f02Mg3=4RV5k6286M8UH8/97H:;H<.X=H>X?H@eXABEXCcD%XECFXG#GIIΖJcKxL̀HMZNbHOnP:; P<5`=P>`?P@e`ABE`CcD%`ECF`G#GIIΝJjKL̇PMaNiPOnCPKPQW``Rl-PS7B`TLPU$`V+PV`X X`YZ`[\]^_`_a}Pb?c]Pdne=vPf`gXPgm`h:PiO`jPk1`l8m`nog`pqQres0tEuv.PvxPxЙyPz{{΃P|`}eP~yz`GP*0 EESTEETTZifgNː;>``0)a\bpg ~ ixp SMTMALTJSTMYTTZifgG{'P]ՠP>ö ŘPGy:[0"gpixu0 p~pLMTBORTBORTSTJSTMYTTZif& 'o׀֐ [YJ;|, l!\"K#;$+%Ұ& ð'0'()Ԧ*ĉ+,k-j.M/tL0d/1]h2r53=J4--5,6 UT`p bpLMTHOVTHOVSTTZif&L ܐ'apȀMK<-| l!\"K#;$+Ӡ%Ġ& ' '()Ԙ*z+z,\-\.>/t>0d 1]Z2r'p3=<4-p56 pd4bp~ pLMTULATULASTTZif }0OMXPLMTISTNPTTZif68@LMTGSTTZif~̕2tݨO0>MX[hFPFP LMTISTKARTPKTTZifYPͬϏfЩyф`Ҋpek6c`-P ``mﰳpy%ZYsp;Up6Ep9'BP| ` 3``P `!I"]M`# $Z0`%?P& &'(P)`*+e,-G._P/{)0H01dF`2A`3D(`4!`5$ `6`67a`8DP8}9`:_;B#?@AnB^CXPDH`E7PF'`GPH`HPI`J׍PKnj`LoPMn`NOPmQplR`OSPNT@1U00V WX 0PX/`YPZ`[P\`]P^`_P`x`ahPbX`cQdAe1f!gzhyh\i[j>k=l mZ`n=Po<`pzPqj`rZPsJ`t9Pu)`vPw `xxyz{¥|}~i*0 *0*0   EETEESTIDTISTTZif 0pЩ%pl9բuFfz~p~ PHSTPHTJSTTZif 00P8@*0LMTGSTASTTZifa6+*0LMTASTTZifgNː;>``M0)a\bpg ~ ixix p SMTMALTJSTSGTTZifZ(̕+u81(2q JMXT`[h[h T` MMTISTIHSTLKTTZif x/^pa>p@ap Հ}R[ps(;~pUT66Hptp4gpgIa+C  p$S  .p p ?kYsLpmpJpU#p Gz!"`41hP5`677P89TP:S`;<=P>`?y@k?`A\sBLrC=PD-`EFGPG^HPIҒ`JKLPM`N-Ow~`PhQXRIPS9`T+UV MPVWPX`YZ[9P\8`]l^`_t`daV%PbF$`c7Xd'WePf fPg`hDiCjxPkw`lm`n0oq/pbdPqRc`rCs3t$PuvPPvO`wx؂yɷPz`{|;`}o~}nnP"*0 LMTEESTEETTZif0'} ivgXI|: l+!\"L #;$+%& '@'@(ʏP@FPbp T`T`bp T` FPLMTDUSTDUSSTTJTTZifjg^<bpBMTICTTZif  D@' 0' wufW|H l9!\*"L#< $+%& ' P'P(`) @)x` 68@T` FPFPT` FP 8@8@FPLMTASHTASHSTTMTTZif38@LMTGSTTZif  #`@'  ivgXI|: l+!\"L #;$+%& '@'@( (P)`0)Դ *ė >8@FPT` bpT`T`bpT`FPFPT`FPLMTSAMTSAMSTTASSTTASTUZTUZSTL . ..MKabul7*NYerevanOBaku7*PBahrainQDacca7*RThimbu*SBrunei*TRangoonU Phnom_PenhVHarbin*WShanghai X Chungking YUrumqi*ZKashgar[ Hong_Kong \Taipei*]Macao7*^Nicosia_Tbilisi`Dili7*aCalcutta bJakartac Ujung_Pandang dJayapura eTehran*fBaghdadg Jerusalem hTokyo7*iAmman7*jAlmaty*kAqtobe*lAqtau7*mBishkeknSeoul7*o Pyongyang pKuwait*q Vientiane rBeirut*s Kuala_Lumpur tKuchinguHovd7*v UlaanbaatarwKatmandu xMuscat*yKarachizGaza7*{Manila*|Qatar7*}Riyadh*~ Singapore ColomboDamascus Dushanbe Bangkok Ashkhabad Dubai7* Samarkand Tashkent Saigon*Aden7* Yekaterinburg Omsk7* Novosibirsk KrasnoyarskIrkutskYakutsk VladivostokMagadan Kamchatka Anadyr*Riyadh87 Riyadh88 Riyadh89 Istanbul gTel_Aviv v Ulan_BatorTZif oB_ГAdcbppLMTSMTICTTZifa8 *`*0LMTASTTZif u @' 0' wufW|H l9!\*"L#< $+%& ' P'P(`)x`)Դ *ė+P,P-P.P/tP0duP1]2r{3=4R]5d62?6F8\P8(9>P: ; P<'P=P> P?P@ePABEPCcD%PECFPG#GIIΏJjKqL̇PMSNiPOn5PKPQWRPRl-PS74PTLPUPV+PVPX XPYZP[\]^_`_a}Pb?~c]Pd`e=vPf}PgXPg_Ph:PiAPjPk#Pl8mPnogPpqQres0tEuv.PvxPxЋyPzm{΃P|P}eP~ylPGP  88@T` FPFPT` FP 8@T`FPT`FPLMTSVETSVESTYEKSTYEKTTZifu@0'} ivgXI|: l+!\"L #;$+%& '@'@(P)xP)Ԧ*ĉ+@,@-@.@/tv@0dg@1]2rm3=t4RO5V621688N@890@:;@<@=@>@?@@e@ABE@CcD%@ECF@G#GIzI΁J\KcLy@MEN[@On'P=@QWD@Rl@S7&@TL@U@V+@V@XX@YZ@[\]^_`_a}@b?pc]@dRe=h@fo@gJ@gQ@h,@i3@j@k@l*m@n og@pqPres0tEuv.@vx@x}y@z_{u@||@}W@~y^@9@DFPbp T`T`bp T` FPLMTOMSTOMSSTTZif v $ 'o׀֐ [hYJ;|, l!\"K#;$+%Ұ& ð'0'0(@)x@)Ԙ*z+0+N,@-@.@/tv@0dg@1]2rm3=t4RO5V621688N@890@:;@<@=@>@?@@e@ABE@CcD%@ECF@G#GIzI΁J\KcLy@MEN[@On'P=@QWD@Rl@S7&@TL@U@V+@V@XX@YZ@[\]^_`_a}@b?pc]@dRe=h@fo@gJ@gQ@h,@i3@j@k@l*m@n og@pqPres0tEuv.@vx@x}y@z_{u@||@}W@~y^@9@MT`p bpbpp bp T`bp LMTNOVTNOVSTTZifu 'o׀֐ [hYJ;|, l!\"K#;$+%Ұ& ð'0'0(@)x@)Ԙ*z+0,0-0.w0/th00dY01]2r_3=f4RA5H62#6*8@08 9"0:;0< 0=0>0?0@e0ABE0CcưD%0ECFu0G#GIlIsJNKULk0M7NM0OnP/0QW60Rl0S70TK0U0V+0V0XX־0YӰZ0[Ե\]^_y`_a}0b?bc]x0dDe=Z0fa0g<0gC0h0i%0j0k0lm0nog0pqPre°s0ɰtEuv.0vx0xoy0zQ{g0|n0}I0~yP0+0WT`p bpbpp bp T`LMTKRATKRASTTZifu'apȀMZK<-| l!\"K#;$+Ӡ%Ġ& ' ' (0)xy0)ԉ*l+ , -x .i /tZ 0dK 1]v2rQ3=X4R35:62682 89 :; < = > ? @e A֠BE CcD% ECFg G#|GI^IeJ@KGL] M)N? On P! QW( Rl S7 TK U V+ V XXְ YŠZ [ԧ\]^_k`_ra} b?Tc]j d6e=L fS g. g5 h i j k lm nog pҠqP٠res0tEuv. vx xayw zC{Y |` }; ~yB  abp~ pp~ p bpIMTIRKTIRKSTTZifup'Sp`p?pL=.| l!["K#;Ԑ$+Ő%& ''( )xk ){*^+,y-j.[/tL0d=1]h2rC3=J4R%5,6268$89:Ґ;<=>?@eAȐBECcD%wECFYG#nGuIPIWJ2K9LOMN1OmPQWRkS6TKUV+VXՐX֢YZ[ԙ\]{^_]`_da}zb?Fc]\d(e=>fEg g'hi jklmnogpĐqPːres0tEuv.vqxxSyiz5{K|R}-~y4yp ~~ ~ pLMTYAKTYAKSTTZifuYGP'E`yxP`1`>/ | k!["KՀ#;ƀ$+%& ''()x])m*P+z,k-\.M/t>0d/1]Z2r53=<4R5616889:Ā;<=>?@eABECcD%iEC~FKG#`GgIBIIJ$K+LAM N#OmPQW RkS6TKUV+VXǀX֔YZv[ԋ\]m^t_O`_Va}lb?8c]Nde=0f7gghijklmnԀogpqPres0tEzuv.vcxyxEy[z'{=|D}~y&{~  ~ LMTVLATVLASTVLASSTTZifu6'7Pkj@P#P0p!ppp{p kp![p"Kp#;p$+p%p& p''()xO)_*B+k,\-M.>/t/0d 1]Lp2r'p3=.p4R p5p61p6p88p9:p;<=>?@eApBExCcpD%ZECppF`2r`3= `4Q`5`61`6`88`9:`;ڽ<=>?@eA`BEjCc`D%LECb`F.G#D`GK`I&`I-`J`K`L$M`NOm`PQVRkS6TKUV+VX`XwY`ZY[o`\v`]Q`^X`_3``_:`a}Ob?`c]1d`e=fgghijܹkl`mn`ogp`qP`re|`s0`tE^`ue`v.zvG`x\x)`y>z `{ |'}~y    LMTPETTPETSTTZif u '0ON0@İ@"````{` k`![`"K`#;`$+`%`& }`''()x@)Q*4+],N-?.0/t!0d1]>`2r`3= `4Q`5`61`6`88`9:`;ڽ<=>?@eA`BEjCc`D%LECb`F.G#D`GK`I&`I-`J`K`L$M`NOm`PQVRkS6TKUV+VX`XwY`ZY[o`\v`]Q`^X`_3``_:`a}Ob?`c]1d`e=fgghijܹkl`mn`ogp`qP`re|`s0`tE^`ue`v.zvG`x\x)`y>z `{ |'}~y d    LMTANATANASTTZifP/0g$u <  jn   _9  f S ' H O  =w   2)  G & x`  y m ! # $a %& ' (V0 ) *: -? 5: 8(5 9y :+ < =n! > @ Ab B Dt EV F` G IKL J K3 M? N O Q3 Rm S U(O Vy W, Y Zn [z ] ^bW _ a4 bV c d fJ gZ h j?7 k l n3 o p] r' sy: tʦ v wm x ze {a |B ~ V  Jr Y > ; 3" ' x k  mW C a 4  V* J    b %  W/ > K M @\ ‘ p 4 Ɔ  ) {" ̱ ; o T  dm ӵ  Y ת . M ۟G B` ߓ y 7 ㈒ ! + }: N q g  f{  [ ( O < DF U 8!_!-d!~!sn! i!!_!P!U!!EK!!;!?Ч!A"!Bs!C!ER!Fg!G*!I !J\!Ki!L!NPA!O!P!RD!S!TS!V8!W+!Xۗ!Z-![~o!\!^!B!_r!`!b!cf!dc!f !g[;!h!i!kO!l!mf!oC!pH!q!s8*!t!u!w,!x}!yi!{ !|rU!}!A!f!2! ![#!!!!D!!-!~!#!!!s-!ķ!?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoponmlkjihgfeqrstuvw^]\[Zxyz{|}T~KIHEBBCDEHJK|Wy[`bqgjnܽpjsv]y}SQ++******k*R*9* *)))))))q)])I):)&))(((((((((((((((((((((()) ))+)5)D)S)b)))))))* **/*>*f*u*******+++)+=+L+[+o+~++++++++,,,,(,7,A,K,U,_,i,s,},,,,,,,,,,,n,d,Z,P,F,<,2+++++++++y+j+`+Q+G+8+.++********z*p*a*\*W***+$+3+B+t++++,,-,,,,--,-@-T-m-------..&.:.I.].q........///%///>/H/W/a/k/u////////////z/p/f/M/ //....v.b.0.-----|-c-E-'-,,,x,+??TZifQ!b!ܴD!!W!!!LP!!!A!蒴!M!5!z!!*!|6!!^!p!!!e!3!!ZQ!!j"N"~""C"""8+" " 5" ,"Ͽ""["0""P&"""!D"""#"%8"&o"'")-V"*~"+B"-!".s)"/Ě"1 "2g|"3"5 ^"6["7@"8":P"";"<">Dp"?"@M"B8"C*"Dۖ"F-"G~s"H"J!P"Kr"L("N"Og"Pq"R "S[N"T"U+"WO"X"Yy"[C"\V"]"_83"`"a"c,"d}"eh"g "hrJ"i"k1"lf"m"o "pZ"qu"r"tOa"u"vR"xC"y>"z"|8/"}"~%","~"ϖ"!" "P""D" ""9*""4"-"C"""R"s"f""hu"" "]"","Q"E""F^""w";"""/"8""$Q"u"j""j"ļ" "_+"Ȱ"D"S"̥X""Hq"Й""="Ԏ""1"؃2"Է"&A"w"K""lU""_"`"i"">i"d"2""'U"x"F""m7"#(#a###U#q## JX# # ?# >#!##3#t##'Q#x#.##m #w##aO##!,#"U###$p#&I#'C#(#*>#+#,#.2Z#/#02#2x#4q#6#7lD#8#:#;`#<#>[#?T#@3#A#CI #Dw#E#G=T#H#I1#K1#L#Mz#O%#Pw\#Q#S>#Tk#U #W#X`#Yx#[#\Td#]#^P#`H#a<#b#d=-#e#f##h1#i#jԔ#mw#r#u`#x#yU(#z#{2#}I#~F##>Z##s#2###'#y>##a#m###b#E##Wr# ##L8##o#A##?#5#v##*#|K###q #¾#\#e## 6#Z#r##O#L##D#!#>  !"#$%&'&%$#("! )*+,-./0123456789 :;< =>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghgfedcbai`j^]klZYXWVmnopqrPOstuvwxyz{G|}E~CBA@>>@BCD}|zyxOqSnV\jaeʽ϶ӯ֪٤d_kVt{|++******p*W*>*%* )))))))v)b)N)?)+)) (((((((((((((((((((((())&)5)D)S)q)))))*****M*a*****++$+8+G+[+j+y++++++++,,,,(,2,A,K,U,_,i,n,x,,,,,,,,,,,,},d,Z,,,+++++++++~+o+`+V+=+.+ *******z*u*k*f*\*R****+++L++++,<,P,,,,--'-;-O-c-|------. .!.5.I.X.l......../// ///9/H/R/\/k/p/z//////////f/M/C/4/%/.....{.g.N.-----h-J-1-,,,F, +++t??TZifQ##9]##ܔ#.-##_#"#t#/##i\#ͺ# #^#ѯ#E#R#դm##G#ٙ##$$$&$'`$($*d$+T$,<$-$/I$0$1$3=b$4$5?$71$8$9ԍ$;%$Z%@*%A|F%Bͼ%D2%Ep%F(%H%Ie%J%MY%QN %R%V%W%Y7%Z%[(%]+%^}7%_%a K%bq%c_%e%ffx%g%i %j[%%k%lH%nO%op%p%rD%s,%t%v9T%w%x܆%z.%{%|L%~"%t%%%iS%% %^(%%d%R%%9%G%u%%<%O%%1%)%%&`%w%ɜ%r\  !"#$%&'&%$#"( )*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklkjihgmedcbanopqrstZuXWVvwxyRQPz{|}L~JIFECBAABE~M{zSwvZsqobehlϼҴ֬idnqtVTRPNI++*****z*a*C***))))))){)g)S)?)0)!) ((((((((((((((((|(((((((()))N)])l)))))))***%*9*M*\*p*****++$+3+G+V+j+y++++++++,, ,,#,2,<,F,P,Z,d,n,x,},,,,,,,,,,,i,_,U,K,A,7,-,++++++~+t+e+L+=++ ********u*k*f*W*R****+)+8+[+++,,,,- --6-J-^-r------...0.?.S.g.{......./// /*/9/H/R/\/f/p/z/////////////u/k/a//.....l.:.!. ------m-O-,,,+`+B??TZif  `վТec{PN`?Ц%''Ъ((`Ы1P`J`΀Pˮ`Pqk PӢ9`CPL ){+ ]`?`\P`ݳ`dh`8kKi`4Pnp9u  :  ` $P 9`P`sPgM6Gz#݀'\>PܔP|s ld!\U"LF#<7$,(%& '5''4(%)*+,-ڐ.ː/t0d1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yh*0 8@ *0*0 *0 IMTEESTEETTRSTTRT . ..Darwin*Perth7*Brisbane Lindeman Adelaide Hobart* Melbourne Sydney* Broken_Hill Lord_Howe  ACTCanberra  LHI NSWNorth7* QueenslandSouth7*Tasmania Victoria West7* YancowinnaTZifN'T^x̷]ͧ@xΠzχ"xCSTTZif N¼=T s̷rͧU  b)%\) ~p~pWSTTZifN TWp̷Vͧ9pΠsχpp9 %I%')') )ESTTZifN TWp̷Vͧ9pΠsχpp9 %I%')') )*Ph*s+ʀ,ҏ-xESTTZifN'T^x̷]ͧ@xΠzχ"xp@ #P"?0!   Ȉ   ^>xXm8O禈!kLjMj/Ly Y!Ո"B#i$"%I&f')') )d*z+ш,Җ-(.x/tE0Z1]a2r<3=C4R5%626889:ˈ;<=>?@eABECcD%pECFRG#gGnIIIPJ+K2LHMN*OmP QWRkS6TKUV+VXΈX֛YZ}[Ԓ\]t^{_V`_]a}sb??c]Ud!e=7f>gg hijklmnۈogpqPĈres0tEuv.vjxxLybz.{D|K}&~y-CSTTZifx TWp̷Vͧ9pΠsχp~Yv;V?p9 P8/ ߀  ~^>xXf8HO!d1Fc(E g' Y~!΀"B#i$"}%I&_')'()Ԙ*À+z,-\./t>0mi1]Z2V3=<46h56J67,89:Ā;*<= >?~@eA^ЀBEC>D%iEFKGGgHIIJuK+LWM N9OmPpUQW RP7S6T0UVVW݀X֔YϿZv[\]^t_x`_VaXb?8c8ddeFf7gbghDij&klmnogpjqPrIs0t)uv vcwxEyqz'{|D}o~y&rQESTTZifN TWp̷Vͧ9pΠsχpp9 P8/ ߀  ~^>xXf8H矀!dǁFc(E y Y~!w"B#i$"}%I&_')') )*s+ʀ,ҏ-x.q/t>0S1]Z2r53=<4R5616889:Ā;<=>?@eABECcD%iEC~FKG#`GgIBIIJ$K+LAM N#OmPQW RkS6TKUV+VXǀX֔YZv[ԋ\]m^t_O`_Va}lb?8c]Nde=0f7gghijklmnԀogpqPres0tEzuv.vcxyxEy[z'{=|D}~y&ESTTZifN TWp̷Vͧ9pΠsχpp9 P8/ ߀  ~^>xXf8H !dǁFc(E y Y~!΀"B#i$"}%I%')') )*s+ʀ,ҏ-x.q/X0S1]Z2r53=<4R5616889:Ā;<=>?@eABECcD%iEC~FKG#`GgIBIIJ$K+LAM N#OmPQW RkS6TKUV+VXǀX֔YZv[ԋ\]m^t_O`_Va}lb?8c]Nde=0f7gghijklmnԀogpqPres0tEzuv.vcxyxEy[z'{=|D}~y&ESTTZifN'T^x̷]ͧ@xΠzχ"xp@ #P"?0!   Ȉ   ^>xXm8O !kLjMj/Ly Y!Ո"B#i$"%I%')') )*z+ш,Җ-x.x/X0Z1]a2r<3=C4R5%62688l89:ˈ;<=>?@eABECcD%pECFRG#gGnIIIPJ+K2LHMN*OmP QWRkS6TKUV+VXΈX֛YZ}[Ԓ\]t^{_V`_]a}sb??c]Ud!e=7f>gg hijklmnۈogpqPĈres0tEuv.vjxxLybz.{D|K}&~y-CSTTZifr f8@x!]xzx?x\x!x>xxyx Ywx!x"B#i$"u%I%')') )*k+x,҈x-xx.jx/Xx0Lx1]Sx2r.x3=5x4Rx5x61x6x88x9x:x;<=>?@eAxBECcxD%aECwxFCG#YxG`xI;xIBxJxK$xL9MxNOmxPQWRkS6TKUV+VXxX֌YxZn[Ԅx\x]fx^mx_Hx`_Oxa}db?1xc]Fdxe=(f/g ghijklxmnxogpxqPxrexs0xtEsxuzxv.v\xxqx>xySz x{5|<}~yESTLHST . .. Rarotonga Fiji7*Gambier Marquesas Tahiti*Guam7*Tarawa* Enderbury  KiritimatiSaipan*Majuro* Kwajalein  YapTruk7*Ponape*Kosrae*Nauru7*Noumea*Auckland ChathamNiue7*NorfolkPalau7* Port_Moresby Pitcairn  Pago_Pago Apia7* GuadalcanalFakaofo Tongatapu Funafuti Johnston Midway*Wake7*Efate7*Wallis*Honolulu Easter* Galapagos <Samoa7*TZif (?y Yc y9E 蕘"awCY%;h G!ˠ"1#j $%J %'* 'lXs`zhCKTCKHSTTZifP <6;6`8$4`8`:`:`;`W`?`@@AB ClDbELEDG,~G&I `IJBK%`L_`Mi`NA`OH`P#`Q(`Ru`S`TT`T`V4`VѫXXYZo[ݩ\qQ]^Q3_m`:P`a`b2`cfl`c`eFN`e`g&0`g`i`i`j`klmbnoBpq"|rns^tNt{`v7`v]`x`x?`yy`z!`{[`|k`}=`~J``D LMTFJSTFJTTZif PH|pLMTGAMTTZif PLH}8zhLMTMARTTZif PUss`LMTTAHTTZifGSTTZifGILTTZifV/0W@ePPHOTTZifU/} js`LINTTZif7p~MPTTZifPMHTTZif P,tW@MHTKWATTZif7p~YAPTTZifTRUTTZifPONTTZifP6g@KOSTTZif +˴HBPp|~LMTNRTJSTTZif tPVƜP7@2K3Dp   LMTNCSTNCTTZifQ`1p`o0#`8h`hmḩOh཮࿎nƒNcp.~L``,o`}h  ` ~^>xgXIf8+`!H`e`*`G` `)``g `` F`!`"0 #i$%.`&B' `'$(`)*ͧ`+#`,`-`.k`/j`0mM`1J`2Vi3*`46K5 `6-678Ӌ9:m;`s1?~`@\N`A^`B<0`C>`D`Ex`E`GG`HvI`JXKL:MNOdPp9`QDzRP`S$\T/`U>V`V[`W`X=`Yϣ`Z`[\`]^l`_x`UaXeb5c8Gde)egF`gՇh(`iij `k`l`m~h`n`o^J`piq>,`rIs`t)u*v v wrxyTz{q`|}S`~fr5` NZHDTNZSTNZDTTZif_ ' `'$(`)*ͧ`+#`,`-`.k`/j`0mM`1J`2Vi3*`46K5 `6-678Ӌ9:m;`s1?~`@\N`A^`B<0`C>`D`Ex`E`GG`HvI`JXKL:MNOdPp9`QDzRP`S$\T/`U>V`V[`W`X=`Yϣ`Z`[\`]^l`_x`UaXeb5c8Gde)egF`gՇh(`iij `k`l`m~h`n`o^J`piq>,`rIs`t)u*v v wrxyTz{q`|}S`~fr5`\LCHADTCHASTTZifC5`t8`^HePNUTTZifANMTNFTTZif~PWTTZifPGTTZif5DBxPNTPSTTZifb8U+00_^HeP eP ePLMTSAMTNSTBSTSSTTZif b8_^HeP LMTSAMTWSTTZifO3LMTSBTTZifs`TKTTZifN sB7P8g9:P;HP?}r@*PA]TBa PC=6D@PE&SPF* G5PH HPIJPKɰLPMNPOPPnQrPRNSRsPT.U2UPVW7PWaXPY~PZ5[`P\]BP^_w$P`zaWPbZc6Pd:e f#PfhPhiPjkbPlmDPnPo`phPqlBrHmPsL$t(OPu,v1Pw wPxy/zP{|P}~PppTOTTOSTTZifTVTTZifs`HSTTZif U+00ePePePNSTBSTSSTTZifWAKTTZif ´fP{P k@![P"K@#;P$+@%~P& a@&`P'C@(|)Q@*H+a3@ LMTVUSTVUTTZifWFTTZif CH ˉ=aI8ՍsHlXzhzhs`HSTHDTHWTTZif@`uz@sU\ U>yp7[p=p p ` p `ph`H`f(`F&yr[Tx`6Z`q<` Z5P!o`":P#O`$P%8%P''ٽP()*+,-./b0`1Ba2``3"C4@g`5 `P6 `78+`8$P9G:P;)jP?@SAhB3CHDE1`EG`GnH`IPJt`KmPLV`M|OPN8`O\1PPzTQ<PRZ6SPT:UVVWXY`Z[`\]`^mP_``MPab`b-zPcBc`d \Pe+e>Pg ag PhCiA?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y BSTGMTBDSTTZif & 0à ve {ȠN? %` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ &ʗYw;ͱ`Xϐn^r2i c)I !BN . p  ޴߮ ̠rHkt R*T2 = ) T q S  g} aI_ Jf _A ! ?#  Ѡ {ǻpp )X P  : 0  l N  0  qޠ.Qy1X#8Ɛ͐㯐Ñk lr!M"LT#a/$,6%JK& '*-'4) )*+,Ӑ-ڐ./t00$1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   DMTISTBSTGMTBDSTTZif & 0à ve {ȠN? ?%` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ I!N,( . p  ޴߮ ̠rHkt R*T2 = ) T q S  g} aI_ Jf _A ! ?#  Ѡ {ǻpp )X P  : 0  l N  0  qޠ.Qy1X#8Ɛ͐㯐Ñk lr!M"LT#a/$,6%JK& '*-'4) )*+,Ӑ-ڐ./t00$1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                             DMTISTBSTGMTTZif 4hmpKͩ͸(9>` x q Op H` k*`pt `pS`pp;`Hp`1p_`̯| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  LMTCETCESTTZifk A| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y WETCETCESTTZif `ٮ MpD[ qKͩ΢Cϒ4Ђ%rҡOcI9), #ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif y 8`^pKͩ΢Cϒ4 `'@PC@̓s|d lU!\F"L7#<($,% %sP'p()`*`+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq  *0   8@*08@*0 MMTEETMSKCETCESTMSDEESTTZif DI %pٮ0`~p.zL5^#p%5'*}4p_PAɧ#OpkpLrP.IZ 02v㠹Ԡ֋  x h Xy ?/8[ : X֠ J Kͩ΢Cϒ4[`n^rN@ӑ@K# *p cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                                 WETCETCESTWESTTZif}Kͩ΢Cϒ4Ђ%r$ cPU?M 5!,p 㡀ӒÃ|s ld!\U"LF#<7$,(%& '5'' `(P)`*P+`,P-`.P/t`0duP1]2r{3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  *0  *0 *0  EETCETCESTEESTTZif `ٮ qKͩ΢Cϒ4n^yҡOӀIL8), pxdpd'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif `վCWpKͩ΢Cϒ4Ђ%r$y^Gɐ׿ΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif4Y-̞+psoLȰƗPKͩ΢Cϒ4t'@PC@̓s|d lU!\F"L7#<($,%& '5'&()*+,ۀ-̀./t0d1]2r3=4R56P62x688      4    *0 8@*08@*0  *0*0TMTCESTCETEETMSKMSDEESTTZifu soQ`̿#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yh*0 *0 HMTEESTEETTZif `POGx,ppHp*` .zL5^#p%5'X&p}4p_PAɧ#Opkp"prpPpI//p2Lpppp`ȷ𽸨_pxlh]XN?p80:Xp l'Kͩ΢Cϒ4OЉrN@ 9  cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  1         PMTWESTWETCETCESTWEMTTZif `ٮ qKͩ΢Cϒ4Ђ%rѿސWmҡOcK#9gըs), xΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  *0 *0  CESTCETCEMTTZif& 0à ve {ȠN? %` ' *, Ӡ l N y0 РpLrP.IZ 02vXԠ W  x z Xy Q8[ : X֠ &ʗYw;ͱ`Xϐn^r2i c)I !BN . p  ޴߮ ̠rHkt R*T2 = ) T͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    BSTGMTBDSTCETCESTTZif !|ƯcPKͪL΢ϓip`߷ P ^` ` ͮ U]7jd{RF`3P#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y<*0   *0 *0 AMTEESTEETCETCESTTZif `ٮ0Xp) dyp( ZA?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif 7𝵼pp`~p\7pL(pl5Kͩ΢Cϒ4_`nBprL>1Ip)뀐 3pp`Ųb`ZpBwpv+np gE:I .Wp 9 9p  ptppSpΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif"F˃ȯd`bePKͩ΢Cϒ4Ђ%Аp'@PC@̓s|d lU!\F"L7#<($,%& '5'&()*+,ۀ-̀./t0d1]2M23=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y      $ *0   8@*0 8@*0 *0 RMTLSTEETMSKCETCESTMSDEESTTZifr #ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y CETCESTTZif~"OPJ0fx`ȬpY*Kͩ΢Cϒ40='@PC@̓s|d lU!\F"L7#<($,% & ''p'p()*+,ۀ-̀./t0d1]2r3=4R4`562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   h *0  8@*08@*0   *0WMTKMTCETEETMSKCESTMSDEESTTZif`pp`~堢.zi5^?%5'*4pnآpPɧ2Opkp0rpP.IZ 02v㠹Ԡ֋  x h Xy ?/8[ : X֠ B0 Kͩ΢Cϒ4orN@ӑ@K# *p cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y              LMTCESTCETWESTWETTZif 7𝵼pp`~p\7pL(pl5Kͩ΢Cϒ4Ђ%rL>1Ip)뀐 3pp`Ųb`ZpBwpv+3p $pp4p  ؐрavAE[*#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif"k >``ߍ`~`ȩླྀྨ࿘|mx^hOX@H18"(ȼ`w}PKͩ΢Cϒ4N`'@PC@̓s|d lU!\F"L7#<($,% %sP&C>'&()``)`*P+`,P-`.P/t`0duP1]2r{3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                          x*0  *0  8@*0*08@*0 CMTBMTEESTEETCETCESTMSDMSKTZif "k >``ߍ`~`ȩླྀྨ࿘|mx^hOX@H18"(ȼ`w}PKͩ΢Cϒ4N`'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()x)@*ij0+p,p-p.p/tp0dp1]2r3=4Ry562[6b8xp8D9Zp:&;%p?p@fpABEpCcD%pECFpG#GIIΫJKḶpMoNpOnQPgpQWnpRlIpS7PpTL+pU2pV, pVpX)XpY Zp[\]^_`_a}pb?c]pd|e=pfpgtpg{phVpi]pj8pk?plTm!pn6ohppqQres1tEuv.pvxpxЧypz{Οp|p}p~ypcp  x*0  *0  8@*0*08@CMTBMTEESTEETCETCESTMSDMSKTZif `POGx,ppHp*` .zL5^#p%5'X&p}4p_PAɧ#Opkp"prpPpI//p2Lpppp`ȷ𽸨_pxlh]XN?p80:Xp [T˭iKͩ΢Cϒ4ЉrN@ 9  cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                             1     PMTWESTWETWEMTCESTCETTZif  KRٸ%Avp#VP6%['^㐩Z煐'gfIΙ+pHRP*s0 T@xq쐼ΐؐ]x§ː]`Xtpp8Vp`!rDKͩ΢Cϒ4Ђ%rѱ^ *p cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                                                   NSTAMTNETNESTCETCESTTZif '{`ȷM`Kͩ΢Cϒ4Ђ%rb L=.xhXG7'/ҐΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CESTCETTZif *Л `ٮe}|`vKͩ΢Cϒ4Ѐ`ѕpҊ`bp#l`^)+ kT᥀і캳Zzw<ZY:;}: U 7t(dT M63#݀΀㡀ӒÃ|s ld!\U"LF#<7$,(%& '5'&()*+,ۀ-̀./t0d1]2r3=4R562j6688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y                                           *0     WMTCESTCETEESTEETTZif KmpǀpɃprp_TppApnop# Opɧ#Opkp"prpPp2Lppppȷ𽸨_pxlh]XN?p80:Xpp/p pb˵R̀Kܢ͕4K`rſpuϬgRХpTьI2f҅pYI9 )  ܹY ݲޢuߒfWrHb9R*B2 !)    z j cSC3#sdUF *  7t(dTC3#ܐ͐㽠ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y p      LMTWESTWETWEMTCETCESTTZif >``ߍ`~`ȩླྀྨ࿘|mx^hOX@H18"(`SPM 3`#݀΀㡀ӒÃ|s ld!\U"LF#<7$,(%& '5'' `(`)`*`+`,`-$-`.P/t`0duP1]2r{3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yx*0 *0 *0 BMTEESTEETTZif `ٮ qKͩ΢Cϒ4Ђ%pѕ`ҊP&'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()P*@+,ۀ-̀./t0d1]2r3=4R562j6q88S9h:5;J3?@fA+BECd D%ـECFG#GIIκJKḺM~NOn`PuQW|RlWS7^TL9U@V,V"X8XYZ[\]^_`_a}܀b?c]de=fgg艀hdikjFkMlcm/nEohp'qQ.rf s1tEuv/vxxжyˀz{έ|}~yq         *0 8@ *0 *0 8@ *0 *0 CESTCETMSDMSKEESTEETTZif _؝>*9Xm(<@m=2h=EP`'@PC@̓s|d lU!\F"L7#<($,% & ''p'p()x)@*ij0+p,p-p.p/tp0dp1]2r3=4Ry562[6b8xp8D9Zp:&;%p?p@fpABEpCcD%pECFpG#GIIΫJKḶpMoNpOnQPgpQWnpRlIpS7PpTL+pU2pV, pVpX)XpY Zp[\]^_`_a}pb?c]pd|e=pfpgtpg{phVpi]pj8pk?plTm!pn6ohppqQres1tEuv.pvxpxЧypz{Οp|p}p~ypcp                                                    #(1h#X?x*0 8@FP *0 8@*0 MMTMSTMDSTMSKMSDEETEESTTZifu& P'0@50̅te|V lG!\8"L)#<$, % & ''p'p())0*ĥ +`,`-`.`/t`0d`1]2r3=4Rk5r62M6T8j`869L`:;.`<5`=`>`?`@e`ABE`CcD%`ECF`G#GIIΝJxKL̕`MaNw`OnCPY`QW``Rl;`S7B`TL`U$`V+`V`XX`YZ`[\]^_`_a}`b?c]`dne=`f`gf`gm`hH`iO`j*`k1`lFm`n(og`p qQres0tEuv.`vx`xЙy`z{{Α`|`}s`~yz`U` /*0FP 8@8@FP 8@ *0*0  FP8@FP8@LMTKUYTKUYSTSAMSTSAMTTZifpp*p^pp_ɧ#Opkp"prpPp¨pXN9p80:!Mp`̖`K`΢ϣ-`Ѝ`у``pb`AF p ` tp   9`ltpd'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y    WESTWETWEMTCESTCETTZifw `ΗMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  CETCESTTZifx $r`&``#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  CESTCETTZif w d`.Kͩ΢Cͨp'@PC@̓s|d lU!\F"L7#<($,% %sP&.)`*P+`,P-`.P/t0d1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y     *0   8@*08@*0*0 KMTEETMSKCETCESTMSDEESTTZif y  qKͩ΢Cϒ4Ѐ`С'@PC@̓s|d lU!\F"L7#<($,% %sP&.'B)`*P+`,P-`.P/t0d1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y      8@ *0 *0 8@  *0*0 CETCESTMSDMSKEETEESTTZif y 0`ʪKͩ΢Cνp'@PC@̓s|d lU!\F"L7#<($,% & ''p'p(P)`*P+`,P-`.P/t0d1]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y      *0   8@*08@*0*0 CUTEETMSKCETCESTMSDEESTTZif {  `Kͩ΢Cϒ4ϟ8'@PC@̓s|d lU!\F"L7#<($,% %sP&.)`*P+`,P-`-.@/tP0dg@1]1]2r3=3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y     *0   8@*08@*0*0 SMTEETMSKCETCESTMSDEESTTZifw 5Kͩ΢Cϒ4Ђ%ѡN@E_p㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y   CETCESTTZifz cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yWESTWETTZif `ٮ qKͩ΢Cϒ4Ђ% cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  CESTCETTZif `ٮ qKͩ΢Cϒ4Ђ% cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y  MESTMETTZifz cEt6d'TMD3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y*0 EESTEETTZif  T6I`nP+`PP'`(n)w`), SJMTCDTCSTTZifuL\Mn@4$#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~y$ LMTCGTCGSTEGTEGSTTZifu hM|P3#ܐ͐㯐ӠÑ| lr!\c"LT#A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yπLMTWGTWGSTTZif[ w+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`LMTADTASTTZif p`p`epjp5`S`3އpiRK௳4~-౜QpgJ`|3pG,`\p'`;p`p`ƴ`Ĺ𿏲o„}Ovd_/XM|p:-^pW` @p9`ˈp`u@U 5peމpݩ`޾kp߉d`MpiF`~/pI(`^pW.G-7'ֶƵ`p`p`op_y`Oxp?[`/Zp(wp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEWTESTEDTTZif,pptEҀcSp3ޕwaYC~;_gXp|AG:p\#'p<p瀹ppZހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A CWTCSTCDTESTTZif :逢eEˉ a/v(XvuXW:9wqaP@0ހ5   ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OMWTMSTMDTTZif H*ˉa&t ؀Ѡ޳ݩ޾߉wip~YIR^;)4GX Q': 3   qޠo_O?/(f fe HG *)  x q(a'Q A 0C ΐ ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]PWTPSTPDTTZifˉa&G *)  x q(a'Q A 0C ΐ ௠    ysir YUIT 97)6 "S  5B%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k p PSTPWTPDTAKSTAKDTTZifˉ(a4 U08 70 x0q6a5QA0Q ܠ 0 ཰  0 0y i0Yc Ib09E )D0"a &0CB%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k pp YSTYWTYDTAKSTAKDTTZifˉ6aB0Gc@F0E@(0x'@qDaCQ&A%1_  @ ̰ 0 0@0@y0i@Yq0Ip@9S0)R@"o 4@QB%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k s`ps` ppCATCAWTAHSTAHDTAKDTAKSTTZifˉDaP@UqPT@SP6@x5PqRaQQ4A31m  P @ @P@Py@iPY@I~P9a@)`P"} BP_B%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k ePs`ePs` pNSTNWTBSTBDTAKDTAKSTTZifˉDaP@UqPT@SP6@x5PqRaQQ4A31m  P @ @P@Py@iPY@I~P9a@)`P"} BP_P32 vG@!ٰ"V)@#j0$6 @%J0&@'*0' ) 0)*~0+,Ӛ-.|/~0^1g@2s@3G@4S"5'r@637T@8!086@90:@;0<4=0>?0@oAŰBOCdD/EDFG$kG@IMI؝@J/K@LL0Ma@N.0OxC@P0Qa_Rl0SAATL0U!#V,0WXҰXYZ[Ֆ\@]x^@_Z`i@a~w0bI@c^Y0d)n@e>;0fg0glh0iNj0k0lmn߰oqpq[@rfs:@tFu@v/0v@x0xڙ@yf0z{@{H0|}*0~y 0ePs`ePs` ps`NSTNWTBSTBDTHADTHASTTZif  :ˉ |,ЁuXMWTMSTMDTTZifH*FL ˉ auXW:9wqaP@0ހ   ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O PWTPSTMWTMSTMDTTZif!,ppW"Gpˈa u@U 5sޗݩp޾y߉rp[iTp~=I6p^ CWTCSTCDTESTEDT . .. Marengo Knox7* Vevay7*  Indianapolis TZif%,ppˈa ޗݩp~=I6p^)pG<4'wp``pP`@p0`p p ` CWTCSTCDTESTEDTTZifX,ppˈa U 5sޗݩp޾y߉rp[iTp~=I6p^Wp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p CWTCSTCDTESTEDTTZif"[<ˈp`53p;@p0`p ` p ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p% LMTCSTESTEWTEDTTZif,ppˈa u@Jg+@p0p' p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A CWTCSTCDTESTTZif b ~|ܡ8L\Lt\dL^ܧDL=ܩ$LܫLܬfLݟܮ̯͂ܰḏ\F̳\m(̵fb\M ̷FD\,̹&&\ LBܻL$ܽLMl߸x(–X(v8b(_8D(?8`8Bˣ85(|8Z(@j!HӈDJHh&)HH H'HXtXݩmH޾VX߉OH8Xi1H~XIH]X(HG&챷ƠHﯽXHXHoX_dHOcX?FH/EX(b'XDC&%wpH`XPH@X0H X H X qH pX ٍ RXonQPy3i2YI8("HHXHXHXH u!~H"U#j$5%J|&'*^'X) @)ސX*"+rX,?H-TX.!H/~6X0H1gR2rH3G44RH5'62H7889:Ƽ;ۉX?M@oXAjHBOXCdLHD/aXED.HFCXG$HG_IHIAJHK#LMNOwPQaXRlS@XTLxU XV,ZWXXwHXXYYHZnX[;H\]H^l_H`iNa~bI0c]d)e=f/XggXhiXj݅kXlƢHmXnHoqXpfHqZrfHHs:tF*Huyv/Fv[x(x=y z{|`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`ܤΔ NSTNDTADTASTADDTTZif 4`#Pˈ``?`i8P``PP@`0P ` P ` xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`LMTADTASTTZif 񫠚0`#P@00zV@0SR<@4@:0@0@0E@U0@Kp~@$0n`@NB@0]@1@0^G0@P0mp@00r<@b06n~P`ˈ``u@U 5|u`W{`ݩtP޾]`߉VP?`i8P~!`IP^`(PG'챾`Po`_kPOj`?MP/L`(i.`KJ-,wpP``PP@`0P ` P ` xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%``LMTADTASTTZifdp1`X袔 _s>S-ގpp܍pR诼SP~5Pg.@|PG@[P&@;P@$й@лнĝпox„aOZdC/p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTESTTZifp1`ˈp`wp``pP` p ` p ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTESTTZifp1`ˈp` p ` p ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTESTTZif6MeO0HE1*% 0pp `raQ8`1!p `p`ˉ acSoU 5Ðޥݩ޾߉iib~KID^-)&GJC',% LMTMDTMSTCSTTZif?pˈa  π p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~ACDTCSTTZifúP?p ;Oˈa ӈhS`U 5\ޗݩp޾y߉rp[iTp~=I6p^)pG<4'o1bJggII++ wq pa Pp@0p π p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~ACDTCSTTZifMˉ avSoU 5',qa LMTMDTMSTCSTTZif M҅萣jʐ5ÀS3ˉ aU uX9aP@0ހ ݐ  ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OLMTMDTMSTTZif[ˉa&v S}U 5  Ѡ޳ݩ޾߉wip~YIR^;)4GX Q': 3   qޠo_O?/(f fe HG *)  x q(a'Q A 0 ΐ ͠ ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]PDTPSTTZif8 [ˉa&U 5  Ѡ޳ݩ޾߉wip~YIR^;)4GX Q': 3   qޠo_O?/(f fe HG *)  x q(a'PDTPSTMSTTZif|`P`0ˈ``/0@([i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0`1gg2r`3GI4R`5'+62`7 889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A ADTASTADDTEDTESTCSTCDTTZif|p`p@ˈp`/>P(iiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A EDTESTEDDTCSTCDTTZif| p‡Pˈa /L`(wiVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~ACDTCSTCDDTTZif|𐡢`ˉ a/Zp(idYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A MDTMSTMDDTCDTCSTTZif| 𐡢`ˉ a/Zp(idYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OMDTMSTMDDTTZif}pˉa&/h( idYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O PDTPSTPDDTMDTMSTTZif}˰# Ҁˉ(a4 /v(iir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]p YDTYSTYDDTPDTPSTTZif}˰# Ҁˉ(a4 /v(0ir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]p YDTYSTYDDTPDTPSTTZifV`1gv2sp3GX4Rp5'+5`62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A LMTCSTCDTEDTESTTZifbpnfV`C` 6`'`ް`Ɨ4PUPϷVPڙv1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~A  LMTMSTCSTCDTTZifZpnfV`C` 6`'`1gv2sp3GX4Rp5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O LMTMSTCSTCDTMDTTZifpnfV`C` 6`'`ؑp1g2s3Gf4R5'H62ڀ LMTMSTCSTPSTMDTTZif]pnfV`C` 6`'`ؑp1g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~O< LMTMSTCSTPSTMDTTZif|g;ؑ~YIR^;)4GX Q': 3   q ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]L LMTPSTMSTPDTTZif75 LMTASTTZif 73BPLMTESTASTTZif 7BOxp?[`/Zp(wp?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3p|LMTEDTESTTZif y$丅ctnvTP_`0>P LMTBMTADTASTTZif7^ٰ;EQء.nX^PX>2X'`X`X`جǤ`vخ`Vذh`6زpشPf|ض0HߙX*฿{X ຟ]X)`?X `_!X`?Xx`(X`8`!ɧsːXUpXb`Paq`7PP  LMTCHDTCSTCDTTZifKMTESTi . ..j GMTk UTCl UCTmGMT-14*nGMT-13*oGMT-12*pGMT-11*qGMT-10*rGMT-97*sGMT-87*tGMT-77*uGMT-67*vGMT-57*wGMT-47*xGMT-37*yGMT-27*zGMT-17*{GMT+17*|GMT+27*}GMT+37*~GMT+47*GMT+57*GMT+67*GMT+77*GMT+87*GMT+97*GMT+10*GMT+11*GMT+12*k Universal kZulu7*j Greenwich jGMT-07*jGMT+07*jGMT07*TZifGMTTZif b€ӔPt]@[fQ@;Hʼm$eP̜O P;ӣP`}@=DS;@ũh@wp@`P5@PH@ P{ P j@ iP ن KPhP}@Qf1F[&{;d]F?(\@ >@zSP @ Z5P!o@"CQ#N@$#3%.@&''P()މP*״+kP,-MP.x/~/P0wZ1gK2W<3G-4@YP5P62P6P889:Ƶ;ېP?T@oPAqPBOxPCdSPD/ZPED5PFPQoP1QP)a *KP+D 6cw$ MMTCSTESTCDTTZifbPMTESTTZif2`ASTAWTTZif744LMTASTTZifǰCMTASTTZifu8ncYI 8(" @@P@P@P@ u!w@"U#j$5%Ju&'*W'P) 9)މP*+kP,8@-MP.@/~/P0@1gK2r@3G-4R@5'62@7889:Ƶ;ۂP?F@oPAc@BOxPCdE@D/ZPED'@FP?F@oPAc@BOxPCdE@D/ZPED'@Fas?@@J0A_y@B*r0C?[@D T0E=@E60GYG0H;I0JKLMrNORڰPp@Q2RP@ST0@TV@V۝0W@X0Yh@Za0[\{C0]f^[%0_yH`DAaY*b$#c9 deeg @gɰh@ij@k0l@ml0n@oL0pjq,n0rJs P0t*stlv UvNw7x0yz{6@|t}@~Tְr@CMTARTARSTTZif ,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v'!0'X7ư8Ͱ9ֶ:;@<=@>as?@@J0A_y@B*r0C?[@D T0E=@E60GYG0H;I0JKLMrNORڰPp@Q2RP@ST0@TV@V۝0W@X0Yh@Za0[\{C0]f^[%0_yH`DAaY*b$#c9 deeg @gɰh@ij@k0l@ml0n@oL0pjq,n0rJs P0t*stlv UvNw7x0yz{6@|t}@~Tְr@CMTARTARSTTZif ,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v7ư8Ͱ9ֶ:;@<=@>as?@@J0A_y@B*r0C?[@D T0E=@E60GYG0H;I0JKLMrNORڰPp@Q2RP@ST0@TV@V۝0W@X0Yh@Za0[\{C0]f^[%0_yH`DAaY*b$#c9 deeg @gɰh@ij@k0l@ml0n@oL0pjq,n0rJs P0t*stlv UvNw7x0yz{6@|t}@~Tְr@CMTARTARSTTZif,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v'!0'X(@)½*@7ư8Ͱ9ֶ:;@<=@>as?@@J0A_y@B*r0C?[@D T0E=@E60GYG0H;I0JKLMrNORڰPp@Q2RP@ST0@TV@V۝0W@X0Yh@Za0[\{C0]f^[%0_yH`DAaY*b$#c9 deeg @gɰh@ij@k0l@ml0n@oL0pjq,n0rJs P0t*stlv UvNw7x0yz{6@|t}@~Tְr@ CMTARTARSTWARTWARSTTZif ,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v)0):7ư8Ͱ9ֶ:;@<=@>as?@@J0A_y@B*r0C?[@D T0E=@E60GYG0H;I0JKLMrNORڰPp@Q2RP@ST0@TV@V۝0W@X0Yh@Za0[\{C0]f^[%0_yH`DAaY*b$#c9 deeg @gɰh@ij@k0l@ml0n@oL0pjq,n0rJs P0t*stlv UvNw7x0yz{6@|t}@~Tְr@CMTARTARSTTZif,{R@ɰ@p0}@0x @Z@;0~`@*0A70ȁ@MM0ΰ)5Cd=0l02@柰C0w@05S0R@504@J$oʰ 䭠 Ԭ ď qɎ0w 5 2~ !i0" Ƞ#$%7%v'!0'X(g)H*@7ư8Ͱ9ֶ:;@<=@>as?@@J0A_y@B*r0C?[@D T0E=@E60GYG0H;I0JKLMrNORڰPp@Q2RP@ST0@TV@V۝0W@X0Yh@Za0[\{C0]f^[%0_yH`DAaY*b$#c9 deeg @gɰh@ij@k0l@ml0n@oL0pjq,n0rJs P0t*stlv UvNw7x0yz{6@|t}@~Tְr@ CMTARTARSTWARTWARSTTZif /8HHLMTANTASTTZif, LPMTBOSTBOTTZif! ed;и2& f8 ӠܹK ޛ݌ T%PV Q Ƿ Ġ oɀ xɐ' 3![ " #X#b%7%Թ LMTFNSTFNTTZif ttI@40t 800ܹY 0ޛ ݚ0T3 ^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" ȠҌ LMTBRSTBRTTZifn kI@40t 800ܹY 0ޛ ݚ0T3 ^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" Ƞ#X#p %7% 7ư8 9֨:g ;0X+ ?0@AGA_k0B!)C?M0D E/0EGKGϠH-IJK LMi NӰOI Pp0Q)t RP0S V T00T8 V0VTWx0X6YZ0Z[v\q]X^Qܠ_y:`: aYb c8c eeڟ g0g h0ic j0kl0mcan0oCCpjq#%rJst*et$ v Gv w)x y z {(0|k } 0~K r0 LMTBRSTBRTTZifv t0I@40t 800ܹY 0ޛ ݚ0T3 ^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" Ƞ#X#p %7% 0y01M2W 3j 48T04 6 06h7ư8 9֨:g ;0X+ ?0@AGA_k0B!)C?M0D E/0EGKGϠH-IJK LMi NӰOI Pp0Q)t RP0S V T00T8 V0VTWx0X6YZ0Z[v\q]X^Qܠ_y:`: aYb c8c eeڟ g0g h0ic j0kl0mcan0oCCpjq#%rJst*et$ v Gv w)x y z {(0|k } 0~K r0 LMTBRSTBRTTZifp h|I@40t 800ܹY 0ޛ ݚ0T3 ^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" Ƞ#X#p %7% 0y01M7ư8 9֨:g ;0X+ ?0@AGA_k0B!)C?M0D E/0EGKGϠH-IJK LMi NӰOI Pp0Q)t RP0S V T00T8 V0VTWx0X6YZ0Z[v\q]X^Qܠ_y:`: aYb c8c eeڟ g0g h0ic j0kl0mcan0oCCpjq#%rJst*et$ v Gv w)x y z {(0|k } 0~K r0ބ LMTBRSTBRTTZif rI@40t 800ܹY 0ޛ ݚ0T3 Z 0^ d0Q,0 Ұ0}Ɏ0xנ5 3Ϡ!i0" Ƞ#X#p %7% '!0')0) * +k2,0-f .0/F 0y01M2W 3j 48T04 6 06h7ư8 9֨:g ;0X+ ?0@AGA_k0B!)C?M0D E/0EGKGϠH-IJK LMi NӰOI Pp0Q)t RP0S V T00T8 V0VTWx0X6YZ0Z[v\q]X^Qܠ_y:`: aYb c8c eeڟ g0g h0ic j0kl0mcan0oCCpjq#%rJst*et$ v Gv w)x y z {(0|k } 0~K r0L LMTBRSTBRTTZif {WNB@ނ08@@ܹg0#@ޛ0ݨ@TA0 l0r@,Q:@0 @ɜ@xC 3ݰ!w@" ְ#X#~0%8%0'!@')@)0*+k@,@-f0.@/F00@1[2W.3x048b@406 -@6v7809ֶ:u0;@X90?@@AUA_y@B!7C?[@DE=@EGYGݰH;IJK0LMi0NOI0Pp@Q)0RP@S d0T0@TF0V@VbW@XDYh@Z&[\r]f^Q_yH`;0aY*b0c9 c0eeڭ0g @g0h@iq0j@kl@mcon@oCQpjq#3rJst*st20v Uv0w7x0yz0{6@|k0}@~K0r@l LMTAMSTAMTTZif WNB@ނ08@@ܹg0#@ޛ0ݨ@TA0 l0r@,Q:@0 @ɜ@xC 3ݰ!w@" ְ LMTAMSTAMTTZifj WNB@ނ08@@ܹg0#@ޛ0ݨ@TA0 l0r@,Q:@0 @ɜ@xC 3ݰ!w@" ְ7809ֶ:u0;@X90?@@AUA_y@B!7C?[@DE=@EGYGݰH;IJK0LMi0NOI0Pp@Q)0RP@S d0T0@TF0V@VbW@XDYh@Z&[\r]f^Q_yH`;0aY*b0c9 c0eeڭ0g @g0h@iq0j@kl@mcon@oCQpjq#3rJst*st20v Uv0w7x0yz0{6@|k0}@~K0r@  LMTAMSTAMTTZif DWNB@ނ08@@ܹg0#@ޛ0ݨ@TA0 l0r@,Q:@0 @ɜ@xC 3ݰ!w@" ְ,@-f0Ǽ LMTAMSTAMTTZif f\PPސ@8PPܹu@1Pޛ@ݶPTO@z@P:QHP@ "PɪPxQ 3!P" p LMTACSTACTTZif $iq P@^{бw=@AгXp"4P9@gзP\ Pn`guP@IU2 +>O@ 1@@ Ѱ @ 0 @ 0@h0H0f(v0F&{t]V?8\@>@p @ Z0!o@"90#N@$0%8%0''١0()½*צ+,-.j/bc0@1BE2`i@3"'4@K@5 D06 @7հ8@809+:0; <0=>j0?@SʰAhB3CHDE1@EpG@GRHv@Io0JX@KQ0L:@M|30N@O\0Pz8Q;0RZS0T9UVVװWXĹY@Z[¿@\}]@^m0_@`M|0abe@b-^0cBG@d @0e+ce"0g Eg0h'i j klmun@oUưps@q5rS@st3@t0v@vމ0wr@xk0y܎zM0{p|~/0}R~gK|4  SMTCLSTCLTTZif XUt*!+Bp@ BMTCOSTCOTTZif . H`LMTANTASTTZifBhQMTECTTZif+5LMTGFTTZif y9> }<'0xDD LMTGBGTGYTTZif +@ t ʰ x0-@Z1t`dCU@FȰ8@'0L /@c0۳08l@O0 p!a@"S#DX@$4;0%A;@&n'@'0(@)H*Ͻ+ 0,@-p ./O0n@16h02W.3474066ر07809ֶ:u0;@X90?@@AUA_y@B!7C?[@DE=@EGYGݰH;IJK0LMi0NOI0Pp@Q)0RP@S d0T0@TF0V@VbW@XDYh@Z&[\r]f^Q_yH`;0aY*b0c9 c0eeڭ0g @g0h@iq0j@kl@mcon@oCQpjq#3rJst*st20v Uv0w7x0yz0{6@|k0}@~K0r@AMTPYTPYSTTZif  t@JPE@/J-, p%&|-%P-@ LMTPESTPETTZif*Kb, X1H<L LMTPMTNEGTSRTTZif73TLMTASTTZif?%Y8C0Ìvԗyy8_[}x8?=]Z8=<8<080UT0͕_ . EJ r T s 6ꦠ>0bqؖ(0ɨX0Ǡ ZG( ݠ0 U0nG!T0";>#$ %Jg%v'!0'X) +):*0+T MMTUYHSTUYTUYSTTZif,@H@CMTVET . .. Scoresbysund GodthabThule7*New_York ChicagoDenver* Los_AngelesJuneau*Yakutat Anchorage Nome7*Adak7*PhoenixBoise7*  Indianapolis  Indiana LouisvilleDetroit Menominee St_Johns  Goose_Bay Halifax Glace_Bay Montreal  Thunder_BayNipigonRegina* Rainy_RiverWinnipeg  Swift_Current Edmonton  Vancouver  Dawson_Creek  Pangnirtung Iqaluit! Rankin_Inlet " Cambridge_Bay # Yellowknife$Inuvik*% Whitehorse&Dawson*'Cancun*( Mexico_City) Chihuahua * Hermosillo+Mazatlan ,Tijuana-Anguilla .Antigua/Nassau*0Barbados 1Belize*2Cayman*3 Costa_Rica4Havana*5Dominica 6 Santo_Domingo 7 El_Salvador8Grenada9 Guadeloupe: Guatemala ;Port-au-Prince< Tegucigalpa=Jamaica> Martinique? Montserrat@ManaguaAPanama*B Puerto_RicoCSt_Kitts DSt_Lucia EMiquelon F St_VincentG Grand_TurkHTortolaI St_Thomas J Buenos_Aires KRosarioLCordobaMJujuy7*N Catamarca OMendozaPAruba7*QLa_Paz*RNoronhaSBelem7*T Fortaleza U Araguaina VMaceio*W Sao_Paulo XCuiaba*Y Porto_VelhoZ Boa_Vista [Manaus*\ Porto_Acre]Santiago ^Bogota*_Curacao` Guayaquil aCayennebGuyana*cAsuncion dLima7*e Paramaribof Port_of_Spain g MontevideohCaracasShiprock Atka7*,Ensenada   Fort_Wayne Knox_INIVirgin*TZifUTCTZifUCTTZifGMT-14TZifGMT-13TZifGMT-12TZifGMT-11TZifGMT-10TZif~GMT-9TZifpGMT-8TZifbpGMT-7TZifT`GMT-6TZifFPGMT-5TZif8@GMT-4TZif*0GMT-3TZif GMT-2TZifGMT-1TZifGMT+1TZifGMT+2TZifGMT+3TZifGMT+4TZifGMT+5TZifGMT+6TZifGMT+7TZifGMT+8TZifpGMT+9TZifs`GMT+10TZifePGMT+11TZifW@GMT+12TZif1Local time zone must be set--see zic manual page . ..AST4ADTEST5EDTCST6CDTMST7MDTPST8PDTYST9YDTAST47*EST57*CST67*MST77*PST87*YST97*(HST107*TZif* Ђ Єpj PZ `IP9`)P` P`Pٓ`ҰЏu`БtГsrVЕbUR8ЗB72Й"7P 6`P`P`P`P`Фj`cЦSCШ3#ЪcЫbEЭDbP&బDPC`&P|%`lP\`KP;`+P`лмԬоī࿴p„o}PdQ]oPMn`=QP-P`3P 2`P`P`϶Хѕ҅ueUE5.P|P`|P{`^P޾]`߮@P?`"P~!`w>^`W G7'֨ƧP`P`Po`_kPOj`?MP/L`(i.`KJ-,wpP``PP@`0P ` 5P xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P `!P"q`#j$Z%J&:'*e(d) G)F*)+(,FP- .(P/'`0 P1 `2rP3b`4RP5B`62P7"`89 9:;ې<ˏ=r>q?T@SAqPBk5CdSPDTR`ED5PF44`G$PH`IPI`JPK`LM`NOPQ|RlS\TLU<~V,aW`X~PY}`Y`PZ_`[BP\A`]$P^#`_P``a~"bd`c^dNe=f-gh hij݌k͋lƩPm`nPo`pmPqvl`rfOPsVN`tF1Pu60`v/Mw`x/x.yz{|}~ADTASTTZif8pj`ZpI`9p)`p `p`١pҾp𒒂rdbcRFBE2("'E` Dp'`&p `p`p`pjpcSC3#qpSRp`4R`Qp4`|3pl`\pK`;p+`pԺĹ𿴜~„}}`d_]}`M|p=_`-^pA` @p#`"p`p!϶ Ці҅ueUE5.``p`މpl`޾kp߮N`Mp0`~/pwL^pW.G-7'ֶƵ`p`p`op_y`Oxp?[`/Zp(w?b@aA`BkCCda`DT`pEDC`F4BpG$%`H$pI`IpJ`KpLMpNOPQ|RlS\TLUpv/[w px=xp~=wZ^W?p@pApBkRCdopDTnEDQpF4PG$3pH2IpIJpKLM؀NOPQ|RlS\TLU<V,}W}XpYY|pZ{[^p\]]@p^?_"p`!a~>bec^ dN e>f.gh hijݨkͨlpmĀnpoppqvrfkpsVjtFMpu6Lv/iw.xKxKy-z-{|}~CDTCSTTZifASTTZifU87qj6Z5J:) ܀ې龀ٽrbRcBb2E"Da `CB%$逢萣jʐcSC3#pǒQnmP|Ol2\1L<+„}d|]M={-z] \?>! >϶=Ц і҆veUE5.ĀÐޥΈ޾߮jiL~Kwi^-WKGJ7-',рАo_O?w/v(XvuXW:9wqaP@0ހ5 5  ࡐ ٿ yeidYGIF9))("E '& ̀ ̐!"q#j$Z%J&:'*() r)q*T+S,p-5.R/Q04132s3c4R5B62ڀ7"ِ89 9:;ۻ<˺=>?@~ABk`Cd}DT|ED_F4^G$AH@I#I"JKL"MNOPQ|RlS\TLU<V,WXYYZ剐[l\k]N^M_0`/a~Mbec^/dN.e>f.gh hijݷkͶlӀmҐnopqvrfysVxtF[u6Zv/xw ?@ ABkn CdDTEDmF4lG$OHNI1I0JKL0MNO PQ| RlS\ TLU< V,W XYYZ嗠[z\y]\^[_>`=a~[bec^=dN< e>f. gh hi jk lmnÐo pqvrfsVtFiu6hv/wJxhxg yJzI {,|+ }~ PDTPSTTZifq0T S06 q50jRZQJ4:3* ڠٰ 0 0r b0R B~02a "`0} |_^A@#"" j氥d T0C 30# 0 0 Ӌ0̨m0l|klN\ML00? @0ABk|0CdDTED{F4zG$]H\I?I>J!K L> MN O0P Q}0Rl S\0TL U<0V, W0XĠYðYZ奰[Ո\Ň]j^i_L`Ka~i be-c^K dNJ0e>- f.,0g h0h i0j k0lmnѠoаpqvrfsVtFwu6vv/ wXxv xu0yX zW0{: |90} ~0 pYDTYSTTZifESTTZifCSTTZifMSTTZifPSTTZifpYSTTZifs`HST . .. Longyearbyen  . .. Pacific-NewAlaska*Aleutian ArizonaCentral  East-Indiana EasternHawaii* Indiana-StarkeMichigan Mountain PacificSamoa7* . ..\Acre7*R DeNoronha WEast7*[West7* . ..Atlantic CentralEast-SaskatchewanEasternMountain  Newfoundland Pacific Saskatchewan %DYukon7* . ..] Continental EasterIsland  . .., BajaNorte +BajaSur(General . ..Riyadh87 Riyadh88 Riyadh89 e#512:\ :pf#1078399:of#218112:bf#4096:ff#1024:\ :pg#1213567:og#82944:bg#8192:fg#1024:\ :ph#1180799:oh#115712:bh#8192:fh#1024: # # HP magneto-optical drive. # (ns, nt, nc are totally bogus) # actually 1K sectors sd650-sony|mo650-sony|HP6300/650A Magneto-optical drive with Sony format:\ :ty=optical:ns#61:nt#8:nc#1306:\ :pa#16384:oa#1024:ba#8192:fa#1024:\ :pb#65536:ob#17408:\ :pc#637328:oc#0:bc#8192:fc#1024:\ :pd#98304:od#17408:\ :pe#102400:oe#115712:be#4096:fe#1024:\ :pf#419216:of#218112:bf#4096:ff#1024:\ :pg#554384:og#82944:bg#8192:fg#1024: sd650|mo650|mo650-ansi|HP6300/650A Magneto-optical with ANSI format drive:\ :ty=optical:ns#61:nt#8:nc#1306:\ :pa#16384:oa#1024:ba#8192:fa#1024:\ :pb#65536:ob#17408:\ :pc#629136:oc#0:bc#8192:fc#1024:\ :pd#98304:od#17408:\ :pe#102400:oe#115712:be#4096:fe#1024:\ :pf#411024:of#218112:bf#4096:ff#1024:\ :pg#546192:og#82944:bg#8192:fg#1024: # $NetBSD: dot.profile,v 1.2.2.1 1999/06/26 23:55:20 cgd Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=hp300h export TERM HOME=/ export HOME umask 022 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^H, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^H 9600 # run update, so that installed software is written as it goes. update # get the terminal type _forceloop="" while [ "X${_forceloop}" = X"" ]; do eval `tset -s -m ":?$TERM"` if [ "X${TERM}" != X"unknown" ]; then _forceloop="done" fi done # Installing or upgrading? _forceloop="" while [ "X${_forceloop}" = X"" ]; do echo -n '(I)nstall or (U)pgrade? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; *) _forceloop="" ;; esac done fi ######## TERMINAL TYPE DESCRIPTIONS SOURCE FILE # # Version 9.13.25 # termcap syntax # # Eric S. Raymond (current maintainer) # John Kunze, Berkeley # Craig Leres, Berkeley # # Please e-mail changes to terminfo@ccil.org. The old termcap@berkeley.edu # address is no longer valid. # # PURPOSE OF THIS FILE: # # This file describes the capabilities of various character-cell terminals, # as needed by software such as screen-oriented editors. # # Other terminfo and termcap files exist, supported by various OS vendors # or as relics of various older versions of UNIX. This one is the longest # and most comprehensive one in existence. It subsumes not only the entirety # of the historical 4.4BSD, GNU, System V and SCO termcap files and the BRL # termcap file, but also large numbers of vendor-maintained termcap and # terminfo entries more complete and carefully tested than those in historical # termcap/terminfo versions. # # Pointers to related resources (including the ncurses distribution) may # be found at . # # INTERNATIONALIZATION: # # This file uses only the US-ASCII as the G0/GL character set. # # This file assumes a US-ASCII character set. If you need to fix this, start # by global-replacing \E(B and \E)B with the appropriate ISO 6429 enablers # for your character set. \E(A and \E)A enables the British character set # with the pound sign at position 2/3. # # In order to allow 8bit encodings (right half of ISO8859 character sets, # EUC encondings, etc.), we do not use G1 (and SO/SI) for alternate # character set but use G0 instead, and \E)0 should be avoided in # and initialization strings. # # FILE FORMAT: # # The version you are looking at may be in any of three formats: master # (terminfo with OT capabilities), stock terminfo, or termcap. You can tell # which by the format given in the header above. # # The master format is accepted and generated by the terminfo tools in the # ncurses suite; it differs from stock (System V-compatible) terminfo only # in that it admits a group of capabilities (prefixed `OT') equivalent to # various obsolete termcap capabilities. You can, thus, convert from master # to stock terminfo simply by filtering with `sed "/OT[^,]*,/s///"'; but if # you have ncurses `tic -I' is nicer (among other things, it automatically # outputs entries in a canonical form). # # The termcap version is generated automatically from the master version # using tic -C. This filtering leaves in the OT capabilities under their # original termcap names. All translated entries fit within the 1023-byte # string-table limit of archaic termcap libraries except where explicitly # noted below. Note that the termcap translation assumes that your termcap # library can handle multiple tc capabilities in an entry. 4.4BSD has this # capability. Older versions of GNU termcap, through 1.3, do not. # # For details on these formats, see terminfo(5) in the ncurses distribution, # and termcap(5) in the 4.4BSD Unix Programmer's Manual. Be aware that 4.4BSD # curses has been declared obsolete by the caretakers of the 4.4BSD sources # as of June 1995; they are encouraging everyone to migrate to ncurses. # # Note: unlike some other distributed terminfo files (Novell Unix & SCO's), # no entry in this file has embedded comments. This is so source translation # to termcap only has to carry over leading comments. Also, no name field # contains embedded whitespace (such whitespace confuses rdist). # # Further note: older versions of this file were often installed with an editor # script (reorder) that moved the most common terminal types to the front of # the file. This should no longer be necessary, as the file is now ordered # roughly by type frequency with ANSI/VT100 and other common types up front. # # Some information has been merged in from terminfo files distributed by # USL and SCO (see COPYRIGHTS AND OTHER DELUSIONS below). Much information # comes from vendors who maintain official terminfos for their hardware # (notably DEC and Wyse). # # A detailed change history is included at the end of this file. # # FILE ORGANIZATION: # # Comments in this file begin with # - they cannot appear in the middle # of a terminfo/termcap entry. Individual capabilities are commented out by # placing a period between the colon and the capability name. # # The file is divided up into major sections (headed by lines beginning with # the string "########") and minor sections (beginning with "####"); do # # grep "^####" | more # # to see a listing of section headings. The intent of the divisions is # (a) to make it easier to find things, and (b) to order the database so # that important and frequently-encountered terminal types are near the # front (so that you'll get reasonable search efficiency even if you don't # use reorder). Minor sections usually correspond to manufacturers or # standard terminal classes. Parenthesized words following manufacturer # names are type prefixes or product line names used by that manufacturers. # # HOW TO READ THE ENTRIES: # # The first name in an entry is the canonical name for the model or # type, last entry is a verbose description. Others are mnemonic synonyms for # the terminal. # # Terminal names look like - # The part to the left of the dash, if a dash is present, describes the # particular hardware of the terminal. The part to the right may be used # for flags indicating special ROMs, extra memory, particular terminal modes, # or user preferences. # # All names should be in lower case, for consistency in typing. # # The following are conventionally used suffixes: # -2p Has two pages of memory. Likewise 4p, 8p, etc. # -am Enable auto-margin. # -m Monochrome. Suppress color support # -mc Magic-cookie. Some terminals (notably older Wyses) can # only support one attribute without magic-cookie lossage. # Their base entry is usually paired with another that # uses magic cookies to support multiple attributes. # -na No arrow keys - termcap ignores arrow keys which are # actually there on the terminal, so the user can use # the arrow keys locally. # -nam No auto-margin - suppress :am: capability # -nl No labels - suppress soft labels # -ns No status line - suppress status line # -rv Terminal in reverse video mode (black on white) # -s Enable status line. # -vb Use visible bell (:vb:) rather than :bl:. # -w Wide - in 132 column mode. # If a name has multiple suffixes and one is a line height, that one should # go first. Thus `aaa-30-s-rv' is recommended over `aaa-s-rv'. # # Entries with embedded plus signs are designed to be included through use/tc # capabilities, not used as standalone entries. # # To avoid search clashes, some older all-numeric names for terminals have # been removed (i.e., "33" for the Model 33 Teletype, "2621" for the HP2621). # All primary names of terminals now have alphanumeric prefixes. # # Comments marked "esr" are mostly results of applying the termcap-compiler # code packaged with ncurses and contemplating the resulting error messages. # In many cases, these indicated obvious fixes to syntax garbled by the # composers. In a few cases, I was able to deduce corrected forms for garbled # capabilities by looking at context. All the information in the original # entries is preserved in the comments. # # In the comments, terminfo capability names are bracketed with <> (angle # brackets). Termcap capability names are bracketed with :: (colons). # # INTERPRETATION OF USER CAPABILITIES # # The System V Release 4 and XPG4 terminfo format defines ten string # capabilities for use by applications, .... In this file, we use # certain of these capabilities to describe functions which are not covered # by terminfo. The mapping is as follows: # # u9 terminal enquire string (equiv. to ANSI/ECMA-48 DA) # u8 terminal answerback description # u7 cursor position request (equiv. to VT100/ANSI/ECMA-48 DSR 6) # u6 cursor position report (equiv. to ANSI/ECMA-48 CPR) # # The terminal enquire string should elicit an answerback response # from the terminal. Common values for will be ^E (on older ASCII # terminals) or \E[c (on newer VT100/ANSI/ECMA-48-compatible terminals). # # The cursor position request () string should elicit a cursor position # report. A typical value (for VT100 terminals) is \E[6n. # # The terminal answerback description (u8) must consist of an expected # answerback string. The string may contain the following scanf(3)-like # escapes: # # %c Accept any character # %[...] Accept any number of characters in the given set # # The cursor position report () string must contain two scanf(3)-style # %d format elements. The first of these must correspond to the Y coordinate # and the second to the %d. If the string contains the sequence %i, it is # taken as an instruction to decrement each value after reading it (this is # the inverse sense from the cup string). The typical CPR value is # \E[%i%d;%dR (on VT100/ANSI/ECMA-48-compatible terminals). # # These capabilities are used by tac(1m), the terminfo action checker soon # to be distributed with ncurses. # # TABSET FILES # # All the entries in this file have been edited to assume that the tabset # files directory is /usr/share/tabset, in conformance with the File Hierarchy # Standard for Linux and free BSD systems. Some vendors (notably Sun) use # /usr/lib/tabset or (more recently) /usr/share/lib/tabset. # # No curses package we know of uses these files. If their location is an # issue, you will have to hand-patch the file locations before compiling # this file. # # REQUEST FOR CONTACT INFORMATION AND HISTORICAL MATERIAL: # # As the ANSI/ECMA-48 standard and variants take firmer hold, and as # character-cell terminals are increasingly replaced by X displays, much of # this file is becoming a historical document (this is part of the reason for # the new organization, which puts ANSI types, xterm, free-Unix consoles, # and vt100 up front in confidence that this will catch 95% of new hardware). # # For the terminal types still alive, I'd like to have manufacturer's # contact data (Internet address and/or snail-mail + phone). # # I'm also interested in enriching the comments so that the latter portions of # the file do in fact become a potted history of VDT technology as seen by # UNIX hackers. Ideally, I'd like the headers for each manufacturer to # include its live/dead/out-of-the-business status, and for as many # terminal types as possible to be tagged with information like years # of heaviest use, popularity, and interesting features. # # I'm especially interested in identifying the obscure entries listed under # `Miscellaneous obsolete terminals, manufacturers unknown' before the tribal # wisdom about them gets lost. If you know a lot about obscure old terminals, # please go to the terminfo resource page, grab the UFO file (ufo.ti), and # eyeball it for things you can identify and describe. # # If you have been around long enough to contribute, please read the file # with this in mind and send me your annotations. # # COPYRIGHTS AND OTHER DELUSIONS # # The BSD ancestor of this file had a standard Regents of the University of # California copyright with dates from 1980 to 1993. # # Some information has been merged in from a terminfo file SCO distributes. # It has an obnoxious boilerplate copyright which I'm ignoring because they # took so much of the content from the ancestral BSD versions of this file # and didn't attribute it, thereby violating the BSD Regents' copyright. # # Not that anyone should care. However many valid functions copyrights may # serve, putting one on a termcap/terminfo file with hundreds of anonymous # contributors makes about as much sense as copyrighting a wall-full of # graffiti -- it's legally dubious, ethically bogus, and patently ridiculous. # # This file deliberately has no copyright. It belongs to no one and everyone. # If you claim you own it, you will merely succeed in looking like a fool. # Use it as you like. Use it at your own risk. Copy and redistribute freely. # There are no guarantees anywhere. Svaha! # ######## STANDARD AND SPECIAL TYPES # # This section describes terminal classes and maker brands that are still # quite common. # #### Specials # # Special "terminals". These are used to label tty lines when you don't # know what kind of terminal is on it. The characteristics of an unknown # terminal are the lowest common denominator - they look about like a ti 700. # dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: lpr|printer|line printer:\ :bs:hc:os:\ :co#132:li#66:\ :bl=^G:cr=^M:do=^J:ff=^L:le=^H:sf=^J: glasstty|classic glass tty interpreting ASCII control characters:\ :am:\ :co#80:\ :bl=^G:cl=^L:cr=^M:do=^J:kb=^H:kd=^J:kl=^H:le=^H:nw=^M^J:\ :ta=^I: #### ANSI.SYS/ISO 6429/ECMA-48 Capabilities # # See the end-of-file comment for more on these. # # The IBM PC alternate character set. Plug this into any Intel console entry. # We use \E[11m for rmacs rather than \E[12m so the string can use the # ROM graphics for control characters such as the diamond, up- and down-arrow. # This works with the System V, Linux, and BSDI consoles. It's a safe bet this # will work with any Intel console, they all seem to have inherited \E[11m # from the ANSI.SYS de-facto standard. klone+acs|alternate character set for ansi.sys displays:\ :ac=`\004a\261f\370g\361h\260j\331k\277l\332m\300n\305o~q\304r\362s_t\303u\264v\301w\302x\263y\371z\372{\373|\374}\375~\376.\031-\030\054\021+^P0\333p\304r\304y\363z\362{\343|\330}\234:\ :ae=\E[10m:as=\E[11m: # Highlight controls corresponding to the ANSI.SYS standard. Most # console drivers for Intel boxes obey these. Makes the same assumption # about \E[11m as klone+acs. True ANSI/ECMA-48 would have :se=\E[27m:, # :ue=\E[24m:, but this isn't a documented feature of ANSI.SYS. klone+sgr|attribute control for ansi.sys displays:\ :S2=\E[11m:S3=\E[10m:mb=\E[5m:md=\E[1m:me=\E[0;10m:\ :mk=\E[8m:mr=\E[7m:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m:\ :se=\E[m:so=\E[7m:ue=\E[m:us=\E[4m:\ :tc=klone+acs: # Highlight controls corresponding to the ANSI.SYS standard. *All* # console drivers for Intel boxes obey these. Does not assume \E[11m will # work; uses \E[12m instead, which is pretty bulletproof but loses you the ACS # diamond and arrow characters under curses. klone+sgr-dumb|attribute control for ansi.sys displays (no ESC [ 11 m):\ :as=\E[12m:mb=\E[5m:md=\E[1m:me=\E[0;10m:mk=\E[8m:\ :mr=\E[7m:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;12%;m:\ :se=\E[m:so=\E[7m:ue=\E[m:us=\E[4m:\ :tc=klone+acs: # KOI8 (RFC1489) alternate character set # From: Qing Long , 24 Feb 1996. klone+koi8acs|alternate character set for ansi.sys displays with KOI8 charset:\ :ac=l\202m\204k\203j\205u\207t\206v\210w\211q\200x\201n\212o\213s\214p\216r\217`\004a\237f\234g\232~\225.\037-\036+\020\054\021h\222I\2200\215y\230z\231{\267}L|\274:\ :ae=\E[10m:as=\E[11m: # ANSI.SYS color control. The setb/setf caps depend on the coincidence # between SVr4/XPG4's color numbers and ANSI.SYS attributes. Here are longer # but equivalent strings that don't rely on that coincidence: # setb=\E[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m, # setf=\E[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m, # The DOS 5 manual asserts that these sequences meet the ISO 6429 standard. # They match a subset of ECMA-48. klone+color|color control for ansi.sys and ISO6429-compatible displays:\ :Co#8:NC#3:pa#64:\ :Sb=\E[4%dm:Sf=\E[3%dm:op=\E[37;40m: # This is better than klone+color, it doesn't assume white-on-black as the # default color pair, but many `ANSI' terminals don't grok the cap. ecma+color|color control for ECMA-48-compatible terminals:\ :Co#8:NC#3:pa#64:\ :Sb=\E[4%dm:Sf=\E[3%dm:op=\E[39;49m: # Attribute control for ECMA-48-compatible terminals ecma+sgr|attribute capabilities for true ECMA-48 terminals:\ :se=\E[27m:ue=\E[24m:\ :tc=klone+sgr: # For comparison, here are all the capabilities implied by the Intel # Binary Compatibility Standard (level 2) that fit within terminfo. # For more detail on this rather pathetic standard, see the comments # near the end of this file. ibcs2|Intel Binary Compatibility Standard prescriptions:\ :AL=\E[%dL:DC=\E[%dP:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:\ :RA=\E[?7l:RI=\E[%dC:S1=\E=%p1%dg:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:bt=\E[Z:ch=\E[%i%dG:cl=\Ec:\ :cm=\E[%i%d;%dH:ct=\E[g:cv=\E[%i%dd:ec=\E[%dX:ei=:im=:\ :rc=\E7:sc=\E7:st=\EH: #### ANSI/ECMA-48 terminals and terminal emulators # # See near the end of this file for details on ANSI conformance. # Don't mess with these entries! Lots of other entries depend on them! # # This section lists entries in a least-capable to most-capable order. # if you're in doubt about what `ANSI' matches yours, try them in that # order and back off from the first that breaks. ansi-mini|any ansi terminal with pessimistic assumptions:\ :am:bs:\ :co#80:it#8:li#24:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:do=\E[B:ho=\E[H:\ :le=\E[D:nd=\E[C:ta=^I:up=\E[A: # ANSI X3.64 from emory!mlhhh (Hugh Hansard) via BRL # # The following is an entry for the full ANSI 3.64 (1977). It lacks # padding, but most terminals using the standard are "fast" enough # not to require any -- even at 9600 bps. If you encounter problems, # try including the padding specifications. # # Note: the "as" and "ae" specifications are not implemented here, for # the available termcap documentation does not make clear WHICH alternate # character set to specify. ANSI 3.64 seems to make allowances for several. # Please make the appropriate adjustments to fit your needs -- that is # if you will be using alternate character sets. # # There are very few terminals running the full ANSI 3.64 standard, # so I could only test this entry on one verified terminal (Visual 102). # I would appreciate the results on other terminals sent to me. # # Please report comments, changes, and problems to: # # U.S. MAIL: Hugh Hansard # Box: 22830 # Emory University # Atlanta, GA. 30322. # # USENET {akgua,msdc,sb1,sb6,gatech}!emory!mlhhh. # ansi77|ansi 3.64 standard 1977 version:\ :am:bs:mi:\ :co#80:it#8:li#24:\ :al=5*\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=5*\E[M:\ :do=\E[B:ei=\E[4l:ho=\E[H:im=\E[4h:k1=\EOP:k2=\EOR:k4=\EOS:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :nd=\E[C:nw=^M\ED:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # Procomm and some other ANSI emulations don't recognize all of the ANSI- # standard capabilities. This entry deletes :UP:, :RI:, :DO:, :LE:, and # / capabilities, forcing curses to use repetitions of :up:, # :nd:, :do: and :le:. Also deleted :IC: and :ic:, as QModem up to # 5.03 doesn't recognize these. Finally, we delete :rp: and :sr:, which seem # to confuse many emulators. On the other hand, we can count on these programs # doing :ae:/:as:/:sa:. Older versions of this entry featured # , but now seems to be more common under # ANSI.SYS influence. # From: Eric S. Raymond Oct 30 1995 pcansi-m|pcansi-mono|ibm-pc terminal programs claiming to be ansi (mono mode):\ :am:bs:mi:ms:\ :co#80:it#8:li#24:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:ct=\E[2g:dc=\E[P:dl=\E[M:do=\E[B:\ :ho=\E[H:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=\E[D:nd=\E[C:sf=^J:st=\EH:ta=^I:up=\E[A:\ :tc=klone+sgr-dumb: pcansi-25-m|pcansi25m|ibm-pc terminal programs with 25 lines (mono mode):\ :li#25:tc=pcansi-m: pcansi-33-m|pcansi33m|ibm-pc terminal programs with 33 lines (mono mode):\ :li#33:tc=pcansi-m: pcansi-43-m|ansi43m|ibm-pc terminal programs with 43 lines (mono mode):\ :li#43:tc=pcansi-m: # The color versions. All PC emulators do color... pcansi|ibm-pc terminal programs claiming to be ansi:\ :tc=klone+color:tc=pcansi-m: pcansi-25|pcansi25|ibm-pc terminal programs with 25 lines:\ :li#25:tc=pcansi: pcansi-33|pcansi33|ibm-pc terminal programs with 33 lines:\ :li#33:tc=pcansi: pcansi-43|pcansi43|ibm-pc terminal programs with 43 lines:\ :li#43:tc=pcansi: # ansi-m -- full ANSI X3.64 with ANSI.SYS-compatible attributes, no color. # If you want pound signs rather than dollars, replace `B' with `A' # in the , , , and capabilities. # From: Eric S. Raymond Nov 6 1995 ansi-m|ansi-mono|ANSI X3.64-1979 terminal with ANSI.SYS compatible attributes:\ :5i:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :cb=\E[1K:ch=\E[%i%dG:ct=\E[2g:cv=\E[%i%dd:ec=\E[%dX:ei=:\ :im=:kB=\E[Z:kI=\E[L:kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:\ :nw=\r\E[S:pf=\E[4i:po=\E[5i:..rp=%p1%c\E[%p2%{1}%-%db:\ :s0=\E(B:s1=\E)B:s2=\E*B:s3=\E+B:ta=\E[I:\ :tc=pcansi-m: # ansi -- this terminfo expresses the largest subset of X3.64 that will fit in # standard terminfo. Assumes ANSI.SYS-compatible attributes and color. # From: Eric S. Raymond Nov 6 1995 ansi|ansi/pc-term compatible with color:\ :u6=\E[%i%d;%dR:u7=\E[6n:..u8=\E[?%[;0123456789]c:\ :u9=\E[c:\ :tc=ecma+color:tc=klone+sgr:tc=ansi-m: # # ANSI.SYS entries # # This completely describes the sequences specified in the DOS 2.1 ANSI.SYS # documentation (except for the keyboard key reassignment feature, which # doen't fit the model well). The klone+acs sequences were valid # though undocumented. The capability is untested but should work for # keys F1-F10 (%p1 values outside this range will yield unpredictable results). # From: Eric S. Raymond Nov 7 1995 ansi.sys-old|ANSI.SYS under PC-DOS 2.1:\ :am:bs:mi:ms:xo:\ :co#80:li#25:\ :RA=\E[?7l:SA=\E[?7h:ce=\E[k:cl=\E[2J:cm=\E[%i%d;%dH:\ :do=\E[B:ho=\E[H:is=\E[m\E[?7h:kd=^J:kh=^^:kl=^H:kr=^L:\ :ku=^K:le=^H:nd=\E[C:pk=\E[0;%+:;"%s":rc=\E[u:sc=\E[s:\ :u6=\E[%i%d;%dR:u7=\E[6n:up=\E[A:\ :tc=klone+color:tc=klone+sgr: ansi.sys|ANSI.SYS 3.1 and later versions:\ :ce=\E[K:tc=ansi.sys-old: # # Define IBM PC keypad keys for vi as per MS-Kermit while using ANSI.SYS. # This should only be used when the terminal emulator cannot redefine the keys. # Since redefining keys with ansi.sys also affects PC-DOS programs, the key # definitions must be restored. If the terminal emulator is quit while in vi # or others using :ks:/:ke:, the keypad will not be defined as per PC-DOS. # The PgUp and PgDn are prefixed with ESC so that tn3270 can be used on Unix # (^U and ^D are already defined for tn3270). The ESC is safe for vi but it # does "beep". ESC ESC i is used for Ins to avoid tn3270 ESC i for coltab. # Note that :kl: is always BS, because PC-dos can tolerate this change. # Caution: vi is limited to 256 string bytes, longer crashes or weirds out vi. # Consequently the End keypad key could not be set (it is relatively safe and # actually useful because it sends ^@ O, which beeps and opens a line above). ansi.sysk|ansisysk|PC-DOS 3.1 ANSI.SYS with keypad redefined for vi:\ :is=U2 PC-DOS 3.1 ANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:\ :ke=\E[;71;0;71p\E[;72;0;72p\E[;73;0;73p\E[;77;0;77p\E[;80;0;80p\E[;81;0;81p\E[;82;0;82p\E[;83;0;83p:\ :ks=\E[;71;30p\E[;72;11p\E[;73;27;21p\E[;77;12p\E[;80;10p\E[;81;27;4p\E[;82;27;27;105p\E[;83;127p:\ :tc=ansi.sys: # # Adds ins/del line/character, hence vi reverse scrolls/inserts/deletes nicer. nansi.sys|nansisys|PC-DOS Public Domain NANSI.SYS:\ :al=\E[1L:dc=\E[1P:dl=\E[1M:ei=:ic=\E[1@:im=:\ :is=U3 PC-DOS Public Domain NANSI.SYS 9-23-86\n:tc=ansi.sys: # # See ansi.sysk and nansi.sys above. nansi.sysk|nansisysk|PC-DOS Public Domain NANSI.SYS with keypad redefined for vi:\ :al=\E[1L:dc=\E[1P:dl=\E[1M:ei=:ic=\E[1@:im=:\ :is=U4 PC-DOS Public Domain NANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:tc=ansi.sysk: #### ANSI console types # # This entry is good for the 1.2.13 version of the Linux console driver. # # Note: there are numerous broken linux entries out there, which didn't screw # up BSD termcap but hose ncurses's smarter cursor-movement optimization. # One common pathology is an incorrect tab length of 4. # # *************************************************************************** # * * # * WARNING: * # * Linuxes come with a default keyboard mapping kcbt=^I. This entry, in * # * response to user requests, assumes kcbt=\E[Z, the ANSI/ECMA reverse-tab * # * character. Here are the keymap replacement lines that will set this up: * # * * # keycode 15 = Tab Tab # alt keycode 15 = Meta_Tab # shift keycode 15 = F26 # string F26 ="\033[Z" # * * # * This has to use a key slot which is unfortunate (any unused one will * # # do, F26 is the higher-numbered one). The change ought to be built * # * into the kernel tables. * # * * # *************************************************************************** # # The 1.3.x kernels add color-change capabilities; if yours doesn't have this # and it matters, turn off . The %02x escape used to implement this is # not back-portable to SV curses and not supported in ncurses versions before # 1.9.9. All linux kernels since 1.2.13 (at least) set the screen size # themselves; this entry assumes that capability. # # From: Eric S. Raymond 20 Jun 1997 linux|linux console:\ :am:eo:mi:ms:ut:xn:xo:\ :it#8:\ :&7=^Z:@7=\E[4~:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:F1=\E[23~:\ :F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:F6=\E[29~:\ :F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:IC=\E[%d@:\ :K2=\E[G:al=\E[L:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :ch=\E[%i%dG:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:cv=\E[%i%dd:dc=\E[P:dl=\E[M:\ :do=^J:ec=\E[%dX:ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:\ :k1=\E[[A:k2=\E[[B:k3=\E[[C:k4=\E[[D:k5=\E[[E:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kB=\E[Z:kD=\E[3~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:kd=\E[B:kh=\E[1~:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :nw=^M^J:r1=\Ec:rc=\E8:\ :..sa=\E[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p5%t;2%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m:\ :sc=\E7:se=\E[27m:sf=^J:sr=\EM:st=\EH:ta=^I:u6=\E[%i%d;%dR:\ :u7=\E[6n:u8=\E[?6c:u9=\E[c:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:\ :tc=klone+sgr:tc=ecma+color: linux-m|Linux console no color:\ :Co@:pa@:\ :AB@:AF@:Sb@:Sf@:tc=linux: linux-c-nc|linux console 1.3.x hack for ncurses only:\ :cc:\ :..Ic=\E]P%p1%x%p2%02x%p3%02x%p4%02x:oc=\E]R:tc=linux: # From: Dennis Henriksen , 9 July 1996 linux-c|linux console 1.3.6+ with private palette for each virtual console:\ :cc:\ :Co#8:pa#64:\ :..Ic=\E]P%?%p1%{9}%>%t%p1%{10}%-%p'a'%+%c%e%p1%d%p2%{255}%&%Pr%gr%{16}%/%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%gr%{15}%&%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%p3%{255}%&%Pr%gr%{16}%/%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%gr%{15}%&%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%p4%{255}%&%Pr%gr%{16}%/%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;%gr%{15}%&%Px%?%gx%{9}%>%t%gx%{10}%-%'A'%+%c%e%gx%d%;:\ :oc=\E]R:\ :tc=linux: # See the note on ICH/ICH1 VERSUS RMIR/SMIR near the end of file linux-nic|linux with ich/ich1 suppressed for non-curses programs:\ :IC@:ei=:ic@:im=:\ :tc=linux: # This assumes you have used setfont(8) to load one of the Linux koi8-r fonts. linux-koi8|linux with koi8 alternate character set:\ :tc=linux:tc=klone+koi8acs: # SCO console and SOS-Syscons console for 386bsd # (scoansi: had unknown capabilities # :Gc=N:Gd=K:Gh=M:Gl=L:Gu=J:Gv=\072:\ # :GC=E:GD=B:GH=D:GL=\64:GU=A:GV=\63:GR=C: # :G1=?:G2=Z:G3=@:G4=Y:G5=;:G6=I:G7=H:G8=<:\ # :CW=\E[M:NU=\E[N:RF=\E[O:RC=\E[P:\ # :WL=\E[S:WR=\E[T:CL=\E[U:CR=\E[V:\ # I renamed GS/GE/HM/EN/PU/PD/RT and added klone+sgr-dumb, based # on the :as:=\E[12m -- esr) scoansi|SCO Extended ANSI standard crt:\ :am:bs:eo:xo:\ :co#80:it#8:li#25:\ :@7=\E[F:al=\E[L:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[@:im=:k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:k5=\E[Q:\ :k6=\E[R:k7=\E[S:k8=\E[T:k9=\E[U:k;=\E[V:kN=\E[G:kP=\E[I:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:\ :mb=\E[5m:md=\E[1m:nd=\E[C:sf=\E[S:sr=\E[T:ta=^I:up=\E[A:\ :tc=klone+sgr-dumb: # This actually describes the generic SVr4 display driver for Intel boxes. # The :mh=\E[2m: isn't documented and therefore may not be reliable. # From: Eric Raymond Mon Nov 27 19:00:53 EST 1995 att6386|at386|386at|AT&T WGS 6386 console:\ :am:bw:eo:xo:\ :co#80:it#8:li#25:\ :@7=\E[Y:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\EOZ:\ :F2=\EOA:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=``a1fxgqh0jYk?lZm@nEooppqDrrsstCu4vAwBx3yyzz{{||}}~~:\ :ae=\E[10m:al=\E[1L:as=\E[12m:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:ch=\E[%i%dG:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :ct=\E[2g:cv=\E[%i%dd:dc=\E[P:dl=\E[1M:do=\E[B:ec=\E[%dX:\ :ei=:ho=\E[H:ic=\E[1@:im=:is=\E[0;10;39m:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\EOT:k6=\EOU:k7=\EOV:k8=\EOW:k9=\EOX:\ :k;=\EOY:kB=^]:kD=\E[P:kI=\E[@:kM=\E0:kN=\E[U:kP=\E[V:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:\ :md=\E[1m:me=\E[0;10m:mh=\E[2m:mk=\E[9m:mr=\E[7m:nd=\E[C:\ :nw=\r\E[S:rc=\E8:\ :..sa=\E[10m\E[0%?%p1%p3%|%t;7%;%?%p2%t;4%;%?%p4%t;5%;%?%p5%t;2%;?%p6%t;1%;%?%p9%t;12%e;10%;%?%p7%t;9%;m:\ :sc=\E7:se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m:ve=\E[=1C:vi=\E[=C:\ :tc=klone+color: # (pc6300plus: removed ":KM=/usr/lib/ua/kmap.s5:"; renamed BO/EE/CI/CV -- esr) pc6300plus|AT&T 6300 plus:\ :am:bs:xo:\ :co#80:li#24:\ :al=\E[1L:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[2J\E[H:\ :cm=\E[%i%2;%2H:cr=^M:ct=\E[3g:dc=\E[1P:dl=\E[1M:do=\E[B:\ :ei=:ho=\E[H:ic=\E[1@:im=:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:\ :k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:k9=\EOk:k;=\EOu:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mh=\E[2m:mk=\E[9m:mr=\E[7m:nd=\E[C:nw=^M^J:\ :se=\E[m:sf=^J:so=\E[7m:st=\EH:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[=1C:vi=\E[=C: # : # Entry for the DNARD OpenFirmware console, close to ANSI but not quite. # # (still unfinished, but good enough so far.) ofcons:\ :bs:bw:co#80:li#30:\ :ku=\233A:kd=\233B:kr=\233C:kl=\233D:kb=^H:kD=\233P:\ :k1=\2330P:k2=\2330Q:k3=\2330W:k4=\2330x:k5=\2330t:k6=\2330u:\ :k7=\2330q:k8=\2330r:k9=\2330p:k;=\2330M:\ :kN=\233/:kP=\233?:\ :mb=\2337;2m:se=\2330m:ue=\2330m:\ :md=\2331m:me=\2330m:mh=\2332m:mk=\2338m:mr=\2337m:\ :..sa=\2330%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :UP=\233%dA:DO=\233%dB:RI=\233%dC:LE=\233%dD:\ :DC=\233%dP:IC=\233%d@:dc=\233P:ic=\233@:\ :DL=\233%dM:dl=\233M:AL=\233%dL:al=\233L:\ :le=\233D:nd=\233C:do=\233B:up=\233A:\ :cl=^L:cr=^M:ta=^I:bl=^G:vb=^G:\ :cm=\233%i%d;%dH:cd=\233J:ce=\233K: # # Terminfo entry for the AT&T Unix PC 7300 # from escape(7) in Unix PC 7300 Manual. # Somewhat similar to a vt100-am (but different enough # to redo this from scratch.) # # /*************************************************************** # * # * FONT LOADING PROGRAM FOR THE UNIX PC # * # * This routine loads a font defined in the file ALTFONT # * into font memory slot #1. Once the font has been loaded, # * it can be used as an alternative character set. # * # * The call to ioctl with the argument WIOCLFONT is the key # * to this routine. For more information, see window(7) in # * the PC 7300 documentation. # ***************************************************************/ # #include /* needed for strcpy call */ # #include /* needed for ioctl call */ # #define FNSIZE 60 /* font name size */ # #define ALTFONT "/usr/lib/wfont/special.8.ft" /* font file */ # /* # * The file /usr/lib/wfont/special.8.ft comes with the # * standard PC software. It defines a graphics character set # * similar to that of the Teletype 5425 terminal. To view # * this or other fonts in /usr/lib/wfont, use the command # * cfont . For further information on fonts see # * cfont(1) in the PC 7300 documentation. # */ # # struct altfdata /* structure for alt font data */ # { # short altf_slot; /* memory slot number */ # char altf_name[FNSIZE]; /* font name (file name) */ # }; # ldfont() # { # int wd; /* window in which altfont will be */ # struct altfdata altf; # altf.altf_slot=1; # strcpy(altf.altf_name,ALTFONT); # for (wd =1; wd < 12; wd++) { # ioctl(wd, WIOCLFONT,&altf); # } # } # # (att7300: added :vi:/:ve:/:ic:/ from the BSDI entry, # they're confirmed by the man page for the System V display---esr) # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att7300|unixpc|pc7300|3b1|s4|AT&T UNIX PC Model 7300:\ :am:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:bt=\E^I:\ :cd=\E[0J:ce=\E[0K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:i1=^O:ic=\E[@:im=:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E5:k6=\E6:k7=\E7:\ :k8=\E8:kD=\Edc:kI=\Eim:kN=\Epg:kP=\EPG:kb=^H:kd=\E[B:\ :kh=\Ehm:kl=\E[D:kr=\E[C:ku=\E[A:md=\E[7m:me=\E[0;10m:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:se=\E[m:sf=^J:so=\E[7m:\ :sr=\EM:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[=1C:vi=\E[=C: # From: Stefan Stapelberg , 24 Feb 1997 # (iris-ansi: added rmam/smam based on init string -- esr) iris-ansi|IRIS emulating 40 line ANSI terminal (almost VT100):\ :am:\ :co#80:it#8:li#40:\ :!2=\E[218q:#2=\E[143q:#4=\E[158q:%9=\E[209q:%f=\E[210q:\ :%i=\E[167q:&7=\E[217q:*4=\E[P:*7=\E[147q:@7=\E[146q:\ :@8=^M:AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:F1=\EOR:F2=\EOS:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :al=\E[L:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:dl=\E[M:do=^J:ho=\E[H:\ :is=\E[?1l\E>\E[?7h\E[100g\E[0m\E7\E[r\E8:k1=\E[001q:\ :k2=\E[002q:k3=\E[003q:k4=\E[004q:k5=\E[005q:k6=\E[006q:\ :k7=\E[007q:k8=\E[008q:k9=\EOP:k;=\EOQ:kB=\E[Z:kD=\177:\ :kI=\E[139q:kM=\E[146q:kN=\E[154q:kP=\E[150q:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:pk=\EP101;%d.y%s\E\:\ :rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[1;7m:sr=\EM:st=\EH:\ :ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[9/y\E[12/y\E[=6l:\ :vs=\E[10/y\E[=1h\E[=2l\E[=6h: iris-ansi-ap|IRIS ANSI in application-keypad mode:\ :F1=\E[011q:F2=\E[012q:is=\E[?1l\E>\E[?7h:k;=\E[010q:\ :ke=\E>:ks=\E=:\ :tc=iris-ansi: # The following is a version of the ibm-pc entry distributed with PC/IX, # (Interactive Systems' System 3 for the Big Blue), modified by Richard # McIntosh at UCB/CSM. The :pt: and :uc: have been removed from the original, # (the former is untrue, and the latter failed under UCB/man); standout and # underline modes have been added. Note: this entry describes the "native" # capabilities of the PC monochrome display, without ANY emulation; most # communications packages (but NOT PC/IX connect) do some kind of emulation. pcix|PC/IX console:\ :am:bw:eo:\ :co#80:li#24:\ :cd=\E[J:ce=\E[K:cl=\Ec:cm=\E[%i%2;%2H:do=\E[B:ho=\E[H:\ :le=^H:me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:ue=\E[m:up=\E[A:\ :us=\E[4m: # (ibmpcx: this entry used to be known as ibmx. # It formerly included the following extension capabilities: # :GC=b:GL=v:GR=t:RT=^J:\ # :GH=\E[196g:GV=\E[179g:\ # :GU=\E[193g:GD=\E[194g:\ # :G1=\E[191g:G2=\E[218g:G3=\E[192g:G4=\E[217g:\ # :CW=\E[E:NU=\E[F:RF=\E[G:RC=\E[H:\ # :WL=\E[K:WR=\E[L:CL=\E[M:CR=\E[N:\ # I renamed GS/GE/WL/WR/CL/CR/PU/PD/HM/EN; also, removed a duplicate # ":kh=\E[Y:". Added IBM-PC forms characters and highlights, they match # what was there before. -- esr) ibmpcx|xenix|ibmx|IBM PC xenix console display:\ :am:bs:ms:\ :co#80:li#25:\ :@7=\E[d:al=\E[L:cd=\E[J:ce=\E[K:cl=^L:cm=\E[%d;%dH:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:k1=\E[K:\ :k2=\E[L:k3=\E[M:k4=\E[N:kN=\E[e:kP=\E[Z:kb=^H:kd=\E[B:\ :kh=\E[Y:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:nd=\E[C:up=\E[A:\ :tc=klone+acs:tc=klone+sgr: # QNX 4.0 Console # Michael's original version of this entry had , :ti=\Ei:, # :te=\Eh\ER:; this was so terminfo applications could write the lower # right corner without triggering a scroll. The ncurses terminfo library can # handle this case with the :ic: capability, and prefers :am: for better # optimization. Bug: The capability resets attributes. # From: Michael Hunter 30 Jul 1996 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) qnx|qnx4|qnx console:\ :km:mi:ms:xt:\ :co#80:it#4:li#25:\ :al=\EE:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:\ :dc=\Ef:dl=\EF:do=^J:ei=:ho=\EH:ic=\Ee:im=:k1=\377\201:\ :k2=\377\202:k3=\377\203:k4=\377\204:k5=\377\205:\ :k6=\377\206:k7=\377\207:k8=\377\210:k9=\377\211:\ :kD=\377\254:kI=\377\253:kN=\377\252:kP=\377\242:\ :kd=\377\251:kh=\377\240:kl=\377\244:kr=\377\246:\ :ku=\377\241:le=^H:mb=\E{:md=\E<:me=\E}\E]\E>\E):mr=\E(:\ :nd=\EC:rp=\Eg%r%+ %.:se=\E):sf=^J:so=\E(:sr=\EI:ta=^I:\ :te=\Eh\ER:ti=\Ei:ue=\E]:up=\EA:us=\E[:ve=\Ey1:vi=\Ey0:\ :vs=\Ey2: #### NetBSD consoles # # pcvt termcap database entries (corresponding to release 3.31) # Author's last edit-date: [Fri Sep 15 20:29:10 1995] # # (For the terminfo master file, I translated these into terminfo syntax. # Then I dropped all the pseudo-HP entries. we don't want and can't use # the :Xs: flag. Then I split :is: into a size-independent :i1: and a # size-dependent :is:. Finally, I added / -- esr) # NOTE: because the 386BSD "vi"/"elvis" seems to have a bug if # both :ic: and :im: are specified (an original VT220 # shows the same buggy behaviour!), :ic: has been taken # out of this entry. for reference, it should be . pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=llmmkkjjuuttvvwwqqxxnnoosspprr``aaffgg~~..--++\054\054hhII00yyzz:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:\ :ve=\E[?25h:vi=\E[?25l: # NetBSD/FreeBSD vt220 terminal emulator console (pc keyboard & monitor) # termcap entries for pure VT220-Emulation and 25, 28, 35, 40, 43 and # 50 lines entries; 80 columns pcvt25|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: # NetBSD/FreeBSD vt220 terminal emulator console (pc keyboard & monitor) # termcap entries for pure VT220-Emulation and 25, 28, 35, 40, 43 and # 50 lines entries; 132 columns pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: # NetBSD/x68k console vt200 emulator. This port runs on a 68K machine # manufactured by Sharp for the Japenese market. # From Minoura Makoto , 12 May 1996 x68k|x68k-ite|NetBSD/x68k ITE:\ :co#96:li#32:\ :%1=\E[28~:kC=\E[9~:tc=vt220: #### FreeBSD console entries # # From: Andrey Chernov 29 Mar 1996 # Andrey Chernov maintains the FreeBSD termcap distributions. # # Note: Users of FreeBSD 2.1.0 and older versions must either upgrade # or comment out the :cb: capability in the console entry. # # Alexander Lukyanov reports: # I have seen FreeBSD-2.1.5R... The old el1 bug changed, but it is still there. # Now el1 clears not only to the line beginning, but also a large chunk # of previous line. But there is another bug - ech does not work at all. # (Accordingly, :ec:=\E[%p1%dX and =\E[1K have been removed.) # # for syscons # common entry without semigraphics # Bug: The capability resets attributes. cons25w|ansiw|ansi80x25-raw|freebsd console (25-line raw mode):\ :NP:am:bw:eo:ms:ut:\ :Co#8:co#80:it#8:li#25:pa#64:\ :@7=\E[F:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[W:\ :F2=\E[X:IC=\E[%d@:K2=\E[E:LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:\ :SR=\E[%dT:Sb=\E[4%dm:Sf=\E[3%dm:UP=\E[%dA:al=\E[L:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%i%d`:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cv=\E[%i%dd:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=:ho=\E[H:ic=\E[@:im=:k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:\ :k5=\E[Q:k6=\E[R:k7=\E[S:k8=\E[T:k9=\E[U:k;=\E[V:kB=\E[Z:\ :kD=\177:kI=\E[L:kN=\E[G:kP=\E[I:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mh=\E[30;1m:mr=\E[7m:nd=\E[C:nw=\E[E:op=\E[x:\ :r1=\E[x\E[m\Ec:se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:\ :up=\E[A: cons25|ansis|ansi80x25|freebsd console (25-line ansi mode):\ :ac=l\332m\300k\277j\331u\264t\303v\301w\302q\304x\263n\305`\004a\260f\370g\361~\371.\031-\030h\261I^U0\333y\363z\362:\ :tc=cons25w: cons25-m|ansis-mono|ansi80x25-mono|freebsd console (25-line mono ansi mode):\ :Co@:pa@:\ :Sb@:Sf@:md@:mh@:op@:ue=\E[m:us=\E[4m:tc=cons25: cons30|ansi80x30|freebsd console (30-line ansi mode):\ :li#30:tc=cons25: cons30-m|ansi80x30-mono|freebsd console (30-line mono ansi mode):\ :li#30:tc=cons25-m: cons43|ansi80x43|freebsd console (43-line ansi mode):\ :li#43:tc=cons25: cons43-m|ansi80x43-mono|freebsd console (43-line mono ansi mode):\ :li#43:tc=cons25-m: cons50|ansil|ansi80x50|freebsd console (50-line ansi mode):\ :li#50:tc=cons25: cons50-m|ansil-mono|ansi80x50-mono|freebsd console (50-line mono ansi mode):\ :li#50:tc=cons25-m: cons60|ansi80x60|freebsd console (60-line ansi mode):\ :li#60:tc=cons25: cons60-m|ansi80x60-mono|freebsd console (60-line mono ansi mode):\ :li#60:tc=cons25-m: cons25r|pc3r|ibmpc3r|cons25-koi8-r|freebsd console w/koi8-r cyrillic:\ :ac=q\200x\201m\204v\211j\205t\206n\212u\207l\202w\210k\203y\230z\231f\234~\225a\220h\221`\004.\031-\030I^U0\215:\ :tc=cons25w: cons25r-m|pc3r-m|ibmpc3r-mono|cons25-koi8r-m|freebsd console w/koi8-r cyrillic (mono):\ :Co@:pa@:\ :Sb@:Sf@:op@:ue=\E[m:us=\E[4m:tc=cons25r: cons50r|cons50-koi8r|freebsd console w/koi8-r cyrillic (50 lines):\ :li#50:tc=cons25r: cons50r-m|cons50-koi8r-m|freebsd console w/koi8-r cyrillic (50-line mono):\ :li#50:tc=cons25r-m: cons60r|cons60-koi8r|freebsd console w/koi8-r cyrillic (60 lines):\ :li#60:tc=cons25r: cons60r-m|cons60-koi8r-m|freebsd console w/koi8-r cyrillic (60-line mono):\ :li#60:tc=cons25r-m: # ISO 8859-1 FreeBSD console cons25l1|cons25-iso8859|freebsd console w/iso 8859-1 chars:\ :ac=l\215m\216k\214j\213u\226t\225v\227w\230q\222x\231n\217o\220s\224p\221r\223`\201a\202f\207g\210~\237.\031-\030+\253\054\273I\247y\232z\233:\ :tc=cons25w: cons25l1-m|cons25-iso-m|freebsd console w/iso 8859-1 chars (mono):\ :Co@:pa@:\ :Sb@:Sf@:md@:mh@:op@:ue=\E[m:us=\E[4m:tc=cons25l1: cons50l1|cons50-iso8859|freebsd console w/iso 8859-1 chars (50 lines):\ :li#50:tc=cons25l1: cons50l1-m|cons50-iso-m|freebsd console w/iso 8859-1 chars (50-line mono):\ :li#50:tc=cons25l1-m: cons60l1|cons60-iso|freebsd console w/iso 8859-1 chars (60 lines):\ :li#60:tc=cons25l1: cons60l1-m|cons60-iso-m|freebsd console w/iso 8859-1 chars (60-line mono):\ :li#60:tc=cons25l1-m: #### 386BSD and BSD/OS Consoles # # This was the original 386BSD console entry (I think). # Some places it's named oldpc3|oldibmpc3. # From: Alex R.N. Wetmore origpc3|origibmpc3|IBM PC 386BSD Console:\ :am:bs:bw:eo:xo:\ :co#80:li#25:\ :ac=l\332q\304k\277x\263j\331m\300w\302u\264v\301t\303n\305:\ :cd=\E[J:ce=\E[K:cl=\Ec:cm=\E[%i%2;%2H:do=\E[B:ho=\E[H:\ :kd=\E[B:kh=\E[Y:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[7m:\ :me=\E[m\E[1;0x\E[2;7x:nd=\E[C:se=\E[1;0x\E[2;7x:\ :sf=\E[S:so=\E[1;7x\E[2;0x:sr=\E[T:ue=\E[1;0x\E[2;7x:\ :up=\E[A:us=\E[1;7x\E[2;0x: # description of BSD/386 console emulator in version 1.0 (supplied by BSDI) oldpc3|oldibmpc3|old IBM PC BSD/386 Console:\ :bs:km:\ :li#25:\ :al=\E[L:bl=^G:cr=^M:dl=\E[M:do=^J:kH=\E[F:kI=\E[L:kN=\E[G:\ :kP=\E[I:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :md=\E[=15F:me=\E[=R:mh=\E[=8F:nw=^M^J:sf=^J:ta=^I: # Description of BSD/OS console emulator in version 1.1, 2.0, 2.1 # Note, the emulator supports many of the additional console features # listed in the iBCS2 (e.g. character-set selection) though not all # are described here. This entry really ought to be upgraded. # Also note, the console will also work with fewer lines after doing # "stty rows NN", e.g. to use 24 lines. # (Color support from Kevin Rosenberg , 2 May 1996) # Bug: The capability resets attributes. bsdos|BSD/OS console:\ :am:bs:bw:eo:km:xo:\ :Co#8:co#80:it#8:li#25:pa#64:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :Sb=\E[4%dm:Sf=\E[3%dm:UP=\E[%dA:al=\E[L:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\Ec:cm=\E[%i%d;%dH:cr=^M:dl=\E[M:do=^J:ho=\E[H:\ :kH=\E[F:kI=\E[L:kN=\E[G:kP=\E[I:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:\ :mh=\E[=8F:mr=\E[7m:nd=\E[C:nw=^M^J:op=\E[x:rc=\E8:sc=\E7:\ :se=\E[0m:sf=^J:so=\E[7m:ta=^I:up=\E[A: bsdos-bold|IBM PC BSD/386 Console with bold instead of underline:\ :ue=\E[0m:us=\E[1m:\ :tc=bsdos: # If you are BSDI, you want the following entries, for the moment. # In release 2.0 they will probably phase out the pc3 and ibmpc3 names pc3|IBM PC BSD/386 Console:\ :mh@:tc=bsdos: ibmpc3|pc3-bold|IBM PC BSD/386 Console with bold instead of underline:\ :us=\E[1m:\ :tc=bsdos-bold: #### DEC VT100 and compatibles # # DEC terminals from the vt100 forward (and the vt52, way obsolete but still # the basis of some emulations) are collected here. Older DEC terminals and # micro consoles can be found in the `obsolete' section. More details on # the relationship between the VT100 and ANSI X3.64/ISO 6429/ECMA-48 may be # found near the end of this file. # # Except where noted, these entries are DEC's official terminfos. # Contact Bill Hedberg of Terminal Support # Engineering for more information. Updated terminfos and termcaps # are kept available at ftp://gatekeeper.dec.com/pub/DEC/termcaps. # # In October 1995 DEC sold its terminals business, including the VT and Dorio # line and trademark, to SunRiver Data Systems. SunRiver has since changed # its name to Boundless Technologies; see http://www.boundless.com. # # (The , :ae:, and :as: capabilities aren't in DEC's official # entry -- esr) vt52|dec vt52:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:do=\EB:ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\ED:nd=\EC:nw=^M^J:sf=^J:sr=\EI:ta=^I:up=\EA: # NOTE: Any VT100 emulation, whether in hardware or software, almost # certainly includes what DEC called the `Level 1 editing extension' codes; # only the very oldest VT100s lacked these and there probably aren't any of # those left alive. To capture these, use one of the VT102 entries. # # Note that the :xn: glitch in vt100 is not quite the same as on the Concept, # since the cursor is left in a different position while in the # weird state (concept at beginning of next line, vt100 at end # of this line) so all versions of vi before 3.7 don't handle # :xn: right on vt100. The correct way to handle :xn: is when # you output the char in column 80, immediately output CR LF # and then assume you are in column 1 of the next line. If :xn: # is on, am should be on too. # # I assume you have smooth scroll off or are at a slow enough baud # rate that it doesn't matter (1200? or less). Also this assumes # that you set auto-nl to "on", if you set it off use vt100-nam # below. # # The padding requirements listed here are guesses. It is strongly # recommended that xon/xoff be enabled, as this is assumed here. # # The vt100 uses and rather than :is:/:ct:/:st: because the # tab settings are in non-volatile memory and don't need to be # reset upon login. Also setting the number of columns glitches # the screen annoyingly. You can type "reset" to get them set. # # Here's a diagram of the VT100 keypad keys with their bindings. # The top line is the name of the key (some DEC keyboards have the keys # labelled somewhat differently, like GOLD instead of PF1, but this is # the most "official" name). The second line is the escape sequence it # generates in Application Keypad mode (where "$" means the ESC # character). The third line contains two items, first the mapping of # the key in terminfo, and then in termcap. # _______________________________________ # | PF1 | PF2 | PF3 | PF4 | # | $OP | $OQ | $OR | $OS | # |_kf1__k1_|_kf2__k2_|_kf3__k3_|_kf4__k4_| # | 7 8 9 - | # | $Ow | $Ox | $Oy | $Om | # |_kf9__k9_|_kf10_k;_|_kf0__k0_|_________| # | 4 | 5 | 6 | , | # | $Ot | $Ou | $Ov | $Ol | # |_kf5__k5_|_kf6__k6_|_kf7__k7_|_kf8__k8_| # | 1 | 2 | 3 | | # | $Oq | $Or | $Os | enter | # |_ka1__K1_|_kb2__K2_|_ka3__K3_| $OM | # | 0 | . | | # | $Op | $On | | # |___kc1_______K4____|_kc3__K5_|_kent_@8_| # # And here, for those of you with orphaned VT100s lacking documentation, is # a description of the soft switches invoked when you do `Set Up'. # # Scroll 0-Jump Shifted 3 0-# # | 1-Smooth | 1-British pound sign # | Autorepeat 0-Off | Wrap Around 0-Off # | | 1-On | | 1-On # | | Screen 0-Dark Bkg | | New Line 0-Off # | | | 1-Light Bkg | | | 1-On # | | | Cursor 0-Underline | | | Interlace 0-Off # | | | | 1-Block | | | | 1-On # | | | | | | | | # 1 1 0 1 1 1 1 1 0 1 0 0 0 0 1 0 <--Standard Settings # | | | | | | | | # | | | Auto XON/XOFF 0-Off | | | Power 0-60 Hz # | | | 1-On | | | 1-50 Hz # | | Ansi/VT52 0-VT52 | | Bits Per Char. 0-7 Bits # | | 1-ANSI | | 1-8 Bits # | Keyclick 0-Off | Parity 0-Off # | 1-On | 1-On # Margin Bell 0-Off Parity Sense 0-Odd # 1-On 1-Even # # The following SET-UP modes are assumed for normal operation: # ANSI_MODE AUTO_XON/XOFF_ON NEWLINE_OFF 80_COLUMNS # WRAP_AROUND_ON JUMP_SCROLL_OFF # Other SET-UP modes may be set for operator convenience or communication # requirements; I recommend # AUTOREPEAT_ON BLOCK_CURSOR MARGIN_BELL_OFF SHIFTED_3_# # Unless you have a graphics add-on such as Digital Engineering's VT640 # (and even then, whenever it can be arranged!) you should set # INTERLACE_OFF # # (I added / based on the init string, also :bs: -- esr) vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 no automargins:\ :am@:xn@:tc=vt100-am: # Ordinary vt100 in 132 column ("wide") mode. vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video no automargin):\ :co#132:li#14:vt@:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: # vt100 with no advanced video. vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:tc=vt100-nav: # vt100 with one of the 24 lines used as a status line. # We put the status line on the top. vt100-s|vt100-s-top|vt100-top-s|vt100 for use with top sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:is=\E7\E[2;24r\E8:\ :ts=\E7\E[1;%p1%dH\E[1K:\ :tc=vt100-am: # Status line at bottom. # Clearing the screen will clobber status line. vt100-s-bot|vt100-bot-s|vt100 for use with bottom sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%p1%dH\E[1K:\ :tc=vt100-am: # Most of the `vt100' emulators out there actually emulate a vt102 # This entry (or vt102-nsgr) is probably the right thing to use for # these. vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: vt102-w|dec vt102 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt102: # Many brain-dead PC comm programs that pretend to be `vt100-compatible' # fail to interpret the ^O and ^N escapes properly. Symptom: the :me: # string in the canonical vt100 entry above leaves the screen littered # with little snowflake or star characters (IBM PC ROM character \017 = ^O) # after highlight turnoffs. This entry should fix that, and even leave # ACS support working, at the cost of making multiple-highlight changes # slightly more expensive. # From: Eric S. Raymond July 22 1995 vt102-nsgr|vt102 no sgr (use if you see snowflakes after highlight changes):\ :me=\E[m:sa@:\ :tc=vt102: # VT125 Graphics CRT. Clear screen also erases graphics vt125|vt125 graphics terminal:\ :cl=\E[H\E[2J\EPpS(E)\E\:tc=vt100: # This isn't a DEC entry, it came from University of Wisconsin. # (vt131: I added / based on the init string, also :bs: -- esr) vt131|dec vt131:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[?7h:SA=\E[?7h:bl=^G:cd=50\E[J:ce=3\E[K:\ :cl=50\E[;H\E[2J:cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :do=^J:ho=\E[H:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:sc=\E7:\ :se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: # vt132 - like vt100 but slower and has ins/del line and such. # I'm told that :im:/:ei: are backwards in the terminal from the # manual and from the ANSI standard, this describes the actual # terminal. I've never actually used a vt132 myself, so this # is untested. # vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:tc=vt100: # vt220: # This vt220 description maps F5--F9 to the second block of function keys # at the top of the keyboard. The "DO" key is used as F10 to avoid conflict # with the key marked (ESC) on the vt220. See vt220d for an alternate mapping. # PF1--PF4 are used as F1--F4. # vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt220-w|vt200-w|DEC vt220 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt220: # # vt220d: # This vt220 description regards F6--F10 as the second block of function keys # at the top of the keyboard. This mapping follows the description given # in the VT220 Programmer Reference Manual and agrees with the labeling # on some terminals that emulate the vt220. There is no support for an F5. # See vt220 for an alternate mapping. # vt220d|DEC VT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:k5@:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :tc=vt220: vt220-nam|v200-nam|VT220 in vt100 mode with no auto margins:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt220-8|dec vt220 8 bit terminal:\ :am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:rc=\E8:sc=\E7:se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: # This was DEC's vt320. Use the purpose-built one below instead #vt320|DEC VT320 in vt100 emulation mode, # use=vt220, # vt220 termcap written Tue Oct 25 20:41:10 1988 by Alex Latzko # (not an official DEC entry!) # The problem with real vt220 terminals is they don't send escapes when in # in vt220 mode. This can be gotten around two ways. 1> don't send # escapes or 2> put the vt220 into vt100 mode and use all the nifty # features of vt100 advanced video which it then has. # # This entry takes the view of putting a vt220 into vt100 mode so # you can use the escape key in emacs and everything else which needs it. # # You probably don't want to use this on a VMS machine since VMS will think # it has a vt220 and will get fouled up coming out of emacs # # From: Alexander Latzko , 30 Dec 1996 vt200-js|vt220-js|dec vt200 series with jump scroll:\ :am:\ :co#80:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:dm=:do=^J:ed=:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[61"p\E[H\E[?3l\E[?4l\E[?1l\E[?5l\E[?6l\E[?7h\E[?8h\E[?25h\E>\E[m:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :nw=^M\ED:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :rf=/usr/lib/tabset/vt100:se=5\E[27m:sf=\ED:so=5\E[7m:\ :sr=\EM:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: # # Use v320n for SCO's LYRIX. Otherwise, use Adam Thompson's vt320-nam. # vt320nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: # These entries are not DEC's official ones, they were purpose-built for the # VT320. Here are the designer's notes: # is end on a PC kbd. Actually 'select' on a VT. Mapped to # 'Erase to End of Field'... since nothing seems to use 'end' anyways... # khome is Home on a PC kbd. Actually 'FIND' on a VT. # Things that use usually use tab anyways... and things that don't use # tab usually use instead... # kprv is same as tab - Backtab is useless... # I left out :sa: because of its RIDICULOUS complexity, # and the resulting fact that it causes the termcap translation of the entry # to SMASH the 1k-barrier... # From: Adam Thompson Sept 10 1995 # (vt320: uncommented :fs: --esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt320|vt300|dec vt320 7 bit terminal:\ :am:es:hs:mi:ms:xn:\ :co#80:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[1$}\E[H\E[K:ue=\E[m:\ :up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt320-nam|vt300-nam|dec vt320 7 bit terminal with no am to make SAS happy:\ :am@:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: # We have to init 132-col mode, not 80-col mode. vt320-w|vt300-w|dec vt320 wide 7 bit terminal:\ :co#132:ws#132:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w-nam|vt300-w-nam|dec vt320 wide 7 bit terminal with no am:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320-w: # VT330 and VT340 -- These are ReGIS and SIXEL graphics terminals # which are pretty much a superset of the VT320. They have the # host writable status line, yet another different DRCS matrix size, # and such, but they add the DEC Technical character set, Multiple text # pages, selectable length pages, and the like. The difference between # the vt330 and vt340 is that the latter has only 2 planes and a monochrome # monitor, the former has 4 planes and a color monitor. These terminals # support VT131 and ANSI block mode, but as with much of these things, # termcap/terminfo doesn't deal with these features. # # Note that this entry is are set up in what was the standard way for GNU # Emacs v18 terminal modes to deal with the cursor keys in that the arrow # keys were switched into application mode at the same time the numeric pad # is switched into application mode. This changes the definitions of the # arrow keys. Emacs v19 is smarter and mines its keys directly out of # your termcap or terminfo entry, # # From: Daniel Glasser , 13 Oct 1993 # (vt340: string capability "sb=\E[M" corrected to "sr"; # also, added / based on the init string -- esr) vt340|dec-vt340|vt330|dec-vt330|dec vt340 graphics terminal with 24 line page:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # DEC doesn't supply a vt400 description, so we add Daniel Glasser's # (originally written with vt420 as its primary name, and usable for it). # # VT400/420 -- This terminal is a superset of the vt320. It adds the multiple # text pages and long text pages with selectable length of the vt340, along # with left and right margins, rectangular area text copy, fill, and erase # operations, selected region character attribute change operations, # page memory and rectangle checksums, insert/delete column, reception # macros, and other features too numerous to remember right now. TERMCAP # can only take advantage of a few of these added features. # # Note that this entry is are set up in what was the standard way for GNU # Emacs v18 terminal modes to deal with the cursor keys in that the arrow # keys were switched into application mode at the same time the numeric pad # is switched into application mode. This changes the definitions of the # arrow keys. Emacs v19 is smarter and mines its keys directly out of # your termcap entry, # # From: Daniel Glasser , 13 Oct 1993 # (vt400: string capability ":sb=\E[M:" corrected to ":sr=\E[M:"; # also, added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt400|vt400-24|dec-vt400|dec vt400 24x80 column autowrap:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:\ :cd=10\E[J:ce=4\E[K:cl=10\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:fs=\E[$}:ho=\E[H:\ :ic=\E[@:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:rc=\E8:sc=\E7:se=\E[27m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # (vt420: I removed :k0:, it collided with . I also restored # a missing :sc: -- esr) vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: # # DECUDK # if (key < 16) then value = key; # else if (key < 21) then value = key + 1; # else if (key < 25) then value = key + 2; # else if (key < 27) then value = key + 3; # else if (key < 30) then value = key + 4; # else value = key + 5; # vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:F4=\E[12;2~:\ :F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:F8=\E[17;2~:\ :F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:FC=\E[21;2~:\ :FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:FG=\E[24~:FH=\E[25~:\ :FI=\E[26~:FJ=\E[28~:FK=\E[29~:FL=\E[31~:FM=\E[32~:\ :FN=\E[33~:FO=\E[34~:FP=\E[35~:FQ=\E[36~:FR=\E[23;2~:\ :FS=\E[24;2~:FT=\E[25;2~:FU=\E[26;2~:FV=\E[28;2~:\ :FW=\E[29;2~:FX=\E[31;2~:FY=\E[32;2~:FZ=\E[33;2~:\ :Fa=\E[34;2~:Fb=\E[35;2~:Fc=\E[36;2~:\ :S6=USR_TERM\072vt420pcdos\072:k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\177:kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\:tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p2%{19}%=%t\E\023\021%e%p2%{32}%<%t\E%p2%c%e%p2%{127}%=%t\E\177%e%p2%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[m:sa@:\ :tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=\177:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:\ :tc=vt420: vt510|DEC VT510:\ :tc=vt420: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: # VT520/VT525 # # The VT520 is a monochrome text terminal capable of managing up to # four independent sessions in the terminal. It has multiple ANSI # emulations (VT520, VT420, VT320, VT220, VT100, VT PCTerm, SCO Console) # and ASCII emulations (WY160/60, PCTerm, 50/50+, 150/120, TVI 950, # 925 910+, ADDS A2). This terminfo data is for the ANSI emulations only. # # Terminal Set-Up is entered by pressing [F3], [Caps Lock]/[F3] or # [Alt]/[Print Screen] depending upon which keyboard and which # terminal mode is being used. If Set-Up has been disabled or # assigned to an unknown key, Set-Up may be entered by pressing # [F3] as the first key after power up, regardless of keyboard type. # (vt520: I added / based on the init string, also :sc: -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:r3=\E[?67h\E[64;1"p:\ :rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # (vt525: I added / based on the init string; # removed :se:=\E[m, :ue:=\E[m, added :sc: -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:r3=\E[?67h\E[64;1"p:\ :rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: #### VT100 emulations # # John Hawkinson tells us that the EWAN telnet for Windows # (the best Windows telnet as of September 1995) presents the name `dec-vt100' # to telnetd. Michael Deutschmann informs us # that this works best with a stock vt100 entry. dec-vt100|EWAN telnet's vt100 emulation:\ :tc=vt100: # From: Adrian Garside <94ajg2@eng.cam.ac.uk>, 19 Nov 1996 dec-vt220|DOS tnvt200 terminal emulator:\ :am@:tc=vt220: # Zstem340 is an (IMHO) excellent VT emulator for PC's. I recommend it to # anyone who needs PC VT340 emulation. (or anything below that level, for # that matter -- DEC's ALL-in-1 seems happy with it, as does INFOPLUS's # RDBM systems, it includes ReGIS and SiXel support! I'm impressed... # I can send the address if requested. # (z340: changed garbled \E[5?l to \E[?5l, DEC smooth scroll off -- esr) # From: Adam Thompson Sept 10 1995 z340|zstem vt340 terminal emulator 132col 42line:\ :li#42:\ :is=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h\E[1;42r\E[42;1H:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h\E[1;42r\E[42;1H:\ :tc=vt320-w: z340-nam|zstem vt340 terminal emulator 132col 42line:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[?5l\E[?7l\E[?8h\E[1;42r\E[42;1H:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?7l\E[?8h\E[1;42r\E[42;1H:\ :tc=z340: #### X terminal emulators # # You can add the following line to your .Xdefaults to change the terminal type # set by the xterms you start up to my-xterm: # # *termName: my-xterm # # System administrators can change the default entry for xterm instances # by adding a similar line to /usr/X11/lib/X11/app-defaults/XTerm. In either # case, xterm will detect and reject an invalid terminal type, falling back # to the default of xterm. # # X10/6.6 11/7/86, minus alternate screen, plus (csr) # (xterm: ":MT:" changed to ":km:"; added / based on init string; # removed (hs, eslok, tsl=\E[?E\E[?%i%dT, fsl=\E[?F, dsl=\E[?E) # as these seem not to work -- esr) x10term|vs100-x10|xterm terminal emulator (X10 window system):\ :am:bs:km:mi:ms:xn:xo:\ :co#80:it#8:li#65:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:RA=\E[?7l:SA=\E[?7h:\ :al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :im=\E[4h:is=\E\E[m\E[?7h\E[?1;4l:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:\ :rs=\E[r\E<\E[m\E[H\E[2J\E[?7h\E[?1;3;4;6l:se=\E[m:\ :sf=^J:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # Compatible with the R5 xterm # (from the XFree86 3.2 distribution, removed) xterm-r5|xterm R5 version:\ :am:bs:km:ms:xn:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:\ :F2=\E[24~:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ei=:ho=\E[H:ic=\E[@:im=:k0=\EOq:k1=\E[11~:\ :k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kA=\E[30~:\ :kD=\E[3~:kE=\E[8~:kI=\E[2~:kL=\E[31~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\E[7~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:r1=\E>\E[1;3;4;5;6l\E[?7h\E[m\E[r\E[2J\E[H:\ :rc=\E8:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:up=\E[A: # Compatible with the R6 xterm # (from XFree86 3.2 distribution, and :it: added, removed) xterm-r6|xterm-old|xterm X11R6 version:\ :am:bs:km:mi:ms:xn:\ :co#80:it#8:li#24:\ :*6=\E[4~:@0=\E[1~:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:\ :DO=\E[%dB:F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:\ :F5=\E[28~:F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:eA=\E(B:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E7\E[r\E[m\E[?7h\E[?1;3;4;6l\E[4l\E8\E>:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:\ :kP=\E[5~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:me=\E[m:ml=\El:\ :mr=\E[7m:mu=\Em:nd=\E[C:\ :r2=\E7\E[r\E[m\E[?7h\E[?1;3;4;6l\E[4l\E8\E>:rc=\E8:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :te=\E[2J\E[?47l\E8:ti=\E7\E[?47h:ue=\E[m:up=\E[A:\ :us=\E[4m: # This is the stock xterm entry supplied with XFree86 3.2 # The name has been changed and some aliases have been removed. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) xterm-xf86-v32|xterm terminal emulator (X Window System):\ :am:bs:km:mi:ms:xn:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOy:K3=\EOu:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E7\E[r\E[m\E[?7h\E[?1;3;4;6l\E[4l\E8\E>:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kD=\177:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\EOH:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:md=\E[1m:\ :me=\E[m\017:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:\ :sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:te=\E[2J\E[?47l\E8:\ :ti=\E7\E[?47h:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # This is the stock xterm entry supplied with XFree86 3.3, which uses VT100 # codes for F1-F4 except while in VT220 mode. xterm-xf86-v33|xterm terminal emulator (X Window System):\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :tc=xterm-xf86-v32: # This is one of the variants from XFree86 3.3 (T.Dickey) xterm-16color|xterm with 16 colors like aixterm:\ :Co#16:NC#32:pa#256:\ :AB@:AF@:\ :..Sb=%p1%{8}%/%{6}%*%{4}%+\E[%d%p1%{8}%m%Pa%?%ga%{1}%=%t4%e%ga%{3}%=%t6%e%ga%{4}%=%t1%e%ga%{6}%=%t3%e%ga%d%;m:\ :..Sf=%p1%{8}%/%{6}%*%{3}%+\E[%d%p1%{8}%m%Pa%?%ga%{1}%=%t4%e%ga%{3}%=%t6%e%ga%{4}%=%t1%e%ga%{6}%=%t3%e%ga%d%;m:\ :tc=xterm-xf86-v33: # This is xterm for ncurses. It mainly adds mappings for more high-half # characters. Note that these will only work for fixed-width fonts. xterm-nc|vs100-nc|xterms-nc|xterm terminal emulator (X Window System):\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~..--++\054\054II00:\ :u6=\E[%i%d;%dR:u7=\E[6n:u8=\E[?1;2c:u9=\E[c:\ :tc=xterm-r6: # This is the standard xterm entry. xterm|vs100|xterms|xterm terminal emulator (X Window System):\ :tc=xterm-r6: # These entries allow access to the X titlebar and icon name as a status line. # Note that twm (and possibly window managers descended from it such as tvtwm, # ctwm, and vtwm) track windows by icon-name; thus, you don't want to mess # with it. xterm+sl|access X title line and icon name:\ :hs:\ :ws#40:\ :ds=\E]0;\007:fs=^G:ts=\E]0;: xterm+sl-twm|access X title line (pacify twm-descended window managers):\ :hs:\ :ws#40:\ :ds=\E]2;\007:fs=^G:ts=\E]2;: # # The following xterm variants don't depend on your base version # xterm-bold|xterm terminal emulator (X11R6 Window System) standout w/bold:\ :so=\E[1m:\ :tc=xterm: # (kterm: this had extension capabilities ":KJ:TY=ascii:" -- esr) kterm|kterm kanji terminal emulator (X window system):\ :es:hs:ds=\E[?H:fs=\E[?F:ts=\E[?E\E[?%i%dT:\ :tc=xterm-r6: # See the note on ICH/ICH1 VERSUS RMIR/SMIR near the end of file xterm-nic|xterm with ich/ich1 suppressed for non-curses programs:\ :IC@:ei=:ic@:im=:\ :tc=xterm: # From: Mark Sheppard , 4 May 1996 xterm1|xterm terminal emulator ignoring the alternate screen buffer:\ :te@:ti@:\ :tc=xterm: # This describes the capabilities of color_xterm, an xterm variant from # before ECMA-64 color support was folded into the main-line xterm release. # This entry is straight from color_xterm's maintainer. # From: Jacob Mandelson , 09 Nov 1996 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) color_xterm|cx|cx100|color_xterm color terminal emulator for X:\ :am:km:mi:ms:xn:\ :co#80:it#8:li#65:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :i1=\E[r\E[m\E[?7h\E[?4;6l\E[4l:im=\E[4h:k1=\E[11~:\ :k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\EOB:kh=\E[7~:kl=\EOD:kr=\EOC:ku=\EOA:le=^H:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:\ :sf=^J:so=\E[7m:sr=\EM:ta=^I:te=\E>\E[?41;1r:\ :ti=\E[?1;41s\E[?1;41h\E=:ue=\E[24m:up=\E[A:us=\E[4m: # From: Mark Olesen & Thomas Dickey 13 Jul 1996 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) rxvt|reduced xterm terminal (X Window System):\ :am:km:mi:ms:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :i1=\E[?47l\E=\E[?1l:ic=\E[@:im=\E[4h:\ :is=\E[r\E[m\E[2J\E[H\E[?7h\E[?1;3;4;6l\E[4l:\ :k0=\E[21~:k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:\ :k5=\E[15~:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:ke=\E>:\ :kh=\E[7~:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:\ :sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:te=\E[?47l\E8:\ :ti=\E7\E[?47h:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: # From: David J. MacKenzie 20 Apr 1995 # Here's a termcap entry I've been using for xterm_color, which comes # with BSD/OS 2.0, and the X11R6 contrib tape too I think. Besides the # color stuff, I also have a status line defined as the window manager # title bar. [I have translated it to terminfo -- ESR] xterm-pcolor|xterm with color used for highlights and status line:\ :md=\E[1m\E[43m:mr=\E[7m\E[34m:so=\E[7m\E[31m:\ :us=\E[4m\E[42m:\ :tc=xterm+sl:tc=xterm: # HP ships this, except for the pb#9600 which was merged in from BSD termcap. # (hpterm: added empty , we have no idea what ACS chars look like --esr) xhpterm|X-hpterm|hp X11 terminal emulator:\ :am:da:db:mi:xs:\ :Nl#8:co#80:lh#2:li#24:lm#0:lw#8:pb#9600:sg#0:\ :LF=\E&j@:LO=\E&jB:ac=:ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:\ :cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:\ :cr=^M:ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:do=\EB:ei=\ER:im=\EQ:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:\ :kA=\EL:kC=\EJ:kD=\EP:kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:\ :kM=\ER:kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kT=\E1:ka=\E3:kb=^H:\ :kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:\ :ku=\EA:le=^H:md=\E&dB:me=\E&d@:mh=\E&dH:ml=\El:mr=\E&dB:\ :mu=\Em:nd=\EC:..pk=\E&f%p1%dk%p2%l%dL%p2%s:\ :..pl=\E&f1a%p1%dk%p2%l%dL%p2%s:\ :..pn=\E&f%p1%dk%p2%l%dd0L%p2%s:\ :..px=\E&f2a%p1%dk%p2%l%dL%p2%s:\ :..sa=\E&d%?%p7%t%'s'%c%;%p1%p3%|%p6%|%{2}%*%p2%{4}%*%+%p4%+%p5%{8}%*%+%'@'%+%c%?%p9%t%'\016'%c%e%'\017'%c%;:\ :se=\E&d@:sf=^J:so=\E&dJ:sr=\ET:st=\E1:ta=^I:ue=\E&d@:\ :up=\EA:us=\E&dD: # This entry describes an xterm with Sun-style function keys enabled # via the X resource setting "xterm*sunFunctionKeys:true" # To understand / note that L1,L2 and F11,F12 are the same. # The ... keys are L3-L10. We don't set # because we want it to be seen as . # The ... keys are R1-R15. We treat some of these in accordance # with their Sun keyboard labels instead. # From: Simon J. Gerraty 10 Jan 1996 xterm-sun|xterm with sunFunctionKeys true:\ :%1=\E[196z:&8=\E[195z:@0=\E[200z:@5=\E[197z:@7=\E[220z:\ :F1=\E[192z:F2=\E[193z:F3=\E[194z:F4=\E[195z:F5=\E[196z:\ :F7=\E[198z:F8=\E[199z:F9=\E[200z:FA=\E[201z:FL=\E[208z:\ :FM=\E[209z:FN=\E[210z:FO=\E[211z:FP=\E[212z:FQ=\E[213z:\ :FS=\E[215z:FU=\E[217z:FW=\E[219z:FY=\E[221z:K2=\E[218z:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kI=\E[2z:kN=\E[222z:kP=\E[216z:kh=\E[214z:\ :tc=xterm: xterms-sun|small (80x24) xterm with sunFunctionKeys true:\ :co#80:li#24:tc=xterm-sun: # This is for the extensible terminal emulator on the X11R6 contrib tape. emu|emu native mode:\ :mi:ms:xo:\ :Co#15:co#80:it#8:li#24:pa#64:vt#200:\ :*6=\Esel:@0=\Efind:@8=^M:AL=\EQ%d;:DC=\EI%d;:DL=\ER%d;:\ :DO=\Ep%d;:F1=\EF11:F2=\EF12:F3=\EF13:F4=\EF14:F5=\EF15:\ :F6=\EF16:F7=\EF17:F8=\EF18:F9=\EF19:FA=\EF20:LE=\Eq-%d;:\ :RI=\Eq%d;:Sb=\Es%i%d;:Sf=\Er%i%d;:UP=\Ep-%d;:\ :ac=a\202f\260g261j\213k\214l\215m\216n\217o\220q\222s\224t\225u\226v\227w\230x\231~\244:\ :ae=\200:al=\EQ1;:as=\200:bl=^G:cb=\EL:cd=\EN:ce=\EK:\ :cl=\EP\EE0;0;:cm=\EE%d;%d;:cr=^M:cs=\Ek%d;%d;:ct=\Ej:\ :dc=\EI1;:dl=\ER1;:do=\EB:eA=\200:ec=\Ej%d;:ei=\EX:\ :ho=\EE0;0;:im=\EY:is=\ES\Er0;\Es0;:k0=\EF00:k1=\EF01:\ :k2=\EF02:k3=\EF03:k4=\EF04:k5=\EF05:k6=\EF06:k7=\EF07:\ :k8=\EF08:k9=\EF09:k;=\EF10:kD=\177:kI=\Eins:kN=\Enext:\ :kP=\Eprior:kb=^H:kd=\EB:kl=\EC:kr=\ED:ku=\EA:le=^H:\ :mb=\ES\EW:md=\ES\EU:me=\ES:mr=\ES\ET:nd=\ED:\ :oc=\Es0;\Er0;:r2=\ES\Es0;\Er0;:se=\ES:sf=\EG:so=\ES\ET:\ :sr=\EF:st=\Eh:ta=^I:ue=\ES:up=\EA:us=\ES\EV:ve=\Ea:vi=\EZ:\ :vs=\Ea: ######## MGR # # MGR is a Bell Labs window system lighter-weight than X. # These entries describe MGR's xterm-equivalent. # They are courtesy of Vincent Broman 14 Jan 1997 # mgr|Bellcore MGR (non X) window system terminal emulation:\ :am:km:\ :AL=\E%da:DC=\E%dE:DL=\E%dd:IC=\E%dA:RA=\E5S:SA=\E5s:\ :al=\Ea:bl=^G:cd=\EC:ce=\Ec:cl=^L:cm=\E%r%d;%dM:cr=^M:\ :cs=\E%d;%dt:dc=\EE:dl=\Ed:do=\Ef:ei=:hd=\E1;2f:hu=\E1;2u:\ :ic=\EA:im=:kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :md=\E2n:me=\E0n:mr=\E1n:nd=\Er:nw=^M^J:se=\E0n:sf=^J:\ :so=\E1n:ta=^I:ue=\E0n:up=\Eu:us=\E4n:ve=\Eh:vi=\E9h:\ :vs=\E0h: mgr-sun|Mgr window with Sun keyboard:\ :%1=\E[207z:%6=\E[198z:&8=\E[195z:@0=\E[200z:@5=\E197z:\ :@7=\E[220z:@8=\E[250z:F1=\E[234z:F2=\E[235z:K1=\E[214z:\ :K2=\E[218z:K3=\E[216z:K4=\E[220z:K5=\E[222z:k1=\E[224z:\ :k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:k6=\E[229z:\ :k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:kN=\E[222z:\ :kP=\E[216z:kh=\E[214z:\ :tc=mgr: mgr-linux|Mgr window with Linux keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:K1=\E[H:K2=\E[G:K3=\E[5~:\ :K4=\E[Y:K5=\E[6~:k0=\E[[J:k1=\E[[A:k2=\E[[B:k3=\E[[C:\ :k4=\E[[D:k5=\E[[E:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:k;=\E[21~:kD=\E[3~:kN=\E[6~:kP=\E[5~:kh=\E[1~:tc=mgr: ######## UNIX VIRTUAL TERMINALS, VIRTUAL CONSOLES, AND TELNET CLIENTS # # Columbus UNIX virtual terminal. This terminal also appears in # UNIX 4.0 and successors as line discipline 1 (?), but is # undocumented and does not really work quite right. cbunix|cb unix virtual terminal:\ :am:bs:da:db:\ :co#80:li#24:lm#0:\ :al=\EP:bl=^G:cd=\EL:ce=\EK:cl=\EL:cm=\EG%r%.%.:cr=^M:\ :dc=\EM:dl=\EN:do=^J:ei=:ic=\EO:im=:kd=\EB:kh=\EE:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:nd=\EC:se=\Eb^D:sf=^J:so=\Ea^D:\ :ue=\Eb^A:up=\EA:us=\Ea^A: # (vremote: removed obsolete ":nl@:" -- esr) vremote|virtual remote terminal:\ :am@:\ :co#79:tc=cbunix: pty|4bsd pseudo teletype:\ :cm=\EG%+ %+ :se=\Eb$:so=\Ea$:ue=\Eb\041:us=\Ea\041:tc=cbunix: # The codes supported by the term.el terminal emulation in GNU Emacs 19.30 eterm|gnu emacs term.el terminal emulation:\ :am:mi:xn:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:cb=\E[1K:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :im=\E[4h:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:se=\E[m:\ :sf=^J:so=\E[7m:ta=^I:te=\E[2J\E[?47l\E8:ti=\E7\E[?47h:\ :ue=\E[m:up=\E[A:us=\E[4m: # Entries for use by the FSF's `screen' program. The screen and # screen-w entries came with version 3.7.1. The screen2 and screen3 entries # come from University of Wisconsin and may be older. # (screen: added :ve: on ANSI model -- esr) screen|VT 100/ANSI X3.64 virtual terminal:\ :am:km:mi:ms:xn:\ :Co#8:co#80:it#8:li#24:pa#64:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:\ :F2=\E[24~:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~..--++\054\054hhII00:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E(B:ei=\E[4l:\ :ho=\E[H:im=\E[4h:is=\E(B:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[15~:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kH=\E[4~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:r2=\Ec:rc=\E8:sc=\E7:se=\E[23m:\ :sf=^J:so=\E[3m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\EM:\ :us=\E[4m:vb=\Eg:ve=\E[?25h:vi=\E[?25l:vs=\E[34l:\ :tc=ecma+color: screen-w|VT 100/ANSI X3.64 virtual terminal with 132 cols:\ :co#132:tc=screen: screen2|VT 100/ANSI X3.64 virtual terminal:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ic=:im=\E[4h:k0=\E~:\ :k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:k8=\ER:\ :k9=\E0I:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:\ :me=\E[m:nd=\E[C:nw=^M^J:r1=\Ec:rc=\E8:sc=\E7:se=\E[23m:\ :sf=^J:so=\E[3m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:\ :us=\E[4m: # (screen3: removed unknown ":xv:LP:G0:" -- esr) screen3|VT 100/ANSI X3.64 virtual terminal:\ :km:mi:ms:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:\ :ho=\E[H:im=\E[4h:is=:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\EOB:ke=\E>:kl=\EOD:kr=\EOC:ks=\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:r1=\Ec:\ :rc=\E8:sc=\E7:se=\E[23m:sf=^J:so=\E[3m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[24m:up=\EM:us=\E[4m: #### Pilot Pro Palm-Top # # From: Jason Downs , 15 Jun 1997 (Top Gun Telnet's author) pilot|tgtelnet|Top Gun Telnet on the Palm Pilot Professional:\ :am:xn:\ :co#39:li#16:\ :bl=^G:cl=\Ec:cm=\Em%+ %+ :cr=^M:do=^J:ho=\Em :kN=^L:kP=^K:\ :kb=^H:kd=^J:kl=^H:le=^H:nw=\Em~ :se=\EB:sf=^J:so=\Eb:ta=^I: ######## WORKSTATION CONSOLES # #### Sun consoles # # :is1: resets scrolling region in case a previous user had used "tset vt100" oldsun|Sun Microsystems Workstation console:\ :am:bs:km:mi:ms:\ :co#80:it#8:li#34:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:al=\E[L:bl=^G:\ :cd=\E[J:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:i1=\E[1r:ic=\E[@:im=:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:me=\E[m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:ta=^I:up=\E[A: # From: Alexander Lukyanov , 14 Nov 1995 # :li: capability later corrected by J.T. Conklin sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:r2=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # On a SparcStation 5, :al:/:AL: flake out on the last line. # Unfortunately, without them the terminal has no way to scroll. sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: # If you are using an SS5, change the sun definition to use sun-ss5. sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: # From: Tue Sep 24 13:14:44 1985 sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:\ :tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :li#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: #### Iris consoles # # (wsiris: this had extension capabilities # :HS=\E7F2:HE=\E7F7:\ # :CT#2:CZ=*Bblack,red,green,yellow,blue,magenta,cyan,*Fwhite: # See the note on Iris extensions near the end of this file. # Finally, removed suboptimal :cl:=\EH\EJ and added :do: & # :vb: from BRL -- esr) wsiris|iris40|iris emulating a 40 line visual 50 (approximately):\ :am:bs:nc:pt:\ :co#80:it#8:kn#3:li#40:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\Ev:cm=\EY%+ %+ :dl=\EM:\ :do=\EB:ho=\EH:is=\E7B0\E7F7\E7C2\E7R3:k0=\E0:k1=\E1:\ :k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:k8=\E8:k9=\E9:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:me=\E7F7:mh=\E7F2:nd=\EC:\ :nl=\EB:se=\E0@:sf=^J:so=\E9P:sr=\EI:ta=^I:ue=\E7R3\E0@:\ :up=\EA:us=\E7R2\E9P:vb=\E7F4\E7B1\013\E7F7\E7B0:ve=\E>:\ :vs=\E;: #### NeWS consoles # # Console terminal windows under the NeWS (Sun's Display Postscript windowing # environment). Note: these have nothing to do with Sony's News workstation # line. # # Entry for NeWS's psterm from Eric Messick & Hugh Daniel # (psterm: unknown ":sl=\EOl:el=\ENl:" removed -- esr) psterm|psterm-basic|NeWS psterm-80x34:\ :am:bs:hs:km:ul:\ :co#80:it#8:li#34:\ :al=\EA:cd=\EB:ce=\EC:cl=^L:cm=\E%d;%d;:cs=\EE%d;%d;:\ :dc=\EF:dl=\EK:do=\EP:ei=\ENi:fs=\ENl:ho=\ER:i1=\EN*:\ :im=\EOi:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=\ET:ll=\EU:\ :mb=\EOb:md=\EOd:me=\EN*:mr=\EOr:nd=\EV:rc=^\:sc=^]:se=\ENo:\ :sf=\EW:so=\EOo:sr=\EX:ta=^I:te=\ENt:ti=\EOt:ts=\EOl:\ :ue=\ENu:up=\EY:us=\EOu:vb=\EZ: psterm-96x48|NeWS psterm 96x48:\ :co#96:li#48:tc=psterm: psterm-90x28|NeWS psterm 90x28:\ :co#90:li#28:tc=psterm: psterm-80x24|NeWS psterm 80x24:\ :co#80:li#24:tc=psterm: # This is a faster termcap for psterm. Warning: if you use this termcap, # some control characters you type will do strange things to the screen. # (psterm-fast: unknown ":sl=^Ol:el=^Nl:" -- esr) psterm-fast|NeWS psterm fast version (flaky ctrl chars):\ :am:bs:hs:km:ul:\ :co#80:it#8:li#34:\ :al=^A:cd=^B:ce=^C:cl=^L:cm=\004%d;%d;:cs=\005%d;%d;:dc=^F:\ :dl=^K:do=^P:ei=^Ni:fs=^Nl:ho=^R:i1=^N*:im=^Oi:kd=\E[B:\ :kl=\E[D    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x :kr=\E[C:ku=\E[A:le=^T:ll=^U:mb=^Ob:md=^Od:me=^N*:\ :mr=^Or:nd=^V:rc=^\:sc=^]:se=^No:sf=^W:so=^Oo:sr=^X:ta=^I:\ :te=^Nt:ti=^Ot:ts=^Ol:ue=^Nu:up=^Y:us=^Ou:vb=^Z: #### NeXT Consoles # # Use `glasstty' for the Workspace application # # From: Dave Wetzel 22 Dec 1995 next|NeXT console:\ :am:xt:\ :co#80:it#8:li#24:\ :bl=^G:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:cr=^M:do=^J:ho=\E[H:\ :kb=^H:kd=^J:kl=^H:le=^H:me=\E[m:nd=\E[C:nw=^M^J:se=\E[4;1m:\ :sf=^J:so=\E[4;2m:ta=^I:up=\E[A: nextshell|NeXT Shell application:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:kb=^H:kd=^J:kl=^H:le=^H:nw=^M^J:ta=^I: #### Common Desktop Environment # # This ships with Sun's CDE in Solaris 2.5 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) dtterm|CDE desktop terminal:\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#24:lm#0:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E F\E>\E[?1l\E[?7h\E[?45l:k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:\ :rc=\E8:sc=\E7:se=\E[22;27m:sf=\ED:so=\E[2;7m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l:\ :ve=\E[?25h:vi=\E[?25l: ### Non-Unix Consoles # # This entry fits the Windows NT console when the _POSIX_TERM environment # variable is set to 'on'. While the Windows NT POSIX console is seldom used, # the obnoxious Telnet client supplied with both the Windows for WorkGroup # 3.11 TCP/IP stack and the Win32 (i.e., Windows 95 and Windows NT 3.1 or # later) operating systems is not, and (surprise!) they match very well. # # This was adapted from MS Knowledge Base item Q108581, dated 13-MAY-1997, # titled "Setting Up VI POSIX Editor for Windows NT 3.1". True to Microsoft # form, not are the installation instructions a pile of mind-numbing # bureaucratese, but the termcap entry is actually broken and unusable as # given; the :do: capability is misspelled "d". # ansi-nt|psx_ansi|Microsoft Windows NT console POSIX ANSI mode:\ :am:bw:ms:\ :co#80:it#8:li#25:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:cr=^M:do=^J:\ :ho=\E[H:kb=^H:kd=\E[V:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :me=\E[0m:mr=\E[7m:nd=\E[C:nw=\r\E[S:rc=\E[u:sc=\E[s:\ :se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:up=\E[A: ######## COMMON TERMINAL TYPES # # This section describes terminal classes and maker brands that are still # quite common, but have proprietary command sets not blessed by ANSI. # #### Altos # # Altos made a moderately successful line of UNIX boxes. In 1990 they were # bought out by Acer, a major Taiwanese manufacturer of PC-clones. # Acer has a web site at http://www.acer.com. # # Altos descriptions from Ted Mittelstaedt 4 Sep 1993 # His comments suggest they were shipped with the system. # # (altos2: had extension capabilities # :c0=^A`\r:c1=^Aa\r:c2=^Ab\r:c3=^Ac\r:\ # :c4=^Ad\r:c5=^Ae\r:c6=^Af\r:c7=^Ag\r:\ # :c8=^Ah\r:c9=^Ai\r:cA=^Aj\r:cB=^Ak\r:\ # :cC=^Al\r:cD=^Am\r:cE=^An\r:cF=^Ao\r: # :XU=^Aq\r:XD=^Ar\r:XR=^As\r:XL=^At\r:\ # :YU=^AQ\r:YD=^AR\r:YR=^AS\r:YL=^AT\r:\ # :HL=^AP\r:SP=\E[i:\ # :IS=\E[@:DE=\E[P:IL=\E[L:NS=\E[S:PS=\E[T:\ # :LO=\E[0q:LC=\E[5q:LL=\E[6q:\ # Comparison with the k* capabilities makes it obvious that the c* things are # shift keys. I have renamed them to keys 32 and up accordingly. Also, # :sr: was given as a boolean-- esr) altos2|alt2|altos-2|altos II:\ :co#80:it#8:li#24:sg#0:\ :*5=^Am\r:*8=^An\r:DL=\E[M:FM=^A`\r:FN=^Aa\r:FO=^Ab\r:\ :FP=^Ac\r:FQ=^Ad\r:FR=^Ae\r:FS=^Af\r:FT=^Ag\r:FU=^Ah\r:\ :FV=^Ai\r:FW=^Aj\r:FX=^Ak\r:RA=\E[?7l:SA=\E[?7h:al=\E[L:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :dc=\E[P:do=\E[1B:ei=:ho=\E[H:ic=\E[@:\ :if=/usr/share/tabset/vt100:im=:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:k0=^AI\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=^AJ\r:kB=^AK\r:kC=^AL\r:\ :kD=^AM\r:kE=^AN\r:kF=^AO\r:kb=^H:kd=\E[B:kh=\E[f:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[1C:nw=^M^J:se=\E[m:\ :sf=^J:so=\E[7m:ta=^I:ue=\E[m:up=\E[1A:us=\E[4m: # (altos3: had extension capabilities # :c0=^A`\r:c1=^Aa\r:c2=^Ab\r:c3=^Ac\r:\ # :c4=^Ad\r:c5=^Ae\r:c6=^Af\r:c7=^Ag\r:\ # :c8=^Ah\r:c9=^Ai\r:cA=^Aj\r:cB=^Ak\r:\ # :cC=^Al\r:cD=^Am\r:cE=^An\r:cF=^Ao\r: # :XU=^Aq\r:XD=^Ar\r:XR=^As\r:XL=^At\r:\ # :HL=^AP\r:SP=\E[i:\ # :IS=\E[@:DE=\E[P:IL=\E[L:NS=\E[S:PS=\E[T:\ altos3|altos5|alt3|alt5|altos-3|altos-5|altos III or V:\ :mb=\E[5p:me=\E[p:sr=\EM:\ :tc=altos2: altos4|alt4|altos-4|altos IV:\ :tc=wy50: # (altos7: had extension capabilities: # :GG#0:GI=\EH8:GF=\EH7:\ # :c0=^A`\r:c1=^Aa\r:c2=^Ab\r:c3=^Ac\r:\ # :c4=^Ad\r:c5=^Ae\r:c6=^Af\r:c7=^Ag\r:\ # :c8=^Ah\r:c9=^Ai\r:cA=^Aj\r:cB=^Ak\r:\ # :cC=^Al\r:cD=^Am\r:cE=^An\r:cF=^Ao\r: # Comparison with the k* capabilities makes it obvious that the c* things are # shift keys. I have renamed them to keys 32 and up accordingly. I have # also made this entry relative to adm12 in order to give it an :sa:. The # imported by use=adm+sgr may work, let me know. -- esr) altos7|alt7|altos VII:\ :am:mi:\ :co#80:li#24:sg#0:\ :*5=^Am\r:*8=^An\r:DL=\ER:FM=^A`\r:FN=^Aa\r:FO=^Ab\r:\ :FP=^Ac\r:FQ=^Ad\r:FR=^Ae\r:FS=^Af\r:FT=^Ag\r:FU=^Ah\r:\ :FV=^Ai\r:FW=^Aj\r:FX=^Ak\r:\ :ac=l2m1k3j5t4u9v=w0q\072x6n8:al=\EE:cd=\EY:ce=\ET:\ :cl=\E+^^:cm=\E=%+ %+ :cr=^M:dc=\EW:do=^J:ei=\Er:ho=^^:\ :im=\Eq:is=\E`\072\Ee(\EO\Ee6\Ec41\E~4\Ec21\Eu\E~2:\ :k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=^AJ\r:kB=^AK\r:\ :kC=^AL\r:kD=^AM\r:kE=^AN\r:kF=^AO\r:kN=\EK:kP=\EJ:kb=^H:\ :kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:mb=\EG2:md=\EGt:mh=\EGp:\ :mk=\EG1:nd=^L:nw=^M^J:pf=\EJ:po=\Ed#:sf=^J:sr=\Ej:ta=^I:\ :up=^K:\ :tc=adm+sgr: altos7pc|alt7pc|altos PC VII:\ :@7=\ET:tc=altos7: #### Hewlett-Packard (hp) # # Hewlett-Packard # 8000 Foothills Blvd # Roseville, CA 95747 # Vox: 1-(916)-785-4363 (Technical response line for VDTs) # 1-(800)-633-3600 (General customer support) # # Generic HP terminal - this should (hopefully) work on any HP terminal. hpgeneric|hp|hewlett-packard generic terminal:\ :am:bs:da:db:mi:pt:xs:\ :co#80:li#24:lm#0:vt#6:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:\ :cm=\E&a%r%dc%dY:cr=^M:ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:\ :do=^J:ei=\ER:im=\EQ:kB=\Ei:kb=^H:le=^H:me=\E&d@:nd=\EC:\ :se=\E&d@:sf=^J:so=\E&dJ:st=\E1:ta=^I:ue=\E&d@:up=\EA:\ :us=\E&dD: hp110|hewlett-packard model 110 portable:\ :li#16:tc=hpgeneric: hp+pfk+cr|hp function keys with CR:\ :k1=\Ep\r:k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:\ :k7=\Ev\r:k8=\Ew\r: hp+pfk-cr|hp function keys w/o CR:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew: # The hp2621s use the same keys for the arrows and function keys, # but not separate escape sequences. These definitions allow the # user to use those keys as arrow keys rather than as function # keys. hp+pfk+arrows|hp alternate arrow definitions:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:kF=\Er\r:kH=\Eq\r:kR=\Es\r:\ :kd=\Ew\r:kh=\Ep\r:kl=\Eu\r:kr=\Ev\r:ku=\Et\r: hp+arrows|hp arrow definitions:\ :kF=\ES:kH=\EF:kR=\ET:kd=\EB:kh=\Eh:kl=\ED:kr=\EC:ku=\EA: # Generic stuff from the HP 262x series # hp262x|HP 262x terminals:\ :xs:\ :cd=\EJ:dc=\EP:ip=:kA=\EL:kD=\EP:kE=\EK:kF=\ES:kI=\EQ:kL=\EM:\ :kM=\ER:kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kd=\EB:ke=\E&s0A:kh=\Eh:\ :kl=\ED:kr=\EC:ks=\E&s1A:ku=\EA:mb=\E&dA:me=\E&d@:mk=\E&dS:\ :mr=\E&dB:\ :..sa=\E&d%'@'%?%p1%t%'B'%|%;%?%p2%t%'D'%|%;%?%p3%t%'B'%|%;%?%p4%t%'A'%|%;%c:\ :se=\E&d@:sf=\ES:so=\E&dB:ta=\011:ue=\E&d@:us=\E&dD: # Note: no :ho: on HPs since that homes to top of memory, not screen. # Due to severe 2621 braindamage, the only way to get the arrow keys to # transmit anything at all is to turn on the function key labels # with :ks:, and even then the user has to hold down shift! # The default 2621 turns off the labels except when it has to to # enable the function keys. If your installation prefers labels # on all the time, or off all the time (at the "expense" of the # function keys), use 2621-nl or 2621-wl. # # Note: there are newer ROMs for 2621's that allow you to set # strap A so the regular arrow keys xmit \EA, etc, as with the # 2645. However, even with this strap set, the terminal stops # xmitting if you reset it, until you unset and reset the strap! # Since there is no way to set/unset the strap with an escape # sequence, we don't use it in the default. # If you like, you can use 2621-ba (brain-damaged arrow keys). hp2621-ba|2621 w/new rom and strap A set:\ :ke@:ks@:tc=hp+arrows:\ :tc=hp2621: # hp2621 with function labels. Most of the time they are off, # but inside vi, the function key labels appear. You have to # hold down shift to get them to xmit. hp2621|hp2621a|hp2621A|2621|2621a|2621A|hp2621-wl|2621-wl|hp 2621 w/labels:\ :is=\E&jA\r:ke=\E&jA:\ :tc=hp2621-fl: hp2621-fl|hp 2621:\ :xo:xs@:\ :pb#19200:\ :bt=\Ei:cm=\E&a%r%dc%dY:dc=\EP:ip=:is=\E&j@\r:ke=\E&j@:\ :ks=\E&jB:me=\E&d@:se=\E&d@:so=\E&dD:ta=\011:ue=\E&d@:\ :us=\E&dD:\ :tc=hp+pfk+cr:tc=hpgeneric: # To use hp2621p printer, setenv TERM=2621p, PRINTER=2612p hp2621p|hp 2621 with printer:\ :pf=\E&p13C:po=\E&p11C:tc=hp2621: hp2621p-a|hp2621p with fn as arrows:\ :tc=hp+pfk+arrows:tc=hp2621p: # hp2621 with k45 keyboard hp2621-k45|hp2621k45|k45|hp 2621 with 45 keyboard:\ :kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:\ :ku=\EA:\ :tc=hp2621: # 2621 using all 48 lines of memory, only 24 visible at any time. hp2621-48|48 line 2621:\ :li#48:\ :cm=\E&a%r%dc%dR:cv=\E&a%dR:ho=\EH:tc=hp2621: # 2621 with no labels ever. Also prevents vi delays on escape. hp2621-nl|hp 2621 with no labels:\ :kd@:ke@:kh@:kl@:kr@:ks@:ku@:tc=hp2621-fl: # Needed for UCB ARPAVAX console, since lsi-11 expands tabs # (wrong). # hp2621-nt|hp 2621 w/no tabs:\ :ta@:tc=hp2621: # Hp 2624 B with 4 or 10 pages of memory. # # Some assumptions are made with this entry. These settings are # NOT set up by the initialization strings. # # Port Configuration # RecvPace=Xon/Xoff # XmitPace=Xon/Xoff # StripNulDel=Yes # # Terminal Configuration # InhHndShk=Yes # InhDC2=Yes # XmitFnctn(A)=No # InhEolWrp=No # # Note: the 2624 DOES have a true :ho:, believe it or not! # # The 2624 has an "error line" to which messages can be sent. # This is CLOSE to what is expected for a "status line". However, # after a message is sent to the "error line", the next carriage # return is EATEN and the "error line" is turned back off again! # So I guess we can't define :hs:, :es:, :ws:, :ds:, :fs:, :ts:. # # This entry supports emacs (and any other program that uses raw # mode) at 4800 baud and less. I couldn't get the padding right # for 9600. # # (hp2624: replaced NUL sequences in flash with mandatory pauses -- esr) hp2624|hp2624a|hp2624b|hp2624b-4p|Hewlett Packard 2624 B:\ :da:db:\ :lm#96:\ :vb=\E&w13F\E&w12F\E&w13F\E&w12F:tc=hp+labels:tc=scrhp: # This hp2626 entry does not use any of the fancy windowing stuff # of the 2626. # # Indeed, terminfo does not yet handle such stuff. Since changing # any window clears memory, it is probably not possible to use # this for screen opt. # # ed is incredibly slow most of the time - I am guessing at the # exact padding. Since the terminal uses xoff/xon this is intended # only for cost computation, so that the terminal will prefer el # or even dl1 which is probably faster! # # \ED\EJ\EC hack for ed from Ed Bradford - apparently ed is only # extra slow on the last line of the window. # # The padding probably should be changed. # hp2626|hp2626a|hp2626p|hp 2626:\ :da:db:\ :lm#0:pb#19200:\ :SF=\E&r%dD:SR=\E&r%dU:cd=\ED\EJ\EC:ip=:is=\E&j@\r:tc=hp+pfk+cr:tc=hp+labels:tc=scrhp: # This entry is for sysline. It allocates a 23 line window with # a 115 line workspace for regular use, and a 1 line window for # the status line. # # This assumes port 2 is being used. # Turn off horizontal line, Create ws #1 with 115 lines, # Create ws #2 with 1 line, Create window #1 lines 1-23, # Create window #2 lines 24-24, Attach cursor to workspace #1. # Note that this clears the tabs so it must be done by tset before # it sets the tabs. # hp2626-s|hp 2626 using only 23 lines:\ :es:hs:\ :li#23:\ :fs=\E&d@\E&w7f2p1I\E&w4f1I:\ :i1=\E&q3t0{0H \E&w0f115n1I \E&w0f1n2I \E&w2f1i0d0u22l0S \E&w2f2i0d23u23l0S \E&w7f2p1I \r:\ :ts=\E&w7f2p2I\E&w4f2I\r\EK\E&a%p1%dC:\ :tc=hp2626: # Force terminal back to 24 lines after being 23. hp2626-ns|hp 2626 using all 24 lines:\ :i1=\E&q3t0{0H \E&w0f118n1I \E&w0f1n2I \E&w2f1i0d0u23l0S \E&w3f2I \E&w7f2p1I \r:tc=hp2626: # Various entries useful for small windows on 2626. hp2626-12|hewlett-packard 2626 12 lines:\ :li#12:tc=hp2626: hp2626-12x40|hewlett-packard 2626 12 lines 40 columns:\ :co#40:li#12:tc=hp2626: hp2626-x40|hewlett-packard 2626 40 columns:\ :co#40:tc=hp2626: hp2626-12-s|hewlett-packard 2626 11 lines plus status:\ :li#11:tc=hp2626-s: # # hp2627 color tubes from University of Wisconsin # hp2627a-rev|hp 2627 with reverse video colors:\ :cr=^M:do=^J:\ :is=\E&v0m1a0b0c1x1y1z1i0a0b1c1x1y1z0i0S\E&j@\r\E3\r:\ :kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:ue=\E&v0S\E&d@:\ :us=\E&dD\E&v1S:\ :tc=hp2621-nl: hp2627a|hp 2627 color terminal with no labels:\ :cr=^M:do=^J:\ :is=\E&v0m1a1b0c1i0a1b1c2i1a0b0c0i0S\E&j@\r\E3\r:\ :kb=^H:kd=^J:kl=^H:nw=^M^J:se=\E&v0S:sf=^J:so=\E&v2S:ta=^I:\ :ue=\E&v0S\E&d@:us=\E&dD\E&v1S:\ :tc=hp2621-nl: hp2627c|hp 2627 color (cyan) terminal with no labels:\ :cr=^M:do=^J:\ :is=\E&v0m1a0b0c2i1a1b0c1i0a1b1c0i0S\E&j@\r\E3\r:\ :kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:\ :tc=hp2627a: # hp2640a doesn't have the Y cursor addressing feature, and C is # memory relative instead of screen relative, as we need. # hp2640a|hp 2640a:\ :cm@:ke@:ks@:tc=hp2645: hp2640b|hp2644a|hp 264x series:\ :ke@:ks@:tc=hp2645: # (hp2641a: removed unknown :gu: -- esr) hp2641a|hp2645a|hp2647a|HP 264?A series BRL entry:\ :am:da:db:mi:xs:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%2C:cl=\EH\EJ:\ :cm=\E&a%r%2c%2Y:cr=^M:cv=\E&a%2Y:dc=\EP:dl=\EM:do=^J:\ :ei=\ER:if=/usr/share/tabset/std:im=\EQ:is=500\EE:kb=^H:\ :kd=^J:kl=^H:le=^H:nd=\EC:nw=^M^J:se=\E&d@:sf=^J:so=\E&dB:\ :ta=^I:up=\EA: # This terminal should be used at 4800 baud or less. It needs padding for # plain characters at 9600, I guessed at an appropriate cr delay. It really # wants ^E/^F handshaking, but that doesn't work well even if you write # software to support it. hp2645|hp45|HP 2645 series:\ :pb#9600:\ :cr=\r:kA=\EL:kD=\EP:kE=\EK:kF=\ES:kI=\EQ:kL=\EM:kM=\ER:\ :kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kT=\E1:kd=\EB:ke=\E&s0A:kh=\Eh:\ :kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:ku=\EA:mb=\E&dA:me=\E&d@:\ :mh=\E&dH:mr=\E&dB:\ :..sa=\E&d%'@'%?%p1%t%'B'%|%;%?%p2%t%'D'%|%;%?%p3%t%'B'%|%;%?%p4%t%'A'%|%;%?%p5%t%'H'%|%;%?%p6%t%'B'%|%;%c:\ :us=\E&dD:\ :tc=hpgeneric: # You should use this terminal at 4800 baud or less. hp2648|hp2648a|HP 2648a graphics terminal:\ :cl=\EH\EJ:cm=\E&a%r%dc%dY:dc=\EP:ip=:tc=hp2645: # The HP 150 terminal is a fairly vanilla HP terminal, with the # clreol standout problem. It also has graphics capabilities and # a touch screen, which we don't describe here. hp150|hewlett packard Model 150:\ :bs:tc=hp2622: # HP 2382a terminals, "the little ones." They don't have any # alternate character set support and sending out ^N/^O will # leave the screen blank. hp2382a|hp2382|hewlett packard 2382a:\ :da:db:\ :lh#1:lm#48:\ :ac@:ae@:as@:me=\E&d@:\ :..pn=\E&f0a%p1%dk%p2%l%Pa%?%ga%t%ga%d%e1%;d0L%?%ga%!%t %;%p2%s:\ :..sa=\E&d%{0}%Pa%?%p4%t%{1}%ga%+%Pa%;%?%p1%p3%|%p6%|%t%{2}%ga%+%Pa%;%?%p2%p6%|%t%{4}%ga%+%Pa%;%?%p1%p5%|%t%{8}%ga%+%Pa%;%?%p7%t%?%ga%ts%ga%'@'%+%e%'S'%;%e%?%ga%t%ga%'@'%+%e%'@'%;%;%c:\ :tc=hp+labels:tc=scrhp: hp2621-a|hp2621a-a|hp2621 with fn as arrows:\ :tc=hp+pfk+arrows:tc=hp2621-fl: # newer hewlett packard terminals newhpkeyboard|generic entry for HP extended keyboard:\ :kA=\EL:kB=\Ei:kC=\EJ:kD=\EP:kE=\EK:kF=\ET:kH=\EF:kI=\EQ:\ :kL=\EM:kM=\ER:kN=\EU:kP=\EV:kR=\ES:kS=\EJ:kb=^H:kd=\EB:\ :ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:ku=\EA:\ :tc=hp+pfk-cr: newhp|generic entry for new hewlett packard terminals:\ :am:bw:mi:xo:xs:\ :co#80:li#24:pb#4800:\ :ac=T1R\041U2S"W3O#V4P$t5u6w7v8\072'9(LQKWlRkT5I3@2[MAJSmFjGdHQ;Y+Z*X\0724>q\054x.n/:\ :ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:cr=^M:ct=\E3:\ :dc=\EP:dl=\EM:do=^J:ei=\ER:i1=\E&jB:im=\EQ:ip=:le=^H:\ :mb=\E&dA:md=\E&dF:me=\E&d@\017:mh=\E&dH:mk=\E&dS:\ :mr=\E&dB:nd=\EC:nw=^M^J:\ :..pk=\E&f0a%p1%dk0d%p2%l%dL%p2%s:\ :..pl=\E&f1a%p1%dk0d%p2%l%dL%p2%s:\ :..px=\E&f2a%p1%dk0d%p2%l%dL%p2%s:r1=\Eg:\ :..sa=\E&d%{0}%Pa%?%p4%t%{1}%ga%+%Pa%;%?%p1%p3%|%p6%|%t%{2}%ga%+%Pa%;%?%p2%p6%|%t%{4}%ga%+%Pa%;%?%p1%p5%|%t%{8}%ga%+%Pa%;%?%p7%t%?%ga%ts%ga%'@'%+%e%'S'%;%e%?%ga%t%ga%'@'%+%e%'@'%;%;%c%?%p9%t\016%e\017%;:\ :se=\E&d@:sf=^J:so=\E&dJ:sr=\ET:st=\E1:ta=\011:ue=\E&d@:\ :up=\EA:us=\E&dD:\ :tc=newhpkeyboard: memhp|memory relative addressing for new HP ttys:\ :vt#6:\ :CM=\E&a%p1%dr%p2%dC:DO=\E&a+%dR:LE=\E&a-%dC:\ :RI=\E&a+%dC:UP=\E&a-%dR:ch=\E&a%dC:cl=\EH\EJ:\ :cm=\E&a%dr%dC:cv=\E&a%dR:ho=\EH:ll=\E&a23R\r:tc=newhp: scrhp|screen relative addressing for new HP ttys:\ :CM=\E&a%p1%dr%p2%dC:DO=\E&a+%dR:LE=\E&a-%dC:\ :RI=\E&a+%dC:UP=\E&a-%dR:ch=\E&a%dC:cl=\E&a0c0Y\EJ:\ :cm=\E&a%dy%dC:cv=\E&a%dY:ho=\E&a0y0C:ll=\E&a0y0C\EA:\ :tc=newhp: # (hp+labels: added label values from a BRL termcap -- esr) hp+labels|"standard" label info for new HP ttys:\ :Nl#8:lh#2:lw#8:\ :LF=\E&j@:LO=\E&jB:l0=f1:l1=f2:l2=f3:l3=f4:l4=f5:l5=f6:l6=f7:\ :l7=f8:\ :..pn=\E&f2a%p1%dk%p2%l%Pa%?%ga%t%ga%d%e1%;d0L%?%ga%!%t %;%p2%s: hp+printer|"standard" printer info for HP ttys:\ :ff=\E&p4u0C:pf=\E&p13C:po=\E&p11C:ps=\EH\E&p4dF: # The new hp2621b is kind of a cross between the old 2621 and the # new 262x series of machines. It has dip-switched options. # The firmware has a bug in it such that if you give it a null # length label, the following character is eaten! hp2621b|hp 2621b with old style keyboard:\ :Nl#8:lh#1:lm#48:lw#8:\ :LO=\E&jB:kF=\ET:kH=\EF:kR=\ES:kd=\EB:kh=\Eh:kl=\ED:kr=\EC:\ :ku=\EA:\ :..pn=\E&f0a%p1%dk%p2%l%Pa%?%ga%t%ga%d%e1%;d3L%?%ga%!%t%{32}%c%;%p2%s\E%'o'%p1%+%c\r:tc=hp2621: hp2621b-p|hp 2621b with printer:\ :tc=hp+printer:tc=hp2621b: # hp2621b - new 2621b with new extended keyboard # these are closer to the new 26xx series than the other 2621b hp2621b-kx|hp 2621b with extended keyboard:\ :tc=newhpkeyboard:tc=hp2621b: hp2621b-kx-p|hp 2621b with new keyboard & printer:\ :tc=hp+printer:tc=hp2621b-kx: # Some assumptions are made in the following entries. # These settings are NOT set up by the initialization strings. # # Port Configuration # RecvPace=Xon/Xoff XmitPace=Xon/Xoff StripNulDel=Yes # # Terminal Configuration # InhHndShk(G)=Yes InhDC2(H)=Yes # XmitFnctn(A)=No InhEolWrp=No # # # Hp 2622a & hp2623a display and graphics terminals # hp2622|hp2622a|hp 2622:\ :da:db:\ :lm#0:pb#19200:\ :is=\E&dj@\r:tc=hp+pfk+cr:tc=hp+labels:tc=scrhp: # The 2623 is a 2622 with extra graphics hardware. hp2623|hp2623a|hp 2623:\ :tc=hp2622: hp2624b-p|hp2624b-4p-p|hewlett packard 2624 B with printer:\ :tc=hp+printer:tc=hp2624: # The hewlett packard B can have an optional extra 6 pages of memory. hp2624-10p|hp2624a-10p|hp2624b-10p|hewlett packard 2624 B w/ 10 pages of memory:\ :lm#240:tc=hp2624: hp2624b-10p-p|hewlett packard 2624 B w/ extra memory & printer:\ :lm#240:tc=hp2624b-p: # Color manipulations for HP terminals hp+color|hp with colors:\ :cc:\ :Co#16:NC#17:pa#7:\ :..Ip=\E&v%?%p2%{1000}%=%t1%e.%p2%d%;a\n%?%p3%{1000}%=%t1%e.%p3%d%;b\n%?%p4%{1000}%=%t1%e.%p4%d%;c\n%?%p5%{1000}%=%t1%e.%p5%d%;x\n%?%p6%{1000}%=%t1%e.%p6%d%;y\n%?%p7%{1000}%=%t1%e.%p7%d%;z\n%p1%dI:\ :oc=\E&v0m1a1b1c0I\E&v1a1I\E&v1b2I\E&v1a1b3I\E&v1c4I\E&v1a1c5I\E&v1b1c6I\E&v1x1y7I:\ :op=\E&v0S:sp=\E&v%dS: # :is: sets the screen to be 80 columns wide hp2397a|hp2397|hewlett packard 2397A color terminal:\ :is=\E&w6f80X:\ :tc=memhp:tc=hp+labels:tc=hp+color: # HP 700/44 Setup parameters: # Terminal Mode HP-PCterm # Inhibit Auto Wrap NO # Status Line Host Writable # PC Character Set YES # Twenty-Five Line Mode YES # XON/XOFF @128 or 64 (sc) # Keycode Mode NO or YES (sc) # Backspace Key BS or BS/DEL # # :is: sets pcterm; autowrap; 25 lines; pc char set; prog DEL key; # \E\\? does not turn off keycode mode # sets alternate start/stop; keycode on hpansi|hp700|hewlett packard 700/44 in HP-PCterm mode:\ :am:eo:xn:xo:\ :co#80:li#25:\ :@7=\E[4~:RA=\E[?7l:S4=\E[>11h\EPO**x0/65;1/67\E\:\ :S5=\E[>11l\EP1**x0/11;1/13\E[m\E\:SA=\E[?7h:XF=g:XN=e:\ :ac=k\277l\332m\300j\331n\305w\302q\304u\264t\303v\301x\263:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[@:im=:\ :is=\E[44"p\E[?7h\E[>10h\E[>12h\EP1;1|3/7F\E\:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:k9=\E[26~:k;=\E[28~:\ :kB=\E[Z:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[1~:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:me=\E[m:nd=\E[C:se=\E[m:sf=^J:\ :so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:\ :vi=\E[?25l: # # (hp2392: copied :ei: here from hpex -- esr) hp2392|239x series:\ :co#80:\ :bt=\Ei:cm=\E&a%dy%dC:cv=\E&a%dY:ei=\ER:im=\EQ:k1=\Ep\r:\ :k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:k7=\Ev\r:\ :k8=\Ew\r:kF=\EU:kN=\Eu:kP=\Ev:kR=\EV:kh=\Eh:ue=\E&d@:\ :us=\E&dD:\ :tc=hpsub: hpsub|hp terminals -- capability subset:\ :am:da:db:mi:xo:xs:\ :li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:cr=^M:\ :dc=\EP:dl=\EM:do=\EB:if=/usr/share/tabset/stdcrt:\ :is=\E&s1A\E<\E&k0\:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:\ :kr=\EC:ks=\E&s1A:ku=\EA:le=^H:me=\E&d@:nd=\EC:se=\E&d@:\ :sf=^J:so=\E&dB:ta=^I:up=\EA: # hpex: # May be used for most 24 x 80 hp terminals, # but has no padding added, so may allow runover in some terminals at high # baud rates. Will not work for hp2640a or hp2640b terminals, hp98x6 and # hp98x5 terminal emulators or hp98x6 consoles. # Adds xy-cursor addressing, vertical cursor addressing, home, # last line, and underline capabilities. # # (hpex: removed memory-lock capabilities ":ml=\El:mu=\Em:", # moved :ei: here from hpsub -- esr) hpex|hp extended capabilites:\ :cm=\E&a%dy%dC:cr=^M:cv=\E&a%dY:do=^J:ei=\ER:im=\EQ:kb=^H:\ :kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:ue=\E&d@:us=\E&dD:\ :tc=hpsub: # From: Ville Sulko , 05 Aug 1996 hp2|hpex2|hewlett-packard extended capabilities newer version:\ :am:da:db:mi:xs:\ :Nl#8:co#80:lh#2:li#24:lm#0:lw#8:sg#0:\ :LF=\E&j@:LO=\E&jB:al=\EL:bl=^G:cd=\EJ:ce=\EK:ch=\E&a%dC:\ :cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:cr=^M:ct=\E3:cv=\E&a%dY:\ :dc=\EP:dl=\EM:do=\EB:ei=\ER:im=\EQ:k1=\Ep:k2=\Eq:k3=\Er:\ :k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:kA=\EL:kC=\EJ:kD=\EP:\ :kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:kM=\ER:kN=\EU:kP=\EV:\ :kR=\ET:kS=\EJ:kT=\E1:ka=\E3:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:\ :kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:ku=\EA:le=^H:me=\E&d@:\ :ml=\El:mu=\Em:nd=\EC:..pk=\E&f%p1%dk%p2%l%dL%p2%s:\ :..pl=\E&f1a%p1%dk%p2%l%dL%p2%s:\ :..pn=\E&f%p1%dk%p2%l%dd0L%p2%s:\ :..px=\E&f2a%p1%dk%p2%l%dL%p2%s:\ :..sa=\E&d%?%p7%t%'s'%c%;%p1%p3%|%p6%|%{2}%*%p2%{4}%*%+%p4%+%p5%{8}%*%+%'@'%+%c%?%p9%t%'\016'%c%e%'\017'%c%;:\ :se=\E&d@:sf=^J:so=\E&dB:st=\E1:ta=^I:ue=\E&d@:up=\EA:\ :us=\E&dD: # HP 236 console # From: hp236|hp236 internal terminal emulator:\ :am:bs:\ :co#80:li#24:\ :al=\EG:ce=\EK:cl=\EF:cm=\EE%+ %+ :dc=\EJ:dl=\EH:ei=:ic=\EI:\ :im=:le=^H:me=\ECI:se=\ECI:so=\EBI:up=^K:ve=\EDE:vs=\EDB: # This works on a hp300 console running Utah 4.3 BSD # From: Craig Leres hp300h|HP Catseye console:\ :am:bs:da:db:mi:xs:\ :co#128:li#51:lm#0:sg#0:\ :al=\EL:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:ch=\E&a%dC:\ :cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:cr=^M:ct=\E3:cv=\E&a%dY:\ :dc=\EP:dl=\EM:do=\EB:ei=\ER:if=/usr/share/tabset/stdcrt:\ :im=\EQ:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:\ :ks=\E&s1A:ku=\EA:le=^H:me=\E&d@:nd=\EC:se=\E&d@:sf=^J:\ :so=\E&dB:ta=^I:ue=\E&d@:up=\EA:us=\E&dD: # From: Greg Couch hp9837|hp98720|hp98721|HP 9000/300 workstations:\ :am:bs:da:db:mi:xs:\ :co#128:it#8:li#46:lm#0:\ :al=\EL:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:ch=\E&a%dC:\ :cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:ct=\E3:cv=\E&a%dY:dc=\EP:\ :dl=\EM:do=\EB:ei=\ER:im=\EQ:is=\E&v0m1b0i&j@:kA=\EL:\ :kD=\EP:kE=\EK:kI=\EQ:kL=\EM:kN=\EU:kP=\EV:kS=\EJ:kb=^H:\ :kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:ku=\EA:\ :le=^H:me=\E&d@:nd=\EC:se=\E&v0S:sf=^J:so=\E&v5S:st=\E1:\ :ta=^I:ue=\E&d@:up=\EA:us=\E&dD: # HP 9845 desktop computer from BRL # (hp9845: removed unknown capability :gu: -- esr) hp9845|HP 9845:\ :am:bs:da:db:eo:mi:xs:\ :co#80:li#21:\ :al=\EL:bc=\ED:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\E&a%r%2c%2Y:\ :dc=\EP:dl=\EM:ei=\ER:if=/usr/share/tabset/std:im=\EQ:\ :nd=\EC:se=\E&d@:so=\E&dB:up=\EA: # From: Charles A. Finnell of MITRE , developed 07SEP90 # (hp98550: replaced /usr/share/tabset/9837 with std because :it#8:,:st=\E1:; # added empty to avoid warnings re :as:/:ae: --esr) hp98550|hp98550a|HP 9000 Series 300 color console:\ :am:bs:da:db:mi:xs:\ :co#128:it#8:li#49:lm#0:\ :ac=:ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:\ :ch=\E&a%dC:cl=\EH\EJ:cm=\E&a%dy%dC:cr=^M:ct=\E3:\ :cv=\E&a%dY:dc=\EP:dl=\EM:do=^J:ei=\ER:\ :if=/usr/share/tabset/std:im=\EQ:k1=\Ep:k2=\Eq:k3=\Er:\ :k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:kA=\EL:kC=\EJ:kD=\EP:\ :kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:kM=\ER:kN=\EU:kP=\EV:\ :kR=\ET:kS=\EJ:kT=\E1:ka=\E3:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:\ :kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:ku=\EA:le=^H:mb=\E&dA:\ :md=\E&dJ:me=\E&d@:mh=\E&dH:mk=\E&ds:mr=\E&dJ:nd=\EC:\ :se=\E&d@:sf=^J:so=\E&dJ:st=\E1:ta=^I:ue=\E&d@:up=\EA:\ :us=\E&dD:ve=\E*dQ:vi=\E*dR: # From: Victor Duchovni # (hp700-wy: removed obsolete ":nl=^J:"; # replaced /usr/share/tabset/hp700-wy with std because :it#8:,:st=\E1: -- esr) hp700-wy|HP700/41 emulating wyse30:\ :am:bs:bw:mi:ms:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=0.7*\EE:bt=\EI:cd=\EY:ce=10\ET:cl=^Z:cm=\E=%+ %+ :\ :cr=^M:ct=\E0:cv=\E[%+ :dc=\EW:dl=\ER:do=^V:ei=\Er:ho=^^:\ :i1=\E~"\EC\Er\E(\EG0\003\E`9\E`1:\ :if=/usr/share/tabset/stdcrt:im=\Eq:kB=\EI:kC=^Z:kE=\ET:\ :kI=\Eq:kM=\Er:kS=\EY:kT=\EI:kb=\177:kd=^V:kh=^^:kl=^H:kr=^L:\ :ku=^K:le=^H:ll=^^^K:me=10\EG0:nd=^L:se=10\EG0:so=10\EG4:\ :sr=\Ej:st=\E1:ta=^I:ue=10\EG0:up=^K:us=10\EG8: # (hp70092: added empty to avoid warnings re :as:/:ae: --esr) hp70092|hp70092a|hp70092A|HP 700/92:\ :am:da:db:xs:\ :Nl#8:co#80:lh#2:li#24:lm#0:lw#8:\ :LF=\E&j@:LO=\E&jB:ac=:ae=^O:al=\EL:as=^N:bl=^G:bt=\Ei:\ :ce=\EK:ch=\E&a%dC:cl=\E&a0y0C\EJ:cm=\E&a%dy%dC:cr=^M:\ :ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:do=\EB:ei=\ER:im=\EQ:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:\ :kA=\EL:kC=\EJ:kD=\EP:kE=\EK:kF=\ES:kH=\EF:kI=\EQ:kL=\EM:\ :kM=\ER:kN=\EU:kP=\EV:kR=\ET:kS=\EJ:kT=\E1:ka=\E3:kb=^H:\ :kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:ks=\E&s1A:kt=\E2:\ :ku=\EA:le=^H:mb=\E&dA:md=\E&dB:me=\E&d@:mh=\E&dH:mr=\E&dB:\ :nd=\EC:se=\E&d@:so=\E&dJ:sr=\ET:st=\E1:ta=^I:ue=\E&d@:\ :up=\EA:us=\E&dD: bobcat|sbobcat|HP 9000 model 300 console:\ :am:da:db:mi:xs:\ :co#128:it#8:li#47:sg#0:\ :al=10*\EL:bt=\Ei:cd=\EJ:ce=\EK:ch=6\E&a%dC:cl=\EH\EJ:\ :cm=6\E&a%dy%dC:cr=^M:cv=6\E&a%dY:dc=\EP:dl=10*\EM:do=\EB:\ :ei=\ER:im=\EQ:kb=^H:kd=\EB:ke=\E&s0A:kh=\Eh:kl=\ED:kr=\EC:\ :ks=\E&s1A:ku=\EA:le=^H:me=\E&d@:nd=\EC:nw=^M^J:se=\E&d@:\ :sf=^J:so=\E&dB:ta=^I:ue=\E&d@:up=\EA:us=\E&dD: gator-t|HP 9000 model 237 emulating extra-tall AAA:\ :li#94:tc=gator: gator|HP 9000 model 237 emulating AAA:\ :bw:km:mi:ul:\ :co#128:it#8:li#47:\ :AL=1*\E[%dL:DC=4\E[%dP:DL=1*\E[%dM:IC=4\E[%d@:al=\E[L:\ :bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%i%d`:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ho=\E[H:\ :ic=\E[@:im=:kb=^H:kd=^J:kl=^H:le=^H:me=\E[m:mr=\E[7m:\ :nd=\E[C:nw=^M^J:rp=1*%.\E[%db:se=\E[m:so=\E[7m:ta=^I:\ :ue=\E[m:up=\EM:us=\E[4m: gator-52|HP 9000 model 237 emulating VT52:\ :co#128:li#47:tc=vt52: gator-52t|HP 9000 model 237 emulating extra-tall VT52:\ :li#94:tc=gator-52: #### Honeywell-Bull # # From: Michael Haardt 11 Jan 93 # # Honeywell Bull terminal. Its cursor and function keys send single # control characters and it has standout/underline glitch. Most programs # do not like these features/bugs. Visual bell is realized by flashing the # "keyboard locked" LED. dku7003-dumb|Honeywell Bull DKU 7003 dumb mode:\ :co#80:li#25:\ :cd=^_:ce=\E[K:cl=^]^_:cm=\E[%i%d;%dH:cr=^M:do=^K:ho=^]:\ :kb=^H:kd=^K:kh=^]:kl=^Y:kr=^X:ku=^Z:le=^Y:nd=^X:nw=^M^J:\ :sf=^J:ta=^I:up=^Z:vb=\E[2h\E[2l: dku7003|Honeywell Bull DKU 7003 all features described:\ :ms:\ :sg#1:ug#1:\ :mb=\E[5m:md=\E[7m:me=\E[m:mh=\E[2m:mr=\E[7m:se=\E[m:\ :so=\E[7m:ue=\E[m:us=\E[4m:\ :tc=dku7003-dumb: #### Lear-Siegler (adm) # # These guys are long since out of the terminals business, but # in 1995 many current terminals still have an adm type as one of their # emulations (usually their stupidest, and usually labeled adm3, though # these `adm3' emulations normally have adm3a+ capabilities). # # WARNING: Some early ADM terminals (including the ADM3 and ADM5) had a # `diagnostic feature' that sending them a ^G while pin 22 (`Ring Indicator') # was being held to ground would trigger a send of the top line on the screen. # A quick fix might be to drop back to a cheesy 4-wire cable with pin 22 # hanging in the air. # adm1a|adm1|lsi adm1a:\ :am:\ :co#80:li#24:\ :bl=^G:cl=\E;:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:le=^H:nd=^L:\ :sf=^J:up=^K: adm2|lsi adm2:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E;:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=^L:sf=^J:up=^K: # (adm3: removed obsolete ":ma=^K^P:" -- esr) adm3|lsi adm3:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=^Z:cr=^M:do=^J:le=^H:sf=^J: # The following ADM-3A switch settings are assumed for normal operation: # SPACE U/L_DISP CLR_SCRN 24_LINE # CUR_CTL LC_EN AUTO_NL FDX # Other switches may be set for operator convenience or communication # requirements. I recommend # DISABLE_KB_LOCK LOCAL_OFF 103 202_OFF # ETX_OFF EOT_OFF # Most of these terminals required an option ROM to support lower case display. # Open the case and look at the motherboard; if you see an open 24-pin DIP # socket, you may be out of luck. # # (adm3a: some capabilities merged in from BRl entry -- esr) adm3a|lsi adm3a:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=1\032:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:kd=^J:kl=^H:\ :kr=^L:ku=^K:le=^H:ma=^K^P:nd=^L:nl=^J:r1=^N:rs=^N:sf=^J:\ :up=^K: adm3a+|adm3a plus:\ :kb=^H:tc=adm3a: # (adm5: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" & duplicate ":do=^J:" -- esr) adm5|lsi adm5:\ :sg#1:\ :bl=^G:cd=\EY:ce=\ET:cr=^M:do=^J:kb=^H:kh=^^:se=\EG:so=\EG:tc=adm3a+: # A lot of terminals other than adm11s use these. Wherever you see # use=adm+sgr with some of its capabilities disabled, try the # disabled ones. They may well work but not have been documented or # expressed in the using entry. We'd like to cook up an :sa: but the # :ae:/:as: sequences of the using entries vary too much. adm+sgr|adm style highlight capabilities:\ :me=\EG0:mk=\EG1:mr=\EG4:se=\EG0:so=\EG4:ue=\EG0:us=\EG8: # LSI ADM-11 from George William Hartwig, Jr. via BRL # Status line additions from Stephen J. Muir # :kh: from . :cl: could also # be ^Z, according to his entry. # (adm11: :us:=\EG4 was obviously erroneous because it also said # :mr:=\EG4. Looking at other ADMs confirms this -- esr) adm11|LSI ADM-11:\ :am:bs:hs:\ :co#80:kn#8:li#24:\ :bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:do=^J:ds=\Eh:\ :fs=\E(\r:ho=^^:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:mb=\EG2:nd=^L:nl=^J:nw=^M^J:ta=^I:\ :ts=\EF\E):up=^K:\ :tc=adm+sgr: # From: Andrew Scott Beals # Corrected by Olaf Siebert , 11 May 1995 # (adm12: removed obsolete ":kn:ma=j^Jk^P^K^Pl ^R^L^L :". This formerly had # :is:=\Eq but that looked wrong; this :is: is from Dave Yost # via BRL. That entry asserted :sg#1:, but I've left that out because # neither earlier nor later ADMSs have it -- esr) adm12|lsi adm12:\ :am:bs:mi:pt:\ :co#80:it#8:li#24:ug#1:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E0:\ :dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:ic=\EQ:im=\Eq:\ :is=\E0 \E1 \E1 \E1 \E1 \E1 \E1 \E1 \E1:\ :k0=^A0\r:k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:k5=^A5\r:\ :k6=^A6\r:k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^J:kl=^H:kr=^L:\ :ku=^K:le=^H:nd=^L:st=\E1:up=^K:\ :tc=adm+sgr: # (adm20: removed obsolete ":kn#7:" -- esr) adm20|lear siegler adm20:\ :am:bs:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:\ :cm=\E=%i%r%+^_%+^_:cr=^M:dc=\EW:dl=\ER:ei=:ho=^^:ic=\EQ:\ :im=:k1=^A:k2=^B:k3=^W:k4=^D:k5=^E:k6=^X:k7=^Z:le=^H:me=\E(:\ :nd=^L:se=\E(:so=\E):ta=^I:up=^K: adm21|lear siegler adm21:\ :sg#1:\ :al=30*\EE:bl=^G:cd=\EY:ce=\ET:cr=^M:dc=\EW:dl=30*\ER:do=^J:\ :ei=:ic=\EQ:im=:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:mk@:sf=^J:\ :tc=adm+sgr:tc=adm3a: # (adm22: ":em=:" was an obvious typo for ":ei=:"; also, # removed obsolete ":kn#7:ma=j^Jk^P^K^Pl ^R^L^L :"; # removed bogus-looking \200 from before :cm:. -- esr) adm22|lsi adm22:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:\ :is=\E%\014\014\014\016\003\200\003\002\003\002\200\200\200\200\200\200\200\200\200\200\200:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:l1=F1:l2=F2:\ :l3=F3:l4=F4:l5=F5:l6=F6:l7=F7:le=^H:me=\E(:nd=^L:se=\E(:\ :so=\E):ta=\Ei:up=^K: # ADM 31 DIP Switches # # This information comes from two versions of the manual for the # Lear-Siegler ADM 31. # # Main board: # rear of case # +-||||-------------------------------------+ # + S1S2 ||S + # + ||3 + # + + # + ||S + # + ||4 + # + + # + + # + + # + + # + + # +-+ +-+ # + + # + S5 S6 S7 + # + == == == + # +----------------------------------------------+ # front of case (keyboard) # # S1 - Data Rate - Modem # S2 - Data Rate - Printer # ------------------------ # Data Rate Setting # ------------------- # 50 0 0 0 0 # 75 1 0 0 0 # 110 0 1 0 0 # 134.5 1 1 0 0 # 150 0 0 1 0 # 300 1 0 1 0 # 600 0 1 1 0 # 1200 1 1 1 0 # 1800 0 0 0 1 # 2000 1 0 0 1 # 2400 0 1 0 1 # 3600 1 1 0 1 # 4800 0 0 1 1 # 7200 1 0 1 1 # 9600 0 1 1 1 # x 1 1 1 1 # # S3 - Interface/Printer/Attributes # --------------------------------- # Printer Busy Control # sw1 sw2 sw3 # --------------- # off off off Busy not active, CD disabled # off off on Busy not active, CD enabled # off on off Busy active on J5-20, CD disabled # on off off Busy active on J5-19, CD disabled - Factory Set. # on off on Busy active on J5-19, CD enabled # # sw4 Used in conjuction with S4 for comm interface control - Fact 0 # # sw5 Secondary Channel Control (Hardware implementation only) - Fact 0 # # sw6 ON enables printer BUSY active LOW - Factory Setting # OFF enables printer BUSY active HIGH - If set to this, ADM31 senses # # sw7 ON - steady cursor - Factory Setting # OFF - blinking cursor # # sw8 ON causes selected attribute character to be displayed # OFF causes SPACE to be displayed instead - Factory Setting # # S4 - Interface # -------------- # Modem Interface # S3 S4 S4 S4 S4 # sw4 sw1 sw2 sw3 sw4 # --------------------------- # OFF ON OFF ON OFF Enable RS-232C interface, Direct Connect and # Current Loop disabled - Factory Setting # ON ON OFF ON OFF Enable Current Loop interface, Direct Connect # disabled # OFF OFF ON OFF ON Enable Direct Connect interface, RS-232C and # Current Loop Disabled # # sw5 ON disables dot stretching mode - Factory Setting # OFF enables dot stretching mode # sw6 ON enables blanking function # OFF enables underline function - Factory Setting # sw7 ON causes NULLS to be displayed as NULLS # OFF causes NULLS to be displayed as SPACES - Factory Setting # # S5 - Word Structure # ------------------- # sw1 ON enables BREAK key - Factory Setting # OFF disables BREAK key # sw2 ON selects 50Hz monitor refresh rate # OFF selects 60Hz monitor refresh rate - Factory Setting # # Modem Port Selection # sw3 sw4 sw5 # --------------- # ON ON ON Selects 7 DATA bits, even parity, 2 STOP bits # OFF ON ON Selects 7 DATA bits, odd parity, 2 STOP bits # ON OFF ON Selects 7 DATA bits, even parity, 1 STOP bit - Factory Set. # OFF OFF ON Selects 7 DATA bits, odd parity, 1 STOP bit # ON ON OFF Selects 8 DATA bits, no parity, 2 STOP bits # OFF ON OFF Selects 8 DATA bits, no parity, 1 STOP bit # ON OFF OFF Selects 8 DATA bits, even parity, 1 STOP bit # OFF OFF OFF Selects 8 DATA bits, odd parity, 1 STOP bit # # sw6 ON sends bit 8 a 1 (mark) # OFF sends bit 8 as 0 (space) - Factory Setting # sw7 ON selects Block Mode # OFF selects Conversation Mode - Factory Setting # sw8 ON selects Full Duplex operation # OFF selects Half Duplex operation - Factory Setting # # S6 - Printer # ------------ # sw1, sw2, sw6, sw7 Reserved - Factory 0 # # Printer Port Selection # same as Modem above, bit 8 (when 8 DATA bits) is always = 0 # # sw8 ON enables Printer Port # OFF disables Printer Port - Factory Setting # # S7 - Polling Address # -------------------- # sw1-7 Establish ASCII character which designates terminal polling address # ON = logic 0 # OFF = logic 1 - Factory Setting # sw8 ON enables Polling Option # OFF disables Polling Option - Factory Setting # # # On some older adm31s, S4 does not exist, and S5-sw6 is not defined. # # This adm31 entry uses underline as the standout mode. # If the adm31 gives you trouble with standout mode, check the DIP switch in # position 6, bank @c11, 25% from back end of the circuit board. Should be # OFF. If there is no such switch, you have an old adm31 and must use oadm31. # (adm31: removed obsolete ":ma=j^Jk^P^K^Pl ^R^L^L :" -- esr) adm31|lsi adm31 with sw6 set for underline mode:\ :am:bs:mi:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:is=\Eu\E0:k0=^A0\r:\ :k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:k5=^A5\r:k6=^A6\r:\ :k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:\ :me=\EG0:nd=^L:se=\EG0:sf=^J:so=\EG1:ue=\EG0:up=^K:us=\EG1: adm31-old|o31|old adm31:\ :so=\EG4:ue@:us@:tc=adm31: # LSI ADM-36 from Col. George L. Sicherman via BRL adm36|LSI ADM36:\ :bs:pt:\ :kn#4:\ :if=/usr/share/tabset/vt100:\ :is=\E<\E>\E[6;?2;?7;?8h\E[4;20;?1;?3;?4;?5;?6;?18;?19l:tc=vt100: # (adm42: removed obsolete ":ma=^K^P:" -- esr) adm42|lsi adm42:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E;:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=\Er:im=\Eq:ip=:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:mk@:nd=^L:pc=\177:sf=^J:ta=^I:ue@:\ :up=^K:us@:vs=\EC\E3 \E3(:\ :tc=adm+sgr: # The following termcap for the Lear Siegler ADM-42 leaves the # "system line" at the bottom of the screen blank (for those who # find it distracting otherwise) adm42-ns|lsi adm-42 with no system line:\ :al=\EE\EF \011:bt=\EI\EF \011:cd=\EY\EF \011:\ :ce=\ET\EF \011:cl=\E;\EF \011:cm=\E=%+ %+ \EF \011:\ :dc=\EW\EF \011:dl=\ER\EF \011:ei=\Er\EF \011:\ :im=\Eq\EF \011:tc=adm42: # ADM 1178 terminal -- rather like an ADM-42. Manual is dated March 1 1985. # The insert mode of this terminal is commented out because it's broken for our # purposes in that it will shift the position of every character on the page, # not just the cursor line! # From: Michael Driscoll 10 July 1996 adm1178|1178|lsi adm1178:\ :am:\ :co#80:li#24:sg#1:ug#1:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ho=^^:ip=6*:kb=^H:kd=^J:kl=^H:\ :le=^H:md=\E(:me=\E):mr=\EG4:nd=^L:nw=^M^J:pc=\177:se=\EG0:\ :sf=^J:so=\EG4:ta=^I:ue=\EG0:up=^K:us=\EG1:vs=\EC\E3 \E3(: #### Prime # # Yes, Prime makes terminals. These entries were posted by Kevin J. Cummings # on 14 Dec 1992 and lightly edited by esr. # # Standout mode is dim reverse-video. pt100|pt200|wren|fenix|prime pt100/pt200:\ :am:bw:mi:ms:\ :co#80:it#8:li#24:\ :DC=\E[%dP:DL=\E[M:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:al=\E[L\E[t:bt=\E[Z:cd=\E[J\E[r:ce=\E[K\E[t:\ :cl=\E?:cm=\E0%+\%+\:cr=^M:dc=\E[P:do=\ED:ei=\E[4l:ho=\E$B:\ :im=\E[4h:kb=^H:kd=\E[B:ke=\E[>13l:kh=\E$A:kl=\E[D:kr=\E[C:\ :ks=\E[>13h:ku=\E[A:le=^H:me=\E[m:mh=\E[2m:nd=\E[C:nw=^M^J:\ :se=\E[m:sf=^J:so=\E[2;7m:ta=^I:te=:\ :ti=\E[>1l\E[>2l\E[>16l\E[4l\E[>9l\E[20l\E[>3l\E[>7h\E[>12l\E[1Q:\ :ue=\E[m:up=\EM:us=\E[4m:vb=\E$\E$P: pt100w|pt200w|wrenw|fenixw|prime pt100/pt200 in 132-column mode:\ :co#132:\ :cm=\E[%i%d;%dH:tc=pt100: pt250|Prime PT250:\ :se@:so@:tc=pt100: pt250w|Prime PT250 in 132-column mode:\ :se@:so@:tc=pt100w: #### Qume (qvt) # # Qume, Inc. # 3475-A North 1st Street # San Jose CA 95134 # Vox: (800)-457-4447 # Fax: (408)-473-1510 # Net: josed@techsupp.wyse.com (Jose D'Oliveira) # # Qume was bought by Wyse, but still (as of early 1995) has its own support # group and production division. # # Discontinued Qume models: # # The qvt101 and qvt102 listed here are long obsolete; so is the qvt101+ # built to replace them, and a qvt119+ which was a 101+ with available wide # mode (132 columns). There was a qvt103 which added vt100/vt131 emulations # and an ANSI-compatible qvt203 that replaced it. Qume started producing # ANSI-compatible terminals with the qvt323 and qvt61. # # Current Qume models (as of February 1995): # # All current Qume terminals have ANSI-compatible operation modes. # Qume is still producing the qvt62, which features emulations for other # popular lines such as ADDS, and dual-host capabilities. The qvt82 is # designed for use as a SCO ANSI terminal. The qvt70 is a color terminal # with many emulations including Wyse370, Wyse 325, etc. Their newest # model is the qvt520, which is vt420-compatible. # # There are some ancient printing Qume terminals under `Daisy Wheel Printers' qvt101|qvt108|qume qvt 101 and QVT 108:\ :sg#1:tc=qvt101+: # This used to have :vs=\E.2: but no :ve: or :vi:. The BSD termcap # file had :vs=\EM4 \200\200\200:. I've done the safe thing and yanked # both. The :mr: is from BSD, which also claimed bold=\E( and dim=\E). # What seems to be going on here is that this entry was designed so that # the normal highlight is bold and standout is dim plus something else # (reverse-video maybe? But then, are there two :mr: sequences?) qvt101+|qvt101p|qume qvt 101 PLUS product:\ :am:bw:hs:ul:\ :co#80:li#24:sg#0:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:\ :ct=\E3:dc=\EW:dl=\ER:do=^J:ds=\Eg\Ef\r:ei=:fs=^M:ho=^^:\ :ic=\EQ:im=:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:kA=\EE:\ :kB=\EI:kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:mk@:nd=^L:pf=\EA:po=\E@:se=\E(:sf=^J:\ :so=\E0P\E):st=\E1:ta=^I:ts=\Eg\Ef:up=^K:vb=\Eb\Ed:ve=\E.4:\ :tc=adm+sgr: qvt102|qume qvt 102:\ :ve=\E.:tc=qvt101: # (qvt103: added / based on init string -- esr) qvt103|qume qvt 103:\ :am:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :DO=\E[%dB:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: qvt103-w|qume qvt103 132 cols:\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=qvt103: qvt119+|qvt119p|qvt119|qume qvt 119 and 119PLUS terminals:\ :am:hs:mi:ms:\ :co#80:li#24:sg#0:\ :al=\EE:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E*1:cm=\E=%+ %+ :\ :cr=^M:ct=\E3:dc=\EW:dl=\ER:do=^J:ds=\Eg\Ef\r:ei=\Er:fs=^M:\ :ho=^^:im=\Eq:is=\EDF\EC\EG0\Er\E(\E%EX:k0=^AI\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:\ :ku=^K:le=^H:nd=^L:pf=\EA:po=\E@:sf=^J:sr=\EJ:st=\E1:ta=^I:\ :ts=\Eg\Ef:up=^K:us=\EG8:vb=\En0\En1:ve=\E.4:vs=\E.2:\ :tc=adm+sgr: qvt119+-25|qvt119p-25|QVT 119 PLUS with 25 data lines:\ :li#25:tc=qvt119+: qvt119+-w|qvt119p-w|qvt119-w|QVT 119 and 119 PLUS in 132 column mode:\ :co#132:\ :is=\EDF\EC\EG0\Er\E(\E%\EX\En4:tc=qvt119+: qvt119+-25-w|qvt119p-25-w|qvt119-25-w|QVT 119 and 119 PLUS 132 by 25:\ :li#25:tc=qvt119+: qvt203|qvt203+|qume qvt 203 Plus:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:ip=:k0=\E[29~:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:k9=\E[28~:sf=\n:\ :tc=qvt103: qvt203-w|qvt203-w-am|qume qvt 203 PLUS in 132 cols (w/advanced video):\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=qvt203: # # Since a command is present for enabling 25 data lines, # a specific terminfo entry may be generated for the 203. # If one is desired for the QVT 119 PLUS then 25 lines must # be selected in the status line (setup line 9). # qvt203-25|QVT 203 PLUS with 25 by 80 column mode:\ :co#80:li#25:\ :is=\E[=40h\E[?3l:tc=qvt203: qvt203-25-w|QVT 203 PLUS with 25 by 132 columns:\ :co#132:li#25:\ :r2=\E[?3h\E[=40h:tc=qvt203: #### Televideo (tvi) # # TeleVideo # 550 East Brokaw Road # PO Box 49048 95161 # San Jose CA 95112 # Vox: (408)-954-8333 # Fax: (408)-954-0623 # # # There are some tvi terminals that require incredible amounts of padding and # some that don't. I'm assuming tvi912 and tvi920 are the old slow ones, and # tvi912b, tvi912c, tvi920b, tvi920c are the new ones that don't need padding. # # All of these terminals (912 to 970 and the tvipt) are discontinued. Newer # Televideo terminals are ANSI and PC-ANSI compatible. tvi803|televideo 803:\ :cl=\E*:tc=tvi950: # Vanilla tvi910 -- W. Gish 10/29/86 # Switch settings are: # # S1 1 2 3 4 # D D D D 9600 # D D D U 50 # D D U D 75 # D D U U 110 # D U D D 135 # D U D U 150 # D U U D 300 # D U U U 600 # U D D D 1200 # U D D U 1800 # U D U D 2400 # U D U U 3600 # U U D D 4800 # U U D U 7200 # U U U D 9600 # U U U U 19200 # # S1 5 6 7 8 # U D X D 7N1 (data bits, parity, stop bits) (X means ignored) # U D X U 7N2 # U U D D 7O1 # U U D U 7O2 # U U U D 7E1 # U U U U 7E2 # D D X D 8N1 # D D X U 8N2 # D U D D 8O1 # D U U U 8E2 # # S1 9 Autowrap # U on # D off # # S1 10 CR/LF # U do CR/LF when CR received # D do CR when CR received # # S2 1 Mode # U block # D conversational # # S2 2 Duplex # U half # D full # # S2 3 Hertz # U 50 # D 60 # # S2 4 Edit mode # U local # D duplex # # S2 5 Cursor type # U underline # D block # # S2 6 Cursor down key # U send ^J # D send ^V # # S2 7 Screen colour # U green on black # D black on green # # S2 8 DSR status (pin 6) # U disconnected # D connected # # S2 9 DCD status (pin 8) # U disconnected # D duplex # # S2 10 DTR status (pin 20) # U disconnected # D duplex # (tvi910: removed obsolete ":ma=^Kk^Ll^R^L:"; added :kh:, :le:, :do:, # :sf:, , , :am:, :ms: from SCO entry -- esr) tvi910|televideo model 910:\ :am:bs:ms:\ :co#80:it#8:li#24:sg#1:\ :bl=^G:bt=\EI:cd=\EY:ce=\ET:ch=\E]%+ :cl=^Z:cm=\E=%+ %+ :\ :cr=^M:cv=\E[%+ :do=^J:ho=\E=\001\001:\ :if=/usr/share/tabset/stdcrt:k0=^AI\r:k1=^A@\r:k2=^AA\r:\ :k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:\ :k9=^AH\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:mk@:nd=^L:\ :sf=^J:ta=^I:up=^K:\ :tc=adm+sgr: # From: Alan R. Rogers # as subsequently hacked over by someone at SCO # (tvi910+: removed obsolete ":ma=^K^P^L :" -- esr) # # Here are the 910+'s DIP switches (U = up, D = down, X = don't care): # # S1 1 2 3 4: # D D D D 9600 D D D U 50 D D U D 75 D D U U 110 # D U D D 135 D U D U 150 D U U D 300 D U U U 600 # U D D D 1200 U D D U 1800 U D U D 2400 U D U U 3600 # U U D D 4800 U U D U 7200 U U U D 9600 U U U U 19200 # # S1 5 6 7 8: # U D X D 7N1 U D X U 7N2 U U D D 7O1 U U D U 7O2 # U U U D 7E1 U U U U 7E2 D D X D 8N1 D D X U 8N2 # D U D D 8O1 D U U U 8E2 # # S1 9 Autowrap (U = on, D = off) # S1 10 CR/LF (U = CR/LF on CR received, D = CR on CR received) # S2 1 Mode (U = block, D = conversational) # S2 2 Duplex (U = half, D = full) # S2 3 Hertz (U = 50, D = 60) # S2 4 Edit mode (U = local, D = duplex) # S2 5 Cursor type (U = underline, D = block) # S2 6 Cursor down key (U = send ^J, D = send ^V) # S2 7 Screen colour (U = green on black, D = black on green) # S2 8 DSR status (pin 6) (U = disconnected, D = connected) # S2 9 DCD status (pin 8) (U = disconnected, D = connected) # S2 10 DTR status (pin 20) (U = disconnected, D = connected) # tvi910+|televideo 910+:\ :al=\EE:dc=\EW:dl=\ER:ei=:ho=^^:ic=\EQ:im=:k0=^A@\r:k1=^AA\r:\ :k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:\ :k8=^AH\r:k9=^AI\r:ll=\E=7 :\ :tc=tvi910: # (tvi912: removed obsolete ":ma=^K^P^L :", added :vb: and # :kh: from BRL entry -- esr) tvi912|tvi914|tvi920|old televideo 912/914/920:\ :am:bs:ms:pt:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EE:bl=^G:cd=\Ey:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E3:\ :dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:k0=^AI\r:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:k9=^AH\r:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:\ :nd=^L:se=\Ek:sf=^J:so=\Ej:st=\E1:ta=^I:ue=\Em:up=^K:us=\El:\ :vb=\Eb\Ed: # the 912 has a key that's like shift: 8 xmits "^A8\r". # The 920 has this plus real function keys that xmit different things. # Terminfo makes you use the funct key on the 912 but the real keys on the 920. tvi912c|tvi912b|new televideo 912:\ :al=\EE:dl=\ER:tc=tvi912: # set to page 1 when entering curses application (\E-17 ) # reset to page 0 when exiting curses application (\E-07 ) tvi912-2p|tvi920-2p|tvi-2p|televideo w/2 pages:\ :te=\E-07 :ti=\E-17 :tc=tvi912: # We got some new tvi912c terminals that act really weird on the regular # termcap, so one of our gurus worked this up. Seems that cursor # addressing is broken. tvi912cc|tvi912 at cowell college:\ :cm@:tc=tvi912c: # Here are the switch settings for the tvi920c: # # S1 (Line), and S3 (Printer) baud rates -- put one, and only one, switch down: # 2: 9600 3: 4800 4: 2400 5: 1200 # 6: 600 7: 300 8: 150 9: 75 # 10: 110 # # S2 UART/Terminal options: # Up Down # 1: Not used Not allowed # 2: Alternate character set Standard character set # 3: Full duplex Half duplex # 4: 50 Hz refresh 60 Hz refresh # 5: No parity Send parity # 6: 2 stop bits 1 stop bit # 7: 8 data bits 7 data bits # 8: Not used Not allowed on Rev E or lower # 9: Even parity Odd parity # 10: Steady cursor Blinking cursor # (On Rev E or lower, use W25 instead of switch 10.) # # S5 UART/Terminal options: # Open Closed # 1: P3-6 Not connected DSR received on P3-6 # 2: P3-8 Not connected DCD received on P3-8 # # 3 Open, 4 Open: P3-20 Not connected # 3 Open, 4 Closed: DTR on when terminal is on # 3 Closed, 4 Open: DTR is connected to RTS # 3 Closed, 4 Closed: Not allowed # # 5 Closed: HDX printer (hardware control) Rev. K with extension port off, # all data transmitted out of the modem port (P3) will also be # transmitted out of the printer port (P4). # # 6 Open, 7 Open: Not allowed # 6 Open, 7 Closed: 20ma current loop input # 6 Closed, 7 Open: RS232 input # 6 Closed, 7 Closed: Not allowed # # Jumper options: # If the jumper is installed, the effect will occur (the next time the terminal # is switched on). # # S4/W31: Enables automatic LF upon receipt of CR from # remote or keyboard. # S4/W32: Enables transmission of EOT at the end of Send. If not # installed, a carriage return is sent. # S4/W33: Disables automatic carriage return in column 80. # S4/W34: Selects Page Print Mode as initial condition. If not # installed, Extension Mode is selected. # tvi920b|tvi920c|new televideo 920:\ :al=\EE:dl=\ER:k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:\ :tc=tvi912: # Televideo 921 and variants # From: Tim Theisen 22 Sept 1995 # (tvi921: removed :ko=bt: before translation, I see no backtab cap; # also added empty to suppress tic warning -- esr) tvi921|televideo model 921 with sysline same as page & real vi function:\ :am:bs:hs:pt:xn:xs:\ :co#80:li#24:sg#0:\ :ac=:ae=\E%:al=\EE:as=\E$:cd=\EY:ce=\ET:cl=^Z:cm=3\E=%+ %+ :\ :cr=^M:dc=\EW:dl=1*\ER:do=^V:ds=\Ef\r\Eg:ei=:fs=\Eg:ho=^^:\ :ic=\EQ:if=/usr/share/tabset/stdcrt:im=:\ :is=\El\E"\EF1\E.3\017\EA\E<:kA=\EE:kC=^Z:kD=\EW:kE=\ET:\ :kI=\EQ:kL=1*\ER:kS=\EY:kb=^H:kd=^V:kl=^H:kr=^L:ku=^K:le=^H:\ :mk@:nd=^L:nw=^M^J:sf=^J:ta=^I:ts=\Ef\EG0:up=^K:ve=\E.3:\ :vs=\E.2:\ :tc=adm+sgr: # without the beeper # (tvi92B: removed :ko=bt: before translation, I see no backtab cap; # also added empty to suppress tic warning -- esr) tvi92B|televideo model 921 with sysline same as page & real vi function:\ :am:hs:xn:xs:\ :co#80:li#24:sg#0:\ :ac=:ae=\E%:al=\EE:as=\E$:cd=\EY:ce=\ET:cl=^Z:cm=3\E=%+ %+ :\ :cr=^M:dc=\EW:dl=1*\ER:do=^V:ds=\Ef\r\Eg:ei=:fs=\Eg:ho=^^:\ :ic=\EQ:if=/usr/share/tabset/stdcrt:im=:\ :is=\El\E"\EF1\E.3\017\EA\E<:kA=\EE:kC=^Z:kD=\EW:kE=\ET:\ :kI=\EQ:kL=1*\ER:kS=\EY:kb=^H:kd=^V:kl=^H:kr=^L:ku=^K:le=^H:\ :mk@:nd=^L:nw=^M^J:sf=^J:ta=^I:ts=\Ef\EG0:up=^K:vb=\Eb\Ed:\ :ve=\E.3:vs=\E.2:\ :tc=adm+sgr: # (tvi92D: removed :ko=bt: before translation, I see no backtab cap -- esr) tvi92D|tvi92B with DTR instead of XON/XOFF & better padding:\ :al=2*\EE:dl=2*\ER:is=\El\E"\EF1\E.3\016\EA\E<:kA=2*\EE:\ :kL=2*\ER:\ :tc=tvi92B: # (tvi924: This used to have :ds=\Es0:, :fs=\031:. I put the new strings # in from a BSD termcap file because it looks like they do something the # old ones skip -- esr) tvi924|televideo tvi924:\ :am:bw:hs:in:mi:ms:xn:xo:\ :co#80:it#8:li#24:sg#0:ws#80:\ :F1=^AK\r:F2=^AL\r:F3=^AM\r:F4=^AN\r:F5=^AO\r:al=\EE:bl=^G:\ :bt=\EI:cd=\Ey:ce=\Et:cl=\E*0:cm=\E=%+ %+ :cr=^M:\ :cs=\E_%+ %+ :ct=\E3:dc=\EW:dl=\ER:do=^V:ds=\Es0\Ef\031:\ :ei=:fs=\031\Es1:ho=^^:\ :i1=\017\E%\E'\E(\EDF\EC\EG0\EN0\Es0\Ev0:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:k0=^A@\r:k1=^AA\r:\ :k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:\ :k8=^AH\r:k9=^AI\r:k;=^AJ\r:kA=\EE:kC=\E*0:kD=\EW:kE=\Et:\ :kI=\EQ:kL=\ER:kS=\Ey:kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:\ :l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:l8=F9:l9=F10:\ :la=F11:le=^H:mb=\EG2:mk@:nd=^L:pk=\E|%+1%s\031:sf=^J:\ :sr=\Ej:st=\E1:ta=^I:ts=\Ef:up=^K:vb=\Eb\Ed:ve=\E.3:vi=\E.0:\ :vs=\E.1:\ :tc=adm+sgr: # TVI925 DIP switches. In each of these, D = Down and U = Up, # # Here are the settings for the external (baud) switches (S1): # # Position Baud # 7 8 9 10 [Printer] # 1 2 3 4 [Main RS232] # ----------------------------------------------------- # D D D D 9600 # D D D U 50 # D D U D 75 # D D U U 110 # D U D D 135 # D U D U 150 # D U U D 300 # D U U U 600 # U D D D 1200 # U D D U 1800 # U D U D 2400 # U D U U 3600 # U U D D 4800 # U U D U 7200 # U U U D 9600 # U U U U 19200 # # # Settings for word length and stop-bits (S1) # # Position Description # 5 6 # --------------------------- # U - 7-bit word # D - 8-bit word # - U 2 stop bits # - D 1 stop bit # # # S2 (external) settings # # Position Up Dn Description # -------------------------------------------- # 1 X Local edit # X Duplex edit (transmit editing keys) # -------------------------------------------- # 2 X 912/920 emulation # X 925 # -------------------------------------------- # 3 X # 4 X No parity # 5 X # -------------------------------------------- # 3 X # 4 X Odd parity # 5 X # -------------------------------------------- # 3 X # 4 X Even parity # 5 X # -------------------------------------------- # 3 X # 4 X Mark parity # 5 X # -------------------------------------------- # 3 X # 4 X Space parity # 5 X # -------------------------------------------- # 6 X White on black display # X Black on white display # -------------------------------------------- # 7 X Half Duplex # 8 X # -------------------------------------------- # 7 X Full Duplex # 8 X # -------------------------------------------- # 7 X Block mode # 8 X # -------------------------------------------- # 9 X 50 Hz # X 60 Hz # -------------------------------------------- # 10 X CR/LF (Auto LF) # X CR only # # S3 (internal switch) settings: # # Position Up Dn Description # -------------------------------------------- # 1 X Keyclick off # X Keyclick on # -------------------------------------------- # 2 X English # 3 X # -------------------------------------------- # 2 X German # 3 X # -------------------------------------------- # 2 X French # 3 X # -------------------------------------------- # 2 X Spanish # 3 X # -------------------------------------------- # 4 X Blinking block cursor # 5 X # -------------------------------------------- # 4 X Blinking underline cursor # 5 X # -------------------------------------------- # 4 X Steady block cursor # 5 X # -------------------------------------------- # 4 X Steady underline cursor # 5 X # -------------------------------------------- # 6 X Screen blanking timer (ON) # X Screen blanking timer (OFF) # -------------------------------------------- # 7 X Page attributes # X Line attributes # -------------------------------------------- # 8 X DCD disconnected # X DCD connected # -------------------------------------------- # 9 X DSR disconnected # X DSR connected # -------------------------------------------- # 10 X DTR Disconnected # X DTR connected # -------------------------------------------- # # (tvi925: BSD has :cl=\E*:. I got :is: and :sr: from there -- esr) tvi925|televideo 925:\ :am:bs:bw:hs:ul:\ :co#80:li#24:sg#1:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:\ :ct=\E3:dc=\EW:dl=\ER:do=^V:ds=\Eh:ei=:fs=^M\Eg:ho=^^:ic=\EQ:\ :im=:is=\El\E":k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:\ :kA=\EE:kC=^Z:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^V:\ :kh=^^:kl=^H:kr=^L:ku=^K:le=^H:mk@:nd=^L:sf=^J:sr=\Ej:st=\E1:\ :ta=^I:ts=\Eh\Ef:up=^K:vb=\Eb\Ed:ve=\E.4:vs=\E.2:\ :tc=adm+sgr: # TeleVideo 925 from Mitch Bradley via BRL # to avoid "magic cookie" standout glitch: tvi925-hi|TeleVideo Model 925 with half intensity standout mode:\ :sg@:\ :kb=^H:kd=^J:kl=^H:se=\E(:so=\E):tc=tvi925: # From: Todd Litwin 28 May 1993 # Originally Tim Curry, Univ. of Central Fla., 5/21/82 # for additional capabilities, # The following tvi descriptions from B:pjphar and virus!mike # is for all 950s. It sets the following attributes: # full duplex (\EDF) write protect off (\E() # conversation mode (\EC) graphics mode off (\E%) # white on black (\Ed) auto page flip off (\Ew) # turn off status line (\Eg) clear status line (\Ef\r) # normal video (\E0) monitor mode off (\EX or \Eu) # edit mode (\Er) load blank char to space (\Ee\040) # line edit mode (\EO) enable buffer control (^O) # protect mode off (\E\047) duplex edit keys (\El) # program unshifted send key to send line all (\E016) # program shifted send key to send line unprotected (\E004) # set the following to nulls: # field delimiter (\Ex0\200\200) # line delimiter (\Ex1\200\200) # start-protected field delimiter (\Ex2\200\200) # end-protected field delimiter (\Ex3\200\200) # set end of text delimiter to carriage return/null (\Ex4\r\200) # # TVI 950 Switch Setting Reference Charts # # TABLE 1: # # S1 1 2 3 4 5 6 7 8 9 10 # +-----------------------+-----+-----+-----------------------+ # | Computer Baud Rate |Data |Stop | Printer Baud Rate | # | |Bits |Bits | | # +------+-----------------------+-----+-----+-----------------------+ # | Up | See | 7 | 2 | See | # +------+-----------------------+-----+-----+-----------------------+ # | Down | TABLE 2 | 8 | 1 | TABLE 2 | # +------+-----------------------+-----+-----+-----------------------+ # # # S2 1 2 3 4 5 6 7 8 9 10 # +-----+-----+-----------------+-----+-----------+-----+-----+ # |Edit |Cursr| Parity |Video|Transmiss'n| Hz |Click| # +------+-----+-----+-----------------+-----+-----------+-----+-----+ # | Up | Dplx|Blink| See |GonBk| See | 60 | Off | # +------+-----+-----+-----------------+-----+-----------+-----+-----+ # | Down |Local|St'dy| TABLE 3 |BkonG| CHART | 50 | On | # +------+-----+-----+-----------------+-----+-----------+-----+-----+ # # TABLE 2: # # +-----------+-----+-----+-----+-----+-----------+ # | Display | 1 | 2 | 3 | 4 | Baud | # +-----------+-----+-----+-----+-----+ | # | Printer | 7 | 8 | 9 | 10 | Rate | # +-----------+-----+-----+-----+-----+-----------+ # | D | D | D | D | 9600 | # | U | D | D | D | 50 | # | D | U | D | D | 75 | # | U | U | D | D | 110 | # | D | D | U | D | 135 | # | U | D | U | D | 150 | # | D | U | U | D | 300 | # | U | U | U | D | 600 | # | D | D | D | U | 1200 | # | U | D | D | U | 1800 | # | D | U | D | U | 2400 | # | U | U | D | U | 3600 | # | D | D | U | U | 4800 | # | U | D | U | U | 7200 | # | D | U | U | U | 9600 | # | U | U | U | U | 19200 | # +-----+-----+-----+-----+-----------+ # # TABLE 3: # +-----+-----+-----+-----------+ # | 3 | 4 | 5 | Parity | # +-----+-----+-----+-----------+ # | X | X | D | None | # | D | D | U | Odd | # | D | U | U | Even | # | U | D | U | Mark | # | U | U | U | Space | # +-----+-----+-----+-----------+ # X = don't care # # CHART: # +-----+-----+-----------------+ # | 7 | 8 | Communication | # +-----+-----+-----------------+ # | D | D | Half Duplex | # | D | U | Full Duplex | # | U | D | Block | # | U | U | Local | # +-----+-----+-----------------+ # # (tvi950: early versions had obsolete ":ma=^Vj^Kk^Hh^Ll^^H:". # I also inserted :ic: and :kI:; the :ko: string indicated that :IC: # should be present and all tvi native modes use the same string for this. # Finally, note that BSD has cud1=^V. -- esr) tvi950|televideo 950:\ :am:bs:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:sg#1:\ :ac=d\rc\014e\nb\011i\013:ae=^X:al=\EE:as=^U:bl=^G:bt=\EI:\ :cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :cr=^M:ct=\E3:dc=\EW:\ :dl=\ER:do=^J:ds=\Eg\Ef\r:ei=\Er:fs=^M:ho=^^:ic=\EQ:im=\Eq:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\Ef\r:\ :k0=^A0\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=\EE:kB=\EI:kC=\E*:\ :kD=\EW:kE=\Et:kI=\EQ:kL=\ER:kS=\Ey:kb=^H:kd=^V:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:mk@:nd=^L:pf=\Ea:po=\E`:sf=^J:sr=\Ej:\ :st=\E1:ta=^I:ts=\Eg\Ef:up=^K:vb=\Eb\Ed:\ :tc=adm+sgr: # # is for 950 with two pages adds the following: # set 48 line page (\E\\2) # place cursor at page 0, line 24, column 1 (\E-07 ) # set local (no send) edit keys (\Ek) # # two page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 48 line page (\E\\2) # place cursor at 0,24,1 (\E-07 ) # set duplex (send) edit keys (\El) when entering vi # set local (no send) edit keys (\Ek) when exiting vi # tvi950-2p|televideo950 w/2 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\2\E-07 \011:\ :ke=\Ek:ks=\El:te=\E\2\E-07 :ti=\E\1\E-07 :\ :tc=tvi950: # # is for 950 with four pages adds the following: # set 96 line page (\E\\3) # place cursor at page 0, line 24, column 1 (\E-07 ) # # four page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 96 line page (\E\\3) # place cursor at 0,24,1 (\E-07 ) # tvi950-4p|televideo950 w/4 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\3\E-07 \011:\ :ke=\Ek:ks=\El:te=\E\3\E-07 :ti=\E\1\E-07 :\ :tc=tvi950: # # :is: for reverse video 950 changes the following: # set reverse video (\Ed) # # set vb accordingly (\Ed ...delay... \Eb) # tvi950-rv|televideo950 rev video:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200:\ :vb=\Ed\Eb:\ :tc=tvi950: # tvi950-rv-2p uses the appropriate entries from 950-2p and 950-rv tvi950-rv-2p|televideo950 rev video w/2 pages:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\2\E-07 :\ :ke=\Ek:ks=\El:te=\E\2\E-07 :ti=\E\1\E-07 :vb=\Ed\Eb:\ :tc=tvi950: # tvi950-rv uses the appropriate entries from 950-4p and 950-rv tvi950-rv-4p|televideo950 rev video w/4 pages:\ :is=\EDF\EC\Eb\EG0\Er\EO\E'\E(\E%\Ew\EX\Ee \017\011\Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\011\Ex3\200\200\Ex4\r\200\E\3\E-07 :\ :ke=\Ek:ks=\El:te=\E\3\E-07 :ti=\E\1\E-07 :vb=\Ed\Eb:\ :tc=tvi950: # From: Andreas Stolcke # (tvi955: removed obsolete ":ma:=^Vj^Kk^Hh^Ll^^H"; # removed incorrect (and overridden) ":do=^J:"; fixed broken continuations in # the :rs: string, inserted the :IC: implied by the termcap :ko: string. Note # the :ko: string had :cl: in it, which means that one of the original # :cl=\E*:, had to be wrong; set because that's what # the 950 has. Finally, corrected the string to match the 950 and what # ko implies -- esr) # If the BSD termcap file was right, :cm=\E=%p1%{32}%+%c%p2%{32}%+%c: would # also work. tvi955|televideo 955:\ :5i:bs:ms@:\ :it#8:sg@:\ :RA=\E[=7l:RX=^N:SA=\E[=7h:SX=^O:\ :ac=0_`RjHkGlFmEnIoPqKsQtMuLvOwNxJ:ae=\E%:as=\E$:\ :cm=\E[%i%d;%dH:do=^V:is=\E[=3l\EF1\Ed\EG0\E[=5l\E%\El:\ :kM=\EQ:kN=\EK:kP=\EJ:kT=\E1:ka=\E3:kt=\E2:mb=\EG2:\ :me=\EG0\E[=5l:mh=\E[=5h:mk=\EG1:ps=\EP:\ :r1=\EDF\EC\Eg\Er\EO\E'\E(\Ew\EX\Ee \017\E0P\E6\200\E0p\E4\200\Ef\r:\ :sf@:ve=\E.2:vi=\E.0:vs=\E.1:\ :tc=tvi950: tvi955-w|955-w|televideo955 w/132 cols:\ :co#132:\ :is=\E[=3h\EF1\Ed\EG0\E[=5l\E%\El:tc=tvi955: # use half-intensity as normal mode, full intensity as :md: tvi955-hb|955-hb|televideo955 half-bright:\ :is=\E[=3l\EF1\Ed\EG0\E[=5h\E%\El:md=\E[=5l:\ :me=\EG0\E[=5h:mh@:tc=tvi955: # From: Humberto Appleton , 880521 UT Austin # (tvi970: removed ":sg#0:"; removed :se:=\E[m, :ue:=\E[m; # added :am:/:cs:/:ho:///:ti:/:te: from BRL. # According to BRL we could have :ke:=\E>, :ks:=\E= but I'm not sure what # it does to the function keys. I deduced /. # also added empty to suppress tic warning, -- esr) tvi970|televideo 970:\ :am:bs:da:db:mi:ms:pt:\ :co#80:it#8:li#24:\ :RA=\E[?7h:SA=\E[?7l:ac=:ae=\E(B:al=\E[L:as=\E(B:bt=\E[Z:\ :cd=\E[J:ce=\E[K:ch=\E[%i%dG:cl=\E[H\E[2J:cm=\E[%i%d;%df:\ :cs=\E[%i%d;%dr:cv=\E[%i%dd:dc=\E[P:dl=\E[M:do=\ED:\ :ds=\Eg\Ef\r:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E<\E[?21l\E[19h\E[1Q\E[10l\E[7l\E[H\E[2J:k1=\E?a:\ :k2=\E?b:k3=\E?c:k4=\E?d:k5=\E?e:k6=\E?f:k7=\E?g:k8=\E?h:\ :k9=\E?i:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:sr=\EM:ta=^I:te=:\ :ti=\E[?20l\E[?7h\E[1Q:ue=\E[m:up=\EM:us=\E[4m:\ :vb=\E[5m\E[m:vs=\E[1Q: tvi970-vb|televideo 970 with visual bell:\ :vb=\E[?5h\200\200\200\200\200\200\200\200\200\200\200\200\200\E[?5l:tc=tvi970: tvi970-2p|televideo 970 with using 2 pages of memory:\ :te=\E[H\E[J\E[V:ti=\E[U\E[?20l\E[?7h\E[1Q:\ :tc=tvi970: # Works with vi and rogue. NOTE: Esc v sets autowrap on, Esc u sets 80 chars # per line (rather than 40), Esc K chooses the normal character set. Not sure # padding is needed, but adapted from the tvi920c termcap. The :so: and # :us: strings are klutzy, but at least use no screen space. # (tvipt: removed obsolete ":ma=^Kk^Ll^R^L:". I wish we knew , # its absence means =\Ev isn't save to use. -- esr) # From: Gene Rochlin 9/19/84. # The :cd:/:k0:/:k1:/:kh:/, and caps are from BRL, which says: # F1 and F2 should be programmed as ^A and ^B; required for UNIFY. tvipt|televideo personal terminal:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :dl=\ER:\ :ho=^^:if=/usr/share/tabset/stdcrt:is=\Ev\Eu\EK:k0=^A:\ :k1=^B:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:pf=^T:\ :po=^R:se=\EF:so=\EG1@A\EH:ue=\EF:up=^K:us=\EG1B@\EH: # From: Nathan Peterson , 03 Sep 1996 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) tvi9065|televideo 9065:\ :am:bw:hs:mi:ms:xn:xo:\ :co#80:it#8:li#25:lm#0:ma#4:vt#0:ws#30:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ae=\E%:\ :al=\EE:as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:\ :cm=\E=%+ %+ :cr=^M:cs=\E[%i%d;%dr:ct=\E3:dc=\EW:dl=\ER:\ :dm=\Er:do=^V:ds=\E_30\r:ec=\E[%d@:ed=\200:ei=\Er:fs=^M:\ :ho=^^:\ :i1=\E"\E%\E'\E(\EG@\EO\EX\E[=5l\E[=6l\E[=7h\Ed\Er:\ :i2=\E<\E[=4l\E[=8h:if=/usr/share/tabset/stdcrt:im=\Eq:\ :ip=:is=\EF2\EG0\E\L:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kb=^H:\ :kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=\E[25;1H:mb=\EG2:\ :md=\EG\054:me=\EG0:mh=\EGp:mr=\EG4:nd=^L:nw=^M^J:\ :rp=\E[%r%db%.:se=\EG0:sf=^J:so=\EGt:sr=\Ej:st=\E1:ta=^I:\ :te=\E.3\Er\E[1;25r\E[25;0H:ti=\E.2:ts=\E[4;1v\E_30:\ :uc=\EG8\EG0:ue=\EG0:up=^K:us=\EG8:vb=\Eb\Ed:ve=\E.3:\ :vi=\E.0:vs=\E.2: #### Visual (vi) # # In September 1993, Visual Technology of Westboro, Massachusetts, # merged with White Pine Software of Nashua, New Hampshire. # # White Pine Software may be contacted at +1 603/886-9050. # Or visit White Pine on the World Wide Web at URL http://www.wpine.com. # # Visual 50 from Beau Shekita, BTL-Whippany # Recently I hacked together the following termcap for Visual # Technology's Visual 50 terminal. It's a slight modification of # the vt52 termcap. # It's intended to run when the Visual 50 is in vt52 emulation mode # (I know what you're thinking; if it's emulating a vt52, then why # another termcap? Well, it turns out that the Visual 50 can handle # :dl: and db(?) among other things, which the vt52 can't) # The termcap works OK for the most part. The only problem is on # character inserts. The whole line gets painfully redrawn for each # character typed. Any suggestions? # Beau's entry is combined with the vi50 entry from University of Wisconsin. # Note especially the :al: function. :k4:-:k6: are really l4-l6 in # disguise; :k7:-:k9: are really l1-l3. vi50|visual 50:\ :am:bs:da:db:ms:pt:\ :co#80:it#8:li#24:\ :al=\EL:bl=^G:bt=4\Ez:cd=\EJ:ce=16\EK:cl=\EH\EJ:\ :cm=\EY%+ %+ :cr=^M:dl=3*\EM:do=\EB:ho=\EH:k1=\EP:k2=\EQ:\ :k3=\ER:k4=\EV:k5=\EE:k6=\E]:k7=\EL:k8=\Ev:k9=\EM:kb=^H:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:nl=^J:\ :nw=^M^J:se=\ET:sf=^J:so=\EU:sr=\EI:ta=^I:ue=\EW:up=\EA:\ :us=\ES: # this one was BSD & SCO's vi50 vi50adm|visual 50 in adm3a mode:\ :am:ms:\ :co#80:it#8:li#24:\ :al=\EL:bl=^G:cd=\Ek:ce=\EK:cl=^Z:cm=\E=%+ %+ :cr=^M:dl=\EM:\ :do=^J:ho=\EH:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:\ :nd=^L:se=\ET:sf=^J:so=\EU:ta=^I:up=^K: # From: Jeff Siegal vi55|Visual 55:\ :am:bs:mi:ms:\ :co#80:it#8:li#24:\ :al=\EL:cd=\EJ:ce=\EK:cl=\Ev:cm=\EY%+ %+ :cs=\E_%+A%+A:\ :dc=\Ew:dl=\EM:do=^J:ei=\Eb:ho=\EH:im=\Ea:\ :is=\Ev\E_AX\Eb\EW\E9P\ET:kb=^H:kd=\EB:kl=\ED:kr=\EC:\ :ku=\EA:le=^H:nd=\EC:se=\ET:so=\EU:sr=\EI:ta=^I:up=\EA: # Visual 200 from BRL # The following switch settings are assumed for normal operation: # FULL_DUPLEX SCROLL CR # AUTO_NEW_LINE_ON VISUAL_200_EMULATION_MODE # Other switches may be set for operator convenience or communication # requirements. # Character insertion is kludged in order to get around the "beep" misfeature. # (This cap is commented out because :im:/:ei: is more efficient -- esr) # Supposedly "4*" delays should be used for :al:, :cd:, :cl:, :dc:, # and :dl: strings, but we seem to get along fine without them. vi200|visual 200:\ :am:bs:mi:ms:pt:\ :co#80:it#8:kn#10:li#24:\ :ac=:ae=\EG:al=\EL:as=\EF:bl=^G:bt=\Ez:cd=\Ey:ce=\Ex:cl=\Ev:\ :cm=\EY%+ %+ :cr=^M:ct=\Eg:dc=\EO:dl=\EM:do=^J:ho=\EH:\ :k0=\E?p:k1=\E?q:k2=\E?r:k3=\E?s:k4=\E?t:k5=\E?u:k6=\E?v:\ :k7=\E?w:k8=\E?x:k9=\E?y:kA=\EL:kC=\Ev:kD=\EO:kE=\Et:kI=\Ei:\ :kL=\EM:kM=\Ej:kS=\EJ:kT=\E1:kb=^H:kd=\EB:ke=\E>:kh=\EH:\ :kl=\ED:kr=\EC:ks=\E=:kt=\E2:ku=\EA:le=^H:me=\E3\Eb:mh=\E4:\ :mk=\Ea:nd=\EC:pf=\EX:po=\EW:ps=\EH\E]:\ :r1=\E3\Eb\Ej\E\\El\EG\Ec\Ek\EX:se=\E3:sf=^J:so=\E4:\ :sr=\EI:st=\E1:ta=^I:up=\EA:ve=\Ec:vs=\Ed: # The older Visuals didn't come with function keys. This entry uses # :ks: and :ke: so that the keypad keys can be used as function keys. # If your version of vi doesn't support function keys you may want # to use vi200-f. vi200-f|visual 200 no function keys:\ :is=\E3\Eb\Ej\E\\El\EG\Ed\Ek:k0=\E?p:k1=\E?q:k2=\E?r:\ :k3=\E?s:k4=\E?t:k5=\E?u:k6=\E?v:k7=\E?w:k8=\E?x:k9=\E?y:\ :ke=\E>:ks=\E=:se@:so@:\ :tc=vi200: vi200-rv|visual 200 reverse video:\ :se=\E3:so=\E4:sr@:ve@:vs@:tc=vi200: # the function keys are programmable but we don't reprogram them to their # default values with :is: because programming them is very verbose. maybe # an initialization file should be made for the 300 and they could be stuck # in it. # (vi300: added / based on init string -- esr) vi300|visual 300 ansi x3.64:\ :am:bw:mi:xn:\ :co#80:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[7s\E[2;3;4;20;?5;?6l\E[12;?7h\E[1Q\E[0;1(D\E[8s:\ :k1=\E_A\E\:k2=\E_B\E\:k3=\E_C\E\:k4=\E_D\E\:k5=\E_E\E\:\ :k6=\E_F\E\:k7=\E_G\E\:k8=\E_H\E\:k9=\E_I\E\:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[C:\ :se=\E[m:sf=^J:so=\E[1m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m: # some of the vi300s have older firmware that has the command # sequence for setting editing extent reversed. vi300-old|visual 300 with old firmware (set edit extent reversed):\ :is=\E[7s\E[2;3;4;20;?5;?6l\E[12;?7h\E[2Q\E[0;1(D\E[8s:\ :tc=vi300: # Visual 500 prototype entry from University of Wisconsin. # The best place to look for the escape sequences is page A1-1 of the # Visual 500 manual. The initialization sequence given here may be # overkill, but it does leave out some of the initializations which can # be done with the menus in set-up mode. # The :xp: line below is so that emacs can understand the padding requirements # of this slow terminal. :xp: is 10 time the padding factor. # (vi500: removed unknown :xp#4: termcap; # also added empty to suppress tic warning -- esr) vi500|visual 500:\ :am:mi:ms:\ :co#80:it#8:li#33:\ :ac=:ae=^O:al=3*\EL\Ex:as=^N:bt=4\Ez:cd=3*\Ey:ce=16\Ex:\ :cl=6*\Ev:cm=\EY%+ %+ :cr=^M:cs=\E(%+ %+ :dc=3*\EO:\ :dl=3*\EM:do=\EB:ei=\Ej:ho=\EH:im=\Ei:\ :is=\E3\E\001\E\007\E\003\Ek\EG\Ed\EX\El\E>\Eb\E\:\ :kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :nw=^M^J:se=\E^G:sf=^J:so=\E^H:ta=8\011:ue=\E^C:up=\EA:\ :us=\E^D: # The visual 550 is a visual 300 with tektronix graphics, # and with 33 lines. clear screen is modified here to # also clear the graphics. vi550|visual 550 ansi x3.64:\ :li#33:\ :cl=\030\E[H\E[2J:tc=vi300: vi603|visual603|visual 603:\ :hs:mi:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:ds=\EP2;1~\E\:ei=\E[4l:\ :fs=\E\:i1=\E>\E[?3l\E[?4l\E[?7h\E[?8h\E[1;24r:\ :im=\E[4h:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:ts=\EP2~:ue=\E[24m:\ :up=\E[A:us=\E[4m:\ :tc=vt100: #### Wyse (wy) # # Wyse Technology # 3471 North First Street # San Jose, CA 95134 # Vox: (408)-473-1200 # Fax: (408) 473-1222 # Web: http://www.wyse.com # # Wyse sales can be reached by phone at 1-800-GET-WYSE. Tech support is at # (800)-800-WYSE (option 5 gets you a human). There's a Web page at the # obvious address, http://www.wyse.com. # # Wyse bought out Link Technology, Inc. in 1990 and closed it down in 1995. # They now own the Qume and Amdek brands, too. So these are the people to # talk with about all Link, Qume, and Amdek terminals. # # Wyse has a BBS containing termcap and terminfo stuff for their terminals # (though this may not last long -- I expect the Web will kill it off by # mid-1997 or so). According to their tech support, at 800-800-9973, it's # at 408-922-4400 thru 4405. The 4400 modem is flaky as of 5/96, so # call 4401 etc. Come in at 9600 hard; don't use autospeed sense. # # All the following entries until (but not including) wy520 are direct from # Wyse technical support and represent their best knowledge as of January 1995. # I canceled the bel capacities in the vb entries. # I made two trivial syntax fixes in the wyse30 entry. # I made some entries relative to adm+sgr. # # # Note: The wyse75, wyse85, and wyse99 have been discontinued. # Although the Wyse 30 can support more than one attribute # it requires magic cookies to do so. Many applications do not # function well with magic cookies. The following terminfo uses # the protect mode to support one attribute (dim) without cookies. # If more than one attribute is needed then the wy30-mc terminfo # should be used. # wy30|wyse30|Wyse 30:\ :5i:am:bs:bw:hs:mi:ms:xo:\ :Nl#8:co#80:lh#1:li#24:lw#8:ma#1:ws#45:\ :#2=\E{:&3=\Er:@8=\E7:LF=\EA11:LO=\EA10:\ :ac=0wa_h[jukslrmqnxqzttuyv]wpxv:ae=\EH^C:al=\EE:\ :as=\EH^B:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:ei=\Er:fs=^M:\ :ho=^^:im=\Eq:ip=:is=\E'\E(\E\1363\E`9\016\024:k1=^A@\r:\ :k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:kA=\EE:kB=\EI:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kN=\EK:\ :kP=\EJ:kS=\EY:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:\ :ll=^^^K:me=\E(\EH\003:mh=\E`7\E):mp=\E`7\E):nd=^L:\ :nw=^M^J:pf=^T:pn=\Ez%+/%s\r:po=^X:ps=\EP:px=\Ez%+?%s\177:\ :..sa=%?%p1%p5%p8%|%|%t\E`7\E)%e\E(%;%?%p9%t\EH\002%e\EH\003%;:\ :se=\E(:sf=\n:so=\E`7\E):sr=\Ej:st=\E1:ta=\011:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0: # # This terminal description uses the non-hidden attribute mode # (with magic cookie). # # (wy30-mc: added :ti: to suppress tic warning --esr) wy30-mc|wyse30-mc|wyse 30 with magic cookies:\ :ms@:\ :ma@:sg#1:\ :ae=\EG0\EH\003:as=\EG0\EH\002:mb=\EG2:\ :me=\EG0\E(\EH\003:mh=\EGp:mp=\EG0\E):\ :..sa=\EG%'0'%?%p2%p6%|%t%{8}%|%;%?%p1%p3%|%p6%|%t%{4}%|%;%?%p4%t%{2}%|%;%?%p1%p5%|%t%{64}%|%;%?%p7%t%{1}%|%;%c%?%p8%t\E)%e\E(%;%?%p9%t\EH\002%e\EH\003%;:\ :te=\EG0:ti=:\ :tc=wy30:tc=adm+sgr: # The mandatory pause used by :vb: does not work with # older versions of terminfo. If you see this effect then # unset xon and delete the / from the delay. # i.e. change $<100/> to $<100> wy30-vb|wyse30-vb|wyse 30 visible bell:\ :bl@:tc=wy30: # # The Wyse 50 can support one attribute (e.g. Dim, Inverse, # Normal) without magic cookies by using the protect mode. # The following description uses this feature, but when more # than one attribute is put on the screen at once, all attributes # will be changed to be the same as the last attribute given. # The Wyse 50 can support more attributes when used with magic # cookies. The wy50-mc terminal description uses magic cookies # to correctly handle multiple attributes on a screen. # wy50|wyse50|Wyse 50:\ :5i:am:bs:bw:hs:mi:ms:xo:\ :Nl#8:co#80:lh#1:li#24:lw#8:ma#1:ws#45:\ :#2=\E{:%9=\EP:&3=\Er:@8=\E7:F1=^AJ\r:F2=^AK\r:F3=^AL\r:\ :F4=^AM\r:F5=^AN\r:F6=^AO\r:LF=\EA11:LO=\EA10:\ :ac=0wa_h[jukslrmqnxqzttuyv]wpxv:ae=\EH^C:al=\EE:\ :as=\EH^B:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:ei=\Er:fs=^M:\ :ho=^^:i1=\E`\072\E`9:im=\Eq:ip=:is=\016\024\E'\E(:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:kA=\EE:kB=\EI:kD=\EW:\ :kE=\ET:kI=\EQ:kL=\ER:kN=\EK:kP=\EJ:kS=\EY:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:me=\E(\EH\003:mh=\E`7\E):\ :mp=\E`7\E):mr=\E`6\E):nd=^L:nw=^M^J:pf=^T:pn=\Ez%+/%s\r:\ :po=^X:ps=\EP:px=\Ez%+?%s\177:\ :..sa=%?%p1%p3%|%t\E`6\E)\n%e%p5%p8%|%t\E`7\E)%e\E(%;\n%?%p9%t\EH\002%e\EH\003%;:\ :se=\E(:sf=\n:so=\E`6\E):sr=\Ej:st=\E1:ta=^I:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0: # # This terminal description uses the non-hidden attribute mode # (with magic cookie). # # The mandatory pause used by flash does not work with some # older versions of terminfo. If you see this effect then # unset :xo: and delete the / from the delay. # i.e. change $<100/> to $<100> # (wy50-mc: added :ti: to suppress tic warning --esr) wy50-mc|wyse50-mc|wyse 50 with magic cookies:\ :ms@:\ :ma@:sg#1:\ :ae=\EG0\EH\003:as=\EG0\EH\002:mb=\EG2:\ :me=\EG0\E(\EH\003:mh=\EGp:mp=\EG0\E):\ :..sa=\EG%'0'%?%p2%p6%|%t%{8}%|%;%?%p1%p3%|%p6%|%t%{4}%|%;%?%p4%t%{2}%|%;%?%p1%p5%|%t%{64}%|%;%?%p7%t%{1}%|%;%c%?%p8%t\E)%e\E(%;%?%p9%t\EH\002%e\EH\003%;:\ :so=\EGt:te=\EG0:ti=:\ :tc=wy50:tc=adm+sgr: wy50-vb|wyse50-vb|wyse 50 visible bell:\ :bl@:tc=wy50: wy50-w|wyse50-w|wyse 50 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:i1=\E`;\E`9:tc=wy50: wy50-wvb|wyse50-wvb|wyse 50 132-column visible bell:\ :bl@:\ :tc=wy50-w: # # The Wyse 350 is a Wyse 50 with color. # Unfortunately this means that it has magic cookies. # The color attributes are designed to overlap the reverse, dim and # underline attributes. This is nice for monochrome applications # because you can make underline stuff green (or any other color) # but for true color applications it's not so hot because you cannot # mix color with reverse, dim or underline. # To further complicate things one of the attributes must be # black (either the foreground or the background). In reverse video # the background changes color with black letters. In normal video # the foreground changes colors on a black background. # This terminfo uses some of the more advanced features of curses # to display both color and blink. In the final analysis I am not # sure that the wy350 runs better with this terminfo than it does # with the wy50 terminfo (with user adjusted colors). # # The mandatory pause used by flash does not work with # older versions of terminfo. If you see this effect then # unset xon and delete the / from the delay. # i.e. change $<100/> to $<100> # # Bug: The capability resets attributes. # (untranslatable capabilities removed to fit entry within 1023 bytes) wy350|wyse350|Wyse 350:\ :5i:am:bw:hs:mi:xo:\ :Co#8:NC#55:Nl#8:co#80:lh#1:li#24:lw#8:pa#8:sg#1:ws#45:\ :#2=\E{:%9=\EP:&3=\Er:@8=\E7:F1=^AJ\r:F2=^AK\r:F3=^AL\r:\ :F4=^AM\r:F5=^AN\r:F6=^AO\r:LF=\EA11:LO=\EA10:Sb=:\ :ac=0wa_h[jukslrmqnxqzttuyv]wpxv:ae=\EG0\EH\003:al=\EE:\ :as=\EG0\EH\002:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:\ :ei=\Er:fs=^M:ho=^^:i1=\E`\072\E`9:i2=\E%?:im=\Eq:ip=:\ :is=\016\024\E'\E(:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:\ :kA=\EE:kB=\EI:kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kN=\EK:kP=\EJ:\ :kS=\EY:kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:\ :mb=\EG2:me=\EG0\E(\EH\003%{0}%PA%{0}%PC:mh=\EGp:\ :mp=\EG0\E):nd=^L:nw=^M^J:oc=\E%?:op=\EG0:pf=^T:\ :pn=\Ez%+/%s\r:po=^X:ps=\EP:px=\Ez%+?%s\177:sf=\n:sr=\Ej:\ :st=\E1:ta=^I:ts=\EF:up=^K:vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: wy350-vb|wyse350-vb|wyse 350 visible bell:\ :bl@:tc=wy350: wy350-w|wyse350-w|wyse 350 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:i1=\E`;\E`9:tc=wy350: wy350-wvb|wyse350-wvb|wyse 350 132-column visible bell:\ :bl@:\ :tc=wy350-w: # # This terminfo description is untested. # The wyse100 emulates an adm31, so the adm31 entry should work. # wy100|wyse 100:\ :hs:mi:\ :co#80:li#24:sg#1:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E;:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ds=\EA31:ei=\Er:fs=^M:im=\Eq:is=\Eu\E0:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:kb=^H:kd=^J:kh=\E{:kl=^H:kr=^L:ku=^K:\ :le=^H:mk@:nd=^L:sf=^J:ts=\EF:up=^K:\ :tc=adm+sgr: # # The Wyse 120/150 has most of the features of the Wyse 60. # This terminal does not need padding up to 9600 baud! # :ms: should be set but the clear screen fails when in # alt-charset mode. Try \EcE\s\s\E+\s if the screen is really clear # then set :ms:. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy120|wyse120|wy150|wyse150|Wyse 120/150:\ :am:bw:hs:km:mi:ms:xo:\ :co#80:it#8:li#24:pb#9601:ws#45:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=^J:ds=\EF\r:ei=\Er:\ :fs=^M:ho=^^:i1=\EcB0\EcC1:i2=\EwJ\Ew1:im=\Eq:ip=:\ :is=\Ed$\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:kN=\EK:kP=\EJ:\ :kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:nd=^L:nw=\r\n:sf=\n:\ :so=\EGt:sr=\Ej:st=\E1:ta=\011:te=\Ew1:ti=\Ew0:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: # wy120-w|wyse120-w|wy150-w|wyse150-w|wyse 120/150 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\E`;:tc=wy120: # wy120-25|wyse120-25|wy150-25|wyse150-25|wyse 120/150 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy120: # wy120-25-w|wyse120-25-w|wy150-25-w|wyse150-25-w|wyse 120/150 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy120-w: # wy120-vb|wyse120-vb|wy150-vb|wyse150-vb|Wyse 120/150 visible bell:\ :bl@:\ :tc=wy120: # wy120-w-vb|wy120-wvb|wyse120-wvb|wy150-w-vb|wyse150-w-vb|Wyse 120/150 132-column visible bell:\ :bl@:\ :tc=wy120-w: # # The Wyse 60 is like the Wyse 50 but with more padding. # The reset strings are slow and the pad times very depending # on other parameters such as font loading. I have tried # to follow the following outline: # # -> set personality # -> set number of columns # -> set number of lines # :i1: -> select the proper font # :is: -> do the initialization # :i3: -> set up display memory (2 pages) # # The Wyse 60's that have vt100 emulation are slower than the # older Wyse 60's. This change happened mid-1987. # The capabilities effected are :dc: :dl: :al: :sf: :sr: # # The meta key is only half right. This terminal will return the # high order bit set when you hit CTRL-function_key # # It may be useful to assign two function keys with the # values \E=(\s look at old data in page 1 # \E=W, look at bottom of page 1 # where \s is a space ( ). # # Note: # The Wyse 60 runs faster when the XON/XOFF # handshake is turned off. # # (wy60: we use \E{ rather than ^^ for home (both are documented) to avoid # a bug reported by Robert Dunn, -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy60|wyse60|Wyse 60:\ :am:bs:bw:hs:km:mi:ms:\ :co#80:li#24:ws#45:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:\ :ei=\Er:fs=^M:ho=\E{:i1=\EcB0\EcC1:i2=\EwJ\Ew1:im=\Eq:ip=:\ :is=\Ed$\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:kN=\EK:kP=\EJ:\ :kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=\E{^K:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:nd=^L:nw=\r\n:sf=\n:\ :so=\EGt:sr=\Ej:st=\E1:ta=\011:te=\Ew1:ti=\Ew0:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: # wy60-w|wyse60-w|wyse 60 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\EeF\E`;:tc=wy60: # wy60-25|wyse60-25|wyse 60 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy60: wy60-25-w|wyse60-25-w|wyse 60 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy60-w: # wy60-42|wyse60-42|wyse 60 80-column 42-lines:\ :li#42:\ :al=\EE:cd=\Ey:cl=\E+:cm=\E=%+ %+ :dc=\EW:dl=\ER:\ :i1=\EcB2\EcC3:ip=:nw=\r\n:r3=\Ee*:sf=\n:sr=\Ej:tc=wy60: wy60-42-w|wyse60-42-w|wyse 60 132-column 42-lines:\ :Nl#16:co#132:lw#7:ws#97:\ :cd=\Ey:cl=\E+:cm=\Ea%i%dR%dC:dc=\EW:ho=\036:ip=:nw=\r\n:\ :r2=\EeF\E`;:\ :tc=wy60-42: # wy60-43|wyse60-43|wyse 60 80-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy60-42: wy60-43-w|wyse60-43-w|wyse 60 132-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy60-42-w: # wy60-vb|wyse60-vb|Wyse 60 visible bell:\ :bl@:tc=wy60: wy60-w-vb|wy60-wvb|wyse60-wvb|Wyse 60 132-column visible bell:\ :bl@:\ :tc=wy60-w: # The Wyse-99GT looks at lot like the Wyse 60 except that it # does not have the 42/43 line mode. In the Wyse-60 the "lines" # setup parameter controls the number of lines on the screen. # For the Wyse 99GT the "lines" setup parameter controls the # number of lines in a page. The screen can display 25 lines max. # The Wyse-99GT also has personalities for the VT220 and # Tektronix 4014. But this has no bearing on the native mode. # # (msgr) should be set but the clear screen fails when in # alt-charset mode. Try \EcE\s\s\E+\s if the screen is really clear # then set msgr, else use msgr@. # # u0 -> enter Tektronix mode # u1 -> exit Tektronix mode # wy99gt|wyse99gt|Wyse 99gt:\ :ms@:\ :al=\EE:cd=\Ey:ce=\Et:cl=\E+:dc=\EW:dl=\ER:i2=\Ew0:ip=:nw@:\ :r2=\E`\072:sf=\n:sr=\Ej:ta=\011:te=\Ew0:ti=\Ew1:\ :u0=\E~>\E8:u1=\E[42h:vb=\E`8\E`9:tc=wy60: # wy99gt-w|wyse99gt-w|wyse 99gt 132-column:\ :Nl#16:co#132:lw#7:ws#97:\ :cd=\Ey:cl=\E+:cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\E`;:tc=wy99gt: # wy99gt-25|wyse99gt-25|wyse 99gt 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r2=\E`\072:r3=\EwG\Ee):tc=wy99gt: # wy99gt-25-w|wyse99gt-25-w|wyse 99gt 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r2=\E`;:tc=wy99gt-w: # wy99gt-vb|wyse99gt-vb|Wyse 99gt visible bell:\ :bl@:tc=wy99gt: # wy99gt-w-vb|wy99gt-wvb|wyse99gt-wvb|Wyse 99gt 132-column visible bell:\ :bl@:\ :tc=wy99gt-w: # # The Wyse 160 is combination of the WY-60 and the WY-99gt. # The reset strings are slow and the pad times very depending # on other parameters such as font loading. I have tried # to follow the following outline: # # -> set personality # -> set number of columns # -> set number of lines # :i1: -> select the proper font # :is: -> do the initialization # :i3: -> set up display memory (2 pages) # # The display memory may be used for either text or graphics. # When "Display Memory = Shared" the terminal will have more pages # but garbage may be left on the screen when you switch from # graphics to text. If "Display Memory = Unshared" then the # text area will be only one page long. # # (wy160: we use \E{ rather than ^^ for home (both are documented) to avoid # a bug reported by Robert Dunn, -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy160|wyse160|Wyse 160:\ :am:bw:hs:km:mi:ms:\ :co#80:li#24:ws#38:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:\ :ei=\Er:fs=^M:ho=\E{:i1=\EcB0\EcC1:i2=\Ew0:im=\Eq:ip=:\ :is=\Ed$\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:kN=\EK:kP=\EJ:\ :kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:ll=\E{^K:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:nd=^L:nw=\r\n:sf=\n:\ :so=\EGt:sr=\Ej:st=\E1:ta=^I:te=\Ew0:ti=\Ew1:ts=\EF:up=^K:\ :vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: # wy160-w|wyse160-w|wyse 160 132-column:\ :Nl#16:co#132:lw#7:ws#90:\ :cm=\Ea%i%dR%dC:dc=\EW:r2=\EeF\E`;:tc=wy160: # wy160-25|wyse160-25|wyse 160 80-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy160: wy160-25-w|wyse160-25-w|wyse 160 132-column 25-lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy160-w: # wy160-42|wyse160-42|wyse 160 80-column 42-lines:\ :li#42:\ :al=\EE:cd=\Ey:cl=\E+:dl=\ER:i1=\EcB2\EcC3:nw=\r\n:r3=\Ee*:\ :sf=\n:sr=\Ej:\ :tc=wy160: wy160-42-w|wyse160-42-w|wyse 160 132-column 42-lines:\ :Nl#16:co#132:lw#7:ws#90:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\EeF\E`;:tc=wy160-42: # wy160-43|wyse160-43|wyse 160 80-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy160-42: wy160-43-w|wyse160-43-w|wyse 160 132-column 43-lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\Ee+:tc=wy160-42-w: # wy160-vb|wyse160-vb|Wyse 160 visible bell:\ :bl@:tc=wy160: wy160-w-vb|wy160-wvb|wyse160-wvb|Wyse 160 132-column visible bell:\ :bl@:\ :tc=wy160-w: # # The Wyse 75 is a vt100 lookalike without advanced video. # # The Wyse 75 can support one attribute (e.g. Dim, Inverse, # Underline) without magic cookies. The following description # uses this capability, but when more than one attribute is # put on the screen at once, all attributes will be changed # to be the same as the last attribute given. # The Wyse 75 can support more attributes when used with magic # cookies. The wy75-mc terminal description uses magic cookies # to correctly handle multiple attributes on a screen. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy75|wyse75|wyse 75:\ :am:bs:hs:mi:ms:xn:xo:\ :co#80:li#24:ma#1:pb#1201:ws#78:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[>\\054\001\001\E[>-\001\001:ec=\E[%dX:ei=\E[4l:\ :fs=^A:ho=\E[H:\ :i1=\E[2;4;20;30l\E[?1;10l\E[12h\E[?7;8;25h:i2=\E[m:\ :im=\E[4h:ip=:is=\E>\E(B:k1=\E[?5i:k2=\E[?3i:\ :k3=\E[2i:k4=\E[@:k5=\E[M:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[@:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:ke=\E>:\ :kh=\E[H:kl=\E[D:kr=\E[C:ks=\E[?1l\E[?7h\E=:ku=\E[A:le=^H:\ :me=\E[m\017:mh=\E[0t\E[2m:mr=\E[1t\E[7m:nd=\E[C:rc=\E8:\ :sc=\E7:se=\E[m:sf=\n:so=\E[1t\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[>\\054\001:ue=\E[m:up=\E[A:us=\E[2t\E[4m:\ :vb=\E[30h\E\\054\E[30l:ve=\E[?25h:vi=\E[?25l: # # This terminal description uses the non-hidden attribute mode # (with magic cookie). # wy75-mc|wyse75-mc|wyse 75 with magic cookies:\ :ms@:\ :ma@:sg#1:ug#1:\ :ae=\E[0p\017:as=\E[0p\016:i2=\E[m\E[p:mb=\E[2p:\ :me=\E[0p\017:mh=\E[1p:mk=\E[4p:mr=\E[16p:\ :..sa=\E[%{0}%?%p2%p6%|%t%{8}%|%;%?%p1%p3%|%p6%|%t%{16}%|%;%?%p4%t%{2}%|%;%?%p1%p5%|%t%{1}%|%;%?%p7%t%{4}%|%;%dp%?%p9%t\016%e\017%;:\ :se=\E[0p:so=\E[17p:ue=\E[0p:us=\E[8p:\ :tc=wy75: wy75-vb|wyse75-vb|wyse 75 with visible bell:\ :pb@:\ :bl@:tc=wy75: wy75-w|wyse75-w|wyse 75 in 132 column mode:\ :co#132:ws#130:\ :r2=\E[35h\E[?3h:tc=wy75: wy75-wvb|wyse75-wvb|wyse 75 with visible bell 132 columns:\ :pb@:\ :bl@:tc=wy75-w: # # Wyse 85 emulating a vt220 7 bit mode. # 24 line screen with status line. # # The vt220 mode permits more function keys but it wipes out # the escape key. I strongly recommend that be set to # escape (esc). # The terminal may have to be set for 8 data bits and 2 stop # bits for the arrow keys to work. # The Wyse 85 runs faster with XON/XOFF enabled. Also the # :DC: and :IC: work best when XON/XOFF is set. :IC: and # :DC: leave trash on the screen when used without XON/XOFF. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy85|wyse85|wyse 85:\ :am:bs:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ds=\E[40l:\ :ec=\E[%dX:ei=\E[4l:fs=\E[1;24r\E8:ho=\E[H:\ :i1=\E[62;1"p\E[?5W:i2=\E>\E(B\E[m:im=\E[4h:ip=:\ :is=\E[2;4;20;30l\E[?1;4;10;16l\E[12h\E[?7;8;25h:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:ke=\E>:kh=\E[26~:kl=\E[D:kr=\E[C:\ :ks=\E[?1l\E=:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:sf=\n:\ :so=\E[7m:sr=\EM:st=\EH:ta=\011:\ :ts=\E[40h\E7\E[25;%i%p1%dH:ue=\E[m:up=\E[A:us=\E[4m:\ :vb=\E[30h\E\\054\E[30l:ve=\E[?25h:vi=\E[?25l: # # Wyse 85 with visual bell. wy85-vb|wyse85-vb|wyse 85 with visible bell:\ :bl@:vb=\E[30h\E\\054\E[30l:tc=wy85: # # Wyse 85 in 132-column mode. wy85-w|wyse85-w|wyse 85 in 132-column mode:\ :co#132:ws#132:\ :r2=\E[35h\E[?3h:tc=wy85: # # Wyse 85 in 132-column mode with visual bell. wy85-wvb|wyse85-wvb|wyse 85 with visible bell 132-columns:\ :bl@:\ :tc=wy85-w: # # Wyse 185 emulating a vt320 7 bit mode. # # This terminal always displays 25 lines. These lines may be used # as 24 data lines and a terminal status line (top or bottom) or # 25 data lines. The 48 and 50 line modes change the page size # and not the number of lines on the screen. # # The Compose Character key can be used as a meta key if changed # by set-up. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy185|wyse185|wyse 185:\ :am:hs:km:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E7\E[99;0H\E[K\E8:ec=\E[%dX:ei=\E[4l:\ :fs=\E[1;24r\E8:ho=\E[H:i1=\E[?5W:\ :i2=\E>\E(B\E[m:im=\E[4h:ip=:\ :is=\E[2;4;20;30l\E[?1;4;10;16l\E[12h\E[?7;8;25h:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:ke=\E>:kh=\E[26~:kl=\E[D:kr=\E[C:\ :ks=\E[?1l\E=:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:sf=\n:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:te=\E[ R:ti=\E[ Q:\ :ts=\E7\E[99;%i%p1%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[30h\E\\054\E[30l:ve=\E[34h\E[?25h:vi=\E[?25l:\ :vs=\E[?25h\E[34l: # # Wyse 185 with 24 data lines and top status (terminal status) wy185-24|wyse185-24|wyse 185 with 24 data lines:\ :hs@:\ :ds@:fs@:r3=\E[?5l\E[47h\E[40l\E[1;24r:ts@:tc=wy185: # # Wyse 185 with visual bell. wy185-vb|wyse185-vb|wyse 185+flash:\ :bl@:tc=wy185: # # Wyse 185 in 132-column mode. wy185-w|wyse185-w|wyse 185 in 132-column mode:\ :co#132:ws#132:\ :DC=\E[%dP:IC=\E[%d@:dc=\E[P:ei=:im=:ip=:r2=\E[35h\E[?3h:tc=wy185: # # Wyse 185 in 132-column mode with visual bell. wy185-wvb|wyse185-wvb|wyse 185+flash+132 cols:\ :bl@:tc=wy185-w: # wy325 terminfo entries # Done by Joe H. Davis 3-9-92 # lines 25 columns 80 # # (untranslatable capabilities removed to fit entry within 1023 bytes) wy325|wyse325|Wyse epc:\ :5i:am:bw:hs:mi:\ :Nl#8:co#80:lh#1:li#24:lw#8:pb#9601:ws#45:\ :#2=\E{:%9=\EP:&3=\Er:@8=\E7:F1=^AJ\r:F2=^AK\r:F3=^AL\r:\ :F4=^AM\r:F5=^AN\r:F6=^AO\r:LF=\EA11:LO=\EA10:RA=\Ed.:\ :SA=\Ed/:\ :ac=+/\\054.0[Iha2fxgqh1jYk?lZm@nEqDtCu4vAwBx3yszr{c~~:\ :ae=\EcD:al=\EE:as=\EcE:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E+:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\EF\r:\ :ei=\Er:fs=^M:ho=^^:i1=\EcB0\EcC1:i2=\Ew0:im=\Eq:ip=:\ :is=\EcD\E'\Er\EH\003\Ed/\EO\Ee1\Ed*\E`@\E`9\E`1\016\024\El:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:kA=\EE:kB=\EI:kD=\EW:\ :kE=\ET:kI=\Eq:kL=\ER:kN=\EK:kP=\EJ:kS=\EY:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:ll=^^^K:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:mp=\E):nd=^L:pf=^T:\ :pl=\EZ2%+?%s\177:pn=\Ez%+/%s\r:po=\Ed#:ps=\EP:\ :px=\EZ1%+?%s\177:r1=\E~\041\E~4:r2=\EeF\E`\072:\ :r3=\EwG\Ee(:sf=\n:so=\EGt:sr=\Ej:st=\E1:ta=^I:te=\Ew0:\ :ti=\Ew1:ts=\EF:up=^K:vb=\E`8\E`9:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: # # lines 24 columns 80 vb # wy325-vb|wyse325-vb|wyse-325 with visual bell:\ :bl@:tc=wy325: # # lines 24 columns 132 # wy325-w|wyse325-w|wy325w-24|wyse-325 in wide mode:\ :Nl#16:co#132:lw#7:ws#97:\ :cm=\Ea%i%dR%dC:dc=\EW:ip=:r2=\E`;:tc=wy325: # # lines 25 columns 80 # wy325-25|wyse325-25|wy325-80|wyse-325|wyse-325 25 lines:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325: # # lines 25 columns 132 # wy325-25w|wyse325-25w|wy325 132 columns:\ :Nl@:lh@:li#25:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325-w: # # lines 25 columns 132 vb # wy325-w-vb|wy325-wvb|wyse325-wvb|wyse-325 wide mode reverse video:\ :bl@:\ :tc=wy325-w: # # lines 42 columns 80 # wy325-42|wyse325-42|wyse-325 42 lines:\ :Nl@:lh@:li#42:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325: # # lines 42 columns 132 # wy325-42w|wyse325-42w|wyse-325 42 lines wide mode:\ :Nl@:lh@:li#42:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325-w: # # lines 42 columns 132 vb # wy325-42w-vb|wy325-42wvb|wyse-325 42 lines wide mode visual bell:\ :bl@:\ :tc=wy325-w: # # lines 43 columns 80 # wy325-43|wyse325-43|wyse-325 43 lines:\ :Nl@:lh@:li#43:lw@:\ :pn@:tc=wy325: # # lines 43 columns 132 # wy325-43w|wyse325-43w|wyse-325 43 lines wide mode:\ :Nl@:lh@:li#43:lw@:\ :pn@:r3=\EwG\Ee):tc=wy325-w: # # lines 43 columns 132 vb # wy325-43w-vb|wy325-43wvb|wyse-325 43 lines wide mode visual bell:\ :bl@:\ :tc=wy325-w: # Wyse 370 -- 24 line screen with status line. # # The terminal may have to be set for 8 data bits and 2 stop # bits for the arrow keys to work. # # If you change keyboards the terminal will send different # escape sequences. # The following definition is for the basic terminal without # function keys. # # -> enter Tektronix 4010/4014 mode # -> exit Tektronix 4010/4014 mode # -> enter ASCII mode (from any ANSI mode) # -> exit ASCII mode (goto native ANSI mode) # -> enter Tek 4207 ANSI mode (from any ANSI mode) # -> exit Tek 4207 mode (goto native ANSI mode) # # Bug: The capability resets attributes. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy370-nk|wyse 370 without function keys:\ :am:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ds=\E[40l:\ :ec=\E[%dX:ei=\E[4l:fs=\E[1;24r\E8:ho=\E[H:\ :i1=\E[90;1"p\E[?5W:i2=\E>\017\E(B\E[63;0w\E[m:\ :im=\E[4h:ip=:\ :is=\E[2;4;20;30;40l\E[?1;10;16l\E[12h\E[?7;8;25h:\ :ke=\E>:ks=\E[?1l\E=:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[27m:sf=\n:\ :so=\E[7m:sr=\EM:st=\EH:ta=\011:te=\E[ R:ti=\E[ Q:\ :ts=\E[40l\E[40h\E7\E[99;%i%p1%dH:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[30h\E\\054\E[30l:ve=\E[34h\E[?25h:\ :vi=\E[?25l:vs=\E[?25h\E[34l: # # Function key set for the ASCII (wy-50 compatible) keyboard # This is the default 370. # wy370|wyse370|wy370-101k|Wyse 370 with 101 key keyboard:\ :@8=\EOM:F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:\ :F5=\E[28~:F6=\E[29~:k1=\E[?4i:k2=\E[?3i:k3=\E[2i:k4=\E[@:\ :k5=\E[M:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kA=\EOP:kB=\E[Z:kD=\EOQ:kI=\EOP:kL=\EOQ:kN=\E[U:\ :kP=\E[V:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :tc=wy370-nk: # # Function key set for the VT-320 (and wy85) compatible keyboard # wy370-105k|Wyse 370 with 105 key keyboard:\ :%1=\E[28~:*6=\E[4~:@0=\E[1~:@8=\EOM:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F5=\E[28~:F6=\E[29~:F7=\E[31~:\ :F8=\E[32~:F9=\E[33~:FA=\E[34~:K1=\EOw:K2=\EOu:K3=\EOy:\ :K4=\EOq:K5=\EOs:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\E[3~:\ :kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[26~:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=PF1:l2=PF2:l3=PF3:l4=PF4:\ :tc=wy370-nk: # # Function key set for the PC compatible keyboard # wy370-EPC|Wyse 370 with 102 key keyboard:\ :@7=\E[1~:@8=\EOM:F1=\E[23~:F2=\E[24~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[M:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:k;=\E[21~:kB=\E[Z:kI=\E[2~:kN=\E[U:kP=\E[V:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :tc=wy370-nk: # # Wyse 370 with visual bell. wy370-vb|Wyse 370 with visible bell:\ :bl@:tc=wy370: # # Wyse 370 in 132-column mode. wy370-w|Wyse 370 in 132-column mode:\ :co#132:ws#132:\ :r2=\E[35h\E[?3h:tc=wy370: # # Wyse 370 in 132-column mode with visual bell. wy370-wvb|Wyse 370 with visible bell 132-columns:\ :vb=\E[30h\E\\054\E[30l:tc=wy370-w: wy370-rv|Wyse 370 reverse video:\ :r3=\E[32h\E[?5h:tc=wy370: # # Wyse 99gt Tektronix 4010/4014 emulator, # wy99gt-tek|Wyse 99gt Tektronix 4010/4014 emulator:\ :am:os:\ :co#74:li#35:\ :bl=^G:cl=\E^L:\ :..cm=\035%{3040}%{89}%p1%*%-%Py\n%p2%{55}%*%Px\n%gy%{128}%/%{31}%&%{32}%+%c\n%gy%{3}%&%{4}%*%gx%{3}%&%+%{96}%+%c\n%gy%{004}%/%{31}%&%{96}%+%c\n%gx%{128}%/%{31}%&%{32}%+%c\n%gx%{004}%/%{31}%&%{64}%+%c\037:\ :cr=^M:do=^J:ff=^L:\ :hd=\036HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH\037:\ :ho=^]7`x @\037:\ :hu=\036DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\037:\ :is=\E8:le=^H:nd= :nw=^M^J:u0=\E~>\E8:u1=\E[42h:up=^K: # # Wyse 160 Tektronix 4010/4014 emulator, # wy160-tek|Wyse 160 Tektronix 4010/4014 emulator:\ :..cm=\035%{3103}%{91}%p1%*%-%Py\n%p2%{55}%*%Px\n%gy%{128}%/%{31}%&%{32}%+%c\n%gy%{3}%&%{4}%*%gx%{3}%&%+%{96}%+%c\n%gy%{004}%/%{31}%&%{96}%+%c\n%gx%{128}%/%{31}%&%{32}%+%c\n%gx%{004}%/%{31}%&%{64}%+%c\037:\ :ho=^]8`g @\037:\ :tc=wy99gt-tek: # # Wyse 370 Tektronix 4010/4014 emulator, # wy370-tek|Wyse 370 Tektronix 4010/4014 emulator:\ :am:os:\ :co#80:li#36:\ :bl=^G:cl=\E^L:\ :..cm=\035%{775}%{108}%p1%*%{5}%/%-%Py\n%p2%{64}%*%{4}%+%{5}%/%Px\n%gy%{32}%/%{31}%&%{32}%+%c\n%gy%{31}%&%{96}%+%c\n%gx%{32}%/%{31}%&%{32}%+%c\n%gx%{31}%&%{64}%+%c\037:\ :cr=^M:do=^J:ff=^L:\ :hd=\036HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH\037:\ :ho=^]8g @\037:\ :hu=\036DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\037:\ :is=\E8:kb=^H:kd=^J:kl=^H:kr=^I:ku=^K:le=^H:nd= :nw=^M^J:\ :u0=\E[?38h\E8:u1=\E[?38l:up=^K: # Vendor-supplied Wyse entries end here. # #TITLE: TERMINFO ENTRY WY520 #DATE: 8/5/93 # The WY520 terminfo is based on the WY285 entry published on the WYSE # BBS with the addition of more function keys and special keys. # # rs1 -> set personality # rs2 -> set number of columns # rs3 -> set number of lines # is1 -> select the proper font # is2 -> do the initialization # is3 -> If this string is empty then rs3 gets sent. # # Wyse 520 emulating a vt420 7 bit mode with default ANSI keyboard # - The BS key is programmed to generate BS in smcup since # is2 doesn't seem to work. # - Remove and shift/Remove: delete a character # - Insert : enter insert mode # - Find : delete to end of file # - Select : clear a line # - F11, F12, F13: send default sequences (not ESC, BS, LF) # - F14 : Home key # - Bottom status line (host writable line) is used. # - smkx,rmkx are removed because this would put the numeric # keypad in Dec application mode which doesn't seem to work # with SCO applications. # # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) wy520|wyse520|wyse 520:\ :am:hs:km:mi:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOy:K3=\EOu:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ds=\E[0$~:\ :ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:i1=\E[?5W:\ :i2=\E>\E(B\017\E[m:im=\E[4h:ip=:\ :is=\E[2;4;20;30l\E[?1;4;10;16l\E[12h\E[?7;8;25;67h:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kh=\E[26~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :rc=\E8:sc=\E7:se=\E[m:sf=\n:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :te=\E[ R:ti=\E[ Q\E[?67;8h:ts=\E[2$~\E[1$}\E[%i%p1%d`:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[34h\E[?25h:vi=\E[?25l:\ :vs=\E[?25h\E[34l: # # Wyse 520 with 24 data lines and status (terminal status) wy520-24|wyse520-24|wyse 520 with 24 data lines:\ :hs@:\ :ds@:fs@:r3=\E[?5l\E[47h\E[40l\E[1;24r:ts@:tc=wy520: # # Wyse 520 with visual bell. wy520-vb|wyse520-vb|wyse 520 with visible bell:\ :vb=\E[30h\E\\054\E[30l:tc=wy520: # # Wyse 520 in 132-column mode. wy520-w|wyse520-w|wyse 520 in 132-column mode:\ :co#132:ws#132:\ :DC=\E[%dP:IC=\E[%d@:dc=\E[P:ei=:im=:ip=:r2=\E[35h\E[?3h:tc=wy520: # # Wyse 520 in 132-column mode with visual bell. wy520-wvb|wyse520-wvb|wyse 520 with visible bell 132-columns:\ :vb=\E[30h\E\\054\E[30l:\ :tc=wy520-w: # # # Wyse 520 emulating a vt420 7 bit mode. # The DEL key is programmed to generate BS in is2. # With EPC keyboard. # - 'End' key will clear till end of line on EPC keyboard # - Shift/End : ignored. # - Insert : enter insert mode. # - Delete : delete a character (have to change interrupt character # to CTRL-C: stty intr '^c') for it to work since the # Delete key sends 7FH. wy520-epc|wyse520-epc|wyse 520 with EPC kb:\ :@7=\E[4~:k0=\E[21~:k1=\E[11~:k2=\E[12~:k3=\E[13~:\ :k4=\E[14~:k5=\E[15~:kD=\177:kE=\E[4~:kh=\E[H:\ :tc=wy520: # # Wyse 520 with 24 data lines and status (terminal status) # with EPC keyboard. wy520-epc-24|wyse520-pc-24|wyse 520 with 24 data lines:\ :hs@:\ :ds@:fs@:r3=\E[?5l\E[47h\E[40l\E[1;24r:ts@:tc=wy520-epc: # # Wyse 520 with visual bell. wy520-epc-vb|wyse520-pc-vb|wyse 520 with visible bell:\ :vb=\E[30h\E\\054\E[30l:\ :tc=wy520-epc: # # Wyse 520 in 132-column mode. wy520-epc-w|wyse520-epc-w|wyse 520 in 132-column mode:\ :co#132:ws#132:\ :DC=\E[%dP:IC=\E[%d@:dc=\E[P:ei=:im=:ip=:r2=\E[35h\E[?3h:tc=wy520-epc: # # Wyse 520 in 132-column mode with visual bell. wy520-epc-wvb|wyse520-p-wvb|wyse 520 with visible bell 132-columns:\ :vb=\E[30h\E\\054\E[30l:\ :tc=wy520-epc-w: # # Wyse 520 in 80-column, 36 lines wy520-36|wyse520-36|wyse 520 with 36 data lines:\ :hs@:\ :li#36:\ :ds@:fs@:r3=\E[?5l\E[36*|\E[36t\E[40l\E[1;36r:ts@:tc=wy520: # # Wyse 520 in 80-column, 48 lines wy520-48|wyse520-48|wyse 520 with 48 data lines:\ :hs@:\ :li#48:\ :ds@:fs@:r3=\E[?5l\E[48*|\E[48t\E[40l\E[1;48r:ts@:tc=wy520: # # Wyse 520 in 132-column, 36 lines wy520-36w|wyse520-36w|wyse 520 with 36 data lines:\ :co#132:ws#132:\ :r2=\E[?3h:\ :r3=\E[?5l\E[36*|\E[36t\E[40l\E[1;36r\E[132$|:tc=wy520-36: # # Wyse 520 in 132-column, 48 lines wy520-48w|wyse520-48w|wyse 520 with 48 data lines:\ :co#132:ws#132:\ :r2=\E[?3h:\ :r3=\E[?5l\E[48*|\E[48t\E[40l\E[1;48r\E[132$|:tc=wy520-48: # # # Wyse 520 in 80-column, 36 lines with EPC keyboard wy520-36pc|wyse520-36pc|wyse 520 with 36 data lines:\ :hs@:\ :li#36:\ :ds@:fs@:r3=\E[?5l\E[36*|\E[36t\E[40l\E[1;36r:ts@:tc=wy520-epc: # # Wyse 520 in 80-column, 48 lines with EPC keyboard wy520-48pc|wyse520-48pc|wyse 520 with 48 data lines:\ :hs@:\ :li#48:\ :ds@:fs@:r3=\E[?5l\E[48*|\E[48t\E[40l\E[1;48r:ts@:tc=wy520-epc: # # Wyse 520 in 132-column, 36 lines with EPC keyboard wy520-36wpc|wyse520-36wpc|wyse 520 with 36 data lines:\ :co#132:ws#132:\ :r2=\E[?3h:\ :r3=\E[?5l\E[36*|\E[36t\E[40l\E[1;36r\E[132$|:tc=wy520-36pc: # # Wyse 520 in 132-column, 48 lines with EPC keyboard wy520-48wpc|wyse520-48wpc|wyse 520 with 48 data lines:\ :co#132:ws#132:\ :r2=\E[?3h:\ :r3=\E[?5l\E[48*|\E[48t\E[40l\E[1;48r\E[132$|:tc=wy520-48pc: # From: John Gilmore # (wyse-vp: removed :if=/usr/share/tabset/wyse-adds:, there's no such # file and we don't know what :st: is -- esr) wyse-vp|wyse|Wyse 50 in ADDS Viewpoint emulation mode with "enhance" on:\ :am:bs:\ :co#80:it#8:li#24:\ :al=\EM:bl=^G:cd=\Ek:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:dc=\EW:\ :dl=\El:do=^J:ei=\Er:ho=^A:im=\Eq:is=\E`\072\E`9\017\Er:\ :kb=^H:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:le=^H:ll=^A^Z:me=^O:\ :nd=^F:nw=^M^J:r1=\E`\072\E`9\017\Er:se=^O:sf=^J:so=^N:\ :ta=^I:ue=^O:up=^Z:us=^N: wy75ap|wyse75ap|wy-75ap|wyse-75ap|Wyse WY-75 Applications and Cursor keypad:\ :is=\E[1;24r\E[?10;3l\E[?1;25h\E[4l\E[m\E(B\E=:kb=^H:\ :kd=\EOB:ke=10\E[?1l\E>:kh=\EOH:kl=\EOD:kr=\EOC:\ :ks=10\E[?1h\E=:ku=\EOA:tc=wy75: # From: Eric Freudenthal wy100q|Wyse 100 for Quotron:\ :bs:\ :co#80:li#24:sg#1:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :dc=\EW:\ :dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:\ :is=\E`\072\200\EC\EDF\E0\E'\E(\EA21:kd=^J:kl=^H:kr=^L:\ :ku=^K:le=^H:mk@:nd=^L:sr=\Ej:up=^K:\ :tc=adm+sgr: #### Kermit terminal emulations # # Obsolete Kermit versions may be listed in the section describing obsolete # non-ANSI terminal emulators later in the file. # # KERMIT standard all versions. # Straight ascii keyboard. :sr=\EI: not avail. many versions + bug prone in vi. # (kermit: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" -- esr) # From: greg small 9-25-84 kermit|standard kermit:\ :bs:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :ho=\EH:\ :is=K0 Standard Kermit 9-25-84\n:kd=^J:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:nd=\EC:up=\EA: kermit-am|standard kermit plus auto-margin:\ :am:\ :is=K1 Standard Kermit plus Automatic Margins\n:tc=kermit: # IBMPC Kermit 1.2. # Bugs: :cd:, :ce:: do not work except at beginning of line! :cl: does # not work, but fake with :cl=\EH\EJ (since :cd=\EJ: works at beginning of # line). # From: greg small 8-30-84 pckermit|pckermit12|UCB IBMPC Kermit 1.2:\ :am:\ :li#25:\ :cd@:ce@:cl=\EH\EJ:\ :is=K2 UCB IBMPC Kermit 1.2 8-30-84\n:tc=kermit: # IBMPC Kermit 1.20 # Cannot use line 25, now acts funny like ansi special scrolling region. # Initialization must escape from that region by cursor position to line 24. # Cannot use character insert because 1.20 goes crazy if insert at col 80. # Does not use :am: because autowrap is lost when kermit dropped and restarted. # From: greg small 12-19-84 pckermit120|UCB IBMPC Kermit 1.20:\ :it#8:li#24:\ :al=\EL:dc=\EN:dl=\EM:do=\EB:ei@:im@:\ :is=\EO\Eq\EJ\EY7 K3 UCB IBMPC Kermit 1.20 12-19-84\n:\ :se=\Eq:so=\Ep:ta=^I:vs=\EO\Eq\EEK3:\ :tc=kermit: # MS-DOS Kermit 2.27 for the IBMPC # Straight ascii keyboard. :sr=\EI: not avail. many versions + bug prone in vi. # Cannot use line 25, now acts funny like ansi special scrolling region. # Initialization must escape from that region by cursor position to line 24. # Does not use am: because autowrap is lost when kermit dropped and restarted. # Reverse video for standout like H19. # (msk227: removed obsolete ":ma=^Hh^Jj^Kk^Ll^^H:" -- esr) # From: greg small 3-17-85 msk227|mskermit227|MS-DOS Kermit 2.27 for the IBMPC:\ :am@:bs:\ :co#80:it#8:li#24:\ :al=\EL:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :dc=\EN:dl=\EM:\ :do=\EB:ei=\EO:ho=\EH:im=\E@:\ :is=\EO\Eq\EG\Ew\EJ\EY7 K4 MS Kermit 2.27 for the IBMPC 3-17-85\n:\ :kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=\EC:rc=\Ek:sc=\Ej:\ :se=\Eq:so=\Ep:ta=^I:up=\EA:vs=\EO\Eq\EG\EwK4: # MS-DOS Kermit 2.27 with automatic margins # From: greg small 3-17-85 msk227am|mskermit227am|UCB MS-DOS Kermit 2.27 with automatic margins:\ :am:\ :is=\EO\Eq\EG\Ev\EJ\EY7 K5 MS Kermit 2.27 +automatic margins 3-17-85\n:\ :vs=\EO\Eq\EG\EvK5:\ :tc=msk227: # MS-DOS Kermit 2.27 UCB 227.14 for the IBM PC # Automatic margins now default. Use ansi :sa: for highlights. # Define function keys. # (msk22714: removed obsolete ":kn#10:" -- esr) # From: greg small 3-17-85 msk22714|mskermit22714|UCB MS-DOS Kermit 2.27 UCB 227.14 IBM PC:\ :am:\ :is=\EO\Eq\EG\Ev\EJ\EY7 K6 MS Kermit 2.27 UCB 227.14 IBM PC 3-17-85\n:\ :k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:\ :k8=\E8:k9=\E9:md=\E[1m:me=\E[m:mr=\E[7m:se=\E[m:so=\E[1m:\ :ue=\E[m:us=\E[4m:vs=\EO\Eq\EG\EvK6:\ :tc=mskermit227: # This was designed for a VT320 emulator, but it is probably a good start # at support for the VT320 itself. # Please send changes with explanations to bug-gnu-emacs@prep.ai.mit.edu. # (vt320-k3: I added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) vt320-k3|MS-Kermit 3.00's vt320 emulation:\ :am:es:hs:km:mi:ms:xn:\ :co#80:it#8:li#49:pb#9600:vt#3:\ :AL=\E[%dL:CC=\E:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SR=\E[%dL:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[0$~:ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E F\E[?1l\E[?7h\E[r\E[2$~:k0=\E[21~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:\ :sc=\E7:se=\E[27m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\r\E[K:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l\E[?5h\E[?5l\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: # From: Joseph Gil 13 Dec 1991 # ACS capabilities from Philippe De Muyter 30 May 1996 # (I removed a bogus boolean :mo: and added :ms:, , -- esr) vt320-k311|dec vt320 series as defined by kermit 3.11:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=3\E[L:as=^N:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: ######## NON-ANSI TERMINAL EMULATIONS # #### Avatar # # These entries attempt to describe Avatar, a terminal emulation used with # MS-DOS bulletin-board systems. It was designed to give ANSI-like # capabilities, but with cheaper (shorter) control sequences. Messy design, # excessively dependent on PC idiosyncracies, but apparently rather popular # in the BBS world. # # No color support. Avatar doesn't fit either of the Tektronix or HP color # models that terminfo knows about. An Avatar color attribute is the # low 7 bits of the IBM-PC display-memory attribute. Bletch. # # I wrote these entries while looking at the Avatar spec. I don't have # the facilities to test them. Let me know if they work, or don't. # # From: Eric S. Raymond 1 Nov 1995 # (The :mb:/:md:/:mr:/:as:/:us:/:so: capabilities exist only to # tell ncurses that the corresponding highlights exist; it should use :sa:, # which is the only method that will actually work for multiple highlights.) avatar0|avatar terminal emulator level 0:\ :am:ms:ut:\ :co#80:it#8:li#25:\ :as=:ce=^V^G:cm=\026\010%.%.:cr=^M:do=^V^D:le=^V^E:\ :mb=^A^V\177:md=^V^A^P:me=^V^A^G:mk=^V^A\200:mr=^A^Vp:\ :nd=^V^F:r2=^L:rp=\031%.%d:\ :..sa=\026\001%{0}%?%p1%t%{112}%|%;%?%p2%t%{1}%|%;%?%p3%t%{112}%|%;%?%p4%t{128}%|%;%?%p6%t%{16}%|%;:\ :sf=^J:so=^A^Vp:up=^V^C:us=^V^A:\ :tc=klone+acs: # From: Eric S. Raymond 1 Nov 1995 avatar0+|avatar terminal emulator level 0+:\ :dc=^V^N:ei=\026\n\200\200\200\200:im=^V^I:tc=avatar0: # From: Eric S. Raymond 1 Nov 1995 avatar|avatar1|avatar terminal emulator level 1:\ :RA=^V":SA=^V$:al=^V+:dl=^V-:ei=^V^P:ve=^V'^A:vi=^V'^B:\ :vs=^V^C:\ :tc=avatar0+: #### RBcomm # # RBComm is a lean and mean terminal emulator written by the Interrupt List # mantainer, Ralf Brown. It was fairly popular in the late DOS years (early # '90s), especially in the BBS world, and still has some loyal users due to # its very small memory footprint and to a cute macro language. rbcomm|IBM PC with RBcomm and EMACS keybindings:\ :am:bw:mi:ms:xn:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DL=\E[%dM:al=^K:bl=^G:bt=\E[Z:cd=^F5:ce=^P^P:\ :cl=^L:cm=\037%r%+ %+ :cr=^M:cs=\E[%i%d;%dr:dc=^W:dl=^Z:\ :dm=:do=^C:ec=\E[%dX:ed=:ei=^]:im=^\:\ :is=\017\035\E(B\E[?7h\E[?3l\E[>8g:kb=^H:kd=^N:\ :ke=\E>:kh=^A:kl=^B:kr=^F:ks=\E=:ku=^P:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mk=\E[8m:mr=^R:nd=^B:nw=^M\ED:\ :r1=\017\E(B\025\E[?3l\E[>8g:rc=\E8:rp=\030%.%.:\ :sc=\E7:se=^U:sf=\ED:so=^R:sr=\EM:ta=^I:te=:ti=:ue=^U:up=^^:\ :us=^T:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: rbcomm-nam|IBM PC with RBcomm, no autowrap:\ :am@:\ :bl=^G:cr=^M:do=^J:\ :is=\017\035\E(B\E[?7l\E[?3l\E[>8g:kb=^H:kd=^J:\ :kl=^H:nw=^M^J:sf=^J:ta=^I:\ :tc=rbcomm: rbcomm-w|IBM PC with RBcomm, 132 column mode:\ :co#132:\ :bl=^G:cr=^M:do=^J:\ :is=\017\035\E(B\E[?7h\E[?3h\E[>8g:kb=^H:kd=^J:\ :kl=^H:nw=^M^J:sf=^J:ta=^I:\ :tc=rbcomm: ######## OLDER TERMINAL TYPES # # This section is devoted to older commercial terminal brands that are now # discontinued, but known to be still in use or represented by emulations. # #### AT&T (att, tty) # # This section also includes Teletype-branded VDTs. # # The AT&T/Teletype terminals group was sold to SunRiver Data Systems (now # Boundless Technologies); for details, see the header comment on the ADDS # section. # # These are AT&T's official terminfo entries. All-caps aliases have been # removed. # att2300|sv80|AT&T 2300 Video Information Terminal 80 column mode:\ :am:eo:mi:ms:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[11r:\ :F2=\E[12r:F3=\E[13r:F4=\E[14r:F5=\E[15r:F6=\E[16r:\ :IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:im=\E[4h:\ :k1=\E[1r:k2=\E[2r:k3=\E[3r:k4=\E[4r:k5=\E[5r:k6=\E[6r:\ :k7=\E[7r:k8=\E[8r:k9=\E[9r:k;=\E[10r:kA=\E[L:kB=\E[Z:\ :kC=\E[J:kD=\E[P:kI=\E[@:kL=\E[M:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:mr=\E[7m:nd=\E[C:\ :pf=\E[4i:po=\E[5i:ps=\E[0i:se=\E[m:sf=^J:so=\E[7m:ta=^I:\ :up=\E[A: att2350|AT&T 2350 Video Information Terminal 80 column mode:\ :pf@:po@:ps@:\ :tc=att2300: # Must setup RETURN KEY - CR, REC'VD LF - INDEX. # Seems upward compatible with vt100, plus ins/del line/char. # On sgr, the protection parameter is ignored. # No check is made to make sure that only 3 parameters are output. # standout= reverse + half-intensity = 3 | 5. # bold= reverse + underline = 2 | 3. # note that half-bright blinking doesn't look different from normal blinking. # NOTE:you must program the function keys first, label second! # (att4410: a BSD entry has been seen with the following capabilities: # :is=\E[?6l:, :k1=\EOc:, :k2=\EOd:, :k3=\EOe:, :k4=\EOg:, # :k6=\EOh:, :k7=\EOi:, :k8=\EOj:, -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) att5410v1|att4410v1|tty5410v1|AT&T 4410/5410 80 columns - version 1:\ :am:hs:mi:ms:xo:\ :Nl#8:co#80:it#8:lh#2:li#24:lw#8:ws#80:\ :ac=``aaffhhggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~00++--\054\054..:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=:fs=\E8:ho=\E[H:i1=\E[?3l:\ :i2=\E[1;03q f1 \EOP\E[2;03q f2 \EOQ\E[3;03q f3 \EOR\E[4;03q f4 \EOS\E[5;03q f5 \EOT\E[6;03q f6 \EOU\E[7;03q f7 \EOV\E[8;03q f8 \EOW:\ :ic=\E[@:im=:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOT:\ :k6=\EOU:k7=\EOV:k8=\EOW:kC=\E[2J:kH=\E[24;1H:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[2;7m:me=\E[m\017:mh=\E[2m:mk=\E[8m:\ :mr=\E[7m:nd=\E[C:nw=^M^J:r2=\Ec\E[?3l\E[2;0y:rc=\E8:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :ts=\E7\E[25;%p1%{1}%+%dH:ue=\E[m:up=\E[A:us=\E[4m: att4410v1-w|att5410v1-w|tty5410v1-w|AT&T 4410/5410 132 columns - version 1:\ :co#132:ws#132:\ :i1=\E[?3h:r2=\Ec\E[?3h\E[2;0y:tc=att5410v1: att4410|att5410|tty5410|AT&T 4410/5410 80 columns - version 2:\ :bs:\ :..px=\E[%p1%d;%p2%l%02dq f%p1%d %p2%s:tc=att5410v1: att5410-w|att4410-w|4410-w|tty5410-w|5410-w|AT&T 4410/5410 in 132 column mode:\ :co#132:ws#132:\ :i1=\E[?3h:r2=\Ec\E[?3h\E[2;0y:tc=att4410: # 5410 in terms of a vt100 # (v5410: added / based on init string -- esr) v5410|att5410 in terms of a vt100:\ :am:mi:ms:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:RA=\E[?7l:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E(B:ei=:ho=\E[H:\ :ic=\E[@:im=:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:kb=^H:\ :kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # # Teletype Model 5420 -- A souped up 5410, with multiple windows, # even! the 5420 has three modes: scroll, window or page mode # this terminfo should work in scroll or window mode, but doesn't # take advantage of any of the differences between them. # # Has memory below (2 lines!) # 3 pages of memory (plus some spare) # The 5410 sequences for :cm:, :vs:, :DC:, :DL:, :ec:, :vb:, :ho:, # , :st: would work for these, but these work in both scroll and window # mode... Unset insert character so insert mode works # :i1: sets 80 column mode, # :is: escape sequence: # 1) turn off all fonts # 2) function keys off, keyboard lock off, control display off, # insert mode off, erasure mode off, # 3) full duplex, monitor mode off, send graphics off, nl on lf off # 4) reset origin mode # 5) set line wraparound # 6) exit erasure mode, positional attribute mode, and erasure extent mode # 7) clear margins # 8) program ENTER to transmit ^J, # We use \212 to program the ^J because a bare ^J will get translated by # UNIX into a CR/LF. The enter key is needed for AT&T uOMS. # 1 2 3 4 5 6 7 8 # :i3: set screen color to black, # No representation in terminfo for the delete word key: kdw1=\Ed # Key capabilities assume the power-up send sequence... # This :te: is not strictly necessary, but it helps maximize # memory usefulness: :te=\Ez:, # Alternate sgr0: :me=\E[m\EW^O:, # Alternate sgr: :sa=\E[%?%p1%t2;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p5%t;2%;%?%p7%t;8%;m%?%p8%t\EV%;%?%p9%t^N%e^O%;:, # smkx programs the SYS PF keys to send a set sequence. # It also sets up labels f1, f2, ..., f8, and sends edit keys. # This string causes them to send the strings :k1:-:k8: # when pressed in SYS PF mode. # (att4415: I added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) att4415|tty5420|att5420|AT&T 4415/5420 80 cols:\ :bs:db:mi:xo:\ :Nl#8:lh#2:lm#78:lw#8:ws#55:\ :@1=\Et:@7=\Ez:@8=\Eent:AL=\E[%dL:CM=\E[%i%p1%d;%p2%dt:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:LF=\E|:\ :LO=\E~:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dE:SR=\E[%dF:\ :UP=\E[%dA:bt=\E[Z:ch=\E[%+^AG:cl=\E[x\E[J:\ :cm=\E[%i%d;%dx:ct=\E[3g:cv=\E[%+^Ad:ec=\E[%ds\E[%dD:\ :ei=\E[4l:ho=\E[x:i1=\E[?3l:i2=\E[?5l:ic@:im=\E[4h:\ :is=\E[m\017\E[1;2;3;4;6l\E[12;13;14;20l\E[?6;97;99l\E[?7h\E[4i\Ex\E[21;1j\212:\ :k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:\ :k8=\EOj:kA=\E[L:kB=\E[Z:kD=\E[P:kE=\E[2K:kF=\E[T:kH=\Eu:\ :kI=\E[4h:kL=\E[M:kN=\E[U:kP=\E[V:kR=\E[S:\ :ke=\E[19;0j\E[21;1j\212:ks=\E[19;1j\E[21;4j\Eent:\ :l1=F1:l2=F2:l3=F3:l4=F4:l5=F5:l6=F6:l7=F7:l8=F8:ll=\Ew:\ :me=\E[m\017:mp=\EV:pf=\E[?9i:po=\E[?4i:ps=\E[?2i:st=\EH:\ :ts=\E7\E[25;%p1%{8}%+%dH:vb=\E[?5h\E[?5l:ve=\E[11;0j:\ :vs=\E[11;1j:\ :tc=att4410: att4415-w|tty5420-w|att5420-w|AT&T 4415/5420 132 cols:\ :co#132:lm#54:ws#97:\ :i1=\E[?3h:tc=att4415: att4415-rv|tty5420-rv|att5420-rv|AT&T 4415/5420 80 cols/rv:\ :i2=\E[?5h:vb=\E[?5l\E[?5h:\ :tc=att4415: att4415-w-rv|tty5420-w-rv|att5420-w-rv|AT&T 4415/5420 132 cols/rv:\ :co#132:lm#54:ws#97:\ :i1=\E[?3h:i2=\E[?5h:vb=\E[?5l\E[?5h:tc=att4415: # Note that this mode permits programming USER PF KEYS and labels # However, when you program user pf labels you have to reselect # user pf keys to make them appear! att4415+nl|tty5420+nl|att5420+nl|generic AT&T 4415/5420 changes for not changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :..pn=\E[%p1%d;0;0;1q%p2%:-16.16s:\ :..px=\E[%p1%d;%p2%l%02d;0;1q F%p1%d %p2%s: att4415-nl|tty5420-nl|att5420-nl|AT&T 4415/5420 without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :tc=att4415+nl:tc=att4415: att4415-rv-nl|tty5420-rv-nl|att5420-rv-nl|AT&T 4415/5420 reverse video without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :tc=att4415+nl:tc=att4415-rv: att4415-w-nl|tty5420-w-nl|att5420-w-nl|AT&T 4415/5420 132 cols without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :tc=att4415+nl:tc=att4415-w: att4415-w-rv-n|tty5420-w-rv-n|att5420-w-rv-n|AT&T 4415/5420 132 cols reverse without changing labels:\ :k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:\ :tc=att4415+nl:tc=att4415-w-rv: # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att5420_2|AT&T 5420 model 2 80 cols:\ :am:db:hs:mi:ms:xo:\ :co#80:it#8:li#24:lm#78:ws#55:\ :AL=\E[%dL:CM=\E[%i%p1%d;%p2%dt:DC=\E[%dP:DL=\E[%dM:\ :IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:SF=\E[%dE:SR=\E[%dF:\ :UP=\E[%dA:ae=^O:al=\E[L:as=^N:bt=\E[1Z:cd=\E[0J:ce=\E[0K:\ :cl=\EH\EJ:cm=\E[%i%d;%dH:cr=\EG:cs=\E[%i%d;%dr:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=\E[1B:ec=\E[%ds\E[%dD:ei=:fs=\E8:\ :ho=\E[H:\ :i1=\E[0;23r\Ex\Ey\E[2;0j\E[3;3j\E[4;0j\E[5;0j\E[6;0j\E[7;0j\E[8;0j\E[9;1j\E[10;0j\E[15;0j\E[16;1j\E[19;0j\E[20;1j\E[29;0j\E[1;24r:\ :ic=\E[@:im=:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:\ :k6=\EOh:k7=\EOi:k8=\EOj:kD=\E[P:kH=\Eu:kI=\E[4h:kN=\E[U:\ :kP=\E[V:kb=^H:kd=\E[B:ke=\E[19;0j:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[19;1j:ku=\E[A:le=^H:ll=\Ew:mb=\E[5m:me=\E[m\017:\ :mh=\E[2m:mr=\E[7m:nd=\E[1C:nw=^M^J:rc=\E8:sc=\E7:se=\E[m:\ :sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E7\E[25;%p1%{8}%+%dH:ue=\E[m:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[11;0j:vs=\E[11;1j: att5420_2-w|AT&T 5420 model 2 in 132 column mode:\ :co#132:\ :i1=\E[0;23r\Ex\Ey\E[2;0j\E[3;3j\E[4;0j\E[5;1j\E[6;0j\E[7;0j\E[8;0j\E[9;1j\E[10;0j\E[15;0j\E[16;1j\E[19;0j\E[20;1j\E[29;0j\E[1;24r:tc=att5420_2: att4418|att5418|AT&T 5418 80 cols:\ :am:xo:\ :co#80:li#24:\ :@8=\E[:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[n:\ :F2=\E[o:F3=\E[H:F4=\E[I:F5=\E[J:F8=\E[K:F9=\E[L:FA=\E[E:\ :FB=\E[_:FC=\E[M:FD=\E[N:FE=\E[O:IC=\E[%d@:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[1L:as=\E(0:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[1P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :i1=\E[?3l:ic=\E[1@:im=:is=\E?6l\E?5l:k1=\E[h:k2=\E[i:\ :k3=\E[j:k6=\E[k:k7=\E[l:k8=\E[f:k9=\E[w:k;=\E[m:kC=\E[%:\ :kd=\EU:kh=\Ec:kl=\E@:kr=\EA:ku=\ES:le=\E[D:mb=\E[5m:\ :me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:\ :se=\E[m:sf=^J:so=\E[7m:ue=\E[m:up=\E[A:us=\E[4m: att4418-w|att5418-w|AT&T 5418 132 cols:\ :co#132:\ :i1=\E[?3h:tc=att5418: att4420|tty4420|teletype 4420:\ :bs:da:db:eo:ms:ul:xo:\ :co#80:li#24:lm#72:\ :al=\EL:bl=^G:cd=\EJ:ce=\Ez:cl=\EH\EJ:cm=\EY%+ %+ :cr=\EG:\ :dc=\EP:dl=\EM:dm@:do=\EB:ed@:ho=\EH:k0=\EU:k3=\E@:kA=\EL:\ :kB=\EO:kC=\EJ:kD=\EP:kF=\ES:kI=\E\136:kL=\EM:kR=\ET:kd=\EB:\ :kh=\EH:kl=^H:kr=\EC:ku=\EA:l0=segment advance:\ :l3=cursor tab:le=\ED:nd=\EC:se=\E~:sf=\EH\EM\EY7 :so=\E}:\ :ue=\EZ:up=\EA:us=\E\: # The following is a terminfo entry for the Teletype 4424 # asynchronous keyboard-display terminal. It supports # the vi editor. The terminal must be set up as follows, # # HIGHLIGHT DEFINITION 3-TONE # DISPLAY FUNCTION GROUP III # # The second entry below provides limited (a la adm3a) # operation under GROUP II. # # This must be used with DISPLAY FUNCTION GROUP I or III # and HIGHLIGHT DEFINITION 3-TONE # The terminal has either bold or blink, depending on options # # (att4424: commented out :ti:=\E[1m, we don't need bright locked on -- esr) att4424|tty4424|teletype 4424:\ :am:bs:xo:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\EL:as=\E(0:bl=^G:bt=\EO:cd=\EJ:ce=\Ez:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\EF:\ :dc=\EP:dl=\EM:do=\EB:ei=:ho=\E[H:ic=\E\136:im=:\ :is=\E[20l\E[?7h:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kC=\EJ:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E3:\ :md=\E3:me=\EX\E~\EZ\E4\E(B:mh=\EW:mr=\E}:nd=\EC:nw=\EE:\ :..sa=\E[%?%p1%t7%;%?%p2%t;4%;%?%p3%t;7%;%?%p6%t;1%;%?%p6%p4%|%t;5%;%?%p5%t;0%;m:\ :se=\E~:sf=^J:so=\E}:sr=\ET:st=\EH:ta=^I:ue=\EZ:up=\EA:\ :us=\E\: att4424-1|tty4424-1|teletype 4424 in display function group I:\ :kC@:kd=\EB:kh@:kl=\ED:kr=\EC:ku=\EA:\ :tc=att4424: # This entry is not one of AT&T's official ones, it was translated from the # 4.4BSD termcap file. The highlight strings are different from att4424. # I have no idea why this is -- older firmware version, maybe? # The following two lines are the comment originally attached to the entry: # This entry appears to avoid the top line - I have no idea why. # From: jwb Wed Mar 31 13:25:09 1982 remote from ihuxp att4424m|tty4424m|teletype 4424M:\ :am:da:db:mi:\ :co#80:it#8:li#23:\ :al=\EL:bl=^G:ce=\E[K:cl=\E[2;H\E[J:cm=\E[%i%2;%2H\E[B:\ :cr=^M:dc=\EP:dl=\EM:do=^J:ei=:ic=\E\136:im=:ip=2:\ :is=\E[m\E[2;24r:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:\ :nd=\E[C:nw=^M^J:se=\E[m:sf=^J:so=\E[7m:sr=\ET:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # The Teletype 5425 is really version 2 of the Teletype 5420. It # is quite similar, except for some minor differences. No page # mode, for example, so all of the :cm: sequences used above have # to change back to what's being used for the 5410. Many of the # option settings have changed their numbering as well. # # This has been tested on a preliminary model. # # (att5425: added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att5425|tty5425|att4425|AT&T 4425/5425:\ :am:da:db:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:lm#78:ws#55:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dE:SR=\E[%dF:UP=\E[%dA:ae=^O:\ :al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ec=\E[%ds\E[%dD:ei=\E[4l:fs=\E8:ho=\E[H:\ :i1=\E<\E[?3l:i2=\E[?5l:im=\E[4h:\ :is=\E[m\017\E[1;2;3;4;6l\E[12;13;14;20l\E[?6;97;99l\E[?7h\E[4i\Ex\E[25;1j\212:\ :k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:\ :k8=\EOj:kD=\E[P:kI=\E[4h:kb=^H:kd=\E[B:\ :ke=\E[21;0j\E[25;1j\212:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[21;1j\E[25;4j\Eent\E~:ku=\E[A:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[2;7m:me=\E[m\017:mh=\E[2m:mr=\E[7m:\ :nd=\E[C:nw=^M^J:rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:\ :sr=\EM:st=\EH:ta=^I:ts=\E7\E[25;%p1%{8}%+%dH:ue=\E[m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[12;0j:\ :vs=\E[12;1j: att5425-nl|tty5425-nl|att4425-nl|AT&T 4425/5425 80 columns no labels:\ :ks=\E[21;1j\E[25;4j\Eent:\ :tc=att4425: att5425-w|att4425-w|tty5425-w|teletype 4425/5425 in 132 column mode:\ :co#132:lm#54:ws#97:\ :i1=\E[?3h:tc=tty5425: # (att4426: his had bogus capabilities: :ri=\EM:, :ri=\E[1U:. # I also added / -- esr) att4426|tty4426|teletype 4426S:\ :am:da:db:xo:\ :co#80:li#24:lm#48:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\EL:as=\E(0:bl=^G:cd=\E[J:ce=\E[0K:ch=\E[%dG:\ :cl=\E[H\E[2J\E[1U\E[H\E[2J\E[1V:cm=\E[%i%d;%dH:cr=^M:\ :ct=\E[3g:cv=\E[%dd:dc=\EP:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :i1=\Ec\E[?7h:ic=\E\136:im=:is=\E[m\E[1;24r:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOT:k6=\EOU:k7=\EOV:k8=\EOW:\ :kB=\EO:kC=\E[2J:kH=\E[24;1H:kb=^H:kd=\EB:kh=\E[H:kl=\ED:\ :kr=\EC:ku=\EA:le=\E[D:ll=\E[24H:md=\E[5m:me=\E[m\E(B:\ :mr=\E[7m:nd=\E[C:nw=^M^J:r2=\Ec\E[?3l\E[2;0y:rc=\E8:\ :sc=\E7:se=\E[m:sf=^J:so=\E[5m:sr=\ET:st=\E1:ta=^I:ue=\E[m:\ :up=\EA:us=\E[4m: # Terminfo entry for the AT&T 510 A Personal Terminal # Function keys 9 - 16 are available only after the # screen labeled (soft keys/action blocks) are labeled. Function key # 9 corresponds to the leftmost touch target on the screen, # function key 16 corresponds to the rightmost. # # This entry is based on one done by Ernie Rice at Summit, NJ and # changed by Anne Gallup, Skokie, IL, ttrdc!anne # (untranslatable capabilities removed to fit entry within 1023 bytes) att510a|bct510a|AT&T 510A Personal Terminal:\ :am:mi:ms:xn:xo:\ :Nl#8:co#80:lh#2:li#24:lw#7:\ :#4=\E[u:%i=\E[v:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:\ :F1=\EOe:F2=\EOf:F3=\EOg:F4=\EOh:F5=\EOi:F6=\EOj:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:\ :ac=hrisjjkkllmmnnqqttuuvvwwxx{{||}}~~-f\054h.e+g`b:\ :ae=\E(B:al=\E[L:as=\E(1:bl=^G:bt=\E[Z:cb=\E[1K:cd=\E[0J:\ :ce=\E[0K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=\E[1B:eA=\E(B:ff=^L:ho=\E[H:\ :i1=\E(B\E[2l:i2=\E[21;1|\212:k1=\EOm:k2=\EOV:\ :k3=\EOu:k4=\ENj:k5=\ENe:k6=\ENf:k7=\ENh:k8=\E[H:k9=\EOc:\ :k;=\EOd:kB=\E[Z:kF=\E[S:kR=\E[T:kb=^H:kd=\E[B:ke=\E[19;0|:\ :kl=\E[D:kr=\E[C:ks=\E[19;1|:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[2;7m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[?8i:po=\E[?4i:ps=\E[0i:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[11;3|:vi=\E[11;0|:vs=\E[11;2|: # Terminfo entry for the AT&T 510 D Personal Terminal # Function keys 9 through 16 are accessed by bringing up the # system blocks. # Function key 9 corresponds to the leftmost touch target on the screen, # function key 16 corresponds to the rightmost. # # There are problems with soft key labeling. These are due to # strangenesses in the native terminal that are impossible to # describe in a terminfo. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att510d|bct510d|AT&T 510D Personal Terminal:\ :am:da:db:mi:ms:xn:xo:\ :co#80:li#24:lm#48:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ae=\E(B:\ :al=\E[L:as=\E(1:bl=^G:bt=\E[Z:cd=\E[0J:ce=\E[0K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[1B:\ :ei=\E[4l:ff=^L:ho=\E[H:i1=\E(B\E[5;0|:\ :i2=\E[21;1|\212:im=\E[4h:k1=\EOm:k2=\EOV:k3=\EOu:k4=\ENj:\ :k5=\ENe:k6=\ENf:k7=\ENh:k8=\E[H:k9=\EOc:kb=^H:kd=\E[B:\ :ke=\E[19;0|:kl=\E[D:kr=\E[C:ks=\E[19;1|:ku=\E[A:le=^H:\ :ll=\E#2:mb=\E[5m:md=\E[2;7m:me=\E[m\017:mh=\E[2m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[11;3|:vs=\E[11;2|: # (att500: I merged this with the att513 entry, att500 just used att513 -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att500|att513|AT&T 513 using page mode:\ :am:mi:ms:xn:xo:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dE:SR=\E[%dF:UP=\E[%dA:ae=^O:\ :al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=%i\E[%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ei=\E[4l:ho=\E[H:\ :i1=\E?\E[3;3|\E[10;0|\E[21;1|\212\E[6;1|\E[1{\E[?99l:\ :im=\E[4h:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:\ :k7=\EOi:k8=\EOj:kD=\ENf:kI=\ENj:kN=\E[U:kP=\E[V:kb=^H:\ :kd=\E[B:ke=\E[19;0|\E[21;1|\212:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[19;1|\E[21;4|\Eent:ku=\E[A:le=^H:ll=\E#2:mb=\E[5m:\ :md=\E[2;7m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=\EE:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m:ve=\E[11;0|:vs=\E[11;1|: # 01-07-88 # printer must be set to EMUL ANSI to accept ESC codes # :up: stops at top margin # :i1: sets cpi 10,lpi 6,form 66,left 1,right 132,top 1,bottom 66,font # and alt font ascii,wrap on,tabs cleared # :is: disables newline on LF,Emphasized off # The capability sets form length # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att5310|att5320|AT&T Model 53210 or 5320 matrix printer:\ :co#132:it#8:li#66:\ :DO=\E[%de:RI=\E[%da:cr=^M:do=^J:ff=^L:i1=\Ec:is=\E[20l\r:\ :nd= :ta=^I:up=\EM: # Teletype 5620, firmware version 1.1 (8;7;3) or earlier from BRL # The following SET-UP modes are assumed for normal operation: # CR_DEF=CR NL_DEF=INDEX DUPLEX=FULL # Other SET-UP modes may be set for operator convenience or communication # requirements. This termcap description is for the Resident Terminal Mode. # No delays specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # The BRL entry also said: UNSAFE :ll=\E[70H: att5620-1|tty5620-1|dmd1|Teletype 5620 with old ROMs:\ :am:xo:\ :co#88:it#8:li#70:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:SF=\E[%dS:\ :SR=\E[%dT:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ho=\E[H:\ :ic=\E[@:im=:kC=\E[2J:kH=\E[70;1H:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:nd=\E[C:nw=^M^J:r1=\Ec:\ :rc=\E8:sc=\E7:sf=^J:sr=\E[T:ta=^I:up=\E[A: # 5620 terminfo (2.0 or later ROMS with char attributes) # The following SET-UP modes are assumed for normal operation: # DUPLEX=FULL GEN_FLOW=ON NEWLINE=INDEX RETURN=CR # Other SET-UP modes may be set for operator convenience or communication # requirements. This termcap description is for Resident Terminal Mode. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # assumptions: :sf: (scroll forward one line) is only done at screen bottom # Be aware that older versions of the dmd have a firmware bug that affects # parameter defaulting; for this terminal, the 0 in \E[0m is not optional. # :ms: is from an otherwise inferior BRL for this terminal. That entry # also has :ll:=\E[70H commented out and marked unsafe. # For more, see the 5620 FAQ maintained by David Breneman . att5620|dmd|tty5620|ttydmd|5620|5620 terminal 88 columns:\ :NL:NP:am:bs:ms:xo:\ :co#88:it#8:li#70:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:SF=\E[%dS:\ :SR=\E[%dT:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[@:im=:kC=\E[2J:kH=\E[70;1H:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[2m:me=\E[0m:mh=\E[2m:\ :mr=\E[7m:nd=\E[C:nw=^J:..px=\E[%p1%d;%p2%l%dq%p2%s:\ :r1=\Ec:rc=\E8:sc=\E7:se=\E[0m:sf=\E[S:so=\E[7m:sr=\E[T:\ :ta=^I:ue=\E[0m:up=\E[A:us=\E[4m: att5620-24|tty5620-24|dmd-24|teletype dmd 5620 in a 24x80 layer:\ :li#24:tc=att5620: att5620-34|tty5620-34|dmd-34|teletype dmd 5620 in a 34x80 layer:\ :li#34:tc=att5620: # 5620 layer running the "S" system's downloaded graphics handler: att5620-s|tty5620-s|layer|vitty|5620 S layer:\ :am:bs:pt:\ :co#80:it#8:li#72:\ :al=\EI:bl=^G:ce=\EK:cl=^L:cm=\EY%r%+ %+ :cr=^M:dl=\ED:\ :do=^J:kC=\E[2J:kH=\E[70;1H:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:sf=^J:ta=^I:up=^K:vb=\E^G: # Entries for thru refer to the shifted system pf keys. # # Entries for thru refer to the alternate keypad mode # keys: = * / + 7 8 9 - 4 5 6 , 1 2 3 0 . ENTER # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att605|AT&T 605 80 column 102key keyboard:\ :am:eo:xo:\ :co#80:li#24:ws#80:\ :DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:ae=\E(B:al=\E[L:as=\E(0:\ :bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:fs=\E8:\ :i1=\E[8;0|\E[?\E[13;20l\E[?\E[12h:ic=\E[@:im=\E[4h:\ :is=\E[m\017:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:\ :k6=\EOh:k7=\EOi:k8=\EOj:k9=\ENo:kD=\E[P:kI=\E[@:kN=\E[U:\ :kP=\E[V:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:ll=\E[24H:mb=\E[5m:md=\E[1m:me=\E[m\017:mh=\E[2m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=^J:\ :so=\E[7m:ta=^I:ts=\E7\E[25;%i%p1%dx:ue=\E[m:up=\E[A:\ :us=\E[4m: att605-pc|ATT 605 in pc term mode:\ :@7=\E[F:AL=\E[L:S4=250\E[?11l\E[50;1|:S5=400\E[50;0|:\ :XF=g:XN=e:\ :ac=k\277l\332m\300j\331n\305w\302q\304u\264t\303v\301x\263:\ :al=\E[L:bt=\E[Z:dc=\E[P:dl=\E[M:do=\E[B:ei=:ic=\E[@:im=:\ :k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:k5=\E[Q:k6=\E[R:k7=\E[S:\ :k8=\E[T:k9=\E[U:k;=\E[V:kB=\E[Z:kD=\E[P:kI=\E[@:kL=\E[M:\ :kN=\E[G:kP=\E[I:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=\E[D:nd=\E[C:up=\E[A:\ :tc=att605: att605-w|AT&T 605-w 132 column 102 key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h\E(B:tc=att605: # (att610: I added / based on the init string. I also # added :SF: and :SR: because the BSD file says the att615s have them, # and the 615 is like a 610 with a big keyboard, and most of their other # smart terminals support the same sequence -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att610|AT&T 610; 80 column; 98key keyboard:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ae=\E(B:\ :al=\E[L:as=\E(0:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=\E[4l:fs=\E8:ho=\E[H:\ :i1=\E[8;0|\E[?3;4;5;13;15l\E[13;20l\E[?7h\E[12h\E(B:\ :i2=\E(B:im=\E[4h:is=\E[m\017:k1=\EOc:k2=\EOd:k3=\EOe:\ :k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:k9=\ENo:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:\ :ts=\E7\E[25;%i%p1%dx:ue=\E[m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h\E[?12l:vi=\E[?25l:\ :vs=\E[?12;25h: att610-w|AT&T 610; 132 column; 98key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att610: att610-103k|AT&T 610; 80 column; 103key keyboard:\ :!1=\EOO:!2=\EOP:!3=\EOS:#1=\EOM:%0=\EOt:%1=\EOm:%2=\ENi:\ :%3=\EOl:%4=\ENc:%5=\ENh:%6=\EOv:%7=\EOr:%8=\ENg:%9=\EOz:\ :%a=\EOL:%b=\ENC:%c=\ENH:%d=\EOR:%e=\ENG:%f=\EOZ:%g=\EOT:\ :%h=\EOY:%j=\EOQ:&0=\EOW:&1=\EOb:&2=\ENa:&3=\EOy:&4=\EOB:\ :&5=\EOq:&6=\EOo:&7=\EOp:&8=\EOs:&9=\ENB:*0=\EOX:*1=\EOU:\ :*2=\END:*3=\EON:*4=\ENF:*5=\ENE:*6=\ENI:*7=\ENN:*8=\EOA:\ :*9=\EOK:@0=\EOx:@1=\E9:@2=\EOw:@3=\EOV:@4=\EOu:@5=\ENd:\ :@6=\EOn:@7=\E0:@8=^M:@9=\EOk:F1@:F2@:F3@:F4@:k9@:k;@:kD=\ENf:\ :kE=\EOa:kI=\ENj:kL=\ENe:kM=\ENj:kN=\E[U:kP=\E[V:\ :tc=att610: att610-103k-w|AT&T 610; 132 column; 103key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att610-103k: att615|AT&T 615; 80 column; 98key keyboard:\ :#4=\E[ A:%i=\E[ @:F5=\EOC:F6=\EOD:F7=\EOE:F8=\EOF:F9=\EOG:\ :FA=\EOH:FB=\EOI:FC=\EOJ:FD=\ENO:FE=\ENP:FF=\ENQ:FG=\ENR:\ :FH=\ENS:FI=\ENT:FJ=\EOP:FK=\EOQ:FL=\EOR:FM=\EOS:FN=\EOw:\ :FO=\EOx:FP=\EOy:FQ=\EOm:FR=\EOt:FS=\EOu:FT=\EOv:FU=\EOl:\ :FV=\EOq:FW=\EOr:FX=\EOs:FY=\EOp:FZ=\EOn:Fa=\EOM:\ :tc=att610: att615-w|AT&T 615; 132 column; 98key keyboard:\ :#4=\E[ A:%i=\E[ @:F5=\EOC:F6=\EOD:F7=\EOE:F8=\EOF:F9=\EOG:\ :FA=\EOH:FB=\EOI:FC=\EOJ:FD=\ENO:FE=\ENP:FF=\ENQ:FG=\ENR:\ :FH=\ENS:FI=\ENT:FJ=\EOP:FK=\EOQ:FL=\EOR:FM=\EOS:FN=\EOw:\ :FO=\EOx:FP=\EOy:FQ=\EOm:FR=\EOt:FS=\EOu:FT=\EOv:FU=\EOl:\ :FV=\EOq:FW=\EOr:FX=\EOs:FY=\EOp:FZ=\EOn:Fa=\EOM:\ :tc=att610-w: att615-103k|AT&T 615; 80 column; 103key keyboard:\ :#4=\E[ A:%i=\E[ @:\ :tc=att610-103k: att615-103k-w|AT&T 615; 132 column; 103key keyboard:\ :#4=\E[ A:%i=\E[ @:\ :tc=att610-103k-w: # (att620: I added / based on the init string and # :SR:/:SF: from a BSD termcap -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att620|AT&T 620; 80 column; 98key keyboard:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:fs=\E8:ho=\E[H:\ :i1=\E[8;0|\E[?3;4;5;13;15l\E[13;20l\E[?7h\E[12h:\ :i2=\E(B:im=\E[4h:is=\E[m\017:k1=\EOc:k2=\EOd:k3=\EOe:\ :k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:k9=\ENo:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:ll=\E[24H:\ :mb=\E[5m:md=\E[1m:me=\E[m\E(B\017:mh=\E[2m:mr=\E[7m:\ :nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[7m:\ :sr=\EM:ta=^I:ts=\E7\E[25;%i%p1%dx:ue=\E[m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[?25h\E[?12l:vi=\E[?25l:\ :vs=\E[?12;25h: att620-w|AT&T 620; 132 column; 98key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att620: att620-103k|AT&T 620; 80 column; 103key keyboard:\ :!1=\EOO:!2=\EOP:!3=\EOS:#1=\EOM:%0=\EOt:%1=\EOm:%2=\ENi:\ :%3=\EOl:%4=\ENc:%5=\ENh:%6=\EOv:%7=\EOr:%8=\ENg:%9=\EOz:\ :%a=\EOL:%b=\ENC:%c=\ENH:%d=\EOR:%e=\ENG:%f=\EOZ:%g=\EOT:\ :%h=\EOY:%j=\EOQ:&0=\EOW:&1=\EOb:&2=\ENa:&3=\EOy:&4=\EOB:\ :&5=\EOq:&6=\EOo:&7=\EOp:&8=\EOs:&9=\ENB:*0=\EOX:*1=\EOU:\ :*2=\END:*3=\EON:*4=\ENF:*5=\ENE:*6=\ENI:*7=\ENN:*8=\EOA:\ :*9=\EOK:@0=\EOx:@1=\E9:@2=\EOw:@3=\EOV:@4=\EOu:@5=\ENd:\ :@6=\EOn:@7=\E0:@8=^M:@9=\EOk:F1@:F2@:F3@:F4@:F5@:F6@:F7@:F8@:\ :F9@:FA@:FB@:FC@:FD@:FE@:FF@:FG@:FH@:FI@:FJ@:FK@:FL@:FM@:FN@:FO@:FP@:\ :FQ@:FR@:FS@:FT@:FU@:FV@:FW@:FX@:FY@:FZ@:Fa@:k9@:k;@:kD=\ENf:\ :kE=\EOa:kI=\ENj:kL=\ENe:kM=\ENj:kN=\E[U:kP=\E[V:\ :tc=att620: att620-103k-w|AT&T 620; 132 column; 103key keyboard:\ :co#132:ws#132:\ :i1=\E[8;0|\E[?4;5;13;15l\E[13;20l\E[?3;7h\E[12h:tc=att620-103k: # AT&T (formerly Teletype) 630 Multi-Tasking Graphics terminal # The following SETUP modes are assumed for normal operation: # Local_Echo=Off Gen_Flow=On Return=CR Received_Newline=LF # Font_Size=Large Non-Layers_Window_Cols=80 # Non-Layers_Window_Rows=60 # Other SETUP modes may be set for operator convenience or communication # requirements. Some capabilities assume a printer attached to the Aux EIA # port. This termcap description is for the Fixed Non-Layers Window. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # (att630: added :ic:, :mb: and :mh: from a BSD termcap file -- esr) att630|AT&T 630 windowing terminal:\ :NP:am:bs:da:db:mi:ms:xo:\ :co#80:it#8:li#60:lm#0:\ :@8=^M:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\ENq:\ :F2=\ENr:F3=\ENs:F4=\ENt:F5=\ENu:F6=\ENv:F7=\ENw:F8=\ENx:\ :F9=\ENy:FA=\ENz:FB=\EN{:FC=\EN|:FD=\EN}:FE=\EN~:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:\ :al=\E[L:bl=^G:bt=\E[Z:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:is=\E[m:k9=\ENo:k;=\ENp:\ :kA=\E[L:kB=\E[Z:kC=\E[2J:kD=\E[P:kI=\E[@:kL=\E[M:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :me=\E[m:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=^M^J:pf=\E[?4i:\ :po=\E[?5i:..px=\E[%p1%d;%p2%l%dq%p2%s:r2=\Ec:rc=\E8:\ :..sa=\E[0%?%p2%t;4%;%?%p1%p3%|%p4%|%p5%|%t;7%;m:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: att630-24|5630-24|5630DMD-24|630MTG-24|AT&T 630 windowing terminal 24 lines:\ :li#24:tc=att630: # This entry was modified 3/13/90 by JWE. # fixes include additions of , correcting :rp:, and modification # of . (See comments below) # att730 has status line of 80 chars # These were commented out: :SF=\E[%p1%dS:, :SR=\E[%p1%dT:, # the and up keys are used for shifted system Fkeys # NOTE: JWE 3/13/90 The 98 key keyboard translation for shift/HOME is # currently the same as :kh: (unshifted HOME or \E[H). On the 102, 102+1 # and 122 key keyboards, the 730's translation is \E[2J. For consistency # has been commented out. The user can uncomment if using the # 102, 102+1, or 122 key keyboards # kHOM=\E[2J, # (att730: I added / based on the init string -- esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) att730|AT&T 730 windowing terminal:\ :am:da:db:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#60:lm#0:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:fs=\E8:\ :ho=\E[H:\ :i1=\E[8;0|\E[?3;4;5;13;15l\E[13;20l\E[?7h\E[12h\E(B\E)B:\ :i2=\E(B:im=\E[4h:is=\E[m\017:k1=\EOc:k2=\EOd:k3=\EOe:\ :k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:k9=\ENo:kI=\E[@:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m\017:mh=\E[2m:mr=\E[7m:nd=\E[C:\ :nw=\EE:rc=\E8:sc=\E7:se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:\ :ta=^I:ts=\E7\E[;%i%p1%dx:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h\E[?12l:vi=\E[?25l:\ :vs=\E[?12;25h: att730-41|730MTG-41|AT&T 730-41 windowing terminal Version:\ :li#41:tc=att730: att730-24|730MTG-24|AT&T 730-24 windowing terminal Version:\ :li#24:tc=att730: att730r|730MTGr|AT&T 730 rev video windowing terminal Version:\ :i1=\E[8;0|\E[?3;4;13;15l\E[?5h\E[13;20l\E[?7h\E[12h\E(B\E)B:\ :vb=\E[?5l\E[?5h:\ :tc=att730: att730r-41|730MTG-41r|AT&T 730r-41 rev video windowing terminal Version:\ :li#41:tc=att730r: att730r-24|730MTGr-24|AT&T 730r-24 rev video windowing terminal Version:\ :li#24:tc=att730r: # The following represents the screen layout along with the associated # bezel buttons for the 5430/pt505 terminal. The "kf" designations do # not appear on the screen but are shown to reference the bezel buttons. # The "CMD", "MAIL", and "REDRAW" buttons are shown in their approximate # position relative to the screen. # # # # +----------------------------------------------------------------+ # | | # XXXX | kf0 kf24 | XXXX # | | # | | # XXXX | kf1 kf23 | XXXX # | | # | | # XXXX | kf2 kf22 | XXXX # | | # | | # XXXX | kf3 kf21 | XXXX # | | # | | # XXXX | kf4 kf20 | XXXX # | | # | | # XXXX | kf5 kf19 | XXXX # | | # | | # XXXX | kf6 kf18 | XXXX # | | # | | # XXXX | | XXXX # | | # | | # +----------------------------------------------------------------+ # # XXXX XXXX XXXX XXXX XXXX XXXX XXXX XXXX XXXX XXXX # # Note: XXXX represents the screen buttons # CMD REDRAW # # MAIL # # version 1 note: # The character string sent by key 'kf26' may be user programmable # to send either \E[16s, or \E[26s. # The character string sent by key 'krfr' may be user programmable # to send either \E[17s, or \E[27s. # # Depression of the "CMD" key sends \E! (kcmd) # Depression of the "MAIL" key sends \E[26s (kf26) # "REDRAW" same as "REFRESH" (krfr) # # "kf" functions adds carriage return to output string if terminal is in # 'new line' mode. # # The following are functions not covered in the table above: # # Set keyboard character (SKC): \EPn1;Pn2w # Pn1= 0 Back Space key # Pn1= 1 Break key # Pn2= Program char (hex) # # Screen Definition (SDF): \E[Pn1;Pn2;Pn3;Pn4;Pn5t # Pn1= Window number (1-39) # Pn2-Pn5= Y;X;Y;X coordinates # # Screen Selection (SSL): \E[Pnu # Pn= Window number # # Set Terminal Modes (SM): \E[Pnh # Pn= 3 Graphics mode # Pn= > Cursor blink # Pn= < Enter new line mode # Pn= = Enter reverse insert/replace mode # Pn= ? Enter no scroll mode # # Reset Terminal Mode (RM): \E[Pnl # Pn= 3 Exit graphics mode # Pn= > Exit cursor blink # Pn= < Exit new line mode # Pn= = Exit reverse insert/replace mode # Pn= ? Exit no scroll mode # # Screen Status Report (SSR): \E[Pnp # Pn= 0 Request current window number # Pn= 1 Request current window dimensions # # Device Status Report (DSR): \E[6n Request cursor position # # Call Status Report (CSR): \E[Pnv # Pn= 0 Call failed # Pn= 1 Call successful # # Transparent Button String (TBS): \E[Pn1;Pn2;Pn3;{string # Pn1= Button number to be loaded # Pn2= Character count of "string" # Pn3= Key mode being loaded: # 0= Unshifted # 1= Shifted # 2= Control # String= Text string (15 chars max) # # Screen Number Report (SNR): \E[Pnp # Pn= Screen number # # Screen Dimension Report (SDR): \E[Pn1;Pn2r # Pn1= Number of rows available in window # Pn2= Number of columns available in window # # Cursor Position Report (CPR): \E[Pn1;Pn2R # Pn1= "Y" Position of cursor # Pn2= "X" Position of cursor # # Request Answer Back (RAB): \E[c # # Answer Back Response (ABR): \E[?;*;30;VSV # *= 0 No printer available # *= 2 Printer available # V= Software version number # SV= Software sub version number # (printer-available field not documented in v1) # # Screen Alignment Aid: \En # # Bell (lower pitch): \E[x # # Dial Phone Number: \EPdstring\ # string= Phone number to be dialed # # Set Phone Labels: \EPpstring\ # string= Label for phone buttons # # Set Clock: \EPchour;minute;second\ # # Position Clock: \EPsY;X\ # Y= "Y" coordinate # X= "X" coordinate # # Delete Clock: \Epr\ # # Programming The Function Buttons: \EPfPn;string\ # Pn= Button number (00-06, 18-24) # (kf00-kf06, kf18-kf24) # string= Text to sent on button depression # # The following in version 2 only: # # Request For Local Directory Data: \EPp12;\ # # Local Directory Data to host: \EPp11;LOCAL...DIRECTORY...DATA\ # # Request for Local Directory Data in print format: \EPp13;\ # # Enable 'Prt on Line' mode: \022 (DC2) # # Disable 'Prt on Line' mode: \024 (DC4) # # 05-Aug-86: # The following Terminfo entry describes functions which are supported by # the AT&T 5430/pt505 terminal software version 2 and later. att505|pt505|att5430|gs5430|AT&T Personal Terminal 505 or 5430 GETSET terminal:\ :am:xo:\ :co#80:it#8:li#24:\ :&2=\E[27s:@4=\E\041:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:\ :DO=\E[%dB:F8=\E[18s:F9=\E[19s:FA=\E[20s:FB=\E[21s:\ :FC=\E[22s:FD=\E[23s:FE=\E24s:FG=\E26s:LE=\E[%dD:\ :RA=\E[11;1j:RI=\E[%dC:SA=\E[11;0j:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:cb=\E2K:cd=\E[0J:\ :ce=\E[0K:cl=\E[2J\E[H:cm=\E[%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\EPr\E[0u\E[2J\E[0;0H\E[m\E[3l\E[l\E[=l\E[?l:\ :im=\E[4h:k0=\E[00s:k1=\E[01s:k2=\E[02s:k3=\E[03s:\ :k4=\E[04s:k5=\E[05s:k6=\E[06s:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:r1=\Ec:rc=\E8:sc=\E7:\ :se=\E[m:sf=^J:so=\E[1m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E[>l:vs=\E[>h: # The following Terminfo entry describes functions which are supported by # the AT&T 5430/pt505 terminal software version 1. att505-24|pt505-24|gs5430-24|AT&T PT505 or 5430 GETSET version 1 24 lines:\ :li#24:\ :RA@:SA@:pf@:po@:rc@:sc@:tc=att505: tt505-22|pt505-22|gs5430-22|AT&T PT505 or 5430 GETSET version 1 22 lines:\ :li#22:tc=att505: # # -------------------- TERMINFO FILE CAN BE SPLIT HERE ----------------------- # This cut mark helps make life less painful for people running ncurses tic # on machines with relatively little RAM. The file can be broken in half here # cleanly and compiled in sections -- no `use' references cross this cut # going forward. # #### Ampex (Dialogue) # # Yes, these are the same people who are better-known for making audio- and # videotape. I'm told they are located in Redwood City, CA. # # From: Fri Sep 11 22:38:32 1981 # (ampex80: some capabilities merged in from SCO's entry -- esr) ampex80|a80|d80|dialogue|dialogue80|ampex dialogue 80:\ :am:bs:bw:ul:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :\ :cr=^M:ct=\E3:dc=\EW:dl=\ER:do=^J:ei=:ic=\EQ:im=:is=\EA:le=^H:\ :nd=^L:se=\Ek:sf=^J:so=\Ej:st=\E1:ta=^I:ue=\Em:up=^K:us=\El: # This entry was from somebody anonymous, Tue Aug 9 20:11:37 1983, who wrote: ampex175|ampex d175:\ :am:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\Ey:ce=\Et:cl=\E+:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:is=\EX\EA\EF:\ :kA=\EE:kD=\EW:kI=\EQ:kL=\ER:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:\ :le=^H:ll=^^^K:nd=^L:se=\Ek:sf=^J:so=\Ej:te=\EF:ti=\EN:\ :ue=\Em:up=^K:us=\El: # No backspace key in the main QWERTY cluster. Fortunately, it has a # NEWLINE/PAGE key just above RETURN that sends a strange single-character # code. Given a suitable Unix (one that lets you set an echo-erase-as-BS-SP-BS # mode), this key can be used as the erase key; I find I like this. Because # some people and some systems may not, there is another termcap ("ampex175") # that suppresses this little eccentricity by omitting the relevant capability. ampex175-b|ampex d175 using left arrow for erase:\ :kb=^_:\ :tc=ampex175: # From: Richard Bascove # (ampex210: removed obsolete ":kn#10:" -- esr) ampex210|a210|ampex a210:\ :am:bs:hs:xn:\ :co#80:it#8:li#24:sg#1:\ :al=\EE:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :dc=\EW:\ :dl=\ER:ei=:fs=\E.2:ho=^^:ic=\EQ:if=/usr/share/tabset/std:\ :im=:is=\EC\Eu\E'\E(\El\EA\E%\E{\E.2\EG0\Ed\En:\ :k0=^A0\r:k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:k5=^A5\r:\ :k6=^A6\r:k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^V:kh=^^:kl=^H:\ :kr=^L:ku=^K:le=^H:mk@:nd=^L:ta=^I:ts=\E.0\Eg\E}\Ef:up=^K:\ :vb=\EU\EX\EU\EX\EU\EX\EU\EX:\ :tc=adm+sgr: # (ampex219: I added / based on the init string, added :vs: # from ampex219w, added :ve:=\E[?3l, irresistibly suggested by :vs:, # and moved the padding to be *after* the caps -- esr) ampex219|ampex-219|amp219|Ampex with Automargins:\ :hs:xn:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=%i\E[%2;%2r:\ :do=\E[B:ho=\E[H:\ :is=\E>\E[?1l\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:k0=\E[21~:\ :k1=\E[7~:k2=\E[8~:k3=\E[9~:k4=\E[10~:k5=\E[11~:k6=\E[17~:\ :k7=\E[18~:k8=\E[19~:k9=\E[20~:kd=\E[B:ke=\E>:kh=\E[H:\ :kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mh=\E[1m:mr=\E[7m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:\ :sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?3l:vs=\E[?3h: ampex219w|ampex-219w|amp219w|Ampex 132 cols:\ :co#132:li#24:\ :bl=^G:cr=^M:do=^J:is=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h:\ :sf=^J:\ :tc=ampex219: # (ampex232: removed :if=/usr/share/tabset/ampex:, no file and no :st: --esr) ampex232|ampex-232|Ampex Model 232:\ :am:\ :co#80:li#24:sg#1:\ :al=5*\EE:bt=\EI:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :dc=\EW:\ :dl=5*\ER:do=^V:ei=:ic=\EQ:im=:is=\Eg\El:k0=^A@\r:k1=^AA\r:\ :k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:\ :k8=^AH\r:k9=^AI\r:kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:\ :mk@:nd=^L:ta=^I:up=^K:vb=\Eb\Ed:ve=\E.4:vi=\E.0:\ :tc=adm+sgr: # (ampex: removed :if=/usr/share/tabset/amp-132:, no file and no :st: -- esr) ampex232w|Ampex Model 232 / 132 columns:\ :co#132:li#24:\ :is=\E\034Eg\El:tc=ampex232: #### Ann Arbor (aa) # # Ann Arbor made dream terminals for hackers -- large screen sizes and huge # numbers of function keys. At least some used monitors in portrait mode, # allowing up to 76-character screen heights! They were reachable at: # # Ann Arbor Terminals # 6175 Jackson Road # Ann Arbor, MI 48103 # (313)-663-8000 # # But in 1996 the phone number reaches some kitschy retail shop, and Ann Arbor # can't be found on the Web; I fear they're long dead. R.I.P. # # Originally from Mike O'Brien@Rand and Howard Katseff at Bell Labs. # Highly modified 6/22 by Mike O'Brien. # split out into several for the various screen sizes by dave-yost@rand # Modifications made 3/82 by Mark Horton # Modified by Tom Quarles at UCB for greater efficiency and more diversity # status line moved to top of screen, :vb: removed 5/82 # Some unknown person at SCO then hacked the init strings to make them more # efficient. # # assumes the following setup: # A menu: 0000 1010 0001 0000 # B menu: 9600 0100 1000 0000 0000 1000 0000 17 19 # C menu: 56 66 0 0 9600 0110 1100 # D menu: 0110 1001 1 0 # # Briefly, the settings are for the following modes: # (values are for bit set/clear with * indicating our preference # and the value used to test these termcaps) # Note that many of these settings are irrelevent to the terminfo # and are just set to the default mode of the terminal as shipped # by the factory. # # A menu: 0000 1010 0001 0000 # Block/underline cursor* # blinking/nonblinking cursor* # key click/no key click* # bell/no bell at column 72* # # key pad is cursor control*/key pad is numeric # return and line feed/return for :cr: key * # repeat after .5 sec*/no repeat # repeat at 25/15 chars per sec. * # # hold data until pause pressed/process data unless pause pressed* # slow scroll/no slow scroll* # Hold in area/don't hold in area* # functions keys have default*/function keys disabled on powerup # # show/don't show position of cursor during page transmit* # unused # unused # unused # # B menu: 9600 0100 1000 0000 0000 1000 0000 17 19 # Baud rate (9600*) # # 2 bits of parity - 00=odd,01=even*,10=space,11=mark # 1 stop bit*/2 stop bits # parity error detection off*/on # # keyboard local/on line* # half/full duplex* # disable/do not disable keyboard after data transmission* # # transmit entire page/stop transmission at cursor* # transfer/do not transfer protected characters* # transmit all characters/transmit only selected characters* # transmit all selected areas/transmit only 1 selected area* # # transmit/do not transmit line separators to host* # transmit/do not transmit page tab stops tabs to host* # transmit/do not transmit column tab stop tabs to host* # transmit/do not transmit graphics control (underline,inverse..)* # # enable*/disable auto XON/XOFF control # require/do not require receipt of a DC1 from host after each LF* # pause key acts as a meta key/pause key is pause* # unused # # unused # unused # unused # unused # # XON character (17*) # XOFF character (19*) # # C menu: 56 66 0 0 9600 0110 1100 # number of lines to print data on (printer) (56*) # # number of lines on a sheet of paper (printer) (66*) # # left margin (printer) (0*) # # number of pad chars on new line to printer (0*) # # printer baud rate (9600*) # # printer parity: 00=odd,01=even*,10=space,11=mark # printer stop bits: 2*/1 # print/do not print guarded areas* # # new line is: 01=LF,10=CR,11=CRLF* # unused # unused # # D menu: 0110 1001 1 0 # LF is newline/LF is down one line, same column* # wrap to preceding line if move left from col 1*/don't wrap # wrap to next line if move right from col 80*/don't wrap # backspace is/is not destructive* # # display*/ignore DEL character # display will not/will scroll* # page/column tab stops* # erase everything*/erase unprotected only # # editing extent: 0=display,1=line*,2=field,3=area # # unused # annarbor4080|aa4080|ann arbor 4080:\ :am:bs:\ :co#80:li#40:\ :bl=^G:cl=\014:\ :..cm=\017%p2%{10}%/%{16}%*%p2%{10}%m%+%c%p1%?%p1%{19}%>%t%{12}%+%;%'@'%+%c:\ :cr=^M:ct=^^P^P:do=^J:ho=^K:kb=^^:kd=^J:kh=^K:kl=^H:kr=^_:\ :ku=^N:le=^H:nd=^_:sf=^J:st=^]^P1:ta=^I:up=^N: # Strange Ann Arbor terminal from BRL aas1901|Ann Arbor K4080 w/S1901 mod:\ :am:\ :co#80:li#40:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=^K:kb=^H:kd=^J:kl=^H:le=^H:\ :ll=^O\200c:nd=^_:nw=^M^J:sf=^J:ta=^I:up=^N: # If you're using the GNU termcap library, add # :cS=\E[%p1%d;%p2%d;%p3%d;%p4%dp: # to these capabilities. This is the nonstandard GNU termcap scrolling # capability, arguments are: # 1. Total number of lines on the screen. # 2. Number of lines above desired scroll region. # 3. Number of lines below (outside of) desired scroll region. # 4. Total number of lines on the screen, the same as the first parameter. # The generic Ann Arbor entry is the only one that uses this. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) aaa+unk|aaa-unk|ann arbor ambassador (internal - don't use this directly):\ :am:bs:km:mi:xo:\ :co#80:it#8:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :ct=\E[2g:dc=\E[P:dl=\E[M:do=^K:ei=:ho=\E[H:\ :i1=\E[m\E7\E[H\E9\E8:i2=\E[1Q\E[>20;30l\EP`+x~M\E\:\ :ic=\E[@:im=:k1=\EOA:k2=\EOB:k3=\EOC:k4=\EOD:k5=\EOE:\ :k6=\EOF:k7=\EOG:k8=\EOH:k9=\EOI:kD=\E[P:kI=\E[@:kb=^H:\ :kd=\E[B:\ :ke=\EP`>y~[[J`8xy~[[A`4xy~[[D`6xy~[[C`2xy~[[B\E\:\ :kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\EP`>z~[[J`8xz~[[A`4xz~[[D`6xz~[[C`2xz~[[B\E\:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mm=\E[>52h:\ :mo=\E[>52l:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:sf=^K:\ :so=\E[7m:st=\EH:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: aaa+rv|ann arbor ambassador in reverse video:\ :i1=\E[7m\E7\E[H\E9\E8:mb=\E[5;7m:md=\E[1;7m:\ :me=\E[7m\016:mk=\E[7;8m:mr=\E[m:r1=\E[H\E[7m\E[J:\ :..sa=\E[%?%p1%p3%|%!%t7;%;%?%p2%t4;%;%?%p4%t5;%;%?%p6%t1;%;%?%p7%t8;%;m:\ :se=\E[7m:so=\E[m:ue=\E[7m:us=\E[4;7m: # Ambassador with the DEC option, for partial vt100 compatibility. aaa+dec|ann arbor ambassador in dec vt100 mode:\ :ac=aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}:\ :ae=^N:as=^O:cs=\E[%i%d;%dr:eA=\E(0:\ :..sa=\E[%?%p1%p3%|%!%t7;%;%?%p2%t4;%;%?%p4%t5;%;%?%p6%t1;%;%?%p7%t8;%;m%?%p9%t\017%e\016%;: aaa-18|ann arbor ambassador/18 lines:\ :li#18:\ :is=\E7\E[60;0;0;18p\E8:te=\E[60;0;0;18p\E[60;1H\E[K:\ :ti=\E[18;0;0;18p:\ :tc=aaa+unk: aaa-18-rv|ann arbor ambassador/18 lines+reverse video:\ :tc=aaa+rv:tc=aaa-18: aaa-20|ann arbor ambassador/20 lines:\ :li#20:\ :is=\E7\E[60;0;0;20p\E8:te=\E[60;0;0;20p\E[60;1H\E[K:\ :ti=\E[20;0;0;20p:\ :tc=aaa+unk: aaa-22|ann arbor ambassador/22 lines:\ :li#22:\ :is=\E7\E[60;0;0;22p\E8:te=\E[60;0;0;22p\E[60;1H\E[K:\ :ti=\E[22;0;0;22p:\ :tc=aaa+unk: aaa-24|ann arbor ambassador/24 lines:\ :li#24:\ :is=\E7\E[60;0;0;24p\E8:te=\E[60;0;0;24p\E[60;1H\E[K:\ :ti=\E[24;0;0;24p:\ :tc=aaa+unk: aaa-24-rv|ann arbor ambassador/24 lines+reverse video:\ :tc=aaa+rv:tc=aaa-24: aaa-26|ann arbor ambassador/26 lines:\ :li#26:\ :is=\E7\E[60;0;0;26p\E8:te=\E[60;0;0;26p\E[26;1H\E[K:\ :ti=\E[H\E[J\E[26;0;0;26p:\ :tc=aaa+unk: aaa-28|ann arbor ambassador/28 lines:\ :li#28:\ :is=\E7\E[60;0;0;28p\E8:te=\E[60;0;0;28p\E[28;1H\E[K:\ :ti=\E[H\E[J\E[28;0;0;28p:\ :tc=aaa+unk: aaa-30-s|aaa-s|ann arbor ambassador/30 lines w/status:\ :es:hs:\ :li#29:\ :ds=\E7\E[60;0;0;30p\E[1;1H\E[K\E[H\E8\r\n\E[K:\ :fs=\E[>51l:is=\r\n\E[A\E7\E[60;1;0;30p\E8:\ :te=\E[60;1;0;30p\E[29;1H\E[K:\ :ti=\E[H\E[J\E[30;1;0;30p\E[30;1H\E[K:\ :ts=\E[>51h\E[1;%p1%dH\E[2K:tc=aaa+unk: aaa-30-s-rv|aaa-s-rv|ann arbor ambassador/30 lines+status+reverse video:\ :tc=aaa+rv:tc=aaa-30-s: aaa-s-ctxt|aaa-30-s-ctxt|ann arbor ambassador/30 lines+status+save context:\ :te=\E[60;1;0;30p\E[59;1H\E[K:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:tc=aaa-30-s: aaa-s-rv-ctxt|aaa-30-s-rv-ct|ann arbor ambassador/30 lines+status+save context:\ :te=\E[60;1;0;30p\E[59;1H\E[K:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:tc=aaa-30-s-rv: aaa|aaa-30|ambas|ambassador|ann arbor ambassador/30 lines:\ :li#30:\ :is=\E7\E[60;0;0;30p\E8:te=\E[60;0;0;30p\E[30;1H\E[K:\ :ti=\E[H\E[J\E[30;0;0;30p:\ :tc=aaa+unk: aaa-30-rv|aaa-rv|ann arbor ambassador/30 lines in reverse video:\ :tc=aaa+rv:tc=aaa-30: aaa-30-ctxt|aaa-ctxt|ann arbor ambassador/30 lines; saving context:\ :te=\E[60;0;0;30p\E[60;1H\E[K:ti=\E[30;0;0;30p:\ :tc=aaa-30: aaa-30-rv-ctxt|aaa-rv-ctxt|ann arbor ambassador/30 lines reverse video; saving context:\ :te=\E[60;0;0;30p\E[60;1H\E[K:ti=\E[30;0;0;30p:\ :tc=aaa+rv:tc=aaa-30: aaa-36|ann arbor ambassador/36 lines:\ :li#36:\ :is=\E7\E[60;0;0;36p\E8:te=\E[60;0;0;36p\E[36;1H\E[K:\ :ti=\E[H\E[J\E[36;0;0;36p:\ :tc=aaa+unk: aaa-36-rv|ann arbor ambassador/36 lines+reverse video:\ :tc=aaa+rv:tc=aaa-36: aaa-40|ann arbor ambassador/40 lines:\ :li#40:\ :is=\E7\E[60;0;0;40p\E8:te=\E[60;0;0;40p\E[40;1H\E[K:\ :ti=\E[H\E[J\E[40;0;0;40p:\ :tc=aaa+unk: aaa-40-rv|ann arbor ambassador/40 lines+reverse video:\ :tc=aaa+rv:tc=aaa-40: aaa-48|ann arbor ambassador/48 lines:\ :li#48:\ :is=\E7\E[60;0;0;48p\E8:te=\E[60;0;0;48p\E[48;1H\E[K:\ :ti=\E[H\E[J\E[48;0;0;48p:\ :tc=aaa+unk: aaa-48-rv|ann arbor ambassador/48 lines+reverse video:\ :tc=aaa+rv:tc=aaa-48: aaa-60-s|ann arbor ambassador/59 lines+status:\ :es:hs:\ :li#59:\ :ds=\E7\E[60;0;0;60p\E[1;1H\E[K\E[H\E8\r\n\E[K:\ :fs=\E[>51l:is=\r\n\E[A\E7\E[60;1;0;60p\E8:\ :ts=\E[>51h\E[1;%p1%dH\E[2K:tc=aaa+unk: aaa-60-s-rv|ann arbor ambassador/59 lines+status+reverse video:\ :tc=aaa+rv:tc=aaa-60-s: aaa-60-dec-rv|ann arbor ambassador/dec mode+59 lines+status+rev video:\ :tc=aaa+dec:tc=aaa+rv:tc=aaa-60-s: aaa-60|ann arbor ambassador/60 lines:\ :li#60:\ :is=\E7\E[60;0;0;60p\E[1Q\E[m\E[>20;30l\E8:tc=aaa+unk: aaa-60-rv|ann arbor ambassador/60 lines+reverse video:\ :tc=aaa+rv:tc=aaa-60: aaa-db|ann arbor ambassador 30/destructive backspace:\ :bs@:\ :i2=\E[1Q\E[m\E[>20l\E[>30h:le=\E[D:tc=aaa-30: guru|guru-33|guru+unk|ann arbor guru/33 lines 80 cols:\ :li#33:\ :i2=\E[>59l:is=\E7\E[255;0;0;33;80;80p\E8\E[J:\ :te=\E[255p\E[255;1H\E[K:ti=\E[33p:vb=\E[>59h\E[>59l:\ :tc=aaa+unk: guru+rv|guru changes for reverse video:\ :i2=\E[>59h:vb=\E[>59l\E[>59h: guru-rv|guru-33-rv|ann arbor guru/33 lines+reverse video:\ :tc=guru+rv:tc=guru-33: guru+s|guru status line:\ :es:hs:\ :ds=\E7\E[;0p\E[1;1H\E[K\E[H\E8\r\n\E[K:fs=\E[>51l:\ :te=\E[255;1p\E[255;1H\E[K:ti=:\ :ts=\E[>51h\E[1;%p1%dH\E[2K: guru-nctxt|guru with no saved context:\ :ti=\E[H\E[J\E[33p\E[255;1H\E[K:tc=guru: guru-s|guru-33-s|ann arbor guru/33 lines+status:\ :li#32:\ :is=\r\n\E[A\E7\E[255;1;0;33;80;80p\E8\E[J:\ :ti=\E[33;1p\E[255;1H\E[K:tc=guru+s:\ :tc=guru+unk: guru-24|ann arbor guru 24 lines:\ :co#80:li#24:\ :is=\E7\E[255;0;0;24;80;80p\E8\E[J:ti=\E[24p:tc=guru+unk: guru-44|ann arbor guru 44 lines:\ :co#97:li#44:\ :is=\E7\E[255;0;0;44;97;100p\E8\E[J:ti=\E[44p:tc=guru+unk: guru-44-s|ann arbor guru/44 lines+status:\ :li#43:\ :is=\r\n\E[A\E7\E[255;1;0;44;80;80p\E8\E[J:\ :ti=\E[44;1p\E[255;1H\E[K:tc=guru+s:\ :tc=guru+unk: guru-76|guru with 76 lines by 89 cols:\ :co#89:li#76:\ :is=\E7\E[255;0;0;76;89;100p\E8\E[J:ti=\E[76p:tc=guru+unk: guru-76-s|ann arbor guru/76 lines+status:\ :co#89:li#75:\ :is=\r\n\E[A\E7\E[255;1;0;76;89;100p\E8\E[J:\ :ti=\E[76;1p\E[255;1H\E[K:tc=guru+s:\ :tc=guru+unk: guru-76-lp|guru-lp|guru with page bigger than line printer:\ :co#134:li#76:\ :is=\E7\E[255;0;0;76;134;134p\E8\E[J:ti=\E[76p:tc=guru+unk: guru-76-w|guru 76 lines by 178 cols:\ :co#178:li#76:\ :is=\E7\E[255;0;0;76;178;178p\E8\E[J:ti=\E[76p:tc=guru+unk: guru-76-w-s|ann arbor guru/76 lines+status+wide:\ :co#178:li#75:\ :is=\r\n\E[A\E7\E[255;1;0;76;178;178p\E8\E[J:\ :ti=\E[76;1p\E[255;1H\E[K:\ :tc=guru+s:tc=guru+unk: guru-76-wm|guru 76 lines by 178 cols with 255 cols memory:\ :co#178:li#76:\ :is=\E7\E[255;0;0;76;178;255p\E8\E[J:ti=\E[76p:tc=guru+unk: aaa-rv-unk|ann arbor unknown type:\ :Nl#0:lh#0:lw#0:\ :ho=\E[H:i1=\E[7m\E7\E[H\E9\E8:mb=\E[5;7m:md=\E[1;7m:\ :me=\E[7m:mk=\E[7;8m:mr=\E[m:r1=\E[H\E[7m\E[J:\ :..sa=\E[%?%p1%!%t7;%;%?%p2%t4;%;%?%p3%t7;%;%?%p4%t5;%;%?%p6%t1;%;%?%p7%t8;%;m:\ :se=\E[7m:so=\E[m:ue=\E[7m:us=\E[4;7m: #### Applied Digital Data Systems (adds) # # ADDS itself is long gone. ADDS was bought by NCR, and the same group made # ADDS and NCR terminals. When AT&T and NCR merged, the engineering for # terminals was merged again. Then AT&T sold the terminal business to # SunRiver, which later changed its name to Boundless Technologies. The # engineers from Teletype, AT&T terminals, ADDS, and NCR (who are still there # as of early 1995) are at: # # Boundless Technologies # 100 Marcus Boulevard # Hauppauge, NY 11788-3762 # Vox: (800)-231-5445 # Fax: (516)-342-7378 # # Their voice mail used to describe the place as "SunRiver (formerly ADDS)". # In 1995 Boundless acquired DEC's terminals business. # # Regent: lowest common denominator, works on all regents. # (regent: renamed ":bc:" to ":le:" -- esr) regent|Adds Regent Series:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=\EY :le=^U:ll=^A:nd=^F:sf=^J:\ :up=^Z: # Regent 100 has a bug where if computer sends escape when user is holding # down shift key it gets confused, so we avoid escape. regent100|Adds Regent 100:\ :sg#1:ug#1:\ :bl=^G:cm=\013%+ %B\020%.:k0=^B1\r:k1=^B2\r:k2=^B3\r:\ :k3=^B4\r:k4=^B5\r:k5=^B6\r:k6=^B7\r:k7=^B8\r:l0=F1:l1=F2:\ :l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:me=\E0@:se=\E0@:so=\E0P:\ :ue=\E0@:us=\E0`:\ :tc=regent: regent20|Adds Regent 20:\ :bl=^G:cd=\Ek:ce=\EK:cm=\EY%+ %+ :tc=regent: regent25|Adds Regent 25:\ :bl=^G:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:tc=regent20: regent40|Adds Regent 40:\ :sg#1:ug#1:\ :al=\EM:bl=^G:dl=\El:k0=^B1\r:k1=^B2\r:k2=^B3\r:k3=^B4\r:\ :k4=^B5\r:k5=^B6\r:k6=^B7\r:k7=^B8\r:l0=F1:l1=F2:l2=F3:\ :l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:me=\E0@:se=\E0@:so=\E0P:\ :ue=\E0@:us=\E0`:\ :tc=regent25: regent40+|Adds Regent 40+:\ :is=\EB:tc=regent40: regent60|regent200|Adds Regent 60:\ :dc=\EE:ei=\EF:im=\EF:is=\EV\EB:kD=\EE:kI=\EF:kM=\EF:\ :se=\ER\E0@\EV:so=\ER\E0P\EV:\ :tc=regent40+: # From: Thu Jul 9 09:27:33 1981 # (viewpoint: added :kr:, function key, and :dl: capabilities -- esr) viewpoint|addsviewpoint|adds viewpoint:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cd=\Ek:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:dl=\El:do=^J:\ :is=\017\E0`:k0=^B1:k2=^B2:k3=^B\041:k4=^B":k5=^B#:kd=^J:\ :kh=^A:kl=^U:kr=^F:ku=^Z:le=^H:ll=^A:me=^O:nd=^F:se=^O:sf=^J:\ :so=^N:ue=^O:up=^Z:us=^N:ve=\017\E0`:vs=\017\E0P: # Some viewpoints have bad ROMs that foo up on ^O screwpoint|adds viewpoint with ^O bug:\ :se@:so@:ue@:us@:vs@:tc=viewpoint: # From: Jay S. Rouman 5 Jul 92 # The :vi:/:ve:/:sa:/:me: strings were added by ESR from specs. # Theory; the vp3a+ wants \E0%c to set highlights, where normal=01000000, # underline=01100000, rev=01010000, blink=01000010,dim=01000001, # invis=01000100 and %c is the logical or of desired attributes. # There is also a `tag bit' enabling attributes, set by \E) and unset by \E(. vp3a+|viewpoint3a+|adds viewpoint 3a+:\ :am:bw:\ :co#80:it#8:li#24:\ :cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:kb=^H:\ :kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:me=\E(:nd=^L:nw=^M^J:\ :..sa=\E0%'@'%?%p1%tQ%|%;%?%p2%t%'`'%|%;%?%p3%tP%|%;%?%p4%t%{2}%|%;%?%p5%t%{1}%|%;%?%p7%tD%|%;%c\E):\ :se=\E(:sf=^J:so=\E0Q\E):ta=^I:up=^K:ve=^X:vi=^W: vp60|viewpoint60|addsvp60|adds viewpoint60:\ :tc=regent40: # # adds viewpoint 90 - from cornell # Note: emacs sends ei occasionally to insure the terminal is out of # insert mode. This unfortunately puts the viewpoint90 IN insert # mode. A hack to get around this is :ic=\EF\s\EF^U:. (Also, # - :ei=:im=: must be present in the termcap translation.) # - :xs: indicates glitch that attributes stick to location # - :ms: means it's safe to move in standout mode # - :cl=\EG\Ek:: clears screen and visual attributes without affecting # the status line # Function key and label capabilities merged in from SCO. vp90|viewpoint90|adds viewpoint 90:\ :bs:bw:ms:xs:\ :co#80:li#24:\ :cd=\Ek:ce=\EK:cl=\EG\Ek:cm=\EY%+ %+ :dc=\EE:dl=\El:do=^J:\ :ei=:ho=\EY :ic=\EF \EF\025:im=:k0=^B1\r:k1=^B2\r:\ :k2=^B3\r:k3=^B4\r:k4=^B5\r:k5=^B6\r:k6=^B7\r:k7=^B8\r:\ :k8=^B9\r:k9=^B\072\r:k;=^B;\r:kb=^H:kd=^J:kh=^A:kl=^U:\ :kr=^F:ku=^Z:l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:\ :l8=F9:l9=F10:la=F11:le=^H:ll=^A:me=\ER\E0@\EV:nd=^F:\ :se=\ER\E0@\EV:sf=^J:so=\ER\E0Q\EV:ta=^I:ue=\ER\E0@\EV:\ :up=^Z:us=\ER\E0`\EV: # Note: if return acts weird on a980, check internal switch #2 # on the top chip on the CONTROL pc board. adds980|a980|adds consul 980:\ :am:bs:\ :co#80:li#24:\ :al=\E\016:bl=^G:cl=\014\013@:cm=\013%+@\E\005%2:cr=^M:\ :dl=\E\017:do=^J:k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:\ :k6=\E6:k7=\E7:k8=\E8:k9=\E9:le=^H:me=^O:nd=\E^E01:se=^O:\ :sf=^J:so=^Y^^^N: #### C. Itoh Electronics # # As of 1995 these people no longer make terminals (they're still in the # printer business). Their terminals were all clones of the DEC VT series. # They're located in Orange County, CA. # # CIT 80 - vt-52 emulator, the termcap has been modified to remove # the delay times and do an auto tab set rather than the indirect # file used in vt100. cit80|cit-80|citoh 80:\ :am:bs:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=\E[H\EJ:cm=\E[%i%2;%2H:cr=^M:ff=^L:\ :is=\E>:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:nd=\E[C:sf=^J:up=\E[A: # From: Tim Wood Fri Sep 27 09:39:12 PDT 1985 # (cit101: added / based on init string, merged this with c101 -- esr) cit101|citc|C.itoh fast vt100:\ :am:bs:xn:\ :co#80:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=:ic=\E[@:\ :im=:is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[3g\E[>5g:\ :kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:ue=\E[m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l:ve=\E[V\E8:vs=\E7\E[U: # CIE Terminals CIT-101e from Geoff Kuenning via BRL # The following termcap entry was created from the Callan cd100 entry. The # last two lines (with the capabilities in caps) are used by RM-cobol to allow # full selection of combinations of reverse video, underline, and blink. # (cit101e: emoved unknown :f0=\EOp:f1=\EOq:f2=\EOr:f3=\EOs:f4=\EOt:f5=\EOu:\ # f6=\EOv:f7=\EOw:f8=\EOx:f9=\EOy:AB=\E[0;5m:AL=\E[m:AR=\E[0;7m:AS=\E[0;5;7m:\ # :NB=\E[0;1;5m:NM=\E[0;1m:NR=\E[0;1;7m:NS=\E[0;1;5;7m: -- esr) cit101e|C. Itoh CIT-101e:\ :am:bs:mi:ms:pt:\ :co#80:it#8:li#24:\ :ac=:ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%2;%2H:cs=\E[%i%2;%2r:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:if=/usr/share/tabset/vt100:im=\E[4h:k0=\EOT:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\EOm:k6=\EOl:k7=\EOM:\ :k8=\EOn:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:\ :nd=\E[C:rc=\E8:sc=\E7:se=\E[m:so=\E[7m:sr=\EM:ue=\E[m:\ :up=\E[A:us=\E[4m:ve=:vs=\E[?1l\E[?4l\E[?7h: cit101e-n|CIT-101e w/o am:\ :am@:\ :kb=^H:kd=^J:kl=^H:vs=\E[?1l\E[?4l\E[?7l:tc=cit101e: cit101e-132|CIT-101e, 132 cols:\ :co#132:\ :kb=^H:kd=^J:kl=^H:tc=cit101e: cit101e-n132|CIT-101e, 132 cols w/o am:\ :am@:\ :co#132:\ :kb=^H:kd=^J:kl=^H:vs=\E[?1l\E[?4l\E[?7l:tc=cit101e: # CIE Terminals CIT-500 from BRL # The following SET-UP modes are assumed for normal operation: # GENERATE_XON/XOFF:YES DUPLEX:FULL NEWLINE:OFF # AUTOWRAP:ON MODE:ANSI SCREEN_LENGTH:64_LINES # DSPLY_CNTRL_CODES?NO PAGE_WIDTH:80 EDIT_MODE:OFF # Other SET-UP modes may be set for operator convenience or communication # requirements. # Hardware tabs are assumed to be set every 8 columns; they can be set up # by the "reset", "tset", or "tabs" utilities. No delays are specified; use # "stty ixon -ixany" to enable DC3/DC1 flow control! # (cit500: I added / based on the init string -- esr) cit500|CIE Terminals CIT-500:\ :bs:mi:ms:pt:xo:\ :co#80:it#8:kn#10:li#64:vt#3:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RA=\E[?7l:\ :RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:ac=:ae=\E(B:al=\E[L:as=\E(0:\ :bl=^G:bt=\E[Z:cd=\EJ:ce=\EK:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ei=\E[4l:ho=\E[H:im=\E[4h:is=\E<:k0=\EOP:k1=\EOQ:\ :k2=\EOR:k3=\EOS:k4=\EOU:k5=\EOV:k6=\EOW:k7=\EOX:k8=\EOY:\ :k9=\EOZ:kA=\E[L:kB=\E[Z:kD=\E[P:kE=\EK:kI=\E[4h:kL=\E[M:\ :kM=\E[4l:kS=\EJ:kb=^H:kd=\EOB:ke=\E[?1l\E>:kh=\E[H:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=PF1:l1=PF2:l2=PF3:\ :l3=PF4:l4=F15:l5=F16:l6=F17:l7=F18:l8=F19:l9=F20:le=^H:\ :ll=\E[64H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:\ :r1=\E<\E2\E[20l\E[?6l\E[r\E[m\E[q\E(B\017\E>:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\EM:us=\E[4m: # C. Itoh printers begin here citoh|ci8510|8510|c.itoh 8510a:\ :co#80:it#8:\ :is=\E(009\054017\054025\054033\054041\054049\054057\054065\054073.:\ :le@:md=\E\041:me=\E"\EY:rp=\ER%r%03%.:sr=\Er:ue=\EY:\ :us=\EX:\ :tc=lpr: citoh-pica|citoh in pica:\ :i1=\EN:tc=citoh: citoh-elite|citoh in elite:\ :co#96:\ :i1=\EE:\ :is=\E(009\054017\054025\054033\054041\054049\054057\054065\054073\054081\054089.:tc=citoh: citoh-comp|citoh in compressed:\ :co#136:\ :i1=\EQ:\ :is=\E(009\054017\054025\054033\054041\054049\054057\054065\054073\054081\054089\054097\054105\054113\054121\054129.:tc=citoh: # citoh has infinite cols because we don't want lp ever inserting \n\t**. citoh-prop|citoh-ps|ips|citoh in proportional spacing mode:\ :co#32767:\ :i1=\EP:tc=citoh: citoh-6lpi|citoh in 6 lines per inch mode:\ :i2=\EA:tc=citoh: citoh-8lpi|citoh in 8 lines per inch mode:\ :li#88:\ :i2=\EB:tc=citoh: #### Control Data (cdc) # cdc456|cdc 456 terminal:\ :am:bs:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=^X:ce=^V:cl=^Y^X:cm=\E1%+ %+ :cr=^M:dl=\EJ:\ :do=^J:ho=^Y:le=^H:nd=^L:sf=^J:up=^Z: # Assorted CDC terminals from BRL (improvements by DAG & Ferd Brundick) cdc721|CDC Viking:\ :am:bs:\ :co#80:li#24:\ :ce=^K:cl=^L:cm=\002%r%+ %+ :ho=^Y:kd=^J:kh=^Y:kl=^H:kr=^I:\ :ku=^W:nd=^X:up=^W: cdc721ll|CDC Vikingll:\ :am:bs:\ :co#132:li#24:\ :ce=^K:cl=^L:cm=\002%r%+ %+ :ho=^Y:kd=^J:kh=^Y:kl=^H:kr=^I:\ :ku=^W:nd=^X:up=^W: # (cdc752: the BRL entry had :ll=\E1 ^Z: commented out cdc752|CDC 752:\ :am:bs:bw:xs:\ :co#80:li#24:\ :bl=^G:ce=^V:cl=\030\E1 :cm=\E1%r%+ %+ :cr=^M:do=^J:\ :ho=\E1 :le=^H:ll=^Y:nd=^U:r1=\E1 \030\002\003\017:\ :sf=^J:up=^Z: # CDC 756 # The following switch/key settings are assumed for normal operation: # 96 chars SCROLL FULL duplex not BLOCK # Other switches may be set according to communication requirements. # Insert/delete-character cannot be used, as the whole display is affected. # "so" & "se" are commented out until jove handles "sg" correctly. cdc756|CDC 756:\ :am:bs:bw:\ :co#80:kn#10:li#24:\ :al=6*\EL:bl=^G:cd=^X:ce=^V:cl=^Y^X:cm=\E1%r%+ %+ :cr=^M:\ :dl=6*\EJ:do=^J:ho=^Y:k0=\EA:k1=\EB:k2=\EC:k3=\ED:k4=\EE:\ :k5=\EF:k6=\EG:k7=\EH:k8=\Ea:k9=\Eb:kA=\EL:kD=\EI:kE=^V:\ :kI=\EK:kL=\EL:kS=^X:kT=^O:kb=^H:kd=^J:kh=^Y:kl=^H:kr=^U:\ :ku=^Z:l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:l8=F9:\ :l9=F10:le=^H:ll=^Y^Z:nd=^U:r1=\031\030\002\003\017:sf=^J:\ :up=^Z: # # CDC 721 from Robert Viduya, Ga. Tech. via BRL. # # Part of the long initialization string defines the "DOWN" key to the left # of the tab key to send an ESC. The real ESC key is positioned way out # in right field. # # The termcap won't work in 132 column mode due to the way it it moves the # cursor. Termcap doesn't have the capability (as far as I could tell) to # handle the 721 in 132 column mode. # # (cdc721: changed :ri: to :sr: -- esr) cdc721-esc|Control Data 721:\ :am:bs:bw:ms:pt:xo:\ :co#80:it#8:kn#10:li#30:\ :al=^^R:bl=^G:bt=^^^K:cd=^^P:ce=^K:cl=^L:cm=\002%r%+ %+ :\ :ct=^^^RY:dc=^^N:dl=^^Q:do=^Z:ei=:ho=^Y:ic=^^O:im=:\ :is=\036\022B\003\036\035\017\022\025\035\036E\036\022H\036\022J\036\022L\036\022N\036\022P\036\022Q\036\022\\036\022\136\036\022b\036\022i\036W =\036\022Z\036\011C1-` `\041k/o:\ :k0=^^q:k1=^^r:k2=^^s:k3=^^t:k4=^^u:k5=^^v:k6=^^w:k7=^^x:\ :k8=^^y:k9=^^z:kb=^H:kd=^Z:ke=^^^Rl:kh=^Y:kl=^H:kr=^X:\ :ks=^^^Rk:ku=^W:le=^H:ll=^B =:mb=^N:\ :me=\017\025\035\036E\036\022\:mh=^\:mk=^^^R[:mr=^^D:\ :nd=^X:se=^^E:sf=\036W =\036U:so=^^D:sr=\036W =\036V:\ :st=^^^RW:ue=^]:up=^W:us=^\: #### Getronics # # Getronics is a Dutch electronics company that at one time was called # `Geveke' and made async terminals; but (according to the company itself!) # they've lost all their documentation on the command set. The hardware # documentation suggests the terminals were actually manufactured by a # Taiwanese electronics company named Cal-Comp. There are known # to have been at least two models, the 33 and the 50. # # The 50 seems to be a top end vt220 clone, with the addition of a higher # screen resolution, a larger screen, at least 1 page of memory above and # below the screen, apparently pages of memory right and left of the screen # which can be panned, and about 75 function keys (15 function keys x normal, # shift, control, func A, func B). It also has more setup possibilities than # the vt220. The monitor case is dated November 1978 and the keyboard case is # May 1982. # # The vt100 emulation works as is. The entry below describes the rather # non-conformant (but more featureful) ANSI mode. # # From: Stephen Peterson , 27 May 1995 # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) visa50|geveke visa 50 terminal in ansi 80 character mode:\ :bw:mi:ms:\ :co#80:li#25:\ :AL=\E[%dL:DC=\E[%dX:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\E[f:K2=\EOP:K3=\EOQ:K4=\EOR:K5=\EOS:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E[3l:al=\E[L:as=\E3h:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[X:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E0;2m\E[1;25r\E[25;1H\E[?3l\E[?7h\E[?8h:k0=\E010:\ :k1=\E001:k2=\E002:k3=\E003:k4=\E004:k5=\E005:k6=\E006:\ :k7=\E007:k8=\E008:k9=\E009:kD=\177:kb=^H:kd=\E[A:ke=\E>:\ :kh=\E[f:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=\E[D:mb=\E[5m:\ :md=\E[1m:me=\E[0;2m:mh=\E[2m:mr=\E[7m:nd=\E[C:nw=^M^J:\ :se=\E[0;2m:sf=^J:so=\E[2;7m:ta=^I:ue=\E[0m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: #### Human Designed Systems (Concept) # # Human Designed Systems # 400 Fehley Drive # King of Prussia, PA 19406 # Vox: (610)-277-8300 # Fax: (610)-275-5739 # Net: support@hds.com # # John Martin is their termcap expert. They're mostly out of # the character-terminal business now (1995) and making X terminals. In # particular, the whole `Concept' line described here was discontinued long # ago. # # From: Sat Jun 27 07:41:20 1981 # Extensive changes to c108 by arpavax:eric Feb 1982 # Some unknown person at SCO then translated it to terminfo. # # There seem to be a number of different versions of the C108 PROMS # (with bug fixes in its Z-80 program). # # The first one that we had would lock out the keyboard of you # sent lots of short lines (like /usr/dict/words) at 9600 baud. # Try that on your C108 and see if it sends a ^S when you type it. # If so, you have an old version of the PROMs. # # You should configure the C108 to send ^S/^Q before running this. # It is much faster (at 9600 baud) than the c100 because the delays # are not fixed. # new status line display entries for c108-8p: # :i3: - init str #3 - setup term for status display - # set programmer mode, select window 2, define window at last # line of memory, set bkgnd stat mesg there, select window 0. # # :ts: - to status line - select window 2, home cursor, erase to # end-of-window, 1/2 bright on, goto(line#0, col#?) # # :fs: - from status line - 1/2 bright off, select window 0 # # :ds: - disable status display - set bkgnd status mesg with # illegal window # # # There are probably more function keys that should be added but # I don't know what they are. # # No delays needed on c108 because of ^S/^Q handshaking # c108|concept108|c108-8p|concept108-8p|concept 108 w/8 pages:\ :i2=\EU\E z"\Ev\001\177 \041p\E ;"\E z \Ev \001\177p\Ep\n:\ :te=\Ev \001\177p\Ep\r\n:\ :tc=c108-4p: c108-4p|concept108-4p|concept 108 w/4 pages:\ :bs:es:hs:xo:\ :pb@:\ :ac=l\qLkTxUmMjE:ae=\Ej :as=\Ej\041:\ :..cm=\Ea%p1%?%p1%{95}%>%t\001%{96}%-%;%{32}%+%c%p2%?%p2%{95}%>%t\001%{96}%-%;%{32}%+%c:\ :cr=^M:dc=\E 1:ds=\E ;\177:fs=\Ee\E z :i1=\EK\E\041\E F:\ :i2=\EU\E z"\Ev\177 \041p\E ;"\E z \Ev \001 p\Ep\n:\ :sf=^J:te=\Ev \001 p\Ep\r\n:ti=\EU\Ev 8p\Ep\r\E\025:\ :ts=\E z"\E?\E\005\EE\Ea %+ :ve=\Ew:vs=\EW:\ :tc=c100: c108-rv|c108-rv-8p|concept 108 w/8 pages in reverse video:\ :te=\Ev \002 p\Ep\r\n:ti=\EU\Ev 8p\Ep\r:\ :tc=c108-rv-4p: c108-rv-4p|concept108rv4p|concept 108 w/4 pages in reverse video:\ :i1=\Ek:se=\Ee:so=\EE:vb=\EK\Ek:\ :tc=c108-4p: c108-w|c108-w-8p|concept108-w-8|concept108-w8p|concept 108 w/8 pages in wide mode:\ :co#132:\ :i1=\E F\E":te=\Ev ^A0\001D\Ep\r\n:\ :ti=\EU\Ev 8\001D\Ep\r:tc=c108-8p: # Concept 100: # These have only window relative cursor addressing, not screen # relative. To get it to work right here, smcup/rmcup (which # were invented for the concept) lock you into a one page # window for screen style programs. # # To get out of the one page window, we use a clever trick: # we set the window size to zero ("\Ev " in rmcup) which the # terminal recognizes as an error and resets the window to all # of memory. # # This trick works on c100 but does not on c108, sigh. # # Some tty drivers use cr3 for concept, others use nl3, hence # the delays on cr and ind below. This padding is only needed at # 9600 baud and up. One or the other is commented out depending on # local conventions. # # 2 ms padding on :te: isn't always enough. 6 works fine. Maybe # less than 6 but more than 2 will work. # # Note: can't use function keys f7-f10 because they are # indistinguishable from arrow keys (!), also, del char and # clear eol use xon/xoff so they probably won't work very well. # # Also note that we don't define insrt/del char/delline/eop/send # because they don't transmit unless we reset them - I figured # it was a bad idea to clobber their definitions. # # The sequence changes the escape character to ^^ so that # escapes will be passed through to the printer. Only trouble # is that ^^ won't be - ^^ was chosen to be unlikely. # Unfortunately, if you're sending raster bits through to be # plotted, any character you choose will be likely, so we lose. # # \EQ"\EY(^W (send anything from printer to host, for xon/xoff) # cannot be # in is2 because it will hang a c100 with no printer # if sent twice. c100|concept100|concept|c104|c100-4p|hds concept 100:\ :am:bs:eo:mi:ul:xn:\ :co#80:li#24:pb#9600:vt#8:\ :al=\E\022:bl=^G:cd=\E\005:ce=\E\025:cl=\E?\E\005:\ :cm=\Ea%+ %+ :cr=\r:dc=\E\021:dl=\E\002:do=^J:ei=\E :\ :i1=\EK:i2=\Ev \Ep\n:im=\E^P:ip=:\ :is=\EU\Ef\E7\E5\E8\El\ENH\E\200\Eo&\200\Eo'\E\Eo\041\200\E\007\041\E\010A@ \E4#\072"\E\072a\E4#;"\E\072b\E4#<"\E\072c:\ :k1=\E5:k2=\E6:k3=\E7:k4=\E8:k5=\E9:k6=\E\072a:k7=\E\072b:\ :k8=\E\072c:kA=\E^R:kB=\E':kD=\E^Q:kE=\E^S:kF=\E[:kI=\E^P:\ :kL=\E^B:kM=\E\200:kN=\E-:kP=\E.:kR=\E\:kS=\E^C:kT=\E]:\ :kb=^H:kd=\E<:ke=\Ex:kh=\E?:kl=\E>:kr=\E=:ks=\EX:kt=\E_:\ :ku=\E;:le=^H:mb=\EC:me=\EN@:mh=\EE:mk=\EH:mp=\EI:mr=\ED:\ :nd=\E=:pf=\036o \E\EQ\041\EYP\027:\ :po=\EQ"\EY(\027\EYD\Eo \036:rp=\Er%.%+ :se=\Ed:sf=^J:\ :so=\ED:ta=\011:te=\Ev \Ep\r\n:\ :ti=\EU\Ev 8p\Ep\r\E\025:ue=\Eg:up=\E;:us=\EG:vb=\Ek\EK: c100-rv|c100-rv-4p|concept100-rv|c100 rev video:\ :i1=\Ek:se=\Ee:so=\EE:vb=\EK\Ek:ve@:vs@:tc=c100: oc100|oconcept|c100-1p|old 1 page concept 100:\ :in:\ :i3@:tc=c100: # :ta: through :ce: included to specify padding needed in raw mode. # (avt-ns: added empty to suppress a tic warning --esr) # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) avt-ns|concept avt no status line:\ :am:bs:eo:mi:ul:xn:xo:\ :co#80:it#8:li#24:lm#192:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(1:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[2g:dc=\E[P:dl=\E[M:do=^J:ei=\E4l:\ :ho=\E[H:i1=\E[=103l\E[=205l:ic=\E[@:im=\E1:ip=:\ :is=\E[1*q\E[2\041t\E[7\041t\E[=4;101;119;122l\E[=107;118;207h\E[1Q\EW\E[\041y\E[\041z\E>\E[0\0720\07232\041r\E[0*w\E[w\E2\r\n\E[2;27\041t:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kD=\E^B\r:kI=\E^A\r:kb=^H:\ :kd=\E[B:ke=\E[\041z\E[0;2u:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E[1\041z\E[0;3u:ku=\E[A:le=^H:ll=\E[24H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mh=\E[1\041{:mr=\E[7m:nd=\E[C:rc=\E8:\ :sc=\E7:se=\E[7\041{:sf=\n:so=\E[7m:sr=\EM:st=\EH:ta=\011:\ :te=\E[w\E2\r\n:ti=\E[=4l\E[1;24w\E2\r:ue=\E[4\041{:\ :up=\E[A:us=\E[4m:ve=\E[=119l:vs=\E[=119h: avt-rv-ns|concept avt in reverse video mode/no status line:\ :i1=\E[=103l\E[=205h:vb=\E[=205l\E[=205h:\ :tc=avt-ns: avt-w-ns|concept avt in 132 column mode/no status line:\ :i1=\E[=103h\E[=205l:ti=\E[H\E[1;24;1;132w:\ :tc=avt-ns: avt-w-rv-ns|concept avt in 132 column mode/no status line/reverse video:\ :i1=\E[=103h\E[=205h:ti=\E[H\E[1;24;1;132w:\ :vb=\E[=205l\E[=205h:tc=avt-ns: # Concept AVT with status line. We get the status line using the # "Background status line" feature of the terminal. We swipe the # first line of memory in window 2 for the status line, keeping # 191 lines of memory and 24 screen lines for regular use. # The first line is used instead of the last so that this works # on both 4 and 8 page AVTs. (Note the lm#191 or 192 - this # assumes an 8 page AVT but lm isn't currently used anywhere.) # avt+s|concept avt status line changes:\ :es:hs:\ :lm#191:\ :ds=\E[0*w:fs=\E[1;1\041w:\ :i2=\E[2w\E[2\041w\E[1;1;1;80w\E[H\E[2*w\E[1\041w\E2\r\n:\ :te=\E[2w\E2\r\n:ti=\E[2;25w\E2\r:\ :ts=\E[2;1\041w\E[;%p1%dH\E[2K: avt|avt-s|concept-avt|avt w/80 columns:\ :tc=avt+s:tc=avt-ns: avt-rv|avt-rv-s|avt reverse video w/sl:\ :i1=\E[=103l\E[=205h:vb=\E[=205l\E[=205h:tc=avt+s:tc=avt-ns: avt-w|avt-w-s|concept avt 132 cols+status:\ :i1=\E[=103h\E[=205l:ti=\E[H\E[1;24;1;132w:tc=avt+s:tc=avt-ns: avt-w-rv|avt-w-rv-s|avt wide+status+rv:\ :i1=\E[=103h\E[=205h:ti=\E[H\E[1;24;1;132w:\ :vb=\E[=205l\E[=205h:tc=avt+s:\ :tc=avt-ns: #### Contel Business Systems. # # Contel c300 and c320 terminals. contel300|contel320|c300|Contel Business Systems C-300 or C-320:\ :am:in:xo:\ :co#80:li#24:sg#1:\ :al=\EL:bl=^G:cd=\EJ:ce=\EI:cl=\EK:cm=\EX%+ \EY%+ :cr=^M:\ :ct=\E3:dc=\EO:dl=\EM:do=^J:ei=:ho=\EH:ic=\EN:im=:ip=:k0=\ERJ:\ :k1=\ERA:k2=\ERB:k3=\ERC:k4=\ERD:k5=\ERE:k6=\ERF:k7=\ERG:\ :k8=\ERH:k9=\ERI:kb=^H:le=^H:ll=\EH\EA:me=\E\041\200:\ :nd=\EC:se=\E\041\200:sf=^J:so=\E\041\r:st=\E1:up=\EA:\ :vb=\020\002\020\003: # Contel c301 and c321 terminals. contel301|contel321|c301|c321|Contel Business Systems C-301 or C-321:\ :ei=:ic@:im=:ip@:se=\E\041\200:so=\E\041\r:vb@:\ :tc=contel300: #### Data General (dg) # # According to James Carlson writing in January 1995, # the terminals group at Data General was shut down in 1991; all these # terminals have thus been discontinued. # # According to the 4.4BSD termcap file, the dg200 :cm: should be the # termcap equivalent of \020%p2%{128}%+%c%p1%{128}%+%c (in termcap # notation that's "^P%r%+\200%+\200"). Those \200s are suspicious, # maybe they were originally nuls (which would fit). dg200|data general dasher 200:\ :NL:am:bs:bw:\ :co#80:li#24:\ :bl=^G:ce=^K:cl=^L:cm=\020%r%.%.:cr=^M:do=^Z:ho=^H:k0=^^z:\ :k1=^^q:k2=^^r:k3=^^s:k4=^^t:k5=^^u:k6=^^v:k7=^^w:k8=^^x:\ :k9=^^y:kd=^Z:kh=^H:kl=^Y:kr=^X:ku=^W:l0=f10:le=^Y:nd=^X:\ :nw=^J:se=^^E:sf=^J:so=^^D:ue=^U:up=^W:us=^T: # Data General 210/211 (and 410?) from Lee Pearson (umich!lp) via BRL dg210|dg-ansi|Data General 210/211:\ :am:\ :co#80:li#24:\ :cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:do=\E[B:ho=\E[H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:nl=\E[B:\ :nw=\r\E[H\E[A\n:se=\E[0;m:so=\E[7;m:ue=\E[0;m:up=\E[A:\ :us=\E[4;m: # From: Peter N. Wan # courtesy of Carlos Rucalde of Vantage Software, Inc. # (dg211: this had :cm=\020%r%.%:., which was an ancient termcap hangover. # I suspect the d200 function keys actually work on the dg211, check it out.) dg211|Data General d211:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb=^Y:l0@:nw=^M^Z:\ :se=00\036E\200/>:sf@:so=5\036D:ta=^I:te=^L:ti=^L^R:ve=^L:\ :vs=^L^R:\ :tc=dg200: # dg450 from cornell dg450|dg6134|data general 6134:\ :le@:nd=^X:tc=dg200: # Note: lesser Dasher terminals will not work with vi because vi insists upon # having a command to move straight down from any position on the bottom line # and scroll the screen up, or a direct vertical scroll command. The 460 and # above have both, the D210/211, for instance, has neither. We must use ANSI # mode rather than DG mode because standard UNIX tty drivers assume that ^H is # backspace on all terminals. This is not so in DG mode. # (dg460-ansi: removed obsolete ":kn#6:"; also removed ":mu=\EW:", on the # grounds that there is no matching ":ml:" # fixed garbled ":k9=\E[00\:z:" capability -- esr) dg460-ansi|Data General Dasher 460 in ANSI-mode:\ :am:bs:ms:ul:\ :co#80:it#8:li#24:\ :al=\E[L:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%2;%2H:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:is=^^F@:k0=\E[001z:\ :k1=\E[002z:k2=\E[003z:k3=\E[004z:k4=\E[005z:k5=\E[006z:\ :k6=\E[007z:k7=\E[008z:k8=\E[009z:k9=\E[010z:kb=\E[D:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:l0=f1:l1=f2:l2=f3:\ :l3=f4:l4=f5:l5=f6:l6=f7:l7=f8:l9=f10:le=^H:mb=\E[5m:me=\E[m:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:nl=\ED:se=\E[m:sf=\E[S:so=\E[7m:\ :sr=\E[T:ta=^I:ue=\E[05:up=\E[A:us=\E[4m: # From: Wayne Throop # Data General 605x # Ought to work for a Model 6242, Type D210 as well as a 605x. # Note that the cursor-down key transmits ^Z. Job control users, beware! # This also matches a posted description of something called a `Dasher 100' # so there's a dg100 alias here. # (dg6053: the 4.4BSD file had :le=^H:, :do=^J:, :nd=^S:. -- esr) dg6053|dg100|data general 6053:\ :am:bs:bw:ul:\ :co#80:li#24:\ :bc=^Y:bl=^G:ce=^K:cl=^L:cm=\020%r%.%.:cr=^M:do=^Z:ho=^H:\ :is=^R:k0=^^q:k1=^^r:k2=^^s:k3=^^t:k4=^^u:k5=^^v:k6=^^w:\ :k7=^^x:k8=^^y:k9=^^z:kb=^Y:kd=^Z:kh=^H:kl=^Y:kr=^X:ku=^W:\ :le=^Y:nd=^X:se=\200^^E:so=\200\200\200\200\200\036D:\ :ta=^I:te=^L:ti=^L^R:ue=^U:up=^W:us=^T:ve=^L:vs=^L^R: #### Datamedia (dm) # # Datamedia was headquartered in Nashua, New Hampshire in 1993. # As of early 1996, at least one company called `Datamedia' has been taken # over by: # # Axent Technologies, Inc. # 2400 Research Boulevard # Rockville, Maryland 20850 # voice: +1 301/258-5043 # fax: +1 301/330-5756 # email: # # makers of OmniGuard client/server security software. They are a software # only company and no longer make terminals. However, the operator there # told me that she had once spoken to a customer looking for Datamedia # terminals who'd mentioned a Datamedia in New Jersey. This is backed up # by comp.terminals poosting describing the ID plate on the back of a # "Datamedia 3000" terminal. Was this an earlier incarnation of Axent? # Inquiring minds want to know... # cs10|colorscan|Datamedia Color Scan 10:\ :ms:\ :co#80:li#24:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%02;%02H:cr=^M:\ :do=^J:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[C:se=\E[m:sf=^J:\ :so=\E[7m:ue=\E[m:up=\E[A:us=\E[4m: cs10-w|Datamedia Color Scan 10 with 132 columns:\ :co#132:\ :cm=\E[%i%02;%03H:tc=cs10: # (dm1520: removed obsolete ":ma=^\ ^_^P^YH:" -- esr) dm1520|dm1521|datamedia 1520:\ :am:bs:xn:\ :co#80:it#8:li#24:\ :bl=^G:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :cr=^M:do=^J:ho=^Y:\ :kd=^J:kh=^Y:kl=^H:kr=^\:ku=^_:le=^H:nd=^\:sf=^J:ta=^I:up=^_: dm2500|datamedia2500|datamedia 2500:\ :bs:nc:\ :co#80:li#24:\ :al=\020\n\030\035\030\035:bl=^G:ce=^W:cl=^^^^\177:\ :cm=\014%r%n%.%.:dc=\020\010\030\035:\ :dl=\020\032\030\035:dm=^P:do=^J:ed=^X^]:\ :ei=\377\377\030\035:ho=^B:ic=\020\034\030\035:im=^P:\ :le=^H:nd=^\:pc=\377:se=^X^]:sf=^J:so=^N:up=^Z: # dmchat is like DM2500, but DOES need "all that padding" (jcm 1/31/82) # also, has a meta-key. # From: # (dmchat: ":MT:" changed to ":km:" -- esr) dmchat|dmchat version of datamedia 2500:\ :km:\ :al=1*\020\n\030\035\030\035:dl=2\020\032\030\035:tc=dm2500: # (dm3025: ":MT:" changed to ":km:" -- esr) dm3025|datamedia 3025a:\ :bs:km:\ :co#80:it#8:li#24:\ :al=\EP\n\EQ:bl=^G:cd=\EJ:ce=\EK:cl=\EM:cm=\EY%r%+ %+ :\ :cr=^M:dc=\010:dl=\EP\EA\EQ:dm=\EP:do=^J:ed=\EQ:ei=\EQ:\ :ho=\EH:im=\EP:ip=:is=\EQ\EU\EV:le=^H:nd=\EC:se=\EO0:sf=^J:\ :so=\EO1:ta=^I:up=\EA: dm3045|datamedia 3045a:\ :am:bs:eo:km@:ul:xn:\ :al@:dc=\EB:dl@:dm@:ed@:ei=\EP:is=\EU\EV:k0=\Ey\r:k1=\Ep\r:\ :k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:k7=\Ev\r:\ :k8=\Ew\r:k9=\Ex\r:kh=\EH:kr=\EC:ku=\EA:pc=\177:se@:so@:\ :tc=dm3025: # Datamedia DT80 soft switches: # 1 0=Jump 1=Smooth # Autorepeat 0=off 1=on # Screen 0=Dark 1=light # Cursor 0=u/l 1=block # # 2 Margin Bell 0=off 1=on # Keyclick 0=off 1=on # Ansi/VT52 0=VT52 1=Ansi # Xon/Xoff 0=Off 1=On # # 3 Shift3 0=Hash 1=UK Pound # Wrap 0=Off 1=On # Newline 0=Off 1=On # Interlace 0=Off 1=On # # 4 Parity 0=Odd 1=Even # Parity 0=Off 1=On # Bits/Char 0=7 1=8 # Power 0=60Hz 1=50Hz # # 5 Line Interface 0=EIA 1=Loop # Aux Interface 0=EIA 1=Loop # Local Copy 0=Off 1=On # Spare # # 6 Aux Parity 0=Odd 1=Even # Aux Parity 0=Off 1=On # Aux Bits/Char 0=7 1=8 # CRT Saver 0=Off 1=On # dm80/1 is a vt100 lookalike, but it doesn't seem to need any padding. dm80|dmdt80|dt80|datamedia dt80/1:\ :cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=%i\E[%d;%dH:do=^J:\ :ho=\E[H:me=\E[m:nd=\E[C:pf=\E[4i:po=\E[5i:ps=\E[0i:\ :se=\E[m:so=\E[7m:sr=\EM:ue=\E[m:up=\E[A:us=\E[4m:\ :tc=vt100: # except in 132 column mode, where it needs a little padding. # This is still less padding than the vt100, and you can always turn on # the ^S/^Q handshaking, so you can use vt100 flavors for things like # reverse video. dm80w|dmdt80w|dt80w|datamedia dt80/1 in 132 char mode:\ :co#132:\ :cd=20\E[0J:ce=20\E[0K:cl=50\E[H\E[2J:cm=5\E[%i%d;%dH:\ :do=^J:up=5\E[A:\ :tc=dm80: # From: Adam Thompson Sept 10 1995 dt80-sas|Datamedia DT803/DTX for SAS usage:\ :am:bw:\ :co#80:li#24:\ :ac=``a1fxgqh0jYk?lZm@nEooppqDrrsstCu4vAwBx3yyzz{{||}}~~:\ :ae=\EG:al=\EL:as=\EF:bl=^G:cd=^K:ce=^]:cl=^L:\ :cm=\E=%r%+ %+ :cr=^M:\ :..cs=\E=%p1%' '%+%c%' '%c\E#1\E=%p2%' '%+%c%' '%c\E#2:\ :ct=\E'0:dl=\EM:do=\EB:ff=^L:ho=^Y:is=\E)0\E<\EP\E'0\E$2:\ :kC=^L:kE=^]:kS=^K:kd=^J:kh=^Y:kl=^H:kr=^\:ku=^_:le=^H:me=^X:\ :mr=\E$2\004:nd=^\:pf=^O:po=^N:se=^X:sf=\EB:so=\E$2\004:\ :sr=\EI:st=\E'1:ta=^I:up=^_: # Datamedia Excel 62, 64 from Gould/SEL UTX/32 via BRL # These aren't end-all Excel termcaps; but do insert/delete char/line # and name some of the extra function keys. (Mike Feldman ccvaxa!feldman) # The naming convention has been bent somewhat, with the use of E? (where # E is for 'Excel') as # a name. This was done to distinguish the entries # from the other Datamedias in use here, and yet to associate a model of # the Excel terminals with the regular datamedia terminals that share # major characteristics. excel62|excel64|datamedia Excel 62:\ :dc=\E[P:ei=\E[4l:im=\E[4h:k5=\EOu:k6=\EOv:k7=\EOw:k8=\EOx:\ :k9=\EOy:kb=^H:kd=^J:kl=^H:\ :tc=dt80: excel62-w|excel64-w|datamedia Excel 62 in 132 char mode:\ :dc=\E[P:ei=\E[4l:im=\E[4h:k5=\EOu:k6=\EOv:k7=\EOw:k8=\EOx:\ :k9=\EOy:kb=^H:kd=^J:kl=^H:\ :tc=dt80w: excel62-rv|excel64-rv|datamedia Excel 62 in reverse video mode:\ :dc=\E[P:ei=\E[4l:im=\E[4h:k5=\EOu:k6=\EOv:k7=\EOw:k8=\EOx:\ :k9=\EOy:kb=^H:kd=^J:kl=^H:vb=\E[?5l\E[?5h:\ :tc=dt80: #### Falco # # Falco Data Products # 440 Potrero Avenue # Sunnyvale, CA 940864-196 # Vox: (800)-325-2648 # Fax: (408)-745-7860 # Net: techsup@charm.sys.falco.com # # Current Falco models as of 1995 are generally ANSI-compatible and support # emulations of DEC VT-series, Wyse, and Televideo types. # # Test version for Falco ts-1. See for info # This terminal was released around 1983 and was discontinued long ago. # The standout and underline highlights are the same. falco|ts1|ts-1|falco ts-1:\ :am:bs:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET\EG0\010:cl=\E*:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:is=\Eu\E3:\ :k0=^A0\r:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:me=\Eg0:nd=^L:\ :se=\Eg0:sf=^J:so=\Eg1:ta=^I:ue=\Eg0:up=^K:us=\Eg1: falco-p|ts1p|ts-1p|falco ts-1 with paging option:\ :am:bs:da:db:mi:ms:ul:\ :co#80:it#8:li#24:\ :al=\EE:bl=^G:bt=\EI:cd=\EY:ce=\ET\EG0\010\Eg0:cl=\E*:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=\E[B:ei=\Er:im=\Eq:\ :is=\EZ\E3\E_c:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:me=\Eg0:nd=\E[C:se=\Eg0:sf=^J:so=\Eg4:ta=^I:te=\E_b:\ :ti=\E_d:ue=\Eg0:up=\E[A:us=\Eg1: # (ts100: I added / based on the init string -- esr) ts100|ts100-sp|falco ts100-sp:\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E~E:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E~W:dl=\E~R:do=^J:eA=\E(B:ei=:ho=\E[H:\ :i1=\E~)\E~ea:ic=\E~Q:im=:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: ts100-ctxt|falco ts-100 saving context:\ :te=\E~_b:ti=\E~_d\E[2J:tc=ts100: #### Florida Computer Graphics # # Florida Computer Graphics Beacon System, using terminal emulator program # "host.com", as provided by FCG. This description is for an early release # of the "host" program. Known bug: :cd: clears the whole screen, so it's # commented out. # From: David Bryant 1/7/83 beacon|FCG Beacon System:\ :am:da:db:\ :co#80:li#32:\ :al=\EE:bl=\ESTART\r\E37\r\EEND\r:ce=\ET:cl=\EZ:\ :cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:do=^J:ei=:ho=\EH:ic=\EQ:\ :im=:le=^H:mb=\ESTART\r\E61\0541\r\EEND\r:\ :me=\ESTART\r\E78\r\E70\0540\r\EEND\r:\ :mr=\ESTART\r\E59\0541\r\EEND\r:nd=\EV:\ :se=\ESTART\r\E70\0540\r\EEND\r:sf=^J:\ :so=\ESTART\r\E70\0546\r\EEND\r:te=:\ :ti=\ESTART\r\E2\0540\r\E12\r\EEND\r:\ :ue=\ESTART\r\E60\0540\r\EEND\r:up=\EU:\ :us=\ESTART\r\E60\0541\r\EEND\r: #### Fluke # # The f1720a differences from ANSI: no auto margin, destructive # tabs, # of lines, funny highlighting and underlining f1720|f1720a|fluke 1720A:\ :xt:\ :co#80:li#16:sg#1:ug#1:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :do=\E[B:is=\E[H\E[2J:kd=^]:kl=^_:kr=^^:ku=^\:le=^H:me=\E[m:\ :nd=\E[C:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ue=\E[m:up=\E[A:\ :us=\E[4m: #### Liberty Electronics (Freedom) # # Liberty Electronics # 48089 Fremont Blvd # Fremont CA 94538 # Vox: (510)-623-6000 # Fax: (510)-623-7021 # From: # (f100: added empty to suppress a tic warning; # made this relative to adm+sgr -- note that isn't # known to work for f100 but does on the f110. --esr) f100|freedom|freedom100|freedom model 100:\ :am:bs:bw:hs:mi:ms:xo:\ :co#80:li#24:\ :ac=:ae=\E$:al=\EE:as=\E%:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :ch=\E]%+ :cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E3:cv=\E[%+ :\ :dc=\EW:dl=\ER:do=^J:ds=\Eg\Ef\r:ei=\Er:fs=^M:ho=^^:im=\Eq:\ :ip=:is=\Eg\Ef\r\Ed:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:\ :kB=\EI:kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:sf=^J:\ :sr=\Ej:st=\E1:ta=^I:ts=\Eg\Ef:up=^K:vb=\Eb\Ed:\ :tc=adm+sgr: f100-rv|freedom-rv|freedom 100 in reverse video:\ :is=\Eg\Ef\r\Eb:vb=\Ed\Eb:tc=f100: # The f110 and f200 have problems with vi(1). They use the ^V # code for the down cursor key. When kcud1 is defined in terminfo # as ^V, the Control Character Quoting capability (^V in insert mode) # is lost! It cannot be remapped in vi because it is necessary to enter # a ^V to to quote the ^V that is being remapped!!! # # f110/f200 users will have to decide whether # to lose the down cursor key or the quoting capability. We will opt # initially for leaving the quoting capability out, since use of VI # is not generally applicable to most interactive applications # (f110: added :ta:, :kh: & from f100 -- esr) f110|freedom110|Liberty Freedom 110:\ :bw@:es:\ :it#8:ws#80:\ :ae=\E%%:al=\EE:as=\E$:dl=\ER:do=^V:ds=\Ef\r:ei=\Er\EO:\ :im=\EO\Eq:ip@:is@:k0=^AI\r:k;@:kA=\EE:kC=^^:kD=\EW:kE=\ET:\ :kI=\EQ:kL=\ER:kS=\EY:mb=\EG2:md=\EG0:mh=\EG@:pf=\Ea:po=\E`:\ :so=\EG<:sr=\EJ:ts=\Ef:vb=\Eb\Ed:ve=\E.2:vi=\E.1:vs=\E.2:\ :tc=f100: f110-14|Liberty Freedom 110 14inch:\ :dc@:tc=f110: f110-w|Liberty Freedom 110 - 132 cols:\ :co#132:tc=f110: f110-14w|Liberty Freedom 110 14in/132 cols:\ :co#132:\ :dc@:tc=f110: # (f200: added to suppress tic warnings re :as:/:ae: --esr) f200|freedom200|Liberty Freedom 200:\ :am:bs:es:hs:mi:ms:xo:\ :co#80:it#8:li#24:ws#80:\ :ac=:ae=\E%%:al=\EE:as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:\ :ch=\E]%+ :cl=^Z:cm=\E=%+ %+ :cr=^M:cs=\Em0%+ %+ :ct=\E3:\ :cv=\E[%+ :dc=\EW:dl=\ER:do=^V:ds=\Ef\r:ei=\Er:fs=^M:ho=^^:\ :im=\Eq:k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=\EE:kC=^^:\ :kD=\EW:kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^V:kl=^H:kr=^L:\ :ku=^K:le=^H:mb=\EG2:md=\EG0:mh=\EG@:nd=^L:pf=\Ea:po=\E`:\ :sf=^J:so=\EG<:sr=\EJ:st=\E1:ts=\Ef:up=^K:vb=\Eo\En:ve=\E.1:\ :vi=\E.0:vs=\E.1:\ :tc=adm+sgr: f200-w|Liberty Freedom 200 - 132 cols:\ :co#132:tc=f200: # The f200 has the ability to reprogram the down cursor key. The key is # reprogrammed to ^J (linefeed). This value is remembered in non-volatile RAM, # so powering the terminal off and on will not cause the change to be lost. f200vi|Liberty Freedom 200 for vi:\ :kd=^J:vb=\Eb\Ed:tc=f200: f200vi-w|Liberty Freedom 200 - 132 cols for vi:\ :co#132:tc=f200vi: #### GraphOn (go) # # Graphon Corporation # 544 Division Street # Campbell, CA 95008 # Vox: (408)-370-4080 # Fax: (408)-370-5047 # Net: troy@graphon.com (Troy Morrison) # # # The go140 and go225 have been discontinued. GraphOn now makes X terminals, # including one odd hybrid that starts out life on power-up as a character # terminal, than can be switched to X graphics mode (driven over the serial # line) by an escape sequence. No info on this beast yet. # (go140: I added / based on the init string -- esr) go140|graphon go-140:\ :bs:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=10\E[J:ce=\E[K:\ :cl=10\E[H\E[2J:cm=\E[%i%2;%2H:dc=\E[P:dl=\E[M:ei=\E[4l:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E<\E=\E[?3l\E[?7l\E(B\E[J\E7\E[;r\E8\E[m\E[q:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kd=\EOB:ke=\E[?1l\E>:\ :kh=\E[H:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: go140w|graphon go-140 in 132 column mode:\ :am:\ :co#132:\ :is=\E<\E=\E[?3h\E[?7h\E(B\E[J\E7\E[;r\E8\E[m\E[q:tc=go140: # Hacked up vt200 termcap to handle GO-225/VT220 # From: # (go225: I added / based on the init string -- esr) go225|go-225|Graphon 225:\ :am:bs:mi:xn:\ :co#80:it#8:li#25:vt#3:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=^J:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:ke=\E>:kh=\E[H:kl=\E[D:\ :kr=\E[C:ks=\E=:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:r1=\E[\041p\E[?7h\E[2;1;1#w:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:te=\E[\041p\E[?7h\E[2;1;1#w:\ :ti=\E[2;0#w\E[1;25r:ue=\E[24m:up=\E[A:us=\E[4m: #### Harris (Beehive) # # Bletch. These guys shared the Terminal Brain Damage laurels with Hazeltine. # Their terminal group is ancient history now (1995) though the parent # company is still in business. # # Beehive documentation is undated and marked Preliminary and has no figures # so we must have early Superbee2 (Model 600, according to phone conversation # with mfr.). It has proved reliable except for some missing padding # (notably after \EK and at bottom of screen). # # The key idea is that AEP mode is poison for :cm: & that US's in # the local memory should be avoided like the plague. That means # that the 2048 character local buffer is used as 25 lines of 80 # characters, period. No scrolling local memory, folks. It also # appears that we cannot use naked INS LINE feature since it uses # US. The sbi fakes :al: with an 80-space insert that may be too # slow at low speeds; also spaces get converted to \040 which is # too long for some programs (not vi). DEL LINE is ok but slow. # # The string is designed for last line of screen ONLY; cup to # 25th line corrects the motion inherent in scrolling to Page 1. # # There is one understood bug. It is that the screen appears to # pop to a new (blank) page after a :nw:, or leave a half-line # ellipsis to a quad that is the extra 48 memory locations. The # data received is dumped into memory but not displayed. Not to # worry if :cm: is being used; the lines not displayed will be, # whenever the cursor is moved up there. Since :cm: is addressed # relative to MEMORY of window, nothing is lost; but beware of # relative cursor motion (:up:,:do:,:nd:,:le:). Recommended, # therefore, is setenv MORE -c . # # WARNING: Not all features tested. # # Timings are assembled from 3 sources. Some timings may reflect # SB2/Model 300 that were used if more conservative. # Tested on a Model 600 at 1200 and 9600 bd. # # The BACKSPACEkb option is cute. The NEWLINE key, so cleverly # placed on the keyboard and useless because of AEP, is made # into a backspace key. In use ESC must be pressed twice (to send) # and sending ^C must be prefixed by ESC to avoid that weird # transmit mode associated with ENTER key. # # IF TERMINAL EVER GOES CATATONIC with the cursor buzzing across # the screen, then it has dropped into ENTER mode; hit # RESET--ONLINE--!tset. # # As delivered this machine has a FATAL feature that will throw # it into that strange transmit state (SPOW) if the space bar is # hit after a CR is received, but before receiving a LF (or a # few others). # # The circuits MUST be modified to eliminate the SPOW latch. # This is done by strapping on chip A46 of the I/O board; cut # the p.c. connection to Pin 5 and strap Pin 5 to Pin 8 of that # chip. This mod has been checked out on a Mod 600 of Superbee II. # With this modification absurdly high timings on cr are # unnecessary. # # NOTE WELL that the rear panel switch should be set to CR/LF, # not AEP! # sb1|beehive superbee:\ :am:bs:bw:da:db:mi:ul:xb:\ :co#80:li#25:sg#1:ug#1:\ :al=\EN\EL\EQ \EP \EO\ER\EA:\ :bl=^G:bt=\E`:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EF%r%03%03:cr=\r:\ :ct=\E3:dc=\EP:dl=\EM:do=^J:ei=\ER:ho=\EH:im=\EQ\EO:\ :is=\EE\EX\EZ\EO\Eb\Eg\ER:k0=\E2:k1=\Ep:k2=\Eq:k3=\Er:\ :k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:k9=\E1:kE=\EK:kI=\EQ\EO:\ :kL=\EM:kM=\ER:kS=\EJ:kb=^_:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :ku=\EA:l0=TAB CLEAR:l9=TAB SET:le=^H:me=\E_3:nd=\EC:\ :se=\E_3:sf=^J:so=\E_1:st=\E1:ta=^I:te=:ti=\EO:ue=\E_3:\ :up=\EA:us=\E_0: sbi|superbee|beehive superbee at Indiana U.:\ :xb:\ :al=1\EN\EL\EQ \EP \EO\ER\EA:cr=\r:tc=sb1: # Alternate (older) description of Superbee - f1=escape, f2=^C. # Note: there are at least 3 kinds of superbees in the world. The sb1 # holds onto escapes and botches ^C's. The sb2 is the best of the 3. # The sb3 puts garbage on the bottom of the screen when you scroll with # the switch in the back set to CRLF instead of AEP. This description # is tested on the sb2 but should work on all with either switch setting. # The f1/f2 business is for the sb1 and the :xb: can be taken out for # the other two if you want to try to hit that tiny escape key. # This description is tricky: being able to use cup depends on there being # 2048 bytes of memory and the hairy string. superbee-xsb|beehive super bee:\ :am:da:db:xb:\ :co#80:it#8:li#25:\ :cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EF%r%3%3:cr=\r:ct=\E3:dc=\EP:\ :dl=\EM:do=^J:ho=\EH:is=\EH\EJ:k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:\ :k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :ku=\EA:le=^H:me=\E_3:nd=\EC:se=\E_3:\ :sf=\n\200\200\200\n\200\200\200\EA\EK\200\200\200\ET\ET:\ :so=\E_1:st=\E1:ta=^I:up=\EA:ve=^J: # This loses on lines > 80 chars long, use at your own risk superbeeic|super bee with insert char:\ :ei=\ER:ic=:im=\EQ:tc=superbee-xsb: sb2|sb3|fixed superbee:\ :xb@:tc=superbee: # Reports are that most of these Beehive entries (except superbee) have not # been tested and do not work right. :se: is a trouble spot. Be warned. # (bee: :ic: was empty, which is obviously bogus -- esr) beehive|bee|harris beehive:\ :am:bs:mi:\ :co#80:li#24:\ :al=\EL:bt=\E>:cd=\EJ:ce=\EK:cl=\EE:cm=\EF%+ %+ :dc=\EP:\ :dl=\EM:do=\EB:ei=\E@:ho=\EH:im=\EQ:kA=\EL:kB=\E>:kC=\EE:\ :kD=\EP:kE=\EK:kI=\EQ:kL=\EM:kM=\E@:kb=^H:kd=\EB:kh=\EH:\ :kl=\ED:kr=\EC:ku=\EA:le=^H:me=\Ed@:nd=\EC:se=\Ed@:so=\EdP:\ :ue=\Ed@:up=\EA:us=\Ed`: # set tab is ^F, clear (one) tab is ^V, no way to clear all tabs. # good grief - does this entry make :sg:/:ug: when it doesn't have to? # look at those spaces in :se:/:so:. Seems strange to me... # (beehive: :if=/usr/share/tabset/beehive: removed, no such file. If you # really care, cook up one using ^F -- esr) beehive3|bh3m|beehiveIIIm|harris beehive 3m:\ :am:bs:\ :co#80:it#8:li#20:\ :al=\023:bl=^G:cd=^R:ce=^P:cl=^E^R:cr=^M:dl=\021:do=^J:ho=^E:\ :le=^H:ll=^E^K:nd=^L:se= ^_:sf=^J:so=^] :st=^F:ta=^I:up=^K: beehive4|bh4|beehive 4:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EE:cr=^M:do=^J:ho=\EH:le=\ED:nd=\EC:\ :sf=^J:up=\EA: microb|microbee|micro bee series:\ :am:bs:\ :co#80:it#8:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EE:cm=\EF%+ %+ :cr=^M:do=^J:k1=\Ep:\ :k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:k9=\Ex:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:me=\Ed@:nd=\EC:\ :se=\Ed@:sf=^J:so= \EdP:ta=^I:ue=\Ed@:up=\EA:us=\Ed`: # 8675, 8686, and bee from Cyrus Rahman # (8675: changed k10, k11...k16 to k;, F1...F6 -- esr) ha8675|harris 8675:\ :F1=^W:F2=\ER:F3=\EE:F4=\EI:F5=\Ei:F6=\Eg:\ :is=\ES\E#\E*\Eh\Em\E?\E1\E9\E@\EX\EU:k1=^F:k2=^P:k3=^N:\ :k4=^V:k5=^J:k6=^T:k7=^H:k8=\177:k9=\Ee:k;=\Ed:\ :tc=bee: # (8686: changed k10, k11...k16 to k;, F1...F6; fixed broken continuation # in :is: -- esr) ha8686|harris 8686:\ :F1=\EW:F2=\002\E{\003:F3=\002\E|\003:F4=\002\E}\003:\ :F5=\002\E~\003:F6=\002\E\177\003:\ :is=\ES\E#\E*\Eh\Em\E?\E1\E9\E@\EX\EU\E"*Z01\E"8F35021B7C83#\E"8F45021B7D83#\E"8F55021B7E83#\E"8F65021B7F83#\E"8F75021B7383#\E"8F851BD7#\E"8F95021B7083#\E"8FA5021B7183#\E"8FB5021B7283#:\ :k1=\002\Ep\003:k2=\002\Eq\003:k3=\002\Er\003:\ :k4=\002\Es\003:k5=\E3:k6=\EI:k7=\ER:k8=\EJ:k9=\E(:k;=\Ej:tc=bee: #### Hazeltine # # Hazeltine appears to be out of the business now (1995). These guys were # co-owners of the Terminal Brain Damage Hall Of Fame along with Harris. # They have a hazeltine.com domain and can be reached at: # # Hazeltine # 450 East Pulaski Road # Greenlawn, New York 11740 # # As late as 1993, manuals for the terminal product line could still be # purchased from: # # TRW Customer Service Division # 15 Law Drive # P.O. Box 2076 # Fairfield, NJ 07007-2078 # # Since :nd: is blank, when you want to erase something you # are out of luck. You will have to do ^L's a lot to # redraw the screen. h1000 is untested. It doesn't work in # vi - this terminal is too dumb for even vi. (The code is # there but it isn't debugged for this case.) hz1000|hazeltine 1000:\ :bs:\ :co#80:li#12:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=^K:le=^H:nd= :sf=^J: # From: Thu Aug 20 09:09:18 1981 hz1420|hazeltine 1420:\ :am:bs:\ :co#80:li#24:\ :al=\E^Z:bl=^G:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E\021%r%.%+ :\ :cr=^M:dl=\E^S:do=^J:le=^H:nd=^P:se=\E^Y:sf=^J:so=\E^_:ta=^N:\ :up=\E^L: # New "safe" cursor movement (11/87) from . Prevents # freakout with out-of-range args and tn3270. No hz since it needs to # receive tildes. hz1500|hazeltine 1500:\ :am:bs:hz:\ :co#80:li#24:\ :al=~\032:bl=^G:cd=~\030:ce=~^O:cl=~^\:\ :cm=~\021%r%>^^ %+`%+`:cr=^M:dl=~\023:do=~^K:ho=~^R:kd=^J:\ :kh=~^R:kl=^H:kr=^P:ku=~^L:le=^H:nd=^P:se=~^Y:sf=^J:so=~^_:\ :up=~^L: # h1510 assumed to be in sane escape mode. Else use h1500. # (h1510: early versions of this entry apparently had ":se=\E^_:, # :so=\E^Y:, but these caps were commented out in 8.3; also, # removed incorrect and overridden ":do=^J:" -- esr) hz1510|hazeltine 1510:\ :am:bs:\ :co#80:li#24:\ :al=\E^Z:bl=^G:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E\021%r%.%.:\ :cr=^M:dl=\E^S:do=\E^K:le=^H:nd=^P:sf=^J:up=\E^L: # Hazeltine 1520 # The following switch settings are assumed for normal operation: # FULL CR U/L_CASE ESCAPE # FORMAT_OFF EOM_A_OFF EOM_B_OFF WRAPAROUND_ON # Other switches may be set for operator convenience or communication # requirements. hz1520|Hazeltine 1520:\ :am:bs:bw:ms:\ :co#80:li#24:\ :al=\E^Z:bl=^G:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E\021%r%.%.:\ :cr=^M:dl=\E^S:do=^J:ho=\E^R:kA=\E^Z:kC=\E^\:kE=\E^O:\ :kL=\E^S:kS=\E^X:kb=^H:kd=\E^K:kh=\E^R:kl=^H:kr=^P:ku=\E^L:\ :le=^H:md=\E^_:me=\E^Y:nd=^P:r1=\E$\E\005\E?\E\031:\ :se=\E^Y:sf=^J:so=\E^_:up=\E^L: # This version works with the escape switch off # (h1520: removed incorrect and overridden ":do=^J:" -- esr) hz1520-noesc|hazeltine 1520:\ :am:hz:\ :co#80:li#24:\ :al=~^Z:bl=^G:cd=~^X:ce=~^O:cl=~^\:cm=~\021%r%.%.:cr=^M:\ :dl=~^S:do=~^K:ho=~^R:le=^H:nd=^P:se=~^Y:sf=^J:so=~^_:up=~^L: # Note: the h1552 appears to be the first Hazeltine terminal which # is not braindamaged. It has tildes and backprimes and everything! # Be sure the auto lf/cr switch is set to cr. hz1552|hazeltine 1552:\ :bs:\ :al=\EE:dl=\EO:do=^J:k1=\EP:k2=\EQ:k3=\ER:l1=blue:l2=red:\ :l3=green:\ :tc=vt52: hz1552-rv|hazeltine 1552 reverse video:\ :do=^J:se=\ET:so=\ES:tc=hz1552: # Note: h2000 won't work well because of a clash between upper case and ~'s. hz2000|hazeltine 2000:\ :am:bs:nc:\ :co#74:li#27:\ :al=~\032:bl=^G:cl=~\034:cm=~\021%r%.%.:dl=~\023:do=^J:\ :ho=~^R:le=^H:pc=\177:sf=^J: # Date: Fri Jul 23 10:27:53 1982. Some unknown person wrote: # I tested this termcap entry for the Hazeltine Esprit with vi. It seems # to work ok. There is one problem though if one types a lot of garbage # characters very fast vi seems not able to keep up and hangs while trying # to insert. That's in insert mode while trying to insert in the middle of # a line. It might be because the Esprit doesn't have insert char and delete # char as a built in function. Vi has to delete to end of line and then # redraw the rest of the line. esprit|Hazeltine Esprit I:\ :am:bs:bw:\ :co#80:li#24:\ :al=\E^Z:bl=^G:bt=\E^T:cd=\E^W:ce=\E^O:cl=\E^\:\ :cm=\E\021%r%.%.:cr=^M:dl=\E^S:do=\E^K:ho=\E^R:is=\E?:\ :k0=^B0^J:k1=^B1^J:k2=^B2^J:k3=^B3^J:k4=^B4^J:k5=^B5^J:\ :k6=^B6^J:k7=^B7^J:k8=^B8^J:k9=^B9^J:kb=^H:kd=\E^K:ke=\E>:\ :kh=\E^R:kl=^H:kr=^P:ks=\E<:ku=\E^L:l0=0:l1=1:l2=2:l3=3:l4=4:\ :l5=5:l6=6:l7=7:l8=8:l9=9:le=^H:nd=^P:se=\E^Y:sf=^J:so=\E^_:\ :up=\E^L: esprit-am|hazeltine esprit auto-margin:\ :am:tc=esprit: # Hazeltine Modular-1 from Cliff Shackelton via BRL # Vi it seems always wants to send a control J for "do" and it turned out # that the terminal would work somewhat if the auto LF/CR was turned off. # (hmod1: removed :dn=~^K: -- esr) hmod1|Hazeltine Modular 1:\ :am:bs:hz:\ :co#80:li#24:\ :al=~^Z:bl=^G:bt=~^T:cl=~^\:cm=~\021%r%.%.:cr=^M:dl=~^S:\ :do=~^K:ho=~^R:kd=~^K:kh=~^R:kl=^H:kr=^P:ku=~^L:le=^H:me=~^Y:\ :nd=^P:rc=~^Q:sc=~^E:se=~^Y:sf=^J:so=~^_:up=~^L: # # Hazeltine Executive 80 Model 30 (1554?) # from Will Martin via BRL # Like VT100, except for different "am" behavior. hazel|exec80|h80|he80|Hazeltine Executive 80:\ :am:bs:pt:\ :co#80:it#8:li#24:vt#3:\ :bl=^G:cd=50\E[J:ce=3\E[K:cl=50\E[;H\E[2J:\ :cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:do=^J:ho=\E[H:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:me=2\E[m:mr=2\E[7m:\ :nd=2\E[C:nl=^J:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:se=2\E[m:\ :so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:us=2\E[4m: #### IBM # ibm327x|line mode IBM 3270 style:\ :gn:\ :ce=^M:cl=^M^J:ho=^M: # Beware! The 3101 entry IBM shipped with AIX 3 is *wrong*. Losers... # From: J.B. Nicholson-Owens 8 Mar 94 # (ibm3101: :if=/usr/share/tabset/ibm3101: removed, no such file -- esr) ibm3101|i3101|IBM 3101-10:\ :am:bs:xo:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EK:cm=\EY%+ %+ :cr=^M:ct=\E1:do=^J:\ :ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :nw=^M^J:sf=^J:st=\E0:ta=^I:up=\EA: # Received from the IBM terminals division (given to DRB) # June 1988 for PS/2 OS 2.2.3 cut ibm3151|i3151|IBM 3151:\ :me=\E4@:\ :..sa=\E4%{64}%?%p1%{0}%>%p1%{4}%<%&%t%{8}%|%;%?%p1%{7}%=%t%{16}%|%;%?%p2%t%{1}%|%;%?%p3%t%{4}%|%;%?%p4%t%{2}%|%;%c:\ :se=\E4@:so=\E4A:ue=\E4@:us=\E4B:\ :tc=ibm3163: # From: Mark Easter 29 Oct 1992 # I've commented out or translated some IBM extensions. ibm3161|ibm3163|wy60-316X|wyse60-316X|IBM 3161/3163 display:\ :am:bs:mi:ms:\ :co#80:it#8:li#24:\ :F1=\Ek\r:F2=\El\r:F3=\E\041a\r:F4=\E\041b\r:\ :F5=\E\041c\r:F6=\E\041d\r:F7=\E\041e\r:F8=\E\041f\r:\ :F9=\E\041g\r:FA=\E\041h\r:FB=\E\041i\r:FC=\E\041j\r:\ :FD=\E\041k\r:FE=\E\041l\r:\ :ac=l\354q\361k\353x\370j\352m\355w\367u\365v\366t\364n\356:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:dc=\EQ:\ :dl=\EO:do=\EB:ho=\EH:k1=\Ea\r:k2=\Eb\r:k3=\Ec\r:k4=\Ed\r:\ :k5=\Ee\r:k6=\Ef\r:k7=\Eg\r:k8=\Eh\r:k9=\Ei\r:k;=\Ej\r:\ :kA=\EN:kB=\E2:kC=\EL\r:kD=\EQ:kE=\EI:kI=\EP \010:kL=\EO:\ :kS=\EJ:kT=\E0:ka=\E 1:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :kt=\E1:ku=\EA:le=\ED:mb=\E4D:md=\E4H:me=\E4@\E<@:mk=\E4P:\ :mr=\E4A:nd=\EC:\ :..sa=\E4%'@'%?%p1%t%'A'%|%;\n%?%p2%t%'B'%|%;\n%?%p3%t%'A'%|%;\n%?%p4%t%'D'%|%;\n%?%p5%t%'@'%|%;\n%?%p6%t%'H'%|%;\n%?%p7%t%'P'%|%;%c\n%?%p9%t\E>A%e\E<@%;:\ :se=\E4@:sf=^J:so=\E4A:te=\E>A:ti=\E>A:ue=\E4@:up=\EA:\ :us=\E4B: # How the 3164 sgr string works: # %{32} # push space for no special video characteristics # %?%p2%t%{1}%|%; # if p2 set, then OR the 1 bit for reverse # %?%p3%t%{4}%|%; # if p3 set, then OR the 4 bit for blink # %?%p4%t%{2}%|%; # if p4 set, then OR the 2 bit for underline # %c # pop Pa1 # %{39}%p1%- # calculate 32 + (7 - p1) for foreground # %c # pop Pa2 # %{64} # use only black background for now # %c # pop Pa3 ibm3164|i3164|IBM 3164:\ :mb=\E4D:md=\E4H:me=\E4@:\ :..sa=\E4%{32}%?%p2%t%{1}%|%;%?%p3%t%{4}%|%;%?%p4%t%{2}%|%;%c%{39}%p1%-%c%{64}%c:tc=ibm3163: ibmaed|IBM Experimental display:\ :am:bs:eo:ms:\ :co#80:it#8:li#52:\ :al=\EN:cd=\EJ:ce=\EI:cl=\EH\EK:cm=\EY%+ %+ :dc=\EQ:dl=\EO:\ :do=\EB:ei=:ho=\EH:ic=\EP:im=:kb=^H:kd=\EB:kl=\ED:kr=\EC:\ :ku=\EA:le=^H:me=\E0:nd=\EC:se=\E0:so=\E0:ta=^I:up=\EA:\ :vb=\EG: ibm-apl|apl|IBM apl terminal simulator:\ :li#25:tc=dm1520: # (ibmmono: this had an unknown `sb' boolean, I changed it to `bs'. # Also it had ":I0=f10:" which pretty obviously should be "l0=f10" -- esr) ibmmono|ibm5151|IBM workstation monochrome:\ :es:hs:\ :al=\EL:dl=\EM:ds=\Ej\EY8 \EI\Ek:fs=\Ek:k0=\E<:k1=\ES:\ :k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:k8=\ER:k9=\EY:\ :kF=\EE:kI=\200:kN=\EE:kP=\Eg:kR=\EG:kb=^H:kh=\EH:l0=f10:\ :md=\EZ:me=\Ew\Eq\Ez\EB:mk=\EF\Ef0;\Eb0;:mr=\Ep:se=\Ez:\ :so=\EZ:sr=\EA:ts=\Ej\EY8%+ \Eo:ue=\Ew:us=\EW:\ :tc=ibm3101: ibmega|ibm5154|IBM Enhanced Color Display:\ :cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ibmmono: ibmega-c|ibm5154-c|IBM Enhanced Color Display:\ :se=\EB:so=\EF\Ef3;:ue=\EB:us=\EF\Ef2;:tc=ibmmono: ibmvga-c|IBM VGA display color termcap:\ :cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ibmega-c: ibmvga|IBM VGA display:\ :cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ibmega: # ibmapa* and ibmmono entries come from ACIS 4.3 distribution rtpc|ibmapa16|ibm6155|IBM 6155 Extended Monochrome Graphics Display:\ :li#32:\ :ds=\Ej\EY@ \EI\Ek:ts=\Ej\EY@%+ \Eo:tc=ibmmono: # Advanced Monochrome (6153) and Color (6154) Graphics Display: ibmapa8c|ibmapa8|ibm6154|ibm6153|IBM 6153/4 Advanced Graphics Display:\ :li#31:\ :ds=\Ej\EY? \EI\Ek:ts=\Ej\EY?%+ \Eo:tc=ibmmono: ibmapa8c-c|ibm6154-c|IBM 6154 Advanced Color Graphics Display:\ :li#31:\ :ds=\Ej\EY? \EI\Ek:mh=\EF\Ef7;:ts=\Ej\EY?%+ \Eo:tc=ibmega-c: # From: Marc Pawliger # also in /usr/lpp/bos/bsdsysadmin. # (hft-c: this entry had :kb=\E[D:kf=\E[C: on the line with ku/kd/kh; this was # pretty obviously mislabeled for :le: and :nd:; also ":ul=\E[4m:" was clearly # a typo for ":us=\E[4m:"; also ":el=\E[K:" was a typo for ":ce=\E[K:". # I also added / based on the terminal reset string. # There was an unknown boolean ":ht:" which I assume was meant to set hardware # tabs, so I have inserted it#8. Finally, :ac=^N: paired with the :ae: looked # like a typo for :as=^N:; finally, added empty to quiet tic -- esr) ibm8512|ibm8513|hft-c|IBM High Function Terminal:\ :am:mi:ms:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DL=\E[%dM:RA=\E[?7l:SA=\E[?7h:ac=:ae=^O:al=\E[L:\ :as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:dl=\E[M:\ :dm=\E[4h:do=^J:ec=\E[%dX:ed=\E[4l:ei=\E[4l:ho=\E[H:\ :im=\E[4h:is=\Eb\E[m\017\E[?7h:k0=\E[010q:k1=\E[001q:\ :k2=\E[002q:k3=\E[003q:k4=\E[004q:k5=\E[005q:k6=\E[006q:\ :k7=\E[007q:k8=\E[008q:k9=\E[009q:kd=\E[B:kh=\E[H:ku=\E[A:\ :le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r1=\Eb\E[m\017\E[?7h\E[H\E[J:rc=\E[u:sc=\E[s:se=\E[m:\ :so=\E[7m:te=\E[20h:ti=\E[20;4l\E[?7h\Eb:ue=\E[m:up=\E[A:\ :us=\E[4m: hft|AIWS High Function Terminal:\ :am:xo:\ :co#80:li#25:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=\E6:ho=\E[H:\ :ic=\E[@:im=\E6:k1=\E[001q:k2=\E[002q:k3=\E[003q:\ :k4=\E[004q:k5=\E[005q:k6=\E[006q:k7=\E[007q:k8=\E[008q:\ :k9=\E[009q:kN=\E[153q:kP=\E[159q:ka=\E[010q:kb=^H:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mk=\E[8m:mr=\E[7m:nd=\E[C:se=\E[m:sf=^J:\ :so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: ibm-system1|system1|ibm system/1 computer:\ :am:xt:\ :co#80:li#24:\ :bl=^G:cl=^Z:cm=\005%+ %+ :ho=^K:le=^H:nd=^\:sf=^J:up=^^: # From: ibm5081|ibmmpel|IBM 5081 1024x1024 256/4096 color display:\ :es:hs:\ :li#33:\ :ds=\Ej\EYA \EI\Ek:fs=\Ek:ts=\Ej\EYA%+ \Eo:tc=ibmmono: ibm5081-c|ibmmpel-c|IBM 5081 1024x1024 256/4096 enhanced color display:\ :es:hs:\ :li#33:\ :ds=\Ej\EYA \EI\Ek:fs=\Ek:ts=\Ej\EYA%+ \Eo:tc=ibmega-c: ibm8514|IBM 8514 color display:\ :es:hs:\ :li#41:\ :cr=^M:do=^J:ds=\Ej\EYI \EI\Ek:fs=\Ek:kb=^H:kd=^J:kl=^H:\ :nw=^M^J:sf=^J:ta=^I:ts=\Ej\EYI%+ \Eo:\ :tc=ibmega: ibm8514-c|IBM 8514 color display:\ :es:hs:\ :li#41:\ :cr=^M:do=^J:ds=\Ej\EYI \EI\Ek:fs=\Ek:kb=^H:kd=^J:kl=^H:\ :nw=^M^J:sf=^J:ta=^I:ts=\Ej\EYI%+ \Eo:\ :tc=ibmega-c: # # AIX entries. IBM ships these with AIX 3. # AIX extension caps are commented out, # except for box1 which has been translated to an string. # aixterm-m|IBM AIXterm Monochrome Terminal Emulator:\ :es:hs:\ :ac=llqqkkxxjjmmwwuuvvttnn:ds=\E[?E:fs=\E[?F:md=\E[1m:\ :me=\E[0;10m\E(B:s0=\E(B:s1=\E(0:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sr@:ts=\E[?%p1%dT:\ :tc=ibm6153: aixterm-m-old|IBM AIXterm Monochrome Terminal Emulator:\ :es:hs:\ :ds=\E[?E:fs=\E[?F:md=\E[1m:\ :..sa=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:\ :sr@:ts=\E[?%p1%dT:\ :tc=ibm6153: jaixterm-m|IBM Kanji AIXterm Monochrome Terminal Emulator:\ :ac@:\ :tc=aixterm-m: #### Infoton/General Terminal Corp. # # gt100 sounds like something DEC would come out with. Let's hope they don't. i100|gt100|gt100a|General Terminal 100A (formerly Infoton 100):\ :am:bs:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=^L:cm=\Ef%r%+ %+ :cr=^M:\ :dl=\EM:do=^J:ho=\EH:le=^H:nd=\EC:se=\Ea:sf=^J:so=\Eb:up=\EA:\ :vb=\Eb\Ea: i400|infoton 400:\ :am:bs:\ :co#80:li#25:\ :al=\E[L:bl=^G:ce=\E[N:cl=\E[2J:cm=%i\E[%3;%3H:cr=^M:\ :dc=\E[4h\E[2Q\E[P\E[4l\E[0Q:dl=\E[M:do=^J:\ :ei=\E[4l\E[0Q:im=\E[4h\E[2Q:le=^H:nd=\E[C:sf=^J:up=\E[A: # (addrinfo: removed obsolete ":bc=^Z:" -- esr) addrinfo:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^K:cl=^L:..cm=\037%p1%{1}%-%c%p2%{1}%-%c:cr=^M:\ :do=^J:ho=^H:le=^Z:ll=^H^\:nd=^Y:sf=^J:up=^\: # (infoton: used to have the no-ops , , -- esr) infoton:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^K:cl=^L:cr=^M:do=^J:le=^Z:ll=^H^\:nd=^Y:sf=^J:\ :up=^\: #### Interactive Systems Corp # # ISC used to sell OEMed and customized hardware to support ISC UNIX. # ISC UNIX still exists in 1995, but ISC itself is no more; they got # bought out by Sun. # # From: Wed Sep 16 08:06:44 1981 # (intext: removed obsolete ":ma=^K^P^R^L^L ::bc=^_:", also the # ":le=^_:" later overridden -- esr) intext|Interactive Systems Corporation modified owl 1200:\ :am:bs:\ :co#80:it#8:li#24:sg#1:\ :al=\020:bl=^G:bt=^Y:cd=\026J:ce=^Kp^R:cl=\014:\ :cm=\017%+ %+ :cr=^M:dc=\022:dl=\021:do=^J:ei=^V<:im=^V;:\ :ip=:k0=^VJ\r:k1=^VA\r:k2=^VB\r:k3=^VC\r:k4=^VD\r:k5=^VE\r:\ :k6=^VF\r:k7=^VG\r:k8=^VH\r:k9=^VI\r:kb=^H:kd=^J:ke=^V9:\ :kh=^Z:kl=^_:kr=^^:ks=\036\072\264\026%:ku=^\:le=^H:nd=^^:\ :se=^V# :sf=^J:so=^V$\054:ta=^I:up=^\: intext2|intextii|INTERACTIVE modified owl 1251:\ :am:bw:ul:\ :co#80:li#24:sg#0:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%+^AG:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=:ic=\E[@:im=:k0=\E@\r:k1=\EP\r:k2=\EQ\r:\ :k3=\ES\r:k4=\ET\r:k5=\EU\r:k6=\EV\r:k7=\EW\r:k8=\EX\r:\ :k9=\EY\r:kb=^H:kd=\EB\r:kh=\ER\r:kl=\ED\r:kr=\EC\r:\ :ku=\EA\r:l0=REFRSH:l1=DEL CH:l2=TABSET:l3=GOTO:l4=+PAGE:\ :l5=+SRCH:l6=-PAGE:l7=-SRCH:l8=LEFT:l9=RIGHT:nd=\E[C:\ :se=\E[2 D:sf=\E[S:so=\E[6 D:sr=\E[T:ta=^I:ue=\E[2 D:\ :up=\E[A:us=\E[18 D:\ :vb=\E[;;;;;;;;;2;;u\E[;;;;;;;;;1;;u: #### Kimtron (abm, kt) # # Kimtron entries include (undocumented) codes for: enter dim mode, # enter bold mode, enter reverse mode, turn off all attributes. # # Kimtron ABM 85 added by Dual Systems # (abm85: removed duplicated ":kd=^J:" -- esr) abm85|Kimtron ABM 85:\ :am:bs:bw:ms:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EE:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :dc=\EW:\ :dl=\ER:do=^J:ei=\Er:if=/usr/share/tabset/stdcrt:im=\EQ:\ :is=\EC\EX\Eg\En\E%\Er\E(\Ek\Em\Eq:kb=^H:kd=^J:kh=^^:\ :kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\Ek:so=\Ej:ta=^I:ue=\Em:\ :up=^K:us=\El: # Kimtron ABM 85H added by Dual Systems. # Some notes about the abm85h entries: # 1) there are several firmware revs of 85H in the world. Use abm85h-old for # firmware revs prior to SP51 # 2) Make sure to use abm85h entry if the terminal is in 85h mode and the # abm85e entry if it is in tvi920 emulation mode. They are incompatible # in some places and NOT software settable i.e., :is: can't fix it) # 3) In 85h mode, the arrow keys and special functions transmit when # the terminal is in dup-edit, and work only locally in local-edit. # Vi won't swallow `del char' for instance, but :ti: turns on # dup-edit anyway so that the arrow keys will work right. If the # arrow keys don't work the way you like, change :ti:, :te:, and # :is:. Note that 920E mode does not have software commands to toggle # between dup and local edit, so you get whatever was set last on the # terminal. # 4) :vb: attribute is nice, but seems too slow to work correctly # (\Eb:pc:\Ed) # 5) Make sure `hidden' attributes are selected. If `embedded' attributes # are selected, the entry should be removed. # 6) auto new-line should be on (selectable from setup mode only) # # From: Erik Fair Sun Oct 27 07:21:05 1985 abm85h|Kimtron ABM 85H native mode:\ :hs:\ :sg@:\ :bl=^G:ds=\Ee:fs=^M:im=\EZ:\ :is=\EC\EN\EX\024\016\EA\Ea\E%\E9\Ee\Er\En\E"\E}\E'\E(\Ef\r\EG0\Ed\E.4\El:\ :kd=^V:me=\E(\EG0:mh=\E):mk@:ts=\Eg\Ef:vb@:ve=\E.4:vs=\E.2:\ :tc=adm+sgr:tc=abm85: abm85e|Kimtron ABM 85H in 920E mode:\ :sg@:\ :bl=^G:im=\EZ:\ :is=\EC\EX\EA\E%\E9\Ee\Er\En\E"\E}\E'\E(\Ef\r\Ek\Eq\Em:\ :me=\E(\Ek:mh=\E):mr=\Ej:vb@:\ :tc=abm85: abm85h-old|oabm85h|o85h|Kimtron ABM 85H with old firmware rev.:\ :sg@:\ :bl=^G:im=\EZ:\ :is=\E}\EC\EX\Ee\En\E%\Er\E(\Ek\Em\Eq\Ed\ET\EC\E9\EF:\ :me=\E(\Ek:mh=\E):mr=\Ej:\ :tc=abm85: # From: # (kt7: removed obsolete :ma=^V^J^L :" -- esr) kt7|kimtron model kt-7:\ :am:bs:\ :co#80:it#8:li#24:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :dc=\EW:\ :dl=\ER:do=^V:ei=:fs=\Eg:ho=^^:ic=\EQ:\ :if=/usr/share/tabset/stdcrt:im=:is=\El\E":k0=^AI\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kA=\EE:kB=\EI:kC=^Z:kD=\EW:\ :kE=\ET:kI=\EQ:kL=\ER:kS=\EY:kb=^H:kd=^V:kh=^^:kl=^H:kr=^L:\ :ku=^K:le=^H:mk@:nd=^L:ta=^I:ts=\Ef:up=^K:\ :tc=adm+sgr: # Renamed TB=^I to :ta:, BE=^G to :bl:, BS=^H to :kb:, N to :kS: (based on the # other kt7 entry and the adjacent key capabilities). Removed EE which is # identical to :mh:. Removed :ES=\EGD: which is some kind of highlight # but we can't figure out what. kt7ix|kimtron model kt-7 or 70 in IX mode:\ :am:bw:\ :co#80:it#8:li#25:\ :@7=\EY:PU=\EK:ac=lZm@k?jYt4uCvAwBqDx3nE:ae=\E%:al=\EE:\ :as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :\ :cr=^M:dc=\EW:dl=\ER:do=^V:ds=\Ef\r:ei=:fs=^M:ho=^^:ic=\EQ:\ :im=:is=\EG0\E s\017\E~:k0=^AI\r:k1=^A@\r:k2=^AA\r:\ :k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:\ :k9=^AH\r:kA=\EE:kB=\EI:kC=\E*:kE=\ET:kI=\EQ:kL=\ER:kN=\EJ:\ :kS=\EY:kb=^H:kd=\E[B:kh=^^:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\EG2:me=\EG0:mh=\EG@:nd=^L:nw=^M^J:se=\EG0:sf=^J:\ :so=\EG4:ta=^I:ts=\Ef:ue=\EG0:up=^K:us=\EG8:ve=\E.3:vi=\E.0: #### Microdata/MDIS # # This was a line of terminals made by McDonnell-Douglas Information Systems. # These entries come direct from MDIS documentation. I have edited them only # to move primary names of the form p[0-9] * to aliases, and to comment out # :ae:/:as: in a couple of entries without strings. I have # also removed the change history; the last version indicates this is # version 4.3 by A.Barkus, September 1990 (earliest entry is October 1989). # # McDonnell Information Systems Terminal Family History # ========================================= # # Prism-1, Prism-2 and P99: # Ancient Microdata and CMC terminals, vaguely like Adds Regent 25. # # Prism-4 and Prism-5: # Slightly less ancient range of Microdata terminals. Follow-on from # Prism-2, but with many enhancements. P5 has eight display pages. # # Prism-6: # A special terminal for use with library systems, primarily in Germany. # Limited numbers. Similar functionality to P5 (except attributes?). # # Prism-7, Prism-8 and Prism-9: # More recent range of MDIS terminals, in which P7 and P8 # replace the P4 & P5, with added functionality, and P9 is the flagship. # The P9 has two emulation modes - P8 and ANSI - and includes a # large number of the DEC VT220 control sequences. Both # P8 and P9 support 80c/24ln/8pg and 132cl/24li/4pg formats. # # Prism-12 and Prism-14: # Latest range, functionally very similar to the P9. The P14 has a # black-on-white overscanning screen. # # The terminfo definitions given here are: # # p2 - Prism-2 (or Prism-1 or P99). # # p4 - Prism-4 (and older P7s & P8s). # p5 - Prism-5 (or Prism-6). # # p7 - Prism-7. # p8 - Prism-8 (in national or multinational mode). # p8-w - 132 column version of p8. # p9 - Prism-9 in ANSI mode. # p9-w - 132 column version of p9. # p9-8 - Prism-9 in Prism-8 emulation mode. # p9-8-w - As p9-8, but with 132 columns. # # p12 - Prism-12 in ANSI mode. # p12-w - 132 column version of p12. # p12-m - Prism-12 in MDC emulation mode. # p12-m-w - As p12-m, but with 132 columns. # p14 - Prism-14 in ANSI mode. # p14-w - 132 column version of p14. # p14-m - Prism-14 in MDC emulation mode. # p14-m-w - As p14-m, but with 132 columns. # # p2: Prism-2 # ----------- # # Includes Prism-1 and basic P99 without SP or MP loaded. # The simplest form of Prism-type terminal. # Basic cursor movement and clearing operations only. # No video attributes. # Notes: # Horizontal cursor qualifiers of NUL, XON and XOFF are mapped to the next # value up, followed by backspace. # P2|MDC Prism-2:\ :am:bw:ms:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:\ :..ch=\020%p1%{10}%/%{16}%*%p1%{10}%m%+%Pc%?%{17}%gc%=%{19}%gc%=%|%gc%!%|%t%{1}%gc%+%c%{8}%e%gc%;%c:\ :cl=\014:\ :..cm=\013%p1%' '%+%c\020%p2%{10}%/%{16}%*%p2%{10}%m%+%Pc%?%{17}%gc%=%{19}%gc%=%|%gc%!%|%t%{1}%gc%+%c%{8}%e%gc%;%c:\ :cr=^M:cv=\013%+ :do=^J:ho=^A:kb=^H:kh=^A:le=^H:nd=^F:sf=^J:\ :up=^Z: # p4: Prism-4 # ----------- # # Includes early versions of P7 & P8. # Basic family definition for most Prisms (except P2 and P9 ANSI). # Notes: # Horizontal cursor qualifiers of NUL, XON and XOFF are mapped to the next # value up, followed by backspace. # Cursor key definitions removed because they interfere with vi and csh keys. # prism4|p4|P4|MDC Prism-4:\ :5i:am:bw:hs:ms:\ :co#80:li#24:sg#1:ug#1:ws#72:\ :bl=^G:cd=\EJ:ce=\EK:\ :..ch=\020%p1%{10}%/%{16}%*%p1%{10}%m%+%Pc%?%{17}%gc%=%{19}%gc%=%|%gc%!%|%t%{1}%gc%+%c%{8}%e%gc%;%c:\ :cl=\014:\ :..cm=\013%p1%' '%+%c\020%p2%{10}%/%{16}%*%p2%{10}%m%+%Pc%?%{17}%gc%=%{19}%gc%=%|%gc%!%|%t%{1}%gc%+%c%{8}%e%gc%;%c:\ :cr=^M:cv=\013%+ :do=^J:ds=\035\343\035\345:fs=^]\345:\ :ho=^A^J:kb=^H:kh=^A:le=^H:mb=^CB:me=^C :mh=^CA:mk=^CH:\ :mr=^CD:nd=^F:pf=\ET:po=\ER:ps=\EU:\ :..sa=\003%'@'%?%p1%p3%|%t%{4}%+%;%?%p2%t%{16}%+%;%?%p4%t%{2}%+%;%?%p5%t%{1}%+%;%?%p7%t%{8}%+%;%c%?%p9%t\016%e\017%;:\ :se=^C :sf=^J:so=^CD:ts=^]\343:ue=^C :up=^Z:us=^CP:\ :ve=^]\342:vi=^]\344: # p5: Prism-5 # ----------- # # Same definition as p4. Includes Prism-6 (not tested!). # Does not use any multi-page features. # prism5|p5|P5|MDC Prism-5:\ :tc=p4: # p7: Prism-7 # ----------- # # Similar definition to p4. Uses ANSI cursor motion to avoid network problems. # Notes: # Use p4 for very early models of P7. # Rev-index removed; can't send nulls to terminal in 8-bit modes. # prism7|p7|P7|MDC Prism-7:\ :ch@:cm=\E[%i%d;%dH:cv@:tc=p4: # p8: Prism-8 # ----------- # # Similar definition to p7. Uses ANSI cursor motion to avoid network problems. # Supports national and multinational character sets. # Notes: # Alternate char set operations only work in multinational mode. # Use p4 for very early models of P8. # Rev-index removed; can't send nulls to terminal in 8-bit modes. # (esr: commented out :as:/:ae: because there's no ) # prism8|p8|P8|MDC Prism-8:\ :ch=\E[%i%d`:cm=\E[%i%d;%dH:cv=\E[%i%dd:is=\E[<12h:tc=p4: # p8-w: Prism-8 in 132 column mode # -------------------------------- # # 'Wide' version of p8. # Notes: # Rev-index removed; can't send nulls to terminal in 8-bit modes. # prism8-w|p8-w|P8-W|MDC Prism-8 in 132 column mode:\ :co#132:\ :is=\E[<12h\E[<14h:tc=p8: # p9: Prism-9 in ANSI mode # ------------------------- # # The "flagship" model of this generation of terminals. # ANSI X3.64 (ISO 6429) standard sequences, plus many DEC VT220 ones. # Notes: # Tabs only reset by "reset". Otherwise assumes default (8 cols). # Fixes to deal with terminal firmware bugs: # . 'ri' uses insert-line since rev index doesn't always # . 'sgr0' has extra '0' since esc[m fails # . 'fsl' & 'dsl' use illegal char since cr is actioned wrong on line 25 # Not covered in the current definition: # . Labels # . Programming Fn keys # . Graphic characters (defaults correctly to vt100) # . Padding values (sets xon) # (esr: commented out :as:/:ae: because there's no ) # # (untranslatable capabilities removed to fit entry within 1023 bytes) prism9|p9|P9|MDC Prism-9 in ANSII mode:\ :5i:am:bw:hs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:ws#72:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:\ :F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:F6=\E[29~:\ :F7=\E[31~:F8=\E[32~:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:\ :al=\E[L:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%i%d`:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%d%v:ct=\E[2g:\ :cv=\E[%i%dd:dc=\E[P:dl=\E[M:do=^J:ds=\E[%}\024:ec=\E[%dX:\ :ei=\E[4l:fs=^T:ho=\E[H:im=\E[4h:is=\E[&p\E[<12l\E F:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:kC=^L:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mp=\E[32%{:mr=\E[7m:nd=\E[C:\ :nw=^M^J:pf=\E[4i:po=\E[5i:ps=\E[i:\ :r2=\E[&p\E[<12l\E F\E[3g\E[9;17;25;33;41;49;57;65;73 N:\ :rc=\E[%z:rp=\E[%r%db%.:sc=\E[%y:se=\E[27m:sf=^J:so=\E[7m:\ :sr=\E[L:st=\EH:ta=^I:ts=\E[%i%p1%d%%}:ue=\E[24m:up=\E[A:\ :us=\E[4m:ve=\E[<4h:vi=\E[<4l: # p9-w: Prism-9 in 132 column mode # -------------------------------- # # 'Wide' version of p9. # prism9-w|p9-w|P9-W|MDC Prism-9 in 132 column mode:\ :co#132:\ :is=\E[&p\E[<12l\E F\E[<14h:\ :r2=\E[&p\E[<12l\E F\E[<14h:tc=p9: # p9-8: Prism-9 in P8 mode # ------------------------ # # P9 terminal in P8 emulation mode. # Similar to p8 definition. # Insertion and deletion operations possible. # prism9-8|p9-8|P9-8|MDC Prism-9 in P8 mode:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:al=\E[L:dc=\E[P:\ :dl=\E[M:ei=:ic=\E[@:im=:\ :tc=p8: # p9-8-w: Prism-9 in P8 and 132 column modes # ------------------------------------------ # # P9 terminal in P8 emulation mode and 132 column mode. # prism9-8-w|p9-8-w|P9-8-W|MDC Prism-9 in Prism 8 emulation and 132 column mode:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:IC=\E[%d@:al=\E[L:dc=\E[P:\ :dl=\E[M:ei=:ic=\E[@:im=:\ :tc=p8-w: # p12: Prism-12 in ANSI mode # --------------------------- # # See p9 definition. # prism12|p12|P12|MDC Prism-12 in ANSI mode:\ :tc=p9: # p12-w: Prism-12 in 132 column mode # ---------------------------------- # # 'Wide' version of p12. # prism12-w|p12-w|P12-W|MDC Prism-12 in 132 column mode:\ :tc=p9-w: # p12-m: Prism-12 in MDC emulation mode # ------------------------------------- # # P12 terminal in MDC emulation mode. # Similar to p8 definition. # Insertion and deletion operations possible. # prism12-m|p12-m|P12-M|MDC Prism-12 in MDC emulation mode:\ :tc=p9-8: # p12-m-w: Prism-12 in MDC emulation and 132 column modes # ------------------------------------------------------- # # P12 terminal in MDC emulation mode and 132 column mode. # prism12-m-w|p12-m-w|P12-M-W|MDC Prism-12 in MDC emulation and 132 column mode:\ :tc=p9-8-w: # p14: Prism-14 in ANSII mode # --------------------------- # # See p9 definition. # prism14|p14|P14|MDC Prism-14 in ANSII mode:\ :tc=p9: # p14-w: Prism-14 in 132 column mode # ---------------------------------- # # 'Wide' version of p14. # prism14-w|p14-w|P14-W|MDC Prism-14 in 132 column mode:\ :tc=p9-w: # p14-m: Prism-14 in MDC emulation mode # ------------------------------------- # # P14 terminal in MDC emulation mode. # Similar to p8 definition. # Insertion and deletion operations possible. # prism14-m|p14-m|P14-M|MDC Prism-14 in MDC emulation mode:\ :tc=p9-8: # p14-m-w: Prism-14 in MDC emulation and 132 column modes # ------------------------------------------------------- # # P14 terminal in MDC emulation mode and 132 column mode. # prism14-m-w|p14-m-w|P14-M-W|MDC Prism-14 in MDC emulation and 132 column mode:\ :tc=p9-8-w: # End of McDonnell Information Systems Prism definitions # These things were popular in the Pick database community at one time # From: George Land 24 Sep 1996 p8gl|prism8gl|McDonnell-Douglas Prism-8 alternate definition:\ :am:bw:hs:mi:\ :co#80:li#24:ma#1:sg#1:ug#1:ws#78:\ :F2=^AJ\r:F3=^AK\r:F4=^AL\r:F5=^AM\r:F6=^AN\r:F7=^AO\r:\ :bl=^G:cd=\EJ:ce=\EK:cl=^L:cm=\E[%i%d;%dH:cr=^M:dc= ^H:\ :dl=^P:do=^J:ho=^A:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k;=^AI\r:\ :kD= ^H:kE=\EK:kL=^P:kS=\EJ:kb=^H:kd=^J:kh=^A:kl=^U:kr=^F:\ :ku=^Z:l1=F1:l2=F2:l3=F3:l4=F4:l5=F5:l6=F6:l7=F7:l8=F8:l9=F9:\ :la=F10:le=^U:mb=^CB:me=^C :mh=^CA:mk=^CH:mr=^CD:nd=^F:\ :nw=^J^M:pc=\200:se=^C :sf=^J:so=^CE:ue=^C :up=^Z:us=^C0: #### Microterm (act, mime) # # The mime1 entries refer to the Microterm Mime I or Mime II. # The default mime is assumed to be in enhanced act iv mode. # # New "safe" cursor movement (5/87) from . Prevents # freakout with out-of-range args on Sytek multiplexors. No :so=^N: and # :se=^N: since it gets confused and it's too dim anyway. No :ic: # since Sytek insists ^S means xoff. # (act4: found ":ic=2^S:ei=:im=:ip=.1*^V:" commented out in 8.3 -- esr) act4|microterm|microterm act iv:\ :am:bs:\ :co#80:li#24:\ :al=2.3*\001<2.3*/>:bl=^G:cd=2.2*\037:ce=.1*\036:\ :cl=12\014:cm=\024%+^X%>/0%+P:cr=^M:dc=.1*\004:\ :dl=2.3*\027:do=^K:ho=^]:kd=^K:kl=^H:kr=^X:ku=^Z:le=^H:nd=^X:\ :sf=^J:up=^Z: # The padding on :sr: and :ta: for act5 and mime is a guess and not final. # The act 5 has hardware tabs, but they are in columns 8, 16, 24, 32, 41 (!)... # (microterm5: removed obsolete ":ma==^Z^P^Xl^Kj:" -- esr) act5|microterm5|microterm act v:\ :kd=^K:kl=^H:kr=^X:ku=^Z:sr=\EH:uc=^H\EA:tc=act4: # Mimes using brightness for standout. Half bright is really dim unless # you turn up the brightness so far that lines show up on the screen. mime-fb|full bright mime1:\ :is=^S\E:se=^S:so=^Y:tc=mime: mime-hb|half bright mime1:\ :is=^Y\E:se=^Y:so=^S:tc=mime: # (mime: removed obsolete ":ma=^X ^K^J^Z^P:"; removed ":do=^K:" that overrode # the more plausible ":do=^J:" -- esr) # uc was at one time disabled to get around a curses bug, be wary of it mime|mime1|mime2|mimei|mimeii|microterm mime1:\ :am:bs:\ :co#80:it#8:li#24:vt#9:\ :al=\001:bl=^G:cd=^_:ce=^^:cl=^]^C:cm=\024%+^X%> 0%+P:\ :cr=^M:dl=\027:do=^J:ho=^]:is=^S\E^Q:kd=^K:kl=^H:kr=^X:ku=^Z:\ :le=^H:nd=^X:sf=^J:sr=\022:ta=\011:uc=^U:up=^Z: # These termcaps (for mime2a) put the terminal in low intensity mode # since high intensity mode is so obnoxious. mime2a-s|microterm mime2a (emulating an enhanced soroc iq120):\ :am:bs:\ :co#80:li#24:\ :al=\001:bl=^G:cd=\EJ:ce=\EK:cl=\EL:cm=\E=%+ %+ :cr=^M:\ :dc=\ED:dl=\027:do=^J:ei=^Z:ho=^^:im=\EE:ip=:is=\E):kd=^J:\ :kl=^H:kr=^L:ku=^K:le=^H:nd=^L:se=\E;:sf=^J:so=\E\072:sr=\EI:\ :ue=\E7:up=\EI:us=\E6: # This is the preferred mode (but ^X can't be used as a kill character) mime2a|mime2a-v|microterm mime2a (emulating an enhanced vt52):\ :bs:\ :co#80:it#8:li#24:\ :al=\001:bl=^G:cd=\EQ:ce=\EP:cl=\EL:cm=\EY%+ %+ :cr=^M:\ :dc=^N:dl=\027:do=^J:ei=^Z:ho=\EH:im=^O:ip=:is=^Y:kd=\EB:\ :kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\E9:sf=^J:so=\E8:\ :sr=\EA:ta=^I:ue=\E5:up=\EA:us=\E4: # (mime3a: removed obsolete ":ma=^X ^K^J^Z^P:" -- esr) mime3a|mime1 emulating 3a:\ :am@:\ :kd=^K:kl=^H:kr=^X:ku=^Z:tc=adm3a: mime3ax|mime-3ax|mime1 emulating enhanced 3a:\ :it#8:\ :al=\001:cd=^_:ce=^X:dl=\027:ta=\011:tc=mime3a: # Wed Mar 9 18:53:21 1983 # We run our terminals at 2400 baud, so there might be some timing problems at # higher speeds. The major improvements in this model are the terminal now # scrolls down and insert mode works without redrawing the rest of the line # to the right of the cursor. This is done with a bit of a kludge using the # exit graphics mode to get out of insert, but it does not appear to hurt # anything when using vi at least. If you have some users using act4s with # programs that use curses and graphics mode this could be a problem. mime314|mm314|mime 314:\ :am:\ :co#80:li#24:\ :al=^A:cd=^_:ce=^^:cl=^L:cm=\024%.%.:dc=^D:dl=^W:ei=^V:ho=^]:\ :im=^S:kd=^K:kl=^H:kr=^X:ku=^Z:le=^H:nd=^X:ta=^I:up=^Z: # Microterm mime 340 from University of Wisconsin mm340|mime340|mime 340:\ :co#80:li#24:\ :al=46\EU:cd=2*\037:ce=2.1\EL:cl=12\032:cm=\E=%+ %+ :\ :cr=^M:dc=2.1*\E#:dl=49.6\EV:do=^J:is=\E\054:kb=^H:kd=^J:\ :kl=^H:ku=^K:le=^H:nd=^L:nw=^M^J:sf=^J:ta=^I:up=^K: # This came from University of Wisconsin marked "astro termcap for jooss". # (mt4520-rv: removed obsolete ":kn#4:" and incorrect ":ri=\E[C:"; # also added / based on the init string -- esr) mt4520-rv|micro-term 4520 reverse video:\ :am:hs:ms:xn:xo:\ :co#80:it#8:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[g:dc=\E[P:dl=\E[M:do=\E[B:ei=:\ :fs=\E[?5l\E[?5h:ho=\E[H:ic=\E[@:im=:\ :is=\E(B\E[2l\E>\E[20l\E[?3l\E[?5h\E[?7h\E[1;24r\E[24;1H\E[H\E[J:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:ll=\E[24;1H:me=\E[m:\ :nd=\E[C:nw=\EE:\ :r1=\E(B\E[2l\E>\E[20l\E[?3l\E[?5h\E[?7h\E[H\E[J:\ :rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:se=\E[0m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[25;1H:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5l\E[?5h:ve=\E[0V\E8:\ :vs=\E7\E[0U: # Fri Aug 5 08:11:57 1983 # This entry works for the ergo 4000 with the following setups: # ansi,wraparound,newline disabled, xon/xoff disabled in both # setup a & c. # # WARNING!!! There are multiple versions of ERGO 4000 microcode # Be advised that very early versions DO NOT WORK RIGHT !! # Microterm does have a ROM exchange program- use it or lose big # (ergo400: added / based on the init string -- esr) ergo4000|microterm ergo 4000:\ :da:db:ms:\ :co#80:li#66:\ :AL=\E[1L:RA=\E[?7l:SA=\E[?7m:bl=^G:cd=\E[0J:ce=\E[0K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:dc=\E[1P:dl=\E[1M:\ :do=\E[B:ei=\E[4l:im=\E[4h:\ :is=\E<\E=\E[?1l\E[?4l\E[?5l\E[?7h\E[?8h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kd=\E[B:ke=\E=:kl=\E[D:kr=\E[C:\ :ks=\E=:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:me=\E[m:\ :nd=\E[C:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:up=\E[A: #### NCR # # NCR's terminal group was merged with AT&T's when AT&T bought the company. # For what happened to that group, see the ADDS section. # # There is an NCR4103 terminal that's just a re-badged Wyse-50. # # NCR7900 DIP switches: # # Switch A: # 1-4 - Baud Rate # 5 - Parity (Odd/Even) # 6 - Don't Send or Do Send Spaces # 7 - Parity Enable # 8 - Stop Bits (One/Two) # # Switch B: # 1 - Upper/Lower Shift # 2 - Typewriter Shift # 3 - Half Duplex / Full Duplex # 4 - Light/Dark Background # 5-6 - Carriage Return Without / With Line Feed # 7 - Extended Mode # 8 - Suppress Keyboard Display # # Switch C: # 1 - End of line entry disabled/enabled # 2 - Conversational mode / (Local?) Mode # 3 - Control characters displayed / not displayed # 4 - (2-wire?) / 4-wire communications # 5 - RTS on and off for each character # 6 - (50Hz?) / 60 Hz # 7 - Exit after level zero diagnostics # 8 - RS-232 interface # # Switch D: # 1 - Reverse Channel (yes / no) # 2 - Manual answer (no / yes) # 3-4 - Cursor appearance # 5 - Communication Rate # 6 - Enable / Disable EXT turnoff # 7 - Enable / Disable CR turnoff # 8 - Enable / Disable backspace # # From , init string hacked by SCO. ncr7900i|ncr7900|ncr 7900 model 1:\ :am:bw:ul:\ :co#80:li#24:sg#1:ug#1:\ :bl=^G:cd=\Ek:ce=\EK:cl=^L:cm=\E1%r%.%.:cr=^M:do=^J:\ :is=\E0@\010\E3\E4\E7:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:le=^H:\ :ll=^A:mb=\E0B:me=\E0@:mh=\E0A:mr=\E0P:nd=^F:pf=^T:po=^R:\ :..sa=\E0%p5%'@'%+%p4%{2}%*%+%p3%{16}%*%+%p2%{32}%*%+%p1%{17}%*%+%c:\ :se=\E0@:sf=^J:so=\E0Q:ue=\E0@:up=^Z:us=\E0`: ncr7900iv|ncr 7900 model 4:\ :am:bw:es:hs:\ :co#80:li#24:\ :al=\E^N:bl=^G:cl=^L:cm=\013%+@\E\005%02:cr=^M:dl=\E^O:\ :do=^J:ds=\Ey1:fs=\Ek\Ey5:ho=\013@\E^E00:k1=\ES:k2=\ET:\ :k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:k8=\ER:kb=^H:kd=\EB:\ :kh=\EH:kl=\ED:kr=\EC:ku=\EA:l6=blue:l7=red:l8=white:le=^H:\ :nw=^M^J:sf=^J:ts=\Ej\Ex5\Ex1\EY8%p1%{32}%+%c\Eo: ncr7901|ncr 7901 model:\ :am:bw:ul:\ :co#80:li#24:\ :bl=^G:cd=\Ek:ce=\EK:ch=\020%+^J:cl=^L:cm=\EY%+ %+ :cr=^M:\ :cv=\013%+@:do=^J:is=\E4^O:kC=^L:kd=^J:kh=^H:kl=^U:kr=^F:\ :ku=^Z:le=^H:ll=^A:mb=\E0B:me=^O:mh=\E0A:mr=\E0P:nd=^F:pf=^T:\ :po=^R:\ :..sa=\E0%p5%'@'%+%p4%{2}%*%+%p3%{16}%*%+%p2%{32}%*%+%p1%{17}%*%+%c\016:\ :se=^O:sf=^J:so=\E0Q\016:ue=^O:up=^Z:us=\E0`\016:ve=^X:\ :vi=^W: #### Perkin-Elmer (Owl) # # These are official terminfo entries from within Perkin-Elmer. # bantam|pe550|pe6100|perkin elmer 550:\ :bs:\ :co#80:li#24:\ :bl=^G:ce=\EI:cl=\EK:cm=\EX%+ \EY%+ :cr=^M:do=^J:ho=\EH:\ :le=^H:ll=\EH\EA:nd=\EC:sf=^J:up=\EA: fox|pe1100|perkin elmer 1100:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EH\EJ:cm=\EX%+ \EY%+ :cr=^M:\ :ct=\E3:do=^J:ho=\EH:le=^H:ll=\EH\EA:nd=\EC:sf=^J:st=\E1:\ :up=\EA:vb=\020\002\020\003: owl|pe1200|perkin elmer 1200:\ :am:bs:in:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EI:cl=\EH\EJ:cm=\EX%+ \EY%+ :\ :cr=^M:ct=\E3:dc=\EO:dl=\EM:do=^J:ei=:ho=\EH:ic=\EN:im=:ip=:\ :k0=\ERJ:k1=\ERA:k2=\ERB:k3=\ERC:k4=\ERD:k5=\ERE:k6=\ERF:\ :k7=\ERG:k8=\ERH:k9=\ERI:kb=^H:le=^H:ll=\EH\EA:\ :me=\E\041\200:nd=\EC:se=\E\041\200:sf=^J:so=\E\041^H:\ :st=\E1:up=\EA:vb=\020\002\020\003: pe1251|pe6300|pe6312|perkin elmer 1251:\ :am:\ :co#80:it#8:li#24:pb#300:sg#1:vt#8:\ :bl=^G:cd=\EJ:ce=\EI:cl=\EK:cm=\EX%+ \EY%+ :cr=^M:ct=\E3:\ :do=\EB:ho=\EH:k0=\ERA:k1=\ERB:k2=\ERC:k3=\ERD:k4=\ERE:\ :k5=\ERF:k6=\ERG:k7=\ERH:k8=\ERI:k9=\ERJ:k;=\ERK:le=\ED:\ :nd=\EC:sf=^J:st=\E1:up=\EA: # (pe7000m: this had # rmul=\E!\0, smul=\E!\040, # which is probably wrong, it collides with kf0 pe7000m|perkin elmer 7000 series monochrome monitor:\ :am:\ :co#80:li#24:\ :bl=^G:bt=\E\041Y:cd=\EJ:ce=\EI:cl=\EK:cm=\ES%+ %+ :cr=^M:\ :do=\EB:ho=\EH:i1=\E\041\200\EW 7o\Egf\ES7 :\ :k0=\E\041\200:k1=\E\041^A:k2=\E\041^B:k3=\E\041^C:\ :k4=\E\041^D:k5=\E\041^E:k6=\E\041^F:k7=\E\041^G:\ :k8=\E\041^H:k9=\E\041^I:k;=\E\041^J:kb=^H:kd=\E\041U:\ :kh=\E\041S:kl=\E\041V:kr=\E\041W:ku=\E\041T:le=\ED:\ :ll=\ES7 :nd=\EC:sf=^J:sr=\ER:up=\EA: pe7000c|perkin elmer 7000 series colour monitor:\ :i1=\E\041\200\EW 7o\Egf\Eb0\Ec7\ES7 :se=\Eb0:so=\Eb2:\ :ue=\E\041\200:us=\E\041 :\ :tc=pe7000m: #### Sperry Univac # # Sperry Univac has merged with Burroughs to form Unisys. # # This entry is for the Sperry UTS30 terminal running the TTY # utility under control of CP/M Plus 1R1. The functionality # provided is comparable to the DEC vt100. # (uts30: I added / based on the init string -- esr) uts30|sperry uts30 with cp/m@1R1:\ :am:bw:hs:\ :co#80:li#24:ws#40:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7m:SF=\E[%dB:\ :SR=\E[%dA:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\Ed:al=\EN:as=\EF:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:cs=\EU%+ %+ :dc=\EM:dl=\EL:do=\EB:\ :ei=:fs=^M:ho=\E[H:ic=\EO:im=:is=\E[U 7\E[24;1H:kb=^H:\ :kd=\EOB:kh=\E[H:kl=\EOD:kr=\EOC:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\EC:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\EX:\ :rf=/usr/share/tabset/vt100:sc=\EW:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EI:ta=^I:ts=\E]:uc=\EPB:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\ES:vi=\ER: #### Tandem # # Tandem builds these things for use with its line of fault-tolerant # transaction-processing computers. They aren't generally available # on the merchant market, and so are fairly uncommon. # tandem6510|adm3a repackaged by Tandem:\ :tc=adm3a: # A funny series of terminal that TANDEM uses. The actual model numbers # have a fourth digit after 653 that designates minor variants. These are # natively block-mode and rather ugly, but they have a character mode which # this doubtless(?) exploits. There is a 6520 that is slightly dumber. # (tandem653: had ":sb=\ES:", probably someone's mistake for sf; also, # removed :if=/usr/share/tabset/tandem653:, no such file -- esr) tandem653|t653x|Tandem 653x multipage terminal:\ :am:bs:da:db:hs:\ :co#80:li#24:sg#1:ug#1:ws#64:\ :cd=\EJ:ce=\EK:cl=\EI:cm=\023%+ %+ :do=^J:ds=\Eo\r:fs=^M:\ :ho=\EH:le=^H:me=\E6 :nd=\EC:se=\E6 :sf=\ES:so=\E6$:sr=\ET:\ :ts=\Eo:ue=\E6 :up=\EA:us=\E60: #### Tandy/Radio Shack # # Tandy has a line of VDTs distinct from its microcomputers. # dmterm|deskmate terminal:\ :am:bw:\ :co#80:li#24:\ :al=\EP:bl=^G:cd=\EJ:ce=\EK:cl=\Ej:cm=\EY%+ %+ :cr=^M:\ :dc=\ES:dl=\ER:do=\EB:ei=:ho=\EH:ic=\EQ:im=:k0=\E1:k1=\E2:\ :k2=\E3:k3=\E4:k4=\E5:k5=\E6:k6=\E7:k7=\E8:k8=\E9:k9=\E0:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:l0=f1:l1=f2:l2=f3:l3=f4:\ :l4=f5:l5=f6:l6=f7:l7=f8:l8=f9:l9=f10:le=^H:ll=\EE:mk@:nd=\EC:\ :sf=\EX:ta=^I:ue@:up=\EA:us@:ve=\EG6:vi=\EG5:\ :tc=adm+sgr: dt100|dt-100|Tandy DT-100 terminal:\ :xo:\ :co#80:li#24:sg#1:ug#1:\ :ac=kkllmmjjnnwwvvttuuqqxx:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\010\E[%i%d;%dH:cr=^M:\ :cs=\E[%2;%2r:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:\ :im=:is=\E[?3l\E(B:k1=\E[?3i:k2=\E[2i:k3=\E[@:k4=\E[M:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[?5i:kN=\E[29~:kP=\E[28~:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:l1=f1:l2=f2:l3=f3:l4=f4:l5=f5:l6=f6:l7=f7:\ :l8=f8:le=^H:me=\E[m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:sr=\EM:\ :ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: dt100w|dt-100w|Tandy DT-100 terminal (wide mode):\ :co#132:tc=dt100: dt110|Tandy DT-110 emulating ansi:\ :xo:\ :co#80:li#24:\ :@7=\E[K:ac=kkllmmjjnnwwvvuuttqqxx:ae=\E(B:al=\E[0L:as=\E(0:\ :bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:cm=\010\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[0P:dl=\E[0M:do=\E[0B:\ :eA=\E(B:ei=:ho=\E[H:ic=\E[0@:im=:is=\E[?3l\E(B:\ :k1=\E[1~:k2=\E[2~:k3=\E[3~:k4=\E[4~:k5=\E[5~:k6=\E[6~:\ :k7=\E[7~:k8=\E[8~:k9=\E[9~:k;=\E[10~:kI=\E[@:kN=\E[26~:\ :kP=\E[25~:kd=\E[B:kh=\E[G:kl=\E[D:kr=\E[C:ku=\E[A:l0=f1:\ :l1=f2:l2=f3:l3=f4:l4=f5:l5=f6:l6=f7:l7=f8:l8=f9:l9=f10:le=^H:\ :me=\E[m:nd=\E[C:se=\E[m:sf=^J:so=\E[7m:sr=\EM:ta=^I:\ :ue=\E[m:up=\E[0A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: pt210|TRS-80 PT-210 printing terminal:\ :hc:os:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: #### Tektronix (tek) # # Tektronix tubes are graphics terminals. Most of them use modified # oscilloscope technology incorporating a long-persistence green phosphor, # and support vector graphics on a main screen with an attached "dialogue # area" for interactive text. # tek|tek4012|tektronix 4012:\ :bs:os:\ :co#75:li#35:\ :bl=^G:cl=\E\014:cr=^M:do=^J:ff=\014:is=\E^O:le=^H: # (tek4013: added to suppress tic warnings re :as:/:ae: --esr) tek4013|tektronix 4013:\ :ac=:ae=\E^O:as=\E^N:tc=tek4012: tek4014|tektronix 4014:\ :co#81:li#38:\ :is=\E\017\E9:tc=tek4012: # (tek4015: added to suppress tic warnings re :as:/:ae: --esr) tek4015|tektronix 4015:\ :ac=:ae=\E^O:as=\E^N:tc=tek4014: tek4014-sm|tektronix 4014 in small font:\ :co#121:li#58:\ :is=\E\017\E\072:tc=tek4014: # (tek4015-sm: added to suppress tic warnings re :as:/:ae: --esr) tek4015-sm|tektronix 4015 in small font:\ :ac=:ae=\E^O:as=\E^N:tc=tek4014-sm: # Tektronix 4023 from Andrew Klossner # # You need to have "stty nl2" in effect. Some versions of tset(1) know # how to set it for you. # # It's got the Magic Cookie problem around stand-out mode. If you can't # live with Magic Cookie, remove the :so: and :se: fields and do without # reverse video. If you like reverse video stand-out mode but don't want # it to flash, change the letter 'H' to 'P' in the :so: field. tek4023|tektronix 4023:\ :am:bs:\ :co#80:dN#4:li#24:sg#1:vt#4:\ :bl=^G:cl=4\E\014:cm=\034%r%+ %+ :cr=^M:do=^J:kb=^H:le=^H:\ :nd=^I:nl=^J:se=^_@:so=^_P: # It is recommended that you run the 4025 at 4800 baud or less; # various bugs in the terminal appear at 9600. It wedges at the # bottom of memory (try "cat /usr/dict/words"); ^S and ^Q typed # on keyboard don't work. You have to hit BREAK twice to get # one break at any speed - this is a documented feature. # Can't use cursor motion because it's memory relative, and # because it only works in the workspace, not the monitor. # Same for home. Likewise, standout only works in the workspace. # # :ce: was commented out since vi and rogue seem to work better # simulating it with lots of spaces! # # :al: and :AL: had 145ms of padding, but that slowed down vi's ^U # and didn't seem necessary. # tek4024|tek4025|tek4027|tektronix 4024/4025/4027:\ :am:bs:da:db:\ :co#80:it#8:li#34:lm#0:\ :AL=\037up\r\037ili %d\r:CC=^_:DL=\037dli %d\r\006:\ :DO=\037dow %d\r:LE=\037lef %d\r:RI=\037rig %d\r:\ :UP=\037up %d\r:al=\037up\r\037ili\r:bl=^G:\ :cd=\037dli 50\r:cl=\037era\r\n\n:cr=^M:dc=\037dch\r:\ :dl=\037dli\r\006:do=^F^J:ei=:ic=\037ich\r \010:im=:\ :is=\041com 31\r\n\037sto 9 17 25 33 41 49 57 65 73\r:\ :ke=\037lea p2\r\037lea p4\r\037lea p6\r\037lea p8\r\037lea f5\r:\ :ks=\037lea p4 /h/\r\037lea p8 /k/\r\037lea p6 / /\r\037lea p2 /j/\r\037lea f5 /H/\r:\ :le=^H:nd=\037rig\r:sf=^F^J:ta=^I:up=^K: tek4025-17|tek 4025 17 line window:\ :li#17:tc=tek4025: tek4025-17-ws|tek 4025 17 line window in workspace:\ :is=\041com 31\r\n\037sto 9 17 25 33 41 49 57 65 73\r\037wor 17\r\037mon 17\r:\ :se=\037att s\r:so=\037att e\r:te=\037mon h\r:\ :ti=\037wor h\r:\ :tc=tek4025-17: tek4025-ex|tek4027-ex|tek 4025/4027 w/!:\ :is=\037com 33\r\n\041sto 9 17 25 33 41 49 57 65 73\r:\ :te=\037com 33\r:ti=\041com 31\r:\ :tc=tek4025: # Tektronix 4025a # From: Doug Gwyn # The following status modes are assumed for normal operation (replace the # initial "!" by whatever the current command character is): # !COM 29 # NOTE: changes command character to GS (^]) # ^]DUP # ^]ECH R # ^]EOL # ^]RSS T # ^]SNO N # ^]STO 9 17 25 33 41 49 57 65 73 # Other modes may be set according to communication requirements. # If the command character is inadvertently changed, termcap can't restore it. # Insert-character cannot be made to work on both top and bottom rows. # Clear-to-end-of-display emulation via !DLI 988 is too grotty to use, alas. # There also seems to be a problem with vertical motion, perhaps involving # delete/insert-line, following a typed carriage return. This terminal sucks. # Delays not specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # (tek4025a: removed obsolete ":xx:". This may mean the tek4025a entry won't # work any more. -- esr) tek4025a|Tektronix 4025A:\ :am:bs:bw:da:db:pt:xo:\ :co#80:it#8:li#34:\ :CC=^]:DC=\035dch %d;:DL=\035dli %d;:DO=\035dow %d;:\ :LE=\035lef %d;:RI=\035rig %d;:SF=\035dow %d;:\ :UP=\035up %d;:al=\013\035ili;:bl=^G:bt=\035bac;:\ :ce=\035dch 80;:ch=\r\035rig %d;:cl=\035era;\n\035rup;:\ :cr=^M:ct=\035sto;:dc=\035dch;:dl=\035dli;:do=^J:le=^H:\ :nd=\035rig;:\ :rs=\041com 29\035del 0\035rss t\035buf\035buf n\035cle\035dis\035dup\035ech r\035eol\035era g\035for n\035pad 203\035pad 209\035sno n\035sto 9 17 25 33 41 49 57 65 73\035wor 0;:\ :sf=^J:ta=^I:up=^K: # From: cbosg!teklabs!davem Wed Sep 16 21:11:41 1981 # Here's the command file that I use to get rogue to work on the 4025. # It should work with any program using the old curses (e.g. it better # not try to scroll, or cursor addressing won't work. Also, you can't # see the cursor.) # (This "learns" the arrow keys for rogue. I have adapted it for termcap - mrh) tek4025-cr|tek 4025 for curses and rogue:\ :am:bs:\ :co#80:it#8:li#33:\ :cl=\037era;:cm=\037jum%i%d\054%d;:do=^F^J:\ :is=\041com 31\r\n\037sto 9 17 25 33 41 49 57 65 73\r:\ :le=^H:nd=\037rig;:sf=^F^J:ta=^I:te=\037wor 0:\ :ti=\037wor 33h:up=^K: # next two lines commented out since curses only allows 128 chars, sigh. # :ti=\037lea p1/b/\037lea p2/j/\037lea p3/n/\037lea p4/h/\037lea p5/ /\037lea p6/l/\037lea p7/y/\037lea p8/k/\037lea p9/u/\037lea p./f/\037lea pt/`era w/13\037lea p0/s/\037wor 33h:\ # :te=\037lea p1\037lea p2\037lea p3\037lea p4\037lea pt\037lea p5\037lea p6\037lea p7\037lea p8\037lea p9/la/13\037lea p.\037lea p0\037wor 0: tek4025ex|4025ex|4027ex|tek 4025 w/!:\ :is=\037com 33\r\n\041sto 9\05417\05425\05433\05441\05449\05457\05465\05473\r:\ :te=\037com 33\r:ti=\041com 31\r:\ :tc=tek4025: tek4105|tektronix 4105:\ :am:bs:mi:ms:ul:xn:xt:\ :co#79:it#8:li#29:\ :ac=:ae=\E[m:al=\E[1L:as=\E[1m:bl=^G:bt=\E[Z:cd=\E[J:\ :ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%2;%2H:cr=^M:ct=\E[1g:\ :dc=\E[1P:dl=\E[1M:do=\E[1B:ei=\E[4l:ho=\E[H:i1=\E%!1\E[m:\ :im=\E[4h:is=\E%!1\E[?6141\E[m:kb=^H:kd=\E[1B:kl=\E[1D:\ :kr=\E[1C:ku=\E[1A:mb=\E[=3;<7m:md=\E[=7;<4m:\ :me=\E[=0;<1m:mh=\E[=1;<6m:mk=\E[=6;<5:mr=\E[=1;<3m:\ :nd=\E[1C:se=\E[=0;<1m:sf=\E[S:so=\E[=2;<3m:sr=\E[T:ta=^I:\ :te=:ti=\E%!1\E[?6l\E[2J:ue=\E[=0;<1m:up=\E[1A:\ :us=\E[=5;<2m: # (tek4105-30: I added / based on the init string -- esr) tek4105-30|4015 emulating 30 line vt100:\ :am:mi:ms:xn:xo:\ :co#80:it#8:li#30:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[1;7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # Tektronix 4105 from BRL # The following setup modes are assumed for normal operation: # CODE ansi CRLF no DABUFFER 141 # DAENABLE yes DALINES 30 DAMODE replace # DAVISIBILITY yes ECHO no EDITMARGINS 1 30 # FLAGGING input INSERTREPLACE replace LFCR no # ORIGINMODE relative PROMPTMODE no SELECTCHARSET G0 B # SELECTCHARSET G1 0 TABS -2 # Other setup modes may be set for operator convenience or communication # requirements; I recommend # ACURSOR 1 0 AUTOREPEAT yes AUTOWRAP yes # BYPASSCANCEL CURSORKEYMODE no DAINDEX 1 0 0 # EOFSTRING '' EOLSTRING EOMCHARS # GAMODE overstrike GCURSOR 0 100 0 GSPEED 10 1 # IGNOREDEL no KEYEXCHAR

NVDEFINE -53 "" # PROMPTSTRING '' QUEUESIZE 2460 WINDOW 0 0 4095 3132 # XMTDELAY 0 # and factory color maps. After setting these modes, save them with NVSAVE. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # "IC" cannot be used in combination with "im" & "ei". # "tek4105a" is just a guess: tek4105a|Tektronix 4105:\ :bs:ms:pt:xo:\ :co#80:it#8:kn#8:li#30:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ac=:ae=^O:al=\E[L:\ :as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ec=\E[%dX:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E%!1:k0=\EOA:k1=\EOB:k2=\EOC:k3=\EOD:k4=\EOP:k5=\EOQ:\ :k6=\EOR:k7=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:\ :l5=F6:l6=F8:le=^H:ll=\E[30;H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :rs=\030\E%!0\EKC\E\014\EKR0\EKF0\ENM0\ELBH=\ETF8000010F40\ELI100\ELLA>\ELM0\EKE0\ENF1\EKS0\END0\E%!1\Ec\E[?3;5l\E[?7;8h\E[r\E[m\E>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :te=\E%!0\ELBH=\E%!1:ti=\E[?6l:ue=\E[m:up=\EM:us=\E[4m:\ :ve=\E%!0\ETD10\E%!1:vi=\E%!0\ETD00\E%!1:\ :vs=\E%!0\ETD70\E%!1: # # Tektronix 4106/4107/4109 from BRL # The following setup modes are assumed for normal operation: # CODE ansi COLUMNMODE 80 CRLF no # DABUFFER 141 DAENABLE yes DALINES 32 # DAMODE replace DAVISIBILITY yes ECHO no # EDITMARGINS 1 32 FLAGGING input INSERTREPLACE replace # LFCR no LOCKKEYBOARD no ORIGINMODE relative # PROMPTMODE no SELECTCHARSET G0 B SELECTCHARSET G1 0 # TABS -2 # Other setup modes may be set for operator convenience or communication # requirements; I recommend # ACURSOR 1 0 AUTOREPEAT yes AUTOWRAP yes # BYPASSCANCEL CURSORKEYMODE no DAINDEX 1 0 0 # EOFSTRING '' EOLSTRING EOMCHARS # GAMODE overstrike GCURSOR 0 100 0 GSPEED 9 3 # IGNOREDEL no KEYEXCHAR
NVDEFINE -53 "" # PROMPTSTRING '' QUEUESIZE 2620 WINDOW 0 0 4095 3132 # XMTDELAY 0 # and factory color maps. After setting these modes, save them with NVSAVE. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! # "IC" cannot be used in combination with "im" & "ei". tek4106brl|tek4107brl|tek4109brl|Tektronix 4106, 4107, or 4109:\ :ms:xo:\ :co#80:it#8:li#32:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ac=:ae=^O:al=\E[L:\ :as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ec=\E[%dX:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E%!1:k0=\EOA:k1=\EOB:k2=\EOC:k3=\EOD:k4=\EOP:k5=\EOQ:\ :k6=\EOR:k7=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:\ :l5=F6:l6=F8:le=^H:ll=\E[32;H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\030\E%!0\EKC\E\014\EKR0\EKF0\ENM0\ELBH=\ETF8000010F40\ELI100\ELLB0\ELM0\EKE0\ENF1\EKS0\END0\ERE0\E%!1\Ec\E[?3;5l\E[?7;8h\E[r\E[m\E>:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7;42m:sr=\EM:st=\EH:\ :ta=^I:te=\E%!0\ELBH=\E%!1:ti=\E[?6l:ue=\E[m:up=\EM:\ :us=\E[4m:ve=\E%!0\ETD10\E%!1:vi=\E%!0\ETD00\E%!1:\ :vs=\E%!0\ETD70\E%!1: tek4107|tek4109|tektronix terminals 4107 4109:\ :am:bs:mi:ms:ul:xn:xt:\ :co#79:it#8:li#29:\ :bl=^G:cd=\EJ:ce=\EK:cl=\ELZ:cm=\EY%+ %+ :cr=^M:do=^J:kb=^H:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:mb=\E%!1\E[5m\E%!0:\ :md=\E%!1\E[1m\E%!0:me=\E%!1\E[m\E%!0:\ :mh=\E%!1\E[<0m\E%!0:mr=\E%!1\E[7m\E%0:nd=\EC:\ :..sa=\E%%\0411\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m\E%%\0410:\ :se=\E%!1\E[m\E%!0:sf=^J:so=\E%!1\E[7;5m\E%!0:sr=\EI:\ :ta=^I:ue=\E%!1\E[m\E%!0:up=\EA:us=\E%!1\E[4m\E%!0:\ :ve=\E%!0:vs=\E%!3: # Tektronix 4207 with sysline. In the ancestral termcap file this was 4107-s; # see the note attached to tek4207. tek4207-s|Tektronix 4207 with sysline but no memory:\ :es:hs:\ :ds=\E7\E[?6l\E[2K\E[?6h\E8:fs=\E[?6h\E8:\ :i1=\E%!1\E[2;32r\E[132D\E[2g\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[J:\ :is=\E7\E[?6l\E[2K\E[?6h\E8:\ :ts=\E7\E[?6l\E[2K\E[;%i%df:tc=tek4107: # The 4110 series may be a wonderful graphics series, but they make the 4025 # look good for screen editing. In the dialog area, you can't move the cursor # off the bottom line. Out of the dialog area, ^K moves it up, but there # is no way to scroll. # # Note that there is a floppy for free from Tek that makes the # 4112 emulate the vt52 (use the vt52 termcap). There is also # an expected enhancement that will use ANSI standard sequences. # # 4112 in non-dialog area pretending to scroll. It really wraps # but vi is said to work (more or less) in this mode. # # 'vi' works reasonably well with this entry. # otek4112|o4112-nd|otek4113|otek4114|old tektronix 4110 series:\ :am:\ :co#80:li#34:\ :bl=^G:cl=\E^L:cr=^M:do=^J:le=^H:sf=^J:te=\EKA1\ELV1:\ :ti=\EKA0\ELV0\EMG0:up=^K: # The 4112 with the ANSI compatibility enhancement tek4112|tek4114|tektronix 4110 series:\ :am:bs:db:\ :co#80:li#34:\ :al=\E[L:bt=\E[Z:cd=\E[0J:ce=\E[0K:cl=\E[2J\E[0;0H:\ :cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=:ic=\E[@:im=:\ :is=\E3\0411:le=^H:me=\E[m:nd=\E[C:se=\E[m:\ :sf=\E7\E[0;0H\E[M\E8:so=\E[7m:sr=\E7\E[0;0H\E[L\E8:\ :ue=\E[m:up=\EM:us=\E[4m: tek4112-nd|4112 not in dialog area:\ :ns:\ :up=^K:tc=tek4112: tek4112-5|4112 in 5 line dialog area:\ :li#5:tc=tek4112: # (tek4113: this used to have ":nd=\LM1\s\LM0:", someone's mistake; # removed ":as=\E^N:, :ae=\E^O:", which had been commented out in 8.3. # Note, the !0 and !1 sequences in :te:/:ti:/:ve:/:vi: were # previously \0410 and \0411 sequences...I don't *think* they were supposed # to be 4-digit octal -- esr) tek4113|tektronix 4113 color graphics with 5 line dialog area:\ :am:bs:da:eo:\ :co#80:li#5:\ :cl=\ELZ:do=^J:is=\EKA1\ELL5\ELV0\ELV1:le=^H:\ :nd=\ELM1 \ELM0:uc=\010\ELM1_\ELM0:\ :vb=\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERB0: tek4113-34|tektronix 4113 color graphics with 34 line dialog area:\ :li#34:\ :is=\EKA1\ELLB2\ELV0\ELV1:tc=tek4113: # :ns: left off to allow vi visual mode. APL font (:as=\E^N:/:ae=\E^O:) not # supported here. :uc: is slow, but looks nice. Suggest setenv MORE -up . # :vb: needs enough delay to let you see the background color being toggled. tek4113-nd|tektronix 4113 color graphics with no dialog area:\ :am:bs:eo:\ :co#80:it#8:li#34:\ :cl=\E^L:do=^J:ho=\ELF7l\177 @:is=\ELZ\EKA0\ELF7l\177 @:\ :le=^H:ll=\ELF hl @:nd=^I:se=\EMT1:so=\EMT2:ta=^I:\ :uc=\010\EMG1_\EMG0:up=^K:\ :vb=\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERB0:\ :vs=\ELZ\EKA0: # This entry is from Tek. Inc. (Brian Biehl) # (tek4115: :bc: renamed to :le:, / added based on init string -- esr) otek4115|Tektronix 4115:\ :am:bs:da:db:eo:\ :co#80:it#8:li#34:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E%!0\E%\014\ELV0\EKA1\ELBB2\ENU@=\ELLB2\ELM0\ELV1\EKYA?\E%!1\E[<1l\E[?7h\E[?8h\E[34;1H\E[34B\E[m:\ :kb=^H:ke=\E>:ks=\E=:le=\E[D:me=\E[m:nd=\E[C:se=\E[m:\ :so=\E[7m:sr=\EM:ta=^I:te=\E%!0\ELBG8\E%!1\E[34;1H\E[J:\ :ti=\E%!0\ELBB2\E%!1:ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E%!0\ELBG8\E%!1\E[34;1H:vs=\E%!0\ELBB2\E%!1: tek4115|newer tektronix 4115 entry with more ANSI capabilities:\ :am:xo:\ :co#80:li#34:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:\ :RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:al=\E[L:bl=^G:\ :bt=\E[Z:cd=\E[J:ce=\E[K:ch=\E[%+^AG:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:ct=\E[2g:cv=\E[%+^Ad:dc=\E[P:\ :dl=\E[M:do=^J:ei=:ho=\E[H:ic=\E[@:im=:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mk=\E[8m:mr=\E[7m:nd=\E[C:..rp=%p1%c\E[%p2%{1}%-%db:\ :..sa=\E[%?%p1%t7;%;%?%p2%t4;%;%?%p3%t7;%;%?%p4%t5;%;%?%p6%t1;%;m:\ :se=\E[m:sf=^J:so=\E[7m:st=\EH:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m: # The tek4125 emulates a vt100 incorrectly - the scrolling region # command is ignored. The following entry replaces :cs: with the needed # :AL:, :AL:, and :im:; removes some cursor pad commands that the tek4125 # chokes on; and adds a lot of initialization for the tek dialog area. # Note that this entry uses all 34 lines and sets the cursor color to green. # Steve Jacobson 8/85 # (tek4125: there were two "\!"s in the is that I replaced with "\E!"; # commented out, :im:=\E1 because there's no :ei: -- esr) tek4125|tektronix 4125:\ :li#34:\ :al=\E[1L:cs@:dl=\E[1M:\ :is=\E%\E\0410\EQD1\EUX03\EKA\ELBB2\ELCE0\ELI100\ELJ2\ELLB2\ELM0\ELS1\ELX00\ELV1\E%\E\0411\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :ks=\E=:rc@:sc@:\ :tc=vt100: # From: # (tek4207: This was the termcap file's entry for the 4107/4207, but SCO # supplied another, less capable 4107 entry. So we'll use that for 4107 and # note that if jcoker wasn't confused you may be able to use this one. # I merged in :ms:,:sf:,:sr:,,:ct: from a BRL entry -- esr) tek4207|Tektronix 4207 graphics terminal with memory:\ :am:bw:mi:ms:ul:xn:\ :co#80:it#8:li#32:\ :al=3\E[L:bt=\E[Z:cd=\E[J:ce=5\E[K:cl=156\E[H\E[J:\ :cm=\E[%i%d;%dH:ct=\E[1g:dc=4\E[P:dl=3\E[M:do=^J:ei=:\ :ho=\E[H:ic=4\E[@:im=:\ :is=\E%!0\ELBP0\E%!1\E[H\E[2g\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[J:\ :kd=\ED:kh=\E[H:kl=\E[D:kr=\E[C:ku=\EM:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mk=\E[=6;<5:mr=\E[7m:nd=\E[C:se=\E[m:\ :sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:\ :te=\E[?6h\E%!0\ELBP0\E%!1\E[32;1f:ti=\E[?6l\E[H\E[J:\ :ue=\E[m:up=\EM:us=\E[4m: # From: Thu Oct 31 12:54:27 1985 # (tek4404: There was a "\!" in :ti: that I replaced with "\E!". # Tab had been given as \E2I,that must be the tab-set capability -- esr) tek4404|tektronix 4404:\ :bs:\ :co#80:it#8:li#32:\ :al=\E[1L:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[1M:do=^J:ei=\E[4l:ho=\E[H:\ :im=\E[4h:kd=\E[B:ke=\E[?1h:kl=\E[D:kr=\E[C:ks=\E[?1l:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:nd=\E[C:rc=\E8:\ :sc=\E7:se=\E[27m:so=\E[7m:st=\E[2I:ta=^I:\ :te=\E[1;1H\E[0J\E[?6h\E[?1l:\ :ti=\E%\E\0411\E[1;32r\E[?6l\E>:ue=\E[m:up=\E[A:\ :us=\E[4m: # Some unknown person wrote: # I added the is string - straight Unix has ESC ; in the login # string which sets a ct8500 into monitor mode (aka 4025 snoopy # mode). The is string here cleans up a few things (but not # everything). ct8500|tektronix ct8500:\ :am:bw:da:db:\ :co#80:li#25:\ :al=\E^L:bl=^G:bt=\E^I:cd=\E^U:ce=\E^T:cl=\E^E:\ :cm=\E|%+ %+ :cr=^M:dc=\E^]:dl=\E^M:do=^J:ei=:ic=\E^\:im=:\ :is=\037\EZ\Ek:le=^H:me=\E :nd=\ES:se=\E :sf=^J:so=\E$:\ :sr=\E^A:ta=^I:ue=\E :up=\ER:us=\E\041: # Tektronix 4205 terminal. # # am is not defined because the wrap around occurs not when the char. # is placed in the 80'th column, but when we are attempting to type # the 81'st character on the line. (esr: hmm, this is like the vt100 # version of xenl, perhaps am + xenl would work!) # # Bold, dim, and standout are simulated by colors and thus not allowed # with colors. The tektronix color table is mapped into the RGB color # table by setf/setb. All colors are reset to factory specifications by oc. # The cap uses RGB notation to define colors. for arguments 1-3 the # interval (0-1000) is broken into 8 smaller sub-intervals (125). Each sub- # interval then maps into pre-defined value. # (untranslatable capabilities removed to fit entry within 1023 bytes) tek4205|tektronix 4205:\ :cc:mi:ms:\ :Co#8:NC#49:co#80:it#8:li#30:pa#63:\ :AL=\E[%dL:DO=\E[%dB:IC=\E[%d@:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[1L:as=\E(0:bl=^G:bt=\E[Z:cb=\E[1K:cd=\E[J:\ :ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:ct=\E[1g:\ :dc=\E[1P:dl=\E[1M:do=\E[B:eA=\E(B:ec=\E%dX:ei=\E[4l:\ :ho=\E[H:i1=\E%!0\ETM1\E%!1\E[m:im=\E[4h:k0=\EOA:k1=\EOB:\ :k2=\EOC:k3=\EOD:k4=\EP:k5=\EQ:k6=\ER:k7=\ES:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:md=\E[=7;<4m:\ :me=\E[=0;<1m\E[24;25;27m\017:mh=\E[=1;<6m:mk=\E[=6;<5:\ :mr=\E[7m:nd=\E[C:\ :oc=\E%!0\n\ETFB0\n0000\n1F4F4F4\n2F400\n30F40\n4A4C because of a bug in old vi (if stty says you have # a "newline" style terminal (-crmode) vi figures all it needs is nl # to get crlf, even if :cr: is not ^M.) # (tty40: removed obsolete ":nl=\EG\EB:", it's just do+cr -- esr) tty40|ds40|ds40-2|dataspeed40|teletype dataspeed 40/2:\ :bs:xo:\ :co#80:li#24:\ :al=\EL:cd=\EJ:cl=\EH\EJ:cr=\EG:ct=\EH\E2:dc=\EP:dl=\EM:\ :do=\EB:ei=:ho=\EH:ic=\E\136:im=:kb=^]:kl=^H:le=^H:nd=\EC:\ :pf=^T:po=\022:r2=\023\ER:se=\E4:sf=\ES:so=\E3:sr=\ET:\ :st=\E1:ta=\E@:up=\E7: tty43|model 43 teletype:\ :am:bs:hc:os:xo:\ :co#132:\ :bl=^G:cr=^M:do=^J:kb=^H:le=^H:sf=^J: #### Tymshare # # You can add :is=\E<: to put this 40-column mode, though I can't # for the life of me think why anyone would want to. scanset|sc410|sc415|Tymshare Scan Set:\ :am:bw:ms:\ :co#80:li#24:\ :ac=l:\ :rc=^C:sc=^B:sf=^J:up=^K: #### Volker-Craig (vc) # # If you saw a Byte Magazine cover with a terminal on it during the early # 1980s, it was probably one of these. Carl Helmers liked them because # they could crank 19.2 and were cheap (that is, until he tried to program # one...) # # Missing in vc303a and vc303 descriptions: they scroll 2 lines at a time # every other linefeed. vc303|vc103|vc203|volker-craig 303:\ :am:bs:ns:\ :co#80:li#24:\ :bl=^G:cl=\014:cr=^M:do=^J:ho=\013:kd=^J:kl=^H:kr=^I:ku=^N:\ :le=^H:ll=\017W:nd=^I:up=^N: vc303a|vc403a|volker-craig 303a:\ :ce=\026:cl=\030:ho=\031:kr=^U:ku=^Z:ll=^P:nd=^U:up=^Z:tc=vc303: # (vc404: removed obsolete ":ma=^Z^P^U :" -- esr) vc404|volker-craig 404:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cd=\027:ce=\026:cl=\030:cm=\020%+ %+ :cr=^M:do=^J:\ :ho=\031:kd=^J:kl=^H:kr=^U:ku=^Z:le=^H:nd=^U:sf=^J:up=^Z: vc404-s|volker-craig 404 w/standout mode:\ :do=^J:se=^O:so=^N:tc=vc404: # From: # (vc414: merged in cup/dl1/home from an old vc414h-noxon) vc414|vc414h|Volker-Craig 414H in sane escape mode.:\ :am:bs:\ :co#80:li#24:\ :al=\E\032:cd=\E^X:ce=10\E\017:cl=\E\034:cm=\E\021%r%.%.:\ :dc=\E3:dl=\E\023:do=\E^K:ei=:ho=\E^R:ic=\E\072:im=:k0=\EA:\ :k1=\EB:k2=\EC:k3=\ED:k4=\EE:k5=\EF:k6=\EG:k7=\EH:kd=\E^K:\ :kh=\E^R:kl=^H:kr=^P:ku=\E^L:l0=PF1:l1=PF2:l2=PF3:l3=PF4:\ :l4=PF5:l5=PF6:l6=PF7:l7=PF8:nd=^P:se=\E^_:so=\E^Y:up=\E^L: vc415|volker-craig 415:\ :cl=^L:tc=vc404: ######## OBSOLETE PERSONAL-MICRO CONSOLES AND EMULATIONS # #### IBM PC and clones # # The pcplot IBM-PC terminal emulation program is really messed up. It is # supposed to emulate a vt-100, but emulates the wraparound bug incorrectly, # doesn't support scrolling regions, ignores add line commands, and ignores # delete line commands. Consequently, the resulting behavior looks like a # crude adm3a-type terminal. # Steve Jacobson 8/85 pcplot|pc-plot terminal emulation program:\ :xn@:\ :AL@:DL@:al@:cs@:dl@:rc@:sc@:tc=vt100: # KayPro II from Richard G Turner # I've found that my KayPro II, running MDM730, continues to emulate an # ADM-3A terminal, just like I was running TERM.COM. On our 4.2 UNIX # system the following termcap entry works well: # I have noticed a couple of minor glitches, but nothing I can't work # around. (I added two capabilities from the BRL entry -- esr) kaypro|kaypro2|kaypro II:\ :am:bs:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=^W:ce=^X:cl=1\032:cm=\E=%+ %+ :cr=^M:\ :dl=\ER:do=^J:ho=^^:kd=^J:kr=^L:ku=^K:nd=^L:sf=^J:up=^K: # From IBM, Thu May 5 19:35:27 1983 # (ibmpc: commented out :im:=\200R because we don't know :ei: -- esr) ibmpc|ibm-pc|ibm5051|5051|IBM Personal Computer (no ANSI.SYS):\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=^L^K:cr=^M^^:do=^J:ho=^K:kd=^_:le=^]:nd=^\:sf=\n:\ :up=^^: #### Apple II # # Apple II firmware console first, then various 80-column cards and # terminal emulators. For two cents I'd toss all these in the UFO file # along with the 40-column apple entries. # # From: brsmith@umn-cs.cs.umn.edu (Brian R. Smith) via BRL # 'it#8' tells UNIX that you have tabs every 8 columns. This is a # function of TIC, not the firmware. # The clear key on a IIgs will do something like clear-screen, # depending on what you're in. appleIIgs|appleIIe|appleIIc|Apple 80 column firmware interface:\ :am:bs:bw:eo:ms:\ :co#80:it#8:li#24:\ :bl=^G:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :cr=^M:do=^J:ho=^Y:\ :kC=^X:kD=\177:kb=^H:kd=^J:kl=^H:kr=^U:ku=^K:le=^H:nd=^\:\ :nw=^M^W:se=^N:sf=^W:so=^O:sr=^V:ta=^I:up=^_: # Apple //e with 80-column card, entry from BRL # The modem interface is permitted to discard LF (maybe DC1), otherwise # passing characters to the 80-column firmware via COUT (PR#3 assumed). # Auto-wrap does not work right due to newline scrolling delay, which also # requires that you set "stty cr2". # Note: Cursor addressing is only available via the Pascal V1.1 entry, # not via the BASIC PR#3 hook. All this nonsense can be avoided only by # using a terminal emulation program instead of the built-in firmware. apple2e|Apple //e:\ :bw:ms:\ :co#80:li#24:\ :bl=^G:cd=4*\013:ce=4\035:cl=100\014:do=^J:ho=^Y:is=^R^N:\ :kb=^H:kd=^J:kl=^H:kr=^U:ku=^K:le=^H:me=^N:mr=^O:nw=100\r:\ :r1=^R^N:se=^N:sf=^W:so=^O:sr=^V:ta=^I:up=^_: # mcvax!vu44!vu45!wilcke uses the "ap" entry together with Ascii Express Pro # 4.20, with incoming and outgoing terminals both on 0, emulation On. apple2e-p|Apple //e via Pascal:\ :cm=\036%r%+ %+ :kb=^H:kd=^J:kl=^H:tc=apple2e: # (ASCII Express) MouseTalk "Standard Apple //" emulation from BRL # Enable DC3/DC1 flow control with "stty ixon -ixany". apple-ae|ASCII Express:\ :am:bs:bw:ms:nx:xo:\ :co#80:it#8:li#24:\ :bl=500\007:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :cr=^M:do=^J:\ :ho=^Y:is=^R^N:kC=^X:kd=^J:kl=^H:kr=^U:ku=^K:le=^H:me=^N:\ :mr=^O:nd=^U:r1=^R^N:se=^N:sf=^W:so=^O:sr=^V:up=^_: appleII|apple ii plus:\ :am:bs:\ :co#80:it#8:li#24:\ :cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :do=^J:ho=\E^Y:\ :is=\024T1\016:kd=^J:kr=^U:le=^H:me=^N:nd=^\:se=^N:so=^O:\ :ta=^I:up=^_:vb=\024G1\024T1:ve=^TC2:vs=^TC6: # Originally by Gary Ford 21NOV83 # From: Fri Oct 11 21:27:00 1985 apple-80|apple II with smarterm 80 col:\ :am:bs:bw:\ :co#80:li#24:\ :bt=^R:cd=10*\013:ce=10\035:cl=10*\014:cm=\036%r%+ %+ :\ :cr=10*\r:do=^J:ho=^Y:le=^H:nd=^\:up=^_: apple-soroc|apple emulating soroc 120:\ :am:\ :co#80:li#24:\ :bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:\ :kd=^J:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:sf=^J:up=^K: # From Peter Harrison, Computer Graphics Lab, San Francisco # ucbvax!ucsfmis!harrison .....uucp # ucbvax!ucsfmis!harrison@BERKELEY .......ARPA # "These two work. If you don't have the inverse video chip for the # Apple with videx then remove the :so: and :se: fields." # (apple-videx: this used to be called DaleApple -- esr) apple-videx|Apple with videx videoterm 80 column board with inverse video:\ :am:bs:xn:\ :co#80:it#8:li#24:\ :cd=^K:ce=^]:cl=300\014:cm=\036%r%+ %+ :do=^J:ho=^Y:kd=^J:\ :kh=^Y:kl=^H:kr=^U:le=^H:me=^Z2:nd=^\:se=^Z2:so=^Z3:ta=^I:\ :up=^_: # My system [for reference] : Apple ][+, 64K, Ultraterm display card, # Apple Cat ][ 212 modem, + more all # controlled by ASCII Express: Pro. # From Dave Shaver apple-uterm-vb|Videx Ultraterm for Apple micros with Visible Bell:\ :am:bs:eo:xt:\ :co#80:li#24:\ :ac=:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :ho=^Y:\ :is=^V4^W06\017\rVisible Bell Installed.\016\r\n:\ :nd=^\:se=^N:so=^O:up=^_:vb=^W35^W06: apple-uterm|Ultraterm for Apple micros:\ :am:bs:eo:xt:\ :co#80:li#24:\ :ac=:cd=^K:ce=^]:cl=^L:cm=\036%r%+ %+ :ho=^Y:\ :is=^V4^W06\016:nd=^\:se=^N:so=^O:up=^_: # from trwrba!bwong (Bradley W. Wong): # # This entry assumes that you are using an apple with the UCSD Pascal # language card. SYSTEM.MISCINFO is assumed to be the same as that # supplied with the standard apple except that screenwidth should be set # using SETUP to 80 columns. Note that the right arrow in not mapped in # this termcap entry. This is because that key, on the Apple, transmits # a ^U and would thus preempt the more useful "up" function of vi. # # HMH 2/23/81 apple80p|80-column apple with Pascal card:\ :am:bw:\ :co#80:li#24:\ :cd=^K:ce=^]:cl=^Y^L:cm=\036%r%+ %+ :ho=^Y:kl=^H:nd=^\\072:\ :up=^_: # # Apple II+ equipped with Videx 80 column card # # Terminfo from ihnp4!ihu1g!djc1 (Dave Christensen) via BRL; # manually converted by D A Gwyn # # DO NOT use any terminal emulation with this data base, it works directly # with the Videx card. This has been tested with vi 1200 baud and works fine. # # This works great for vi, except I've noticed in pre-R2, ^U will scroll back # 1 screen, while in R2 ^U doesn't. # For inverse alternate character set add: # :as:=^O::ae:=^N: # (apple-v: added it#8 -- esr) apple-videx2|Apple II+ w/ Videx card (similar to Datamedia h1520):\ :am:xn:\ :co#80:it#8:li#24:\ :bl=100\007:cd=16*\013:ce=^]:cl=16*\014:cm=\036%r%+ %+ :\ :cr=^M:do=^J:ho=^Y:kb=^H:kd=^J:kh=^Y:kl=^H:kr=^\:ku=^_:le=^H:\ :nd=^\:se=^Z2:sf=^J:so=^Z3:ta=8\011:up=^_: apple-videx3|vapple|Apple II with 80 col card:\ :am:bs:\ :co#80:li#24:\ :ce=\Ex:cl=\Ev:cm=\EY%+ %+ :ho=\EH:k0=\EP:k1=\EQ:k2=\ER:\ :k3=\E :k4=\E\041:k5=\E":k6=\E#:k7=\E$:k8=\E%:k9=\E&:kd=\EB:\ :kh=\EH:kl=\ED:kr=\EC:ku=\EA:nd=\EC:up=\EA: #From: decvax!cbosgd!cbdkc1!mww Mike Warren via BRL aepro|Apple II+ running ASCII Express Pro--vt52:\ :bs:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=300\014:cm=\EY%+ %+ :ho=\EH:nd=\EC:\ :up=\EA: # UCSD addition: Yet another termcap from Brian Kantor's Micro Munger Factory apple-vm80|ap-vm80|apple with viewmax-80:\ :bs:\ :co#80:li#24:\ :cd=300\013:ce=^]:cl=300\014:cm=100\036%+ %+ :ho=200\031:\ :nd=^\\072:up=^_: #### Apple Lisa & Macintosh # # (lisa: changed :vs: to :ve: -- esr) lisa|apple lisa console display (black on white):\ :am:bs:eo:ms:\ :co#88:it#8:li#32:\ :ac=lfmekcjdttuvvuwsqax`nb:ae=\E[10m:al=\E[L:as=\E[11m:\ :cd=\E[J:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:\ :do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:is=\E>\E[m\014:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[C:\ :se=\E[m:so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[5l:\ :vi=\E[5h: liswb|apple lisa console display (white on black):\ :is=\E>\E[0;7m\014:se=\E[0;7m:so=\E[m:ue=\E[0;7m:\ :us=\E[4m:tc=lisa: # lisaterm from ulysses!gamma!epsilon!mb2c!jed (John E. Duncan III) via BRL; # :is: revised by Ferd Brundick # # These entries assume that the 'Auto Wraparound' is enabled. # Xon-Xoff flow control should also be enabled. # # The vt100 uses :rs2: and :rf: rather than :is2:/:tbc:/:hts: because the tab # settings are in non-volatile memory and don't need to be reset upon login. # Also setting the number of columns glitches the screen annoyingly. # You can type "reset" to get them set. # lisaterm|Apple Lisa or Lisa/2 running LisaTerm vt100 emulation:\ :am:bs:pt:xn:xo:\ :co#80:it#8:kn#4:li#24:vt#3:\ :DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:do=^J:ho=\E[H:k0=\EOP:k1=\EOQ:\ :k2=\EOR:k3=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=F1:l1=F2:l2=F3:l3=F4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r1=\E>\E[?1l\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\E[A:us=\E[4m: # Lisaterm in 132 column ("wide") mode. lisaterm-w|Apple Lisa with Lisaterm in 132 column mode:\ :co#132:\ :kb=^H:kd=^J:kl=^H:tc=lisaterm: # Although MacTerminal has insert/delete line, it is commented out here # since it is much faster and cleaner to use the "lock scrolling region" # method of inserting and deleting lines due to the MacTerminal implementation. # Also, the "Insert/delete ch" strings have an extra character appended to them # due to a bug in MacTerminal V1.1. Blink is disabled since it is not # supported by MacTerminal. mac|macintosh|Macintosh with MacTerminal:\ :xn:\ :dN#30:\ :dc=7\E[P:ei=:ic=9\E[@:im=:ip=7:mb@:tc=lisa: # Lisaterm in 132 column ("wide") mode. mac-w|macterminal-w|Apple Macintosh with Macterminal in 132 column mode:\ :co#132:tc=mac: #### Radio Shack/Tandy # # (coco3: This had "ta" used incorrectly as a boolean and bl given as "bl#7". # I read these as mistakes for ":it#8:" and ":bl=\007:" respectively -- esr) # From: <{pbrown,ctl}@ocf.berkeley.edu> 12 Mar 90 coco3|os9LII|Tandy CoCo3 24*80 OS9 Level II:\ :am:bs:\ :co#80:it#8:li#24:\ :al=^_0:bl=^G:cd=^K:ce=^D:cl=5*\014:cm=2\002%r%+ %+ :\ :dl=^_1:do=^J:ho=^A:kd=^J:kl=^H:kr=^I:ku=^L:le=^H:mb=^_":\ :md=\E\072^A:me=\037\041\E\072\200:mr=^_ :nd=^F:\ :se=^_\041:so=^_ :ue=^_#:up=^I:us=^_":ve=^E\041:vi=^E : # (trs2: removed obsolete ":nl=^_:" -- esr) trs2|trsII|trs80II|Radio Shack Model II using P&T CP/M:\ :am:bs:ms:\ :co#80:it#8:li#24:\ :al=^D:bl=^G:cd=^B:ce=^A:cl=^L:cm=\EY%+ %+ :cr=^M:dl=^K:\ :do=^_:ho=^F:kb=^H:kd=^_:kl=^\:kr=^]:ku=^^:le=^H:me=^O:nd=^]:\ :se=^O:sf=^J:so=^N:ta=^I:up=^^: # From: Kevin Braunsdorf # (This had extension capabilities # :BN=\E[?33h:BF=\E[?33l:UC=\E[_ q:BC=\E[\177 q:\ # :CN=\ERC:CF=\ERc:NR=\ERD:NM=\ER@: # I also deleted the unnecessary ":kn#2:", ":sg#0:" -- esr) trs16|trs-80 model 16 console:\ :am:bs:\ :co#80:it#8:li#24:\ :ac=l_mbk`javewcquxs:ae=\ERg:al=\EL:as=\ERG:bl=^G:cd=\EJ:\ :ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:dc=\EQ:dl=\EM:do=\EB:ei=:\ :ho=\EH:ic=\EP:im=:k0=^A:k1=^B:k2=^D:k3=^L:k4=^U:k5=^P:k6=^N:\ :k7=^S:kb=^H:kd=\EB:kh=^W:kl=\ED:kr=\EC:ku=\EA:l0=f1:l1=f2:\ :l2=f3:l3=f4:l4=f5:l5=f6:l6=f7:l7=f8:le=^H:me=\ER@:nd=\EC:\ :pf=\E]+:po=\E]=:se=\ER@:sf=^J:so=\ERD:ta=^I:up=\EA:ve=\ERC:\ :vi=\ERc: #### Atari ST # # From: Simson L. Garfinkel atari|atari st:\ :am:bs:\ :co#80:it#8:li#25:\ :al=\EL:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :dl=\EM:do=\EB:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=\ED:me=\Eq:nd=\EC:se=\Eq:\ :so=\Ep:sr=\EI:ta=^I:up=\EA: # UniTerm terminal program for the Atari ST: 49-line VT220 emulation mode # From: Paul M. Aoki uniterm|uniterm49|UniTerm VT220 emulator with 49 lines:\ :li#49:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;49r\E[49;1H:tc=vt220: # MiNT VT52 emulation. 80 columns, 25 rows. # MiNT is Now TOS, the operating system which comes with all Ataris now # (mainly Atari Falcon). This termcap is for the VT52 emulation you get # under tcsh/zsh/bash/sh/ksh/ash/csh when you run MiNT in `console' mode # From: Per Persson , 27 Feb 1996 st52|Atari ST with VT52 emulation:\ :am:km:\ :co#80:li#25:\ :K1=\E#7:K2=\E#9:K3=\E#5:K4=\E#1:K5=\E#3:al=\EL:bl=^G:\ :cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:dl=\EM:do=\EB:\ :ho=\EH:k0=\E#D:k1=\E#;:k2=\E#<:k3=\E#=:k4=\E#>:k5=\E#?:\ :k6=\E#@:k7=\E#A:k8=\E#B:k9=\E#C:kA=\E#R:kC=\E#7:kF=\E#2:\ :kR=\E#8:kb=^H:kd=\E#P:kh=\E#G:kl=\E#K:kr=\E#M:ku=\E#H:\ :l0=f10:le=\ED:me=\Eq:nd=\EC:nw=^M^J:r1=\Ez_\Eb@\EcA:\ :rc=\Ek:sc=\Ej:se=\Eq:sf=^J:so=\Ep:sr=\EI:ta=^I:te=:ti=\Ee:\ :up=\EA:ve=\Ee:vi=\Ef: #### Commodore Business Machines # # Formerly located in West Chester, PA; went spectacularly bust in 1994 # after years of shaky engineering and egregious mismanagement. Made one # really nice machine (the Amiga) and boatloads of nasty ones (PET, C-64, # C-128, VIC-20). The C-64 is said to have been the most popular machine # ever (most units sold); they can still be found gathering dust in closets # everywhere. # # From: Kent Polk , 30 May 90 # Added a few more entries, converted caret-type control sequence (^x) entries # to '\0xx' entries since a couple of people mentioned losing '^x' sequences. # # :as:, :ae: Support for alternate character sets. # :ve=\E[\040p:vi=\E[\060\040p: cursor visible/invisible. # :xn: vt100 kludginess at column 80/NEWLINE ignore after 80 cols(Concept) # This one appears to fix a problem I always had with a line ending # at 'width+1' (I think) followed by a blank line in vi. The blank # line tended to disappear and reappear depending on how the screen # was refreshed. Note that this is probably needed only if you use # something like a Dnet Fterm with the window sized to some peculiar # dimension larger than 80 columns. # :k0=\E9~: map F10 to k0 - could have F0-9 -> k0-9, but ... F10 was 'k;' # (amiga: removed obsolete :kn#10:, # also added empty to suppress a warning --esr) amiga|Amiga ANSI:\ :am:bs:bw:xn:\ :co#80:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SF=\E[%dS:SR=\E[%dT:UP=\E[%dA:ac=:\ :ae=^O:al=\E[L:as=^N:bl=^G:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=\E[B:ei=:\ :ho=\E[H:ic=\E[@:im=:is=\E[20l:k0=\E[9~:k1=\E[0~:k2=\E[1~:\ :k3=\E[2~:k4=\E[3~:k5=\E[4~:k6=\E[5~:k7=\E[6~:k8=\E[7~:k9=\E[8~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[7;2m:\ :md=\E[1m:me=\E[m:mh=\E[2m:mk=\E[8m:mr=\E[7m:nd=\E[C:\ :rs=\Ec:se=\E[m:sf=\E[S:so=\E[7m:sr=\E[T:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\E[ p:vi=\E[0 p: # From: Hans Verkuil , 4 Dec 1995 # (amiga: added empty to suppress a warning --esr) amiga-bad|Amiga ANSI:\ :bs:bw:ms:\ :co#80:li#24:\ :DC=\233%dP:DO=\233%dB:IC=\233%d@:LE=\233%dD:RI=\233%dC:\ :SF=\233%dS:SR=\233%dT:UP=\233%dA:ac=:ae=^O:as=^N:bl=^G:\ :bt=\233Z:cd=\233J:ce=\233K:cl=\233H\233J:\ :cm=\233%i%d;%dH:cr=^M:dc=\233P:do=\233B:ec=\233%dP:ei=:\ :ho=\233H:ic=\233@:im=:is=\23320l:k0=\2339~:k1=\2330~:\ :k2=\2331~:k3=\2332~:k4=\2333~:k5=\2334~:k6=\2335~:\ :k7=\2336~:k8=\2337~:k9=\2338~:kD=\177:kb=^H:kd=\233B:\ :kl=\233D:kr=\233C:ku=\233A:le=\233D:mb=\2337;2m:\ :md=\2331m:me=\2330m:mh=\2332m:mk=\2338m:mr=\2337m:\ :nd=\233C:nw=\233B\r:r1=\Ec:se=\2330m:sf=\233S:so=\2337m:\ :sr=\233T:ta=^I:te=\233?7h:ti=\233?7l:ue=\2330m:up=\233A:\ :us=\2334m:vb=^G:ve=\233 p:vi=\2330 p: # Commodore B-128 microcomputer from Doug Tyrol # I'm trying to write a termcap for a commodore b-128, and I'm # having a little trouble. I've had to map most of my control characters # to something that unix will accept (my delete-char is a ctrl-t, etc), # and create some functions (like cm), but thats life. # The problem is with the arrow keys - right, and up work fine, but # left deletes the previous character and down I just can't figure out. # Jove knows what I want, but I don't know what it's sending to me (it # isn't thats bound to next-line in jove). # Anybody got any ideas? Here's my termcap. # DAG -- I changed his "^n" entries to "\n"; see if that works. # commodore|b-128|Commodore B-128 micro:\ :am:bw:\ :co#80:dN#20:li#24:pb#150:\ :al=10\Ei:bc=^H:ce=10\Eq:cl=10\E\006:\ :cm=20\E\013%2\054%2\054:cr=^M:dc=10*\177:dl=10*\Ed:\ :do=^J:ei=:ho=\E^E:ic=5\E\n:im=:kd=^J:kh=\E^E:kl=^B:kr=^F:\ :ku=^P:nd=^F:nl=^M:ta=5\011:up=^P: #### North Star # # North Star Advantage from Lt. Fickie via BRL northstar|North Star Advantage:\ :bs:\ :co#80:li#24:\ :cd=200\017:ce=200\016:cl=200\004:cm=1\E=%+ %+ :\ :ho=200\034\032: #### Osborne # # Thu Jul 7 03:55:16 1983 # # As an aside, be careful; it may sound like an anomaly on the # Osborne, but with the 80-column upgrade, it's too easy to # enter lines >80 columns! # # I've already had several comments... # The Osborne-1 with the 80-col option is capable of being # 52, 80, or 104 characters wide; default to 80 for compatibility # with most systems. # # The tab is destructive on the Ozzie; make sure to 'stty -tabs'. osborne-w|osborne1-w|osborne I in 104-column mode:\ :ms:ul:xt:\ :co#104:li#24:\ :al=\EE:bl=^G:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:dc=\EW:dl=\ER:\ :do=^J:ei=:ic=\EQ:im=:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:\ :se=\E(:sf=^J:so=\E):ue=\Em:up=^K:us=\El: # Osborne I from ptsfa!rhc (Robert Cohen) via BRL osborne|osborne1|osborne I in 80-column mode:\ :am:bs:mi:ms:ul:xs:\ :co#80:dB#4:li#24:\ :al=\EE:ce=\ET:cl=^Z:cm=\E=%+ %+ :dc=4\EW:dl=\ER:do=^J:ei=:\ :im=\EQ:is=^Z:kb=^H:kd=^J:kl=^H:kr=^L:ku=^K:le=\010:nd=^L:\ :se=\E):so=\E(:ue=\Em:up=^K:us=\El: # # Osborne Executive definition from BRL # Similar to tvi920 # Added by David Milligan and Tom Smith (SMU) osexec|Osborne executive:\ :am:bs:\ :co#80:li#24:sg#1:ug#1:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :cr=^M:ct=\E3:\ :dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:\ :is=\Eq\Ek\Em\EA\Ex0:k0=^A@\r:k1=^AA\r:k2=^AB\r:k3=^AC\r:\ :k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:k8=^AH\r:k9=^AI\r:\ :kb=^H:kd=^J:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:nl=^J:se=\Ek:\ :so=\Ej:st=\E1:ue=\Em:up=^K:us=\El: #### Console types for obsolete UNIX clones # # Coherent, Minix, Venix, and several lesser-known kin were OSs for 8088 # machines that tried to emulate the UNIX look'n'feel. Coherent and Venix # were commercial, Minix an educational tool sold in conjunction with a book. # Memory-segmentation limits and a strong tendency to look like V7 long after # it was obsolete made all three pretty lame. Venix croaked early. Coherent # and Minix were ported to 32-bit Intel boxes, only to be run over by a # steamroller named `Linux' (which, to be fair, traces some lineage to Minix). # Coherent's vendor, the Mark Williams Company, went belly-up in 1994. There # are also, I'm told, Minix ports that ran on Amiga and Atari machines and # even as single processes under SunOS and the Macintosh OS. # # This is the entry provided with minix 1.7.4, with bogus :ri: removed. minix|minix console (v1.7):\ :am:xn:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:cd=\E[0J:\ :ce=\E[K:cl=\E[H\E[0J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:is=\E[0m:k0=\E[Y:\ :k1=\E[V:k2=\E[U:k3=\E[T:k4=\E[S:k5=\E[G:kb=^H:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:l0=End:l1=PgUp:l2=PgDn:\ :l3=Num +:l4=Num -:l5=Num 5:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[0m:mr=\E[7m:nd=\E[C:nw=^M^J:se=\E[0m:sf=^J:so=\E[7m:\ :sr=\EM:ta=^I:ue=\E[0m:up=\E[A:us=\E[4m: # Corrected Jan 14, 1997 by Vincent Broman minix-old|minix console (v1.5):\ :xo:\ :co#80:it#8:li#25:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:al=\E[L:bl=^G:cd=\E[0J:\ :ce=\E[K:cl=\E[H\E[0J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=:ho=\E[H:ic=\E[@:im=:k0=\E[Y:k1=\E[V:\ :k2=\E[U:k3=\E[T:k4=\E[S:k5=\E[G:kb=^H:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:\ :mr=\E[7m:nd=\E[C:nw=^M^J:se=\E[0m:sf=^J:so=\E[7m:sr=\EM:\ :ta=^I:ue=\E[0m:up=\E[A:us=\E[4m: # The linewrap option can be specified by editing /usr/include/minix/config.h # before recompiling the minix 1.5 kernel. minix-old-am|minix console with linewrap:\ :am:tc=minix-old: pc-minix|minix console on an Intel box:\ :tc=klone+acs:tc=minix: # According to the Coherent 2.3 manual, the PC console is similar # to a z19. The differences seem to be (1) 25 lines, (2) no status # line, (3) standout is broken, (4) ins/del line is broken, (5) # has blinking and bold. pc-coherent|pcz19|coherent|IBM PC console running Coherent:\ :am:mi:\ :co#80:it#8:li#25:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :cr=^M:dc=\EN:\ :do=\EB:ei=\EO:ho=\EH:im=\E@:kb=^H:kd=\EB:kh=\EH:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:me=\Eq:nd=\EC:se=\Eq:sf=^J:so=\Ep:\ :sr=\EI:ta=^I:up=\EA: # According to the Venix 1.1 manual, the PC console is similar # to a DEC vt52. Differences seem to be (1) arrow keys send # different strings, (2) enhanced standout, (3) added insert/delete line. # Note in particular that it doesn't have automatic margins. # There are other keys (f1-f10, kpp, knp, kcbt, kich1, kdch1) but they # not described here because this derives from an old termcap entry. pc-venix|venix|IBM PC console running Venix:\ :co#80:it#8:li#25:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:\ :dl=\EM:do=^J:kb=^H:kd=\EP:kh=\EG:kl=\EK:kr=\EM:ku=\EH:le=^H:\ :nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: #### Miscellaneous microcomputer consoles # # If you know anything more about any of these, please tell me. # # basis from Peter Harrison, Computer Graphics Lab, San Francisco # ucbvax!ucsfmis!harrison ...uucp / ucbvax!ucsfmis!harrison@BERKELEY ...ARPA # (basis: removed obsolete ":ma=^K^P^R^L^L :nl=5000*^J:" -- esr) basis|BASIS108 computer with terminal translation table active:\ :cd=\EY:ce=\ET:cl=300\E*:do=5000\n:kb=^H:kd=^J:kl=^H:kr=^L:\ :ku=^K:me=\E):se=\E):so=\E(:\ :tc=adm3a: # luna's BMC terminal emulator luna|luna68k|LUNA68K Bitmap console:\ :co#88:li#46:tc=ansi-mini: megatek|pegasus workstation terminal emulator:\ :am:os:\ :co#83:li#60: # The Xerox 820 was a Z80 micro with a snazzy XEROX PARC-derived # interface (pre-Macintosh by several years) that went nowhere. xerox820|x820|Xerox 820:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^Q:ce=^X:cl=1^Z:cm=\E=%+ %+ :cr=^M:do=^J:ho=^^:\ :le=^H:nd=^L:sf=^J:up=^K: #### Videotex and teletext # # \E\:1} switch to te'le'informatique mode (ascii terminal/ISO 6429) # \E[?3l 80 columns # \E[?4l scrolling on # \E[12h local echo off # \Ec reset: G0 U.S. charset (to get #,@,{,},...), 80 cols, clear screen # \E(0 G0 DEC set (line graphics) # # From: Igor Tamitegama , 18 Jan 1997 m2-nam|minitel|minitel-2|minitel-2-nam|France Telecom Minitel 2 mode te'le'informatique:\ :bs:es:hs:xn:\ :co#80:it#8:li#24:sg#0:ws#72:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:SF=^J:SR=\EM:UP=\E[%dA:\ :ac=aaffggjjkkllmmnnooqqssttuuvvwwxx:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:\ :fs=^J:ho=\E[H:i1=\E\0721}\Ec\E[?4l\E[12h:\ :i2=\E[?3l kbs=\010:im=\E[4h:ip=7:is=\Ec\E[12h:\ :k0=\EOp:k1=\EOq:k2=\EOr:k3=\EOs:k4=\EOt:k5=\EOu:k6=\EOv:\ :k7=\EOw:k8=\EOx:k9=\EOy:k;=\EOp:kA=\E[4l:kC=\E[2J:kD=\E[P:\ :kI=\E[4h:kL=\E[M:kN=\EOn:kP=\EOR:kd=\E[B:kh=\E[H:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:ll=\E[24;80H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:ps=\E[i:\ :r1=\Ec\E[?4l\E[12h:r2=\Ec:rc=\E8:sc=\E7:se=\E[27m:\ :sf=^J:so=\E[7m:sr=\EM:ta=^I:ts=^_@A:u6=\E[%i%d;%dR:\ :u7=\E[6n:ue=\E[24m:up=\E[A:us=\E[4m:vb=^G:ve=\E[<1l:\ :vi=\E[<1h: ######## OBSOLETE VDT TYPES # # These terminals are *long* dead -- these entries are retained for # historical interest only. #### Amtek Business Machines # # (abm80: early versions of this entry apparently had ":se=\E^_:so=\E^Y", # but these caps were commented out in 8.3; also, removed overridden # ":do=^J:" -- esr) abm80|amtek business machines 80:\ :am:bs:bw:\ :co#80:li#24:\ :al=\E^Z:bt=^T:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E\021%r%+ %+ :\ :dl=\E^S:do=\E^K:ho=\E^R:le=^H:nd=^P:up=\E^L: #### Bell Labs blit terminals # # These were AT&T's official entries. The 5620 FAQ maintained by # David Breneman has this to say: # # Actually, in the beginning was the Jerq, and the Jerq was white with a # green face, and Locanthi and Pike looked upon the Jerq and said the Jerq # was good. But lo, upon the horizon loomed a mighty management-type person # (known now only by the initials VP) who said, the mighty Jerq must stay # alone, and could not go forth into the world. So Locanthi and Pike put the # Jerq to sleep, cloned its parts, and the Blit was brought forth unto the # world. And the Jerq lived the rest of its days in research, but never # strayed from those paths. # # In all seriousness, the Blit was originally known as the Jerq, but when # it started to be shown outside of the halls of the Bell Labs Research # organization, the management powers that be decided that the name could # not remain. So it was renamed to be Blit. This was in late 1981. # # (The AT&T 5620 was the commercialized Blit. Its successors were the 630, # 730, and 730+.) # blit|jerq|blit running teletype rom:\ :am:eo:ul:xo:\ :co#87:it#8:li#72:\ :AL=\EF%+ :DC=\Ee%+ :DL=\EE%+ :IC=\Ef%+ :al=\EF\041:bl=^G:\ :ce=\EK:cl=^L:cm=\EY%r%+ %+ :cr=^M:dc=\Ee\041:dl=\EE\041:\ :do=^J:ei=:ic=\Ef\041:im=:k1=\Ex:k2=\Ey:k3=\Ez:kb=^H:kd=\EB:\ :kl=\ED:kr=\EC:ku=\EA:le=\ED:nd=\EC:sf=^J:ta=^I:up=\EA: # (cbblit: here's a BSD termcap that says :do=\EG: -- esr) cbblit|fixterm|blit running columbus code:\ :co#88:\ :cd=\EJ:ei=\ER:ic@:im=\EQ:pO=\EP%03:pf=^T:po=^R:se=\EV\041:\ :so=\EU\041:ue=\EV":us=\EU":vb=\E^G:\ :tc=blit: oblit|ojerq|first version of blit rom:\ :am:da:db:eo:mi:ul:xo:\ :co#88:it#8:li#72:\ :AL=\Ef%+ :DL=\Ee%+ :al=\EF:bl=^G:cd=\EJ:ce=\EK:cl=^L:\ :cm=\EY%r%+ %+ :cr=^M:dc=\EO:dl=\EE:do=^J:ei=\ER:im=\EQ:\ :kb=^H:le=\ED:nd=\EC:sf=^J:ta=^I:up=\EA:vb=\E^G: #### Bolt, Beranek & Newman (bbn) # # The BitGraph was a product of the now-defunct BBN Computer Corporation. # The parent company, best known as the architects of the Internet, is # still around. # # Entries for the BitGraph terminals. The problem # with scrolling in vi can only be fixed by getting BBN to put # smarter scroll logic in the terminal or changing vi or padding # scrolls with about 500 ms delay. # # I always thought the problem was related to the terminal # counting newlines in its input buffer before scrolling and # then moving the screen that much. Then vi comes along and # paints lines in on the bottom line of the screen, so you get # this big white gap. bitgraph|bg2.0nv|bg3.10nv|bbn bitgraph 2.0 or later (normal video):\ :is=\E>\E[?5l\E[?7h:vb=\E[?5h\E[?5l:\ :tc=bg2.0: bg2.0rv|bg3.10rv|bbn bitgraph 2.0 (reverse video):\ :is=\E>\E[?5h\E[?7h:vb=\E[?5l\E[?5h:tc=bg2.0: bg2.0|bg3.10|bbn bitgraph 2.0 or later (no init):\ :bs:xn:\ :co#85:li#64:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=%i\E[%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dl=\E[M:do=\E[B:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:\ :ku=\E[A:l1=PF1:l2=PF2:l3=PF3:l4=PF4:le=^H:me=\E[m:nd=\E[C:\ :rc=\E8:sc=\E7:se=\E[m:sf=\n:so=\E[7m:ta=^I:up=\E[A: bg1.25rv|bbn bitgraph 1.25 (reverse video):\ :is=\E>\E[?5h\E[?7h:vb=\E[?5l\E[?5h:tc=bg1.25: bg1.25nv|bbn bitgraph 1.25 (normal video):\ :is=\E>\E[?5l\E[?7h:vb=\E[?5h\E[?5l:tc=bg1.25: # (bg1.25: I added / based on the init string -- esr) bg1.25|bbn bitgraph 1.25:\ :co#85:li#64:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=%i\E[%d;%dH:cr=^M:dl=\E[M:do=\E[B:k1=\EP:\ :k2=\EQ:k3=\ER:k4=\ES:kd=\EB:ke=\E>:kl=\ED:kr=\EC:ks=\E=:\ :ku=\EA:l1=PF1:l2=PF2:l3=PF3:l4=PF4:le=^H:ll=\E[64;1H:\ :me=\E[m:nd=\E[C:se=\E[m:sf=\n:so=\E[7m:ta=^I:up=\E[A: #### Chromatics # # I have put the long strings in :ti:/:te:. Ti sets up a window # that is smaller than the screen, and puts up a warning message # outside the window. Te erases the warning message, puts the # window back to be the whole screen, and puts the cursor at just # below the small window. I defined :ve: and :vi: to really turn # the cursor on and off, but I have taken this out since I don't # like the cursor being turned off when vi exits. cg7900|chromatics|chromatics 7900:\ :am:\ :co#80:li#40:\ :al=^A>2:bl=^G:cd=^Al:ce=^A`:cl=^L:cm=\001M%r%d\054%d\054:\ :cr=^M:dc=^A<1:dl=^A<2:do=^J:ei=:ho=^\:ic=^A>1:im=:le=^H:\ :ll=^A|:nd=^]:se=\001C1\054\001c2\054:sf=^J:\ :so=\001C4\054\001c7\054:\ :te=\001W0\05440\05485\05448\054\014\001W0\0540\05485\05448\054\001M0\05440\054:\ :ti=\001P0\001O1\001R1\001C4\054\001c0\054\014\001M0\05442\054WARNING DOUBLE ENTER ESCAPE and \025\001C1\054\001c2\054\001W0\0540\05479\05439\054:\ :uc=\001\001_\001\200:up=^K: #### Computer Automation # ca22851|computer automation 22851:\ :am:\ :co#80:li#24:\ :bl=^G:cd=^\:ce=^]:cl=\014:cm=\002%i%.%.:cr=^M:do=^J:ho=^^:\ :kd=^W:kh=^^:kl=^U:ku=^V:le=^U:nd=^I:sf=^J:up=^V: #### Cybernex # # This entry has correct padding and the undocumented "ri" capability cyb83|xl83|cybernex xl-83:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cd=\020:ce=\017:cl=\014:cm=\027%+ %+ :cr=^M:do=^J:\ :ho=^K:kd=^J:kl=^H:kr=^I:ku=^N:le=^H:nd=^I:sf=^J:sr=^N:up=^N: # (mdl110: removed obsolete ":ma=^Z^P:" and overridden ":cd=145^NA^W:" -- esr) cyb110|mdl110|cybernex mdl-110:\ :am:bs:\ :co#80:li#24:\ :al=\016A\016\035:bl=^G:cd=\016@\026:ce=\016@\026:\ :cl=\030:cm=\020%+ %+ :cr=^M:dc=\016A\036:\ :dl=\016A\016\036:do=^J:ei=:ho=^Y:ic=\016A\035:im=:le=^H:\ :nd=^U:se=^NG:sf=^J:so=^NF:ta=\011:up=^Z: #### Datapoint # # Datapoint is gone. They used to be headquartered in Texas. # They created ARCnet, an Ethernet competitor that flourished for a while # in the early 1980s before 3COM got wise and cut its prices. The service # side of Datapoint still lives (1995) in the form of Intelogic Trace. # dp3360|datapoint|datapoint 3360:\ :am:bs:\ :co#82:li#25:\ :bl=^G:cd=^_:ce=^^:cl=^]^_:cr=^M:do=^J:ho=^]:le=^H:nd=^X:\ :sf=^J:up=^Z: # From: Jan Willem Stumpel , 11 May 1997 # The Datapoint 8242 Workstation was sold at least between 1985 # and 1989. To make the terminal work with this entry, press # CONTROL-INT-INT to take the terminal off-line, and type (opt). # Set the options AUTO ROLL, ROLL DN, and ESC KBD on, and AUTO # CR/LF off. Use control-shift-[] as escape key, control-I as tab, # shift-F1 to shift-F5 as F6 to F10 (unshifted F1 to F5 are in # fact unusable because the strings sent by the terminal conflict # with other keys). # The terminal is capable of displaying "box draw" characters. # For each graphic character you must send 2 ESC's (\E\E) followed # by a control character as follows: # character meaning # ========= ======= # ctrl-E top tee # ctrl-F right tee # ctrl-G bottom tee # ctrl-H left tee # ctrl-I cross # ctrl-J top left corner # ctrl-K top right corner # ctrl-L bottom left corner # ctrl-M bottom right corner # ctrl-N horizontal line # ctrl-O vertical line # Unfortunately this cannot be fitted into the termcap/terminfo # description scheme. dp8242|datapoint 8242:\ :ms:\ :co#80:li#25:\ :al=\E^T:bl=^G:cd=^W:ce=^V:cl=\025\E\004\027\030:\ :cm=\011%r%+\%+\:cr=^M:dl=\E^Z:do=^J:ho=^U:\ :i1=\E\014\E\016\200\230\200\317\025\027\030\E\004:\ :k1=^G\Ee:k2=^I\Ed:k3=^J\Ec:k4=^J\Eb:k5=^S\Ea:k6=\EO\Ee:\ :k7=\EN\Ed:k8=\EM\Ec:k9=\EL\Eb:k;=\EK\Ea:kb=^H:kd=^B:kl=^D:\ :kr=^F:ku=^E:le=^H:nw=^M^J:\ :r1=\E\014\E\016\200\230\200\317\025\027\030\E\004:\ :rp=\E\023%.%.:se=\E^D:sf=^C:so=\E^E:sr=^K:ta=^I:ue=\E^D:\ :us=\E^F:ve=^X:vi=^Y:\ :..wi=\E\014\E\016%p1%'\200'%+%c%p2%'\200'%+%c%p3%'\200'%+%c%p4%'\200'%+%c\025: #### DEC terminals (Obsolete types: DECwriter and vt40/42/50) # # These entries are DEC's official terminfos for its older terminals. # Contact Bill Hedberg of Terminal Support # Engineering for more information. Updated terminfos and termcaps # are kept available at ftp://gatekeeper.dec.com/pub/DEC/termcaps. # gt40|dec gt40:\ :bs:os:\ :co#72:li#30:\ :bl=^G:cr=^M:do=^J:le=^H: gt42|dec gt42:\ :bs:os:\ :co#72:li#40:\ :bl=^G:cr=^M:do=^J:le=^H: vt50|dec vt50:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cr=^M:do=^J:le=^H:nd=\EC:\ :sf=^J:ta=^I:up=\EA: vt50h|dec vt50h:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:do=^J:\ :le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: # (vt61: there's a BSD termcap that claims :dl=\EPd:, :al=\EPf.: :kb=^H:) vt61|vt-61|vt61.5|dec vt61:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=\r:do=^J:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:sf=\n:sr=\EI:ta=^I:\ :up=\EA: # The gigi does standout with red! # (gigi: I added / based on the init string, corrected cub1 -- esr) gigi|vk100|dec gigi graphics terminal:\ :am:bs:xn:\ :co#84:li#24:\ :DO=\E[%dB:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:\ :UP=\E[%dA:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:do=^J:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?20l\E[?7h\E[?8h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:kd=\EOB:ke=\E[?1l\E>:kh=\E[H:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:me=\E[m:\ :nd=\E[C:se=\E[m:sf=^J:so=\E[7;31m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: # DEC PRO-350 console (VT220-style). The 350 was DEC's attempt to produce # a PC differentiated from the IBM clones. It was a total, ludicrous, # grossly-overpriced failure (among other things, DEC's OS didn't include # a format program, so you had to buy pre-formatted floppies from DEC at # a hefty premium!). pro350|decpro|dec pro console:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :do=\EB:\ :ho=\EH:k0=\EE:k1=\EF:k2=\EG:k3=\EH:k4=\EI:k5=\EJ:k6=\Ei:\ :k7=\Ej:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:\ :se=\E^N:so=\E^H:sr=\EI:ta=^I:ue=\E^C:up=\EA:us=\E^D: dw1|decwriter I:\ :bs:hc:os:\ :co#72:\ :bl=^G:cr=^M:do=^J:le=^H:sf=^J: dw2|decwriter|dw|decwriter II:\ :bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:kb=^H:le=^H:sf=^J: # \E(B Use U.S. character set (otherwise # => british pound !) # \E[20l Disable "linefeed newline" mode (else puts \r after \n,\f,\v) # \E[w 10 char/in pitch # \E[1;132 full width horizontal margins # \E[2g clear all tab stops # \E[z 6 lines/in # \E[66t 66 lines/page (for \f) # \E[1;66r full vertical page can be printed # \E[4g clear vertical tab stops # \E> disable alternate keypad mode (so it transmits numbers!) # \E[%i%p1%du set tab stop at column %d (origin == 1) # (Full syntax is \E[n;n;n;n;n;...;nu where each 'n' is # a tab stop) # # The dw3 does standout with wide characters. # dw3|la120|decwriter III:\ :bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:\ :i1=\E(B\E[20l\E[w\E[0;132s\E[2g\E[z\E[66t\E[1;66r\E[4g\E>:\ :is=\E[9;17;25;33;41;49;57;65;73;81;89;97;105;113;121;129u\r:\ :kb=^H:le=^H:me=\E[w:se=\E[w:sf=^J:so=\E[6w:ta=^I: dw4|decwriter IV:\ :am:bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:is=\Ec:k0=\EOP:k1=\EOQ:k2=\EOR:k3=\EOS:\ :kb=^H:le=^H:sf=^J:ta=^I: # These aren't official ln03|dec ln03 laser printer:\ :hc:\ :co#80:li#66:\ :bl=^G:cr=^M:do=^J:hd=\EK:hu=\EL:me=\E[m:nw=^M^J:se=\E[22m:\ :sf=^J:so=\E[1m:ta=^I:ue=\E[24m:us=\E[4m: ln03-w|dec ln03 laser printer 132 cols:\ :co#132:\ :bl=^G:cr=^M:do=^J:kb=^H:kd=^J:kl=^H:nw=^M^J:sf=^J:ta=^I:tc=ln03: #### Delta Data (dd) # # Untested. The cup sequence is hairy enough that it probably needs work. # The idea is ctrl(O), dd(row), dd(col), where dd(x) is x - 2*(x%16) + '9'. # There are BSD-derived termcap entries floating around for this puppy # that are *certainly* wrong. delta|dd5000|delta data 5000:\ :am:bs:\ :co#80:li#27:\ :bl=^G:ce=^NU:cl=^NR:cm=\017%+^P%+^P:dc=^NV:do=^J:ho=^NQ:\ :le=^H:nd=^Y:sf=^J:up=^Z: #### Digital Data Research (ddr) # # (ddr: I added / based on the init string -- esr) ddr|rebus3180|ddr3180|Rebus/DDR 3180 vt100 emulator:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[7l:SA=\E[7l:cd=50\E[J:ce=3\E[K:cl=50\E[H\E[2J:\ :cm=5\E[%i%d;%dH:cs=\E[%i%d;%dr:do=^J:ho=\E[H:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\E[B:ke=\E[?1l\E>:kl=\E[D:kr=\E[C:ks=\E[?1h\E=:\ :ku=\E[A:le=^H:mb=2\E[5m:md=2\E[1m:me=2\E[m:mr=2\E[7m:\ :nd=2\E[C:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[m:sf=5\ED:\ :so=\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:us=2\E[4m: #### Evans & Sutherland # # Jon Leech tells us: # The ps300 was the Evans & Sutherland Picture System 300, a high # performance 3D vector graphics system with a bunch of specialized hardware. # Approximate date of release was 1982 (early 80s, anyway), and it had several # evolutions including (limited) color versions such as the PS330C. PS300s # were effectively obsolete by the late 80s, replaced by raster graphics # systems, although specialized applications like molecular modelling # hung onto them for a while longer. AFAIK all E&S vector graphics systems # are out of production, though of course E&S is very much alive (in 1996). # (ps300: changed ":pt@:" to "it@" -- esr) # ps300|Picture System 300:\ :xt:\ :it@:\ :se@:so@:ue@:us@:tc=vt100: #### General Electric (ge) # terminet1200|terminet300|tn1200|tn300|terminet|GE terminet 1200:\ :bs:hc:os:\ :co#120:\ :bl=^G:cr=^M:do=^J:sf=^J: #### Heathkit/Zenith # # Here is a description of the H19 DIP switches: # # S401 # 0-3 = baud rate as follows: # # 3 2 1 0 # --- --- --- --- # 0 0 1 1 300 baud # 0 1 0 1 1200 baud # 1 0 0 0 2400 baud # 1 0 1 0 4800 baud # 1 1 0 0 9600 baud # 1 1 0 1 19.2K baud # # 4 = parity (0 = no parity) # 5 = even parity (0 = odd parity) # 6 = stick parity (0 = normal parity) # 7 = full duplex (0 = half duplex) # # S402 # 0 = block cursor (0 = underscore cursor) # 1 = no key click (0 = keyclick) # 2 = wrap at end of line (0 = no wrap) # 3 = auto LF on CR (0 = no LF on CR) # 4 = auto CR on LF (0 = no CR on LF) # 5 = ANSI mode (0 = VT52 mode) # 6 = keypad shifted (0 = keypad unshifted) # 7 = 50Hz refresh (1 = 60Hz refresh) # # Factory Default settings are as follows: # 7 6 5 4 3 2 1 0 # S401 1 0 0 0 1 1 0 0 # S402 0 0 0 0 0 0 0 0 # (h19: I added / based on the init string; # also added empty to suppress a tic warning -- esr) h19-a|h19a|heath-ansi|heathkit-a|heathkit h19 ansi mode:\ :am:bs:mi:ms:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:ac=:ae=\E[11m:al=\E[1L:as=\E[10m:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :dc=\E[1P:dl=\E[1M:do=\E[1B:ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E<\E[>1;2;3;4;5;6;7;8;9l\E[m\E[11m\E[?7h:k1=\EOS:\ :k2=\EOT:k3=\EOU:k4=\EOV:k5=\EOW:k6=\EOP:k7=\EOQ:k8=\EOR:\ :kb=^H:kd=\E[1B:kh=\E[H:kl=\E[1D:kr=\E[1C:ku=\E[1A:l6=blue:\ :l7=red:l8=white:le=^H:nd=\E[1C:se=\E[m:sf=^J:so=\E[7m:\ :sr=\EM:ta=^I:up=\E[1A:ve=\E[>4l:vs=\E[>4h: h19-bs|heathkit w/keypad shifted:\ :ke=\Eu:ks=\Et:tc=h19-b: h19-smul|heathkit w/keypad shifted/underscore cursor:\ :ke=\Eu:ks=\Et:\ :tc=h19-u: # (h19: merged in :ip: from BSDI hp19-e entry>; # also added empty to suppress a tic warning --esr) h19|heath|h19-b|heathkit|heath-19|z19|zenith|heathkit h19:\ :am:bs:es:hs:mi:ms:\ :co#80:it#8:li#24:\ :ac=:ae=\EG:al=\EL:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EE:\ :cm=\EY%+ %+ :cr=^M:dc=\EN:dl=\EM:do=\EB:ei=\EO:fs=\Ek\Ey5:\ :ho=\EH:im=\E@:ip=1.5<1.5/>:k1=\ES:k2=\ET:k3=\EU:k4=\EV:\ :k5=\EW:k6=\EP:k7=\EQ:k8=\ER:kb=^H:kd=\EB:kh=\EH:kl=\ED:\ :kr=\EC:ku=\EA:l6=blue:l7=red:l8=white:le=^H:nd=\EC:se=\Eq:\ :sf=^J:so=\Ep:sr=\EI:ta=^I:\ :ts=\Ej\Ex5\EY8%p1%{32}%+%c\Eo\Eo:up=\EA:ve=\Ey4:\ :vs=\Ex4: h19-u|heathkit with underscore cursor:\ :ve@:vs@:tc=h19-b: h19-us|h19us|heathkit w/keypad shifted/underscore cursor:\ :ke=\Eu:ks=\Et:\ :tc=h19-u: h19-g|h19g|heathkit w/block cursor:\ :ve=\Ex4:tc=h19-b: alto-h19|altoh19|altoheath|alto-heath|alto emulating heathkit h19:\ :li#60:\ :al=\EL:dl=\EM:tc=h19: # The major problem with the Z29 is that it requires more padding than the Z19. # # The problem with declaring an H19 to be synonymous with a Z29 is that # it needs more padding. It especially loses if a program attempts # to put the Z29 into insert mode and insert text at 9600 baud. It # even loses worse if the program attempts to insert tabs at 9600 # baud. Adding padding to text that is inserted loses because in # order to make the Z29 not die, one must add so much padding that # whenever the program tries to use insert mode, the effective # rate is about 110 baud. # # What program would want to put the terminal into insert mode # and shove stuff at it at 9600 baud you ask? # # Emacs. Emacs seems to want to do the mathematically optimal # thing in doing a redisplay rather than the practical thing. # When it is about to output a line on top of a line that is # already on the screen, instead of just killing to the end of # the line and outputting the new line, it compares the old line # and the new line and if there are any similarities, it # constructs the new line by deleting the text on the old line # on the terminal that is already there and then inserting new # text into the line to transform it into the new line that is # to be displayed. The Z29 does not react kindly to this. # # But don't cry for too long.... There is a solution. You can make # a termcap entry for the Z29 that says the Z29 has no insert mode. # Then Emacs cannot use it. "Oh, no, but now inserting into a # line will be really slow", you say. Well there is a sort of a # solution to that too. There is an insert character option on # the Z29 that will insert one character. Unfortunately, it # involves putting the terminal into ansi mode, inserting the # character, and changing it back to H19 mode. All this takes 12 # characters. Pretty expensive to insert one character, but it # works. Either Emacs doesn't try to use its inserting hack when # it's only given an insert character ability or the Z29 doesn't # require padding with this (the former is probably more likely, # but I haven't checked it out). # (z29: added empty to suppress a tic warning, merged in # status line capabilities from BRL entry --esr) z29|zenith29|z29b|zenith z29b:\ :am:bs:es:hs:mi:ms:pt:\ :co#80:kn#10:li#24:\ :ac=:ae=\EF:al=1\EL:as=\EG:bc=\ED:bl=^G:bt=\E-:cd=\EJ:ce=\EK:\ :cl=\EE:cm=\EY%+ %+ :cr=^M:dc=\EN:dl=1\EM:do=\EB:ds=\Ey1:\ :ei=\EO:fs=\Ek\Ey5:ho=\EH:ic=\E<\E[1@\E[?2h:im=\E@:\ :is=\E<\E[?2h\Ev:k0=\E~:k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:\ :k6=\EP:k7=\EQ:k8=\ER:k9=\E0I:kb=^H:kd=\EB:kh=\EH:kl=\ED:\ :kr=\EC:ku=\EA:l0=home:le=^H:nd=\EC:se=\Eq:sf=\n:so=\Ep:\ :sr=2\EI:ta=^I:ts=\Ej\Ex5\Ex1\EY8%+ \Eo:ue=\Es0:up=\EA:\ :us=\Es8:ve=\Ey4:vs=\Ex4: # z29 in ansi mode. Assumes that the cursor is in the correct state, and that # the world is stable. causes the terminal to be reset to the state # indicated by the name. kc -> key click, nkc -> no key click, uc -> underscore # cursor, bc -> block cursor. # From: Mike Meyers # (z29a: replaced nonexistent :if=/usr/share/tabset/zenith29: befause :st: # looks vt100-compatible -- esr) z29a|z29a-kc-bc|h29a-kc-bc|heath/zenith 29 in ansi mode:\ :am:bs:es:hs:mi:ms:pt:\ :co#80:it#8:kn#10:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:bc=\ED:bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[1P:\ :do=^J:ds=\E[>1l:fs=\E[u\E[>5l:ho=\E[H:\ :if=/usr/share/tabset/vt100:k0=\E[~:k1=\EOS:k2=\EOT:\ :k3=\EOU:k4=\EOV:k5=\EOW:k6=\EOP:k7=\EOQ:k8=\EOR:k9=\EOX:\ :kC=\E[J:kS=\E[J:kb=^H:kd=\EOB:kh=\E[H:kl=\EOD:kr=\EOC:\ :ku=\EOA:l0=help:le=^H:mb=\E[5m:md=\E[2m:me=\E[m:mh=\E[2m:\ :mr=\E[7m:nd=\E[C:nw=^M\ED:ps=\E#7:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>4h\E[>1;2;3;5;6;7;8;9l\E[m\E[11m:\ :rc=\E[r:sc=\E[s:se=\E[m:sf=\ED:so=\E[7;2m:sr=\EM:st=\EH:\ :ta=^I:te=\E[?7h:ti=\E[?7l:\ :ts=\E[s\E[>5;1h\E[25;%i%dH\E[1K:ue=\E[m:up=\E[A:\ :us=\E[4m: z29a-kc-uc|h29a-kc-uc|z29 ansi mode with keyckick and underscore cursor:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>1;2;3;4;5;6;7;8;9l\E[m\E[11m:\ :tc=z29a: z29a-nkc-bc|h29a-nkc-bc|z29 ansi mode with block cursor and no keyclick:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>2;4h\E[>1;3;5;6;7;8;9l\E[m\E[11m:\ :tc=z29a: z29a-nkc-uc|h29a-nkc-uc|z29 ansi mode with underscore cursor and no keyclick:\ :r1=\E<\E[1;24r\E[24;1H\E[?7h\E[>2h\E[>1;3;4;5;6;7;8;9l\E[m\E[11m:\ :tc=z29a: # From: Jeff Bartig 31 Mar 1995 z39-a|z39a|zenith39-a|zenith39-ansi|Zenith 39 in ANSI mode:\ :5i:am:es:hs:mi:ms:xo:\ :co#80:li#24:\ :%1=\E[~:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:K1=\EOw:\ :K2=\EOy:K3=\EOu:K4=\EOq:K5=\EOs:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:ac=``aaffggjjkkllmmnnooqqssttuuvvwwxx~~0a:\ :ae=\E(B:al=\E[1L:as=\E(0:bl=^G:bt=\E[1Z:cb=\E[1K:cd=\E[0J:\ :ce=\E[0K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[1P:dl=\E[1M:do=\E[B:\ :ds=\E[>1l:ei=\E[4l:fs=\E[u:ho=\E[H:im=\E[4h:\ :is=\E<\E[>1;3;5;6;7l\E[0m\E[2J:k1=\EOS:k2=\EOT:k3=\EOU:\ :k4=\EOV:k5=\EOW:k6=\EOP:k7=\EOQ:k8=\EOR:k9=\EOX:kS=\E[J:\ :kb=^H:kd=\E[B:ke=\E[>7l:kh=\E[H:kl=\E[D:kr=\E[C:ks=\E[>7h:\ :ku=\E[A:le=^H:ll=\E[24;1H:mb=\E[5m:md=\E[1m:me=\E[0m:\ :mh=\E[2m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[?19h\E[i:r2=\E<\Ec\200:rc=\E[u:sc=\E[s:se=\E[0m:\ :sf=^J:so=\E[7m:st=\EH:ta=^I:ts=\E[s\E[>1h\E[25;%i%p1%dH:\ :ue=\E[0m:up=\E[A:us=\E[4m:ve=\E[>5l:vi=\E[>5h: # From: Brad Brahms z100|h100|z110|z-100|h-100|heath/zenith z-100 pc with color monitor:\ :ve=\Ey4\Em70:vs=\Ex4\Em71:\ :tc=z100bw: # (z100bw: removed obsolete ":kn#10:", added empty -- esr) z100bw|h100bw|z110bw|z-100bw|h-100bw|heath/zenith z-100 pc:\ :bs:mi:ms:pt:\ :co#80:it#8:kn#10:li#24:\ :ac=:ae=\EG:al=5*\EL:as=\EF:cd=\EJ:ce=\EK:cl=5*\EE:\ :cm=1*\EY%+ %+ :dc=1*\EN:dl=5*\EM:do=\EB:ei=\EO:ho=\EH:\ :im=\E@:k0=\EJ:k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:\ :k7=\EQ:k8=\ER:k9=\EOI:kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:\ :ku=\EA:le=^H:nd=\EC:se=\Eq:so=\Ep:sr=\EI:ta=^I:up=\EA:\ :ve=\Ey4:vs=\Ex4: p19|h19-b with il1/dl1:\ :al=2*\EL:dl=2*\EM:tc=h19-b: # From: # (ztx: removed duplicate :sr: -- esr) ztx|ztx11|zt-1|htx11|ztx-1-a|ztx-10 or 11:\ :am:bs:es:hs:\ :co#80:it#8:li#24:\ :al=\EL:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :dl=\EM:do=^J:\ :ds=\Ey1:fs=\Ek\Ey5:ho=\EH:\ :is=\Ej\EH\Eq\Ek\Ev\Ey1\Ey5\EG\Ey8\Ey9\Ey>:k0=\ES:\ :k1=\EB:k2=\EU:k3=\EV:k4=\EW:k5=\EP:k6=\EQ:k7=\ER:kb=^H:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:se=\Eq:so=\Es5:\ :sr=\EI:ta=^I:ts=\Ej\Ex5\Ex1\EY8%+ \Eo:ue=\Eq:up=\EA:\ :us=\Es2: #### IMS International (ims) # # There was a company called IMS International located in Carson City, # Nevada, that flourished from the mid-70s to mid-80s. They made S-100 # bus/Z80 hardware and a line of terminals called Ultimas. # # From: Erik Fair Sun Oct 27 07:21:05 1985 ims950-b|bare ims950 no init string:\ :is@:tc=ims950: # (ims950: removed obsolete ":ko@:" -- esr) ims950|ims televideo 950 emulation:\ :xn@:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb@:kd@:kh@:kl@:kr@:ku@:vb@:tc=tvi950: # (ims950-rv: removed obsolete ":ko@:" -- esr) ims950-rv|ims tvi950 rev video:\ :xn@:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb@:kd@:kh@:kl@:kr@:ku@:vb@:tc=tvi950-rv: ims-ansi|ultima2|ultimaII|IMS Ultima II:\ :am:bs:\ :co#80:it#8:li#24:\ :cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:cm=\E[%i%2;%2H:do=\ED:\ :if=/usr/share/tabset/vt100:\ :is=\E[m\E[>14l\E[?1;?5;20l\E>\E[1m\r:kd=\E[B:kh=\E[H:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:se=\E[m\E[1m:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m\E[1m:up=\EM:us=\E[4m: #### Intertec Data Systems # # I think this company is long dead as of 1995. They made an early CP/M # micro called the "Intertec Superbrain" that was moderately popular, # then sank out of sight. # superbrain|intertec superbrain:\ :am:bs:bw:\ :co#80:li#24:\ :bc=^U:bl=^G:cd=\E~k<10*>:ce=\E~K:cl=\014:cm=\EY%+ %+ :\ :cr=^M:do=^J:kd=^J:kl=^U:kr=^F:ku=^K:le=^H:nd=^F:sf=^J:ta=^I:\ :te=^L:ti=^L:up=^K: # (intertube: a Gould entry via BRL asserted smul=\E0@$<200/>, # rmul=\E0A$<200/>; my guess is the highlight letter is bit-coded like an ADM, # and the reverse is actually true. Try it. -- esr) intertube|intertec|Intertec InterTube:\ :am:bs:\ :co#80:li#25:\ :bl=^G:cl=^L:cm=\EY%+ %+ :cr=^M:do=^J:ho=^A:le=^H:nd=^F:\ :se=\E0@:sf=^J:so=\E0P:up=^Z: # The intertube 2 has the "full duplex" problem like the tek 4025: if you # are typing and a command comes in, the keystrokes you type get interspersed # with the command and it messes up intertube2|intertec data systems intertube 2:\ :bs:\ :ce=\EK:ch=\020%+^J:cm=\016%.\020%+^J:cv=\013%.:\ :ll=^K^X\r:\ :tc=intertube: #### Ithaca Intersystems # # This company made S100-bus personal computers long ago in the pre-IBM-PC # past. They used to be reachable at: # # Ithaca Intersystems # 1650 Hanshaw Road # Ithaca, New York 14850 # # However, the outfit went bankrupt years ago. # # The Graphos III was a color graphics terminal from Ithaca Intersystems. # These entries were written (originally in termcap syntax) by Brian Yandell # and Mike Meyer at the # University of Wisconsin. # (graphos: removed obsolete and syntactically incorrect :kn=4:, # removed :if=/usr/share/tabset/init.graphos: and # no such file & no :st: -- esr) graphos|graphos III:\ :am:mi:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:\ :UP=\E[%dA:al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:dm=\E[4h:do=\E[B:\ :ed=\E[4l:ei=\E[4l:ho=\E[H:im=\E[4h:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:me=\E[m:nd=\E[C:nw=^M\ED:rc=\E8:sc=\E7:\ :se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:up=\E[A:\ :ve=\Ez56;2;0;0z\Ez73z\Ez4;1;1z:\ :vs=\Ez4;2;1z\Ez56;2;80;24z: graphos-30|graphos III with 30 lines:\ :li#30:\ :vs=\Ez4;2;1z\Ez56;2;80;30z:tc=graphos: #### Modgraph # # These people used to be reachable at: # # Modgraph, Inc # 1393 Main Street, # Waltham, MA 02154 # Vox: (617)-890-5796. # # However, if you call that number today you'll get an insurance company. # I have mail from "Michael Berman, V.P. Sales, Modgraph" dated # 26 Feb 1997 that says: # # Modgraph GX-1000, replaced by GX-2000. Both are out of production, have been # for ~7 years. Modgraph still in business. Products are rugged laptop and # portable PC's and specialized CRT and LCD monitors (rugged, rack-mount # panel-mount etc). I can be emailed at sonfour@aol.com # modgraph|mod24|modgraph terminal emulating vt100:\ :xn@:\ :co#80:li#24:\ :is=\E\1369;0s\E\1367;1s\E[3g\E\13611;9s\E\13611;17s\E\13611;25s\E\13611;33s\E\13611;41s\E\13611;49s\E\13611;57s\E\13611;65s\E\13611;73s\E\13611;81s\E\13611;89s:\ :rf@:sr=5\EM\E[K:vs=\E\1369;0s\E\1367;1s:\ :tc=vt100: # The GX-1000 manual is dated 1984. This looks rather like a VT-52. modgraph2|modgraph gx-1000 80x24 with keypad not enabled:\ :am:da:db:\ :co#80:it#8:li#24:\ :cd=50\EJ:ce=3\EK:cl=50\EH\EJ:cm=5\EY%+ %+ :\ :is=\E<\E\1365;2s\E\1367;1s\E[3g\E\13611;9s\E\13611;17s\E\13611;25s\E\13611;33s\E\13611;41s\E\13611;49s\E\13611;57s\E\13611;65s\E\13611;73s\E\13611;81s\E\13611;89s\E\13612;0s\E\13614;2s\E\13615;9s\E\13625;1s\E\1369;1s\E\13627;1:\ :le=^H:nd=2\EC:sr=5\EI:ta=^I:up=2\EA: # # Modgraph from Nancy L. Cider # BUG NOTE from Barbara E. Ringers : # If we set TERM=vt100, and set the Modgraph screen to 24 lines, setting a # mark and using delete-to-killbuffer work correctly. However, we would # like normal mode of operation to be using a Modgraph with 48 line setting. # If we set TERM=mod (which is a valid entry in termcap with 48 lines) # the setting mark and delete-to-killbuffer results in the deletion of only # the line the mark is set on. # We've discovered that the delete-to-killbuffer works correctly # with TERM=mod and screen set to 80x48 but it's not obvious. Only # the first line disappears but a ctrl-l shows that it did work # correctly. modgraph48|mod|Modgraph w/48 lines:\ :am:bs:pt:xn:\ :co#80:it#8:li#48:vt#3:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:do=^J:ho=\E[H:\ :is=\E<\E[1;48r\E[0q\E[3;4q\E=\E[?1h:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:r1=\E=\E[0q\E>:rc=\E8:\ :sc=\E7:se=\E[m:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[0q\E[1;2q\E[?5l\E[0q\E[4;3q: #### Morrow Designs # # This was George Morrow's company. They started in the late 1970s making # S100-bus machines. They used to be reachable at: # # Morrow # 600 McCormick St. # San Leandro, CA 94577 # # but they're long gone now (1995). # # The mt70 terminal was shipped with the Morrow MD-3 microcomputer. # Jeff's specimen was dated June 1984. # From: Jeff Wieland 24 Feb 1995 mt70|mt-70|Morrow MD-70; native Morrow mode:\ :am:mi:ms:xo:\ :co#80:it#8:li#24:\ :%1=^AO\r:F1=^A`\r:F2=^Aa\r:F3=^Ab\r:F4=^Ac\r:F5=^Ad\r:\ :F6=^Ae\r:F7=^Af\r:F8=^Ag\r:F9=^Ah\r:FA=^Ai\r:\ :ac=+z\054{.yOi-x`|jGkFlEmDnHtLuKvNwMxIqJ:ae=\E%:\ :al=\EE:as=\E$:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=^Z:\ :cm=\E=%+ %+ :cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ei=:ho=^^:\ :i1=\E"2\EG0\E]:ic=\EQ:im=:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:\ :k;=^AI\r:kB=^A^Z\r:kC=^An\r:kD=\177:kb=^H:kd=^AK\r:\ :kh=^AN\r:kl=^AL\r:kr=^AM\r:ku=^AJ\r:le=^H:mh=\EG2:mk@:\ :nd=^L:nw=^_:sf=^J:ta=^I:te=:ti=\E"2\EG0\E]:up=^K:us=\EG1:\ :vb=\EK1\EK0:ve=\E"2:vi=\E"0:\ :tc=adm+sgr: #### Motorola # # Motorola EXORterm 155 from {decvax, ihnp4}!philabs!sbcs!megad!seth via BRL # (Seth H Zirin) ex155|Motorola Exorterm 155:\ :am:bs:bw:\ :co#80:kn#5:li#24:ug#1:\ :bt=\E[:cd=\ET:ce=\EU:cl=\EX:cm=\EE%+ %+ :do=\EB:ho=\E@:\ :kB=\E[:kC=\EX:kE=\EU:kS=\ET:kb=^H:kd=^J:kh=\E@:kl=^H:kr=^L:\ :ku=^K:nd=\ED:se=\Ec\ED:so=\Eb\ED:ta=\EZ:ue=\Eg\ED:\ :us=\Ef\ED: #### Omron # # This company is still around in 1995, manufacturing point-of-sale systems. omron|Omron 8025AG:\ :am:bs:da:db:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\ER:ce=\EK:cl=\EJ:cr=^M:dc=\EP:dl=\EM:do=^J:\ :ho=\EH:le=^H:nd=\EC:se=\E4:sf=\ES:so=\Ef:sr=\ET:up=\EA:\ :vs=\EN: #### Ramtek # # Ramtek was a vendor of high-end graphics terminals around 1979-1983; they # were competition for things like the Tektronics 4025. # # Ramtek 6221 from BRL, probably by Doug Gwyn # The following SET-UP modes are assumed for normal operation: # UNDERLINE_CURSOR ANSI_MODE AUTO_XON/XOFF_ON # NEWLINE_OFF 80_COLUMNS # Other SET-UP modes may be set for operator convenience or communication # requirements; I recommend # SMOOTH_SCROLL AUTO_REPEAT_ON 3_#_SHIFTED WRAP_AROUND_ON # Hardware tabs are assumed to be every 8 columns; they can be set up by the # "reset", "tset", or "tabs" utilities (use rt6221-w, 160 columns, for this). # Note that the Control-E key is useless on this brain-damaged terminal. No # delays are specified; use "stty ixon -ixany" to enable DC3/DC1 flow control! rt6221|Ramtek 6221, 80x24:\ :bs:ms:pt:xo:\ :co#80:it#8:kn#4:li#24:vt#3:\ :DO=\E[%dB:LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ac=:ae=\E(B:as=\E(0:\ :bl=^G:cd=\E[J:ce=\E[K:cl=\E[1;1H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^K:ho=\E[1;1H:is=:\ :k0=\EOP:k1=\EOQ:k2=\EOR:k3=\EOS:kb=^H:kd=\E[B:ke=\E>:\ :kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:l0=PF1:l1=PF2:l2=PF3:l3=PF4:\ :le=^H:ll=\E[24;1H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:nw=\EE:\ :r1=\E[1w\E[>37m\E[>39m\E[1v\E[20l\E[?3l\E[?6l\E[>5h\E[>6h\E[>7h\E[>8l\E[>9h\E[>10l\E[1;24r\E[m\E[q\E(B\017\E#5\E>:\ :rc=\E8:sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ue=\E[m:up=\EM:us=\E[4m:ve=\E[>5h\E[>9h:vi=\E[>5l:\ :vs=\E[>7h\E[>9l: # [TO DO: Check out: short forms of ho/cl and ll; reset (\Ec)]. rt6221-w|Ramtek 6221, 160x48:\ :co#160:li#48:\ :ll=\E[48;1H:tc=rt6221: #### RCA # # RCA VP3301 or VP3501 rca|rca vp3301/vp3501:\ :bs:\ :co#40:li#24:\ :cl=^L:cm=\EY%+ %+ :ho=^Z:nd=^U:se=\E\ES0:so=\E\ES1:up=^K: #### Selanar # # Selanar HiREZ-100 from BRL, probably by Doug Gwyn # The following SET-UP modes are assumed for normal operation: # SET_DEFAULT_TABS 48_LINES 80_COLUMNS # ONLINE ANSI CURSOR_VISIBLE # VT102_AUTO_WRAP_ON VT102_NEWLINE_OFF VT102_MONITOR_MODE_OFF # LOCAL_ECHO_OFF US_CHAR_SET WPS_TERMINAL_DISABLED # CPU_AUTO_XON/XOFF_ENABLED PRINT_FULL_SCREEN # For use with graphics software, all graphics modes should be set to factory # default. Other SET-UP modes may be set for operator convenience or # communication requirements. No delays are specified; use "stty ixon -ixany" # to enable DC3/DC1 flow control! # I commented out the scrolling capabilities since they are too slow. hirez100|Selanar HiREZ-100:\ :bs:mi:ms:pt:xo:\ :co#80:it#8:kn#4:li#48:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ac=:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:\ :dc=\E[P:dl=\E[M:do=^J:ho=\E[H:is=\E<:k0=\EOP:k1=\EOQ:\ :k2=\EOR:k3=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l0=PF1:l1=PF2:l2=PF3:l3=PF4:\ :le=^H:ll=\E[48H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:nw=\EE:pf=\E[4i\E[?4i:po=\E[?5i\E[5i:ps=\E[i:\ :r1=\030\E2\E<\E[4i\E[?4i\E[12h\E[2;4;20l\E[?0;7h\E[?1;3;6;19l\E[r\E[m\E(B\017\E>:\ :rc=\E8:sc=\E7:se=\E[m:so=\E[7m:st=\EH:ta=^I:ue=\E[m:up=\EM:\ :us=\E[4m: hirez100-w|Selanar HiREZ-100 in 132-column mode:\ :co#132:tc=hirez100: #### Signetics # # From University of Wisconsin vsc|Signetics Vsc Video driver by RMC:\ :am:ms:\ :co#80:it#8:li#26:\ :ce=\E[K:cl=50\E[;H\E[2J:cm=\E[%i%d;%dH:cr=^M:do=^J:\ :ho=\E[H:kb=^H:kd=^J:kl=^H:le=^H:me=^_\041:mr=^_ :nd=\E[C:\ :nw=^M^J:se=^_\041:sf=^J:so=^_ :ta=^I:ue=^_#:up=\E[A:us=^_": #### Soroc # # Alan Frisbie writes: # # As you may recall, the Soroc logo consisted of their name, # with the letter "S" superimposed over an odd design. This # consisted of a circle with a slightly smaller 15 degree (approx.) # wedge with rounded corners inside it. The color was sort of # a metallic gold/yellow. # # If I had been more of a beer drinker it might have been obvious # to me, but it took a clue from their service department to make # me exclaim, "Of course!" The circular object was the top of # a beer can (the old removable pop-top style) and "Soroc" was an # anagram for "Coors". # # I can just imagine the founders of the company sitting around # one evening, tossing back a few and trying to decide what to # call their new company and what to use for a logo. # # (soroc120: removed obsolete ":ma=^K^P^R^L^L :" -- esr) soroc120|iq120|soroc|soroc iq120:\ :cd=\EY:ce=\ET:cl=\E*:do=^J:kd=^J:kl=^H:kr=^L:ku=^K:tc=adm3a: soroc140|iq140|soroc iq140:\ :am:bs:mi:\ :co#80:li#24:\ :al=\Ee:bl=^G:bt=\EI:cd=\Ey:ce=\Et:cl=\E+:cm=\E=%+ %+ :\ :cr=^M:dc=\Ew:dl=\Er:do=^J:ei=\E8:ho=^^:im=\E9:k0=^A0\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:kh=^^:kr=^L:ku=^K:le=^H:\ :ll=^^^K:nd=^L:se=\E\177:sf=^J:so=\E\177:ue=\E^A:up=^K:\ :us=\E^A: #### Southwest Technical Products # # These guys made an early personal micro called the M6800. # The ct82 was probably its console terminal. # # (swtp: removed obsolete ":bc=^D:" -- esr) swtp|ct82|southwest technical products ct82:\ :am:\ :co#82:li#20:\ :al=^^Y:bl=^G:cd=^V:ce=^F:cl=^L:cm=\013%r%.%.:cr=^M:dc=^^H:\ :dl=^Z:do=^J:ei=:ho=^P:ic=^^X:im=:\ :is=\034\022\036\023\036\004\035\027\011\023\036\035\036\017\035\027\022\011:\ :le=^D:ll=^C:nd=^S:se=^^^F:sf=^N:so=^^^V:sr=^O:up=^A: #### Synertek # # Bob Manson writes (28 Apr 1995): # # Synertek used to make ICs, various 6502-based single-board process # control and hobbyist computers, and assorted peripherals including a # series of small inexpensive terminals (I think they were one of the # first to have a "terminal-on-a-keyboard", where the terminal itself # was only slightly larger than the keyboard). # # They apparently had a KTM-1 model, which I've never seen. The KTM-2/40 # was a 40x24 terminal that could connect to a standard TV through a # video modulator. The KTM-2/80 was the 80-column version (the 2/40 # could be upgraded to the 2/80 by adding 2 2114 SRAMs and a new ROM). # I have a KTM-2/80 still in working order. The KTM-2s had fully # socketed parts, used 2 6507s, a 6532 as keyboard scanner, a program # ROM and 2 ROMs as character generators. They were incredibly simple, # and I've never had any problems with mine (witness the fact that mine # was made in 1981 and is still working great... I've blown the video # output transistor a couple of times, but it's a 2N2222 :-) # # The KTM-3 (which is what is listed in the terminfo file) was their # attempt at putting a KTM-2 in a box (and some models came with a # CRT). It wasn't much different from the KTM-2 hardware-wise, but the # control and escape sequences are very different. The KTM-3 was always # real broken, at least according to the folks I've talked to about it. # # The padding in the entry is probably off--these terminals were very # slow (it takes like 100ms for the KTM-2 to clear the screen...) And # anyone with any sanity replaced the ROMs with something that provided # a reasonable subset of VT100 functionality, since the usual ROMs were # obviously very primitive... oh, you could get an upgraded ROM from # Synertek for some incredible amount of money, but what hacker with an # EPROM burner would do that? :) # # Sorry I don't have any contact info; I believe they were located in # Sunnyvale, and I'm fairly sure they are still manufacturing ICs # (they've gone to ASICs and FPGAs), but I doubt they're in the computer # business these days. # # Tested, seems to work fine with vi. synertek|ktm|synertek380|synertek ktm 3/80 tubeless terminal:\ :am:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=^Z:cm=\E=%+ %+ :le=^H:nd=^L:up=^K: #### Tab Office Products # # TAB Products Co. - Palo Alto, California # Electronic Office Products, # 1451 California Avenue 94304 # # I think they're out of business. # # The tab 132 uses xon/xoff, so no padding needed. # :ks:/:ke: have nothing to do with arrow keys. # :is: sets 80 col mode, normal video, autowrap on (for :am:). # Seems to be no way to get rid of status line. # The manual for this puppy was dated June 1981. It claims to be VT52- # compatible but looks more vt100-like. tab132|tab|tab132-15|tab 132/15:\ :da:db:\ :co#80:dN@:li#24:lm#96:\ :al=\E[L:cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:do=^J:ei=\E[4l:\ :im=\E[4h:is=\E[?7h\E[?3l\E[?5l:kd=\E[B:ke@:kl=\E[D:ks@:\ :ku=\E[A:\ :tc=vt100: tab132-w|tab132 in wide mode:\ :co#132:\ :is=\E[?7h\E[?3h\E[?5l:tc=tab132: tab132-rv|tab132 in reverse-video mode:\ :is=\E[?7h\E[?3l\E[?5h:tc=tab132: tab132-w-rv|tab132 in reverse-video/wide mode:\ :is=\E[?7h\E[?3h\E[?5h:tc=tab132-w: #### Teleray # # Research Incorporated # 6425 Flying Cloud Drive # Eden Prairie, MN 55344 # Vox: (612)-941-3300 # # The Teleray terminals were all discontinued in 1992-93. RI still services # and repairs these beasts, but no longer manufactures them. The Teleray # people believe that all the types listed below are very rare now (1995). # There was a newer line of Telerays (Model 7, Model 20, Model 30, and # Model 100) that were ANSI-compatible. # # Note two things called "teleray". Reorder should move the common one # to the front if you have either. A dumb teleray with the cursor stuck # on the bottom and no obvious model number is probably a 3700. # t3700|dumb teleray 3700:\ :bs:\ :co#80:li#24:\ :bl=^G:cl=^L:cr=^M:do=^J:le=^H:sf=^J: t3800|teleray 3800 series:\ :bs:\ :co#80:it#8:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=^L:cm=\EY%+ %+ :cr=^M:do=^J:ho=\EH:\ :le=^H:ll=\EY7 :nd=\EC:sf=^J:ta=^I:up=^K: t1061|teleray|teleray 1061:\ :am:bs:km:xs:xt:\ :co#80:it#8:li#24:sg#1:ug#1:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\014:cm=\EY%+ %+ :cr=^M:\ :ct=\EG:dc=\EQ:dl=\EM:do=^J:ei=:ho=\EH:ic=\EP:im=:ip=:\ :is=\Ee\EU01^Z1\EV\EU02^Z2\EV\EU03^Z3\EV\EU04^Z4\EV\EU05^Z5\EV\EU06^Z6\EV\EU07^Z7\EV\EU08^Z8\EV\Ef:\ :k1=^Z1:k2=^Z2:k3=^Z3:k4=^Z4:k5=^Z5:k6=^Z6:k7=^Z7:k8=^Z8:\ :le=^H:nd=\EC:se=\ER@:sf=^J:so= \ERD:st=\EF:ta=^I:ue=\ER@:\ :up=\EA:us=\ERH: t1061f|teleray 1061 with fast PROMs:\ :al=\EL:dl=\EM:ip@:tc=t1061: # "Teleray Arpa Special", officially designated as # "Teleray Arpa network model 10" with "Special feature 720". # This is the new (1981) fast microcode updating the older "arpa" proms # (which gave meta-key and programmable-fxn keys). 720 is much much faster, # converts the keypad to programmable function keys, and has other goodies. # Standout mode is still broken (magic cookie, etc) so is suppressed as no # programs handle such lossage properly. # Note: this is NOT the old termcap's "t1061f with fast proms." # From: J. Lepreau Tue Feb 1 06:39:37 1983, Univ of Utah # (t10: removed overridden ":so@:se@:us@:ue@:" -- esr) t10|teleray 10 special:\ :bs:km:xs:xt:\ :co#80:it#8:li#24:sg#2:ug#2:\ :al=\EL:cd=\EJ:ce=\EK:cl=30\Ej:cm=\EY%+ %+ :dc=\EQ:dl=\EM:\ :ei=:ho=\EH:ic=\EP:im=:le=^H:nd=\EC:pc=\200:se=\ER@:sf=\Eq:\ :so=\ERD:sr=\Ep:ta=^I:ue=\ER@:up=\EA:us=\ERH: # teleray 16 - map the arrow keys for vi/rogue, shifted to up/down page, and # back/forth words. Put the function keys (f1-f10) where they can be # found, and turn off the other magic keys along the top row, except # for line/local. Do the magic appropriate to make the page shifts work. # Also toggle ^S/^Q for those of us who use Emacs. t16|teleray 16:\ :am:da:db:mi:xs:xt:\ :co#80:li#24:\ :al=\E[L:bl=^G:cd=\E[0J:ce=\E[0K:cl=\E[H\E[2J:\ :cm=%i\E[%d;%df:cr=^M:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:\ :ho=\E[H:im=\E[4h:k1=^Z1:k2=^Z2:k3=^Z3:k4=^Z4:k5=^Z5:k6=^Z6:\ :k7=^Z7:k8=^Z8:k9=^Z9:k;=^Z0:le=^H:me=\E[m:nd=\E[C:se=\E[m:\ :sf=^J:so=\E[7m:sr=\E[T:ta=^I:te=\E[V\E[24;1f\E[?38h:\ :ti=\E[U\E[?38l:ue=\E[m:up=\E[A:us=\E[4m: #### Texas Instruments (ti) # # The Silent 700 was so called because it was built around a quiet thermal # printer. It was portable, equipped with an acoustic coupler, and pretty # neat for its day. ti700|ti733|ti735|ti745|ti800|ti silent 700/733/735/745 or omni 800:\ :bs:hc:os:\ :co#80:\ :bl=^G:cr=\r:do=^J:le=^H:sf=^J: # # Texas Instruments 916 VDT 7 bit control mode # ti916|ti916-220-7|Texas Instruments 916 VDT 8859/1 vt220 mode 7 bit CTRL:\ :da:db:in:ms:\ :%9=^X:@4=\E[29~:@8=^J:AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:\ :DO=\E[%dB:F1=\E[29~:F2=\E[31~:IC=\E[%d@:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:as=\E(0:bt=\E[Z:cb=\E[1K:\ :cd=\E[J:ce=\E[0K:ch=\E[%+^AG:cl=\E[H\E[2J:\ :cm=\E[%i%d;%dH:ct=\E[3g:cv=\E[%+^Ad:dc=\E[P:eA=\E(B:\ :ec=\E[%dX:ei=:ff=^L:im=:ip=:is=\E[1;24r\E[24;1H:k1=\E[17~:\ :k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:k6=\E[23~:\ :k7=\E[24~:k8=\E[25~:k9=\E[26~:k;=\E[28~:kD=\E[P:kI=\E[@:\ :kN=\E[S:kP=\E[T:kh=\E[H:mp=\E&:r2=\E[\041p:st=\E[0W:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h:\ :tc=vt220: # # Texas Instruments 916 VDT 8 bit control mode # ti916-8|ti916-220-8|Texas Instruments 916 VDT 8859/1 8 vt220 mode bit CTRL:\ :%9=^X:@4=\23329~:@8=^J:F1=\23329~:F2=\23331~:k1=\23317~:\ :k2=\23318~:k3=\23319~:k4=\23320~:k5=\23321~:k6=\23323~:\ :k7=\23324~:k8=\23325~:k9=\23326~:k;=\23328~:kD=\233P:\ :kI=\233@:kN=\233S:kP=\233T:kd=\233B:kh=\233H:kl=\233D:\ :kr=\233C:ku=\233A:\ :tc=ti916: # # Texas Instruments 916 VDT 8859/1 7 bit control 132 column mode # ti916-132|Texas Instruments 916 VDT vt220 132 column:\ :co#132:tc=ti916: # # Texas Instruments 916 VDT 8859/1 8 bit control 132 column mode # ti916-8-132|Texas Instruments 916 VDT vt220 132 column:\ :co#132:tc=ti916-8: ti924|Texas Instruments 924 VDT 8859/1 7 bit CTRL:\ :am:bs:xo:\ :co#80:it#8:li#24:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:\ :cm=%i\E[%d;%dH:cr=^M:cs=%i\E[%d;%dr:ct=\E[3g:dl=\E[M:\ :do=\E[B:ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[16~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kD=\E[P:kI=\E[@:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:\ :us=\E[4m:ve=\E[?25h:vi=\E[?25l:vs=\E[?31h: ti924-8|Texas Instruments 924 VDT 8859/1 8 bit CTRL:\ :am:xo:\ :co#80:it#8:li#24:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:\ :cm=%i\E[%d;%dH:cr=^M:cs=%i\E[%d;%dr:ct=\E[3g:dl=\E[M:\ :do=\E[B:ho=\E[H:k1=P\217>:k2=Q\217>:k3=R\217>:k4=S\217>:\ :k5=~\23316>:k6=~\23317>:k7=~\23318>:k8=~\23319>:\ :k9=~\23320>:kD=P\233>:kI=@\233>:kb=^H:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=\E[D:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:rc=\E8:sc=\E7:se=\E[m:sf=\ED:so=\E[7m:\ :sr=\EM:st=\EH:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:\ :vi=\E[?25l:vs=\E[?31h: ti924w|Texas Instruments 924 VDT 7 bit - 132 column mode:\ :co#132:tc=ti924: ti924-8w|Texas Instruments 924 VDT 8 bit - 132 column mode:\ :co#132:tc=ti924-8: ti931|Texas Instruments 931 VDT:\ :am:bs:xo:\ :co#80:li#24:\ :al=\EN:bl=^G:cd=\EJ:ce=\EI:cl=\EL:cm=\EY%+ %+ :cr=^M:\ :dc=\EQ:dl=\EO:do=\EB:ei=:ho=\EH:ic=\ER\EP\EM:im=:\ :is=\EGB\E(@B@@\E):k1=\Ei1:k2=\Ei2:k3=\Ei3:k4=\Ei4:\ :k5=\Ei5:k6=\Ei6:k7=\Ei7:k8=\Ei8:k9=\Ei9:kA=\EN:kD=\EQ:\ :kI=\EP:kL=\EO:kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=\ED:mb=\E4P:\ :me=\E4@:mk=\E4H:mr=\E4B:nd=\EC:se=\E4@:sf=\Ea:so=\E4A:\ :sr=\Eb:ue=\E4@:up=\EA:us=\E4D:ve=\E4@: ti926|Texas Instruments 926 VDT 8859/1 7 bit CTRL:\ :cs@:sf=\E[1S:sr=\E[1T:tc=ti924: # (ti926-8: I corrected this from the broken SCO entry -- esr) ti926-8|Texas Instruments 926 VDT 8859/1 8 bit CTRL:\ :cs@:sf=\2331S:sr=\2331T:\ :tc=ti924-8: ti_ansi|basic entry for ti928:\ :am:eo:ut:xn:xo:\ :Co#8:co#80:it#8:li#25:pa#64:\ :@7=\E[F:Sb=\E[4%dm:Sf=\E[3%dm:al=\E[L:bl=^G:bt=\E[Z:\ :cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[@:im=:k0=\E[V:k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:\ :k5=\E[Q:k6=\E[R:k7=\E[S:k8=\E[T:k9=\E[U:kN=\E[G:kP=\E[I:\ :kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:nd=\E[C:op=\E[37;40m:se=\E[m:\ :sf=\E[S:so=\E[7m:sr=\E[T:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # # 928 VDT 7 bit control mode # ti928|Texas Instruments 928 VDT 8859/1 7 bit CTRL:\ :%9=\E[35~:@7=\E_1\E\:@8=\E[8~:F1=\E[29~:F2=\E[31~:\ :F3=\E[32~:F5=\E[34~:k1=\E[17~:k2=\E[18~:k3=\E[19~:\ :k4=\E[20~:k5=\E[21~:k6=\E[23~:k7=\E[24~:k8=\E[25~:\ :k9=\E[26~:k;=\E[28~:kD=\E[P:kI=\E[@:kN=\E[S:kP=\E[T:\ :tc=ti_ansi: # # 928 VDT 8 bit control mode # ti928-8|Texas Instruments 928 VDT 8859/1 8 bit CTRL:\ :%9=\23335~:@7=\2371\234:@8=\2338~:F1=\23329~:F2=\23331~:\ :F3=\23332~:F5=\23334~:k1=\23317~:k2=\23318~:k3=\23319~:\ :k4=\23320~:k5=\23321~:k6=\23323~:k7=\23324~:k8=\23325~:\ :k9=\23326~:k;=\23328~:kD=\233P:kI=\233@:kN=\233S:\ :kP=\233T:kh=\233H:\ :tc=ti_ansi: #### Zentec (zen) # # (zen30: removed obsolete :ma=^L ^R^L^K^P:. This entry originally # had just :so:=\EG6 which I think means standout was supposed to be # dim-reverse using ADM12-style attributes. ADM12 :us:/:ue: and # might work-- esr) zen30|z30|zentec 30:\ :am:bs:mi:ul:\ :co#80:li#24:\ :al=\EE:bl=^G:cd=\EY:ce=\ET:cl=\E*:cm=\E=%+ %+ :cr=^M:\ :dc=\EW:dl=\ER:do=^J:ei=\Er:ho=^^:im=\Eq:le=^H:mh=\EG2:nd=^L:\ :sf=^J:so=\EG6:ue@:up=^K:us@:\ :tc=adm+sgr: # (zen50: this had extension capabilities # :BS=^U:CL=^V:CR=^B: # UK/DK/RK/LK/HM were someone's aliases for ku/kd/kl/kr/kh, # which were also in the original entry -- esr) # (zen50: removed obsolete ":ma=^Hh^Ll^Jj^Kk:" -- esr) zen50|z50|zentec zephyr:\ :am:bs:\ :co#80:li#24:sg#1:\ :al=\EE:cd=\EY:ce=\ET:cl=\E+:cm=\E=%+ %+ :dc=\EW:dl=\ER:ei=:\ :ic=\EQ:im=:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:le=^H:mk@:ue@:up=^K:\ :us@:\ :tc=adm+sgr: # CCI 4574 (Office Power) from Will Martin via BRL cci|cci1|z8001|zen8001|CCI Custom Zentec 8001:\ :am:bs:bw:\ :co#80:li#24:\ :cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cs=\ER%+ %+ :do=^J:\ :ho=\EH:is=\EM \EF\ET\EP\ER 7:kb=^H:kd=\EB:kh=\EH:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:mb=\EM":me=\EM :mh=\EM\041:mk=\EM(:\ :mr=\EM$:nd=\EC:pf=^T:po=^R:se=\EM :so=\EM$:sr=\EI:ue=\EM :\ :up=\EA:us=\EM0:ve=\EP:vs=\EF\EQ\EM \ER 7: ######## OBSOLETE UNIX CONSOLES # #### Apollo consoles # # Apollo got bought by Hewlett-Packard. The Apollo workstations are # labeled HP700s now. # # From: Gary Darland apollo|apollo console:\ :am:bs:mi:\ :co#88:li#53:\ :al=\EI:cd=\EJ:ce=\EK:ch=\EN%d:cl=^L:cm=\EM%+ %d):cv=\EO+ :\ :dc=\EP:dl=\EL:do=\EB:ei=\ER:im=\EQ:le=^H:nd=\EC:se=\ET:\ :sf=\EE:so=\ES:sr=\ED:te=\EX:ti=\EW:ue=\EV:up=\EA:us=\EU: # We don't know whether or not the apollo guys replicated DEC's firmware bug # in the VT132 that reversed :ei:/:im:. To be on the safe side, disable # both these capabilities. apollo_15P|apollo 15 inch display:\ :ei@:im@:tc=vt132: apollo_19L|apollo 19 inch display:\ :ei@:im@:tc=vt132: apollo_color|apollo color display:\ :ei@:im@:tc=vt132: #### Convergent Technology # # Burroughs bought Convergent shortly before it merged with Univac. # CTOS is (I believe) dead. Probably the aws is too (this entry dates # from 1991 or earlier). # # Convergent AWS workstation from Gould/SEL UTX/32 via BRL # (aws: removed unknown :dn=^K: -- esr) aws|Convergent Technologies AWS workstation under UTX,Xenix:\ :am:\ :co#80:li#28:sg#0:ug#0:\ :ac=:ae=\EAAF:al=\EIL:as=\EAAN:bc=^H:cd=\EEF:ce=\EEL:\ :ch=\EH%.:cl=^L:cm=\EC%r%.%.:cv=\EV%.:dc=\EDC:dl=\EDL:\ :do=^K:ei=:ic=\EIC:im=:kb=^H:kd=^K:kl=^N:kr=^R:ku=^A:\ :ma=\016h\013j\001k\022l\002m:nd=^R:nl=^J:se=\EARF:\ :sf=\ESU:so=\EARN:sr=\ESD:ue=\EAUF:up=^A:us=\EAUN: awsc|Convergent Technologies AWS workstation under CTOS:\ :am:\ :co#80:li#24:sg#0:ug#0:\ :ac=:ae=\EAAF:as=\EAAN:bc=^N:cd=\EEF:ce=\EEL:cl=^L:\ :cm=\EC%r%.%.:do=^K:kb=^H:kd=^K:kl=^N:kr=^R:ku=^A:\ :ma=\016h\013j\001k\022l\002m:nd=^R:se=\EAA:so=\EAE:\ :ue=\EAA:up=^A:us=\EAC: #### DEC consoles # # The MicroVax console. Tim Theisen writes: # The digital uVax II's had a graphic display called a qdss. It was # supposed to be a high performance graphic accelerator, but it was # late to market and barely appeared before faster dumb frame buffers # appeared. I have only used this display while running X11. However, # during bootup, it was in text mode, and probably had a terminal emulator # within it. And that is what your termcap entry is for. In graphics # mode the screen size is 1024x864 pixels. qdss|qdcons|qdss glass tty:\ :am:bs:\ :co#128:li#57:\ :cl=1\032:cm=\E=%.%.:do=^J:le=^H:nd=^L:up=^K: #### Fortune Systems consoles # # Fortune made a line of 68K-based UNIX boxes that were pretty nifty # in their day; I (esr) used one myself for a year or so around 1984. # They had no graphics, though, and couldn't compete against Suns and # the like. R.I.P. # # From: Robert Nathanson via tut Wed Oct 5, 1983 # (This had extension capabilities # :rv=\EH:re=\EI:rg=0:GG=0:\ # :CO=\E\\:WL=^Aa\r:WR=^Ab\r:CL=^Ac\r:CR=^Ad\r:DL=^Ae\r:RF=^Af\r:\ # :RC=^Ag\r:CW=^Ah\r:NU=^Aj\r:EN=^Ak\r:HM=^Al:PL=^Am\r:\ # :PU=^An\r:PD=^Ao\r:PR=^Ap\r:HP=^A@\r:RT=^Aq\r:TB=\r:CN=\177:MP=\E+F: # It had both ":bs:" and ":bs=^H:"; I removed the latter. Also, it had # ":sg=0:" and ":ug=0:"; evidently the composer was trying (unnecessarily) # to force both magic cookie glitches off. Once upon a time, I # used a Fortune myself, so I know the capabilities of the form ^A[a-z]\r are # function keys; thus the "Al" value for HM was certainly an error. I renamed # EN/PD/PU/CO/CF/RT according to the XENIX/TC mappings, but not HM/DL/RF/RC. # I think :rv: and :re: are start/end reverse video and :rg: is a nonexistent # "reverse-video-glitch" capability; I have put :rv: and :re: in with standard # names below. I've removed obsolete ":nl=5^J:" as there is a :do: -- esr) fos|fortune|Fortune system:\ :am:bs:bw:\ :co#80:li#25:\ :@7=^Ak\r:@8=^Aq:ac=l m"k(j*v%w#q&x-:ae=^O:al=\034E:\ :as=\Eo:bl=^G:cd=\034Y:ce=^\Z:cl=\014:cm=\034C%+ %+ :cr=^M:\ :dc=\034W:dl=\034R:do=\n:ei=:ho=\036:ic=\034Q:im=:is=^_..:\ :k1=^Aa\r:k2=^Ab\r:k3=^Ac\r:k4=^Ad\r:k5=^Ae\r:k6=^Af\r:\ :k7=^Ag\r:k8=^Ah\r:kN=^Ao\r:kP=^An\r:kb=^H:kd=^Ay\r:\ :kh=^A?\r:kl=^Aw\r:kr=^Az\r:ku=^Ax\r:le=^H:mb=\EN:me=\EI:\ :mr=\EH:nw=^M^J:se=^\I`:sf=^J:so=^\H`:ta=^Z:ue=^\IP:up=\013:\ :us=^\HP:ve=\E\:vi=\E]:vs=\E\072: #### Masscomp consoles # # Masscomp has gone out of business. Their product line was purchased by # comany in Georgia (US) called "XS International", parts and service may # still be available through them. # # (masscomp: ":MT:" changed to ":km:"; -- esr) masscomp|masscomp workstation console:\ :bs:km:mi:\ :co#80:it#8:li#24:\ :al=\E[L:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%d;%dH:dc=\E[P:\ :dl=\E[M:do=\E[B:ei=\E[4l:im=\E[4h:is=\EGc\EGb\EGw:kb=^H:\ :kd=\EOB:kl=\EOD:kr=\EOC:ku=\EOA:le=^H:nd=\E[C:se=\E[m:\ :so=\E[7m:ta=^I:ue=\EGau:up=\E[A:us=\EGu: masscomp1|masscomp large screen version 1:\ :co#104:li#36:tc=masscomp: masscomp2|masscomp large screen version 2:\ :co#64:li#21:tc=masscomp: ######## OTHER OBSOLETE TYPES # # These terminals are *long* dead -- these entries are retained for # historical interest only. # #### Obsolete non-ANSI software emulations # # CTRM terminal emulator # 1. underlining is not allowed with colors: first, is is simulated by # black on white, second, it disables background color manipulations. # 2. BLINKING, REVERSE and BOLD are allowed with colors, # so we have to save their status in the static registers A, B and H # respectively, to be able to restore them when color changes # (because any color change turns off ALL attributes) # 3. :md: and :mr: sequences alternate modes, # rather then simply entering them. Thus we have to check the # static register B and H to determine the status, before sending the # escape sequence. # 4. :me: now must set the status of all 3 register (A,B,H) to zero # and then reset colors # 5. implementation of the protect mode would badly penalize the performance. # we would have to use \E&bn sequence to turn off colors (as well as all # other attributes), and keep the status of protect mode in yet another # static variable. If someone really needs this mode, they would have to # create another terminfo entry. # 6. original color-pair is white on black. # store the information about colors into static registers # 7. set foreground color. it performs the following steps. # 1) turn off all attributes # 2) turn on the background and video attributes that have been turned # on before (this information is stored in static registers X,Y,Z,A,B,H,D). # 3) turn on foreground attributes # 4) store information about foreground into U,V,W static registers # 8. turn on background: similar to turn on foreground above # (untranslatable capabilities removed to fit entry within 1023 bytes) ctrm|C terminal emulator:\ :am:ut:xo:\ :Co#8:NC#2:Nl#0:co#80:lh#0:li#24:lm#0:lw#0:pa#63:pb#19200:vt#6:\ :al=\EL:bl=^G:bt=\Ei:cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:\ :cm=\E&a%r%dc%dY:cr=^M:ct=\E3:cv=\E&a%dY:dc=\EP:dl=\EM:\ :do=^J:ei=\ER:im=\EQ:ip=:is=\E&jA\r:k1=\Ep\r:k2=\Eq\r:\ :k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:k7=\Ev\r:k8=\Ew\r:\ :kb=^H:kd=\Ew\r:ke=\E&jA:kh=\Ep\r:kl=\Eu\r:kr=\Ev\r:\ :ks=\E&jB:ku=\Et\r:le=^H:mb=\E&dA%{1}%PA:\ :md=%?%gH%{0}%=%t\E&dH%{1}%PH%;:\ :me=\E&d@%{0}%PA%{0}%PB%{0}%PH:\ :mr=%?%gB%{0}%=%t\E&dB%{1}%PB%;:nd=\EC:\ :op=\E&bn\E&bB\E&bG\E&bR\n%{0}%PX%{0}%PY%{0}%PZ\n%{1}%PW%{1}%PV%{1}%PU:\ :sf=^J:so=\E&dD:st=\E1:ta=\011:up=\EA:us=\E&dD: # gs6300 - can't use blue foreground, it clashes with underline; # it's simulated with cyan # Bug: The capability probably resets attributes. # (gs6300: commented out (no ) --esr) gs6300|emots|AT&T PC6300 with EMOTS terminal emulator:\ :am:ms:ut:xo:\ :Co#8:co#80:it#8:li#24:pa#63:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:Sb=\E[?;%dm:\ :..Sf=\E[?%?%p1%{0}%=%t0\n%e%p1%{1}%=%t2\n%e%p1%{1}%-%d%;m:\ :UP=\E[%dA:\ :ac=\054\054..--++``aaffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E[10m:al=\E[L:as=\E[11m:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:\ :ei=:ho=\E[H:ic=\E[@:im=:is=\E[m:k1=\E[0s:k2=\E[24s:\ :k3=\E[1s:k4=\E[23s:k5=\E[2s:k6=\E[22s:k7=\E[3s:k8=\E[21s:\ :kB=^R^I:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m\E[10m:mr=\E[7m:nd=\E[C:\ :op=\E[?;m:pf=\E[4i:po=\E[5i:r1=\Ec:sf=^J:so=\E[1m:sr=\E[L:\ :ta=^I:up=\E[A:us=\E[4m: # From: 29 Oct 85 05:40:18 GMT # MS-Kermit with Heath-19 emulation mode enabled # (h19k: changed ":pt@:" to ":it@" h19k|h19kermit|heathkit emulation provided by Kermit (no auto margin):\ :am@:da:db:xt:\ :it@:\ :ta@:tc=h19-u: # Apple Macintosh with Versaterm, a terminal emulator distributed by Synergy # Software (formerly Peripherals Computers & Supplies, Inc) of # 2457 Perkiomen Ave., Reading, PA 19606, 1-800-876-8376. They can # also be reached at support@synergy.com. versaterm|versaterm vt100 emulator for the macintosh:\ :am:xn:\ :co#80:it#8:li#24:\ :al=9\E[1L:bl=^G:cd=50\E[J:ce=3\E[K:cl=50\E[;H\E[2J:\ :cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:dc=7\E[1P:\ :dl=9\E[1M:do=^J:ei=:ho=\E[H:ic=7\E[1@:im=:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :kb=^H:kd=\EOB:ke=\E>\E[?1l:kl=\EOD:kr=\EOC:ks=\E=\E[?1h:\ :ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:me=2\E[m:mr=2\E[7m:\ :nd=2\E[C:nw=^M^J:r1=\E>:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=2\E[m:so=2\E[7m:\ :sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:us=2\E[4m: # From: Rick Thomas # (xtalk: I added / based on the init string. # I also removed :sg#1: and the trailing \s characters from the highlight # changers, I don't believe these on a VT100-emulating PC display -- esr) xtalk|IBM PC with xtalk communication program (versions up to 3.4):\ :am:mi:ms:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:ct=\E[3g:dl=\E[M:do=^J:\ :eA=\E(B:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:me=\E[m:nd=\E[C:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:se=\E[m:sf=^J:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:up=\E[A: # The official PC terminal emulator program of the AT&T Product Centers. # Note - insert mode commented out - doesn't seem to work on AT&T PC. simterm|attpc running simterm:\ :am:\ :co#80:li#24:\ :al=\EL:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\E=%+ %+ :cr=^M:\ :dc=\ER:dl=\EM:do=\EB:ho=\EH:le=^H:me=\E&d@:nd=\EC:se=\E&d@:\ :sf=^J:so=\E&dB:te=\EVE:ti=\EVS:up=\EA: #### Daisy wheel printers # # This section collects Diablo, DTC, Xerox, Qume, and other daisy # wheel terminals. These are now largely obsolete. # # (diablo1620: removed :if=/usr/share/tabset/xerox1720:, no such file -- esr) diablo1620|diablo1720|diablo450|ipsi|diablo 1620:\ :bs:hc:os:\ :co#132:it#8:\ :ch=\E\011%i%.:ct=\E2:do=^J:hd=\ED:hu=\EU:kb=^H:le=^H:\ :st=\E1:ta=^I:up=\E^J: diablo1620-m8|diablo1640-m8|diablo 1620 w/8 column left margin:\ :co#124:\ :is=\r \E9:tc=diablo1620: # (diablo1640: removed :if=/usr/share/tabset/xerox1730:, no such file -- esr) diablo1640|diablo1730|diablo1740|diablo630|x1700|diablo|xerox|diablo 1640:\ :bl=^G:se=\E&:so=\EW:ue=\ER:us=\EE:\ :tc=diablo1620: # (diablo1640-lm: removed :if=/usr/share/tabset/xerox1730-lm:, no such # file -- esr) diablo1640-lm|diablo-lm|xerox-lm|diablo 1640 with indented left margin:\ :co#124:\ :se=\E&:so=\EW:ue=\ER:us=\EE:tc=diablo1620: diablo1740-lm|630-lm|1730-lm|x1700-lm|diablo 1740 printer:\ :tc=diablo1640-lm: # DTC 382 with VDU. Has no :cd: so we fake it with :ce:. Standout # :so=^P\s\002^PF: works but won't go away without dynamite :se=^P\s\200:. # The terminal has tabs, but I'm getting tired of fighting the braindamage. # If no tab is set or the terminal's in a bad mood, it glitches the screen # around all of memory. Note that return puts a blank ("a return character") # in the space the cursor was at, so we use ^P return (and thus ^P newline for # newline). Note also that if you turn off :pt: and let Unix expand tabs, # curses won't work (some old BSD versions) because it doesn't clear this bit, # and cursor addressing sends a tab for row/column 9. What a losing terminal! # I have been unable to get tabs set in all 96 lines - it always leaves at # least one line with no tabs in it, and once you tab through that line, # it completely weirds out. # (dtc382: change :te: to :ti: -- it just does a clear --esr) dtc382|DTC 382:\ :am:bs:da:db:xs:\ :co#80:li#24:lm#96:\ :al=^P^Z:bl=^G:cd=\020\025\020\023\020\023:ce=^P^U:\ :cl=\020\035:cm=\020\021%r%.%.:cr=^P^M:dc=^X:dl=^P^S:\ :ei=^Pi:ho=^P^R:im=^PI:le=^H:nd=^PR:pc=\177:sf=^J:te=:\ :ti=\020\035:ue=^P \200:up=^P^L:us=^P ^P:ve=^Pb:vs=^PB: dtc300s|DTC 300s:\ :bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:ct=\E3:do=^J:ff=^L:hd=\Eh:hu=\EH:kb=^H:le=^H:\ :sf=^J:st=\E1:ta=^I:up=^Z: gsi|mystery gsi terminal:\ :bs:hc:os:\ :co#132:\ :bl=^G:cr=^M:do=^J:hd=\Eh:hu=\EH:le=^H:sf=^J:ta=^I:up=^Z: aj830|aj832|aj|anderson jacobson:\ :bs:hc:os:\ :bl=^G:cr=^M:do=^J:hd=\E9:hu=\E8:le=^H:sf=^J:up=\E7: # From: Chris Torek Thu, 7 Nov 85 18:21:58 EST aj510|Anderson-Jacobson model 510:\ :am:bs:mi:\ :co#80:li#24:\ :al=2*\E&I:cd=\E'P:ce=\E'L:cl=^L:cm=\E#%+ %+ :dc=.1*\E'D:\ :dl=2*\E&D:ei=\E'J:ic=:im=\E'I:ip=.1*:kd=\EZ:kl=\EW:kr=\EX:\ :ku=\EY:le=^H:nd=\EX:pc=\177:se=\E"I:so=\E"I:te=\E"N:\ :ti=\E"N:ue=\E"U:up=\EY:us=\E"U: # From: Thu Aug 20 09:09:18 1981 # This is incomplete, but it's a start. nec5520|nec|spinwriter|nec 5520:\ :bs:hc:os:\ :co#132:it#8:\ :bl=^G:cr=^M:ct=\E3:do=^J:ff=^L:hd=\E]s\n\E]W:\ :hu=\E]s\E9\E]W:kb=^H:le=^H:sf=^J:st=\E1:ta=^I:up=\E9: qume5|qume|Qume Sprint 5:\ :bs:hc:os:\ :co#80:it#8:\ :bl=^G:cr=^M:ct=\E3:do=^J:ff=^L:hd=\Eh:hu=\EH:kb=^H:le=^H:\ :sf=^J:st=\E1:ta=^I:up=^Z: # I suspect the xerox 1720 is the same as the diablo 1620. xerox1720|x1720|x1750|xerox 1720:\ :bs:hc:os:\ :co#132:it#8:\ :bl=^G:cr=^M:ct=\E2:do=^J:ff=^L:le=^H:sf=^J:st=\E1:ta=^I: #### Miscellaneous obsolete terminals, manufacturers unknown # # If you have any information about these (like, a manufacturer's name, # and a date on the serial-number plate) please send it! cad68-3|cgc3|cad68 basic monitor transparent mode size 3 chars:\ :am:bs:\ :co#73:li#36:\ :cl=^Z:ho=^^:le=^H:nd=^L:up=^K: cad68-2|cgc2|cad68 basic monitor transparent mode size 2 chars:\ :am:bs:\ :co#85:li#39:\ :cl=^Z:ho=^^:k1=\E5:k2=\E6:k3=\E7:k4=\E8:kd=\E2:kl=\E3:\ :kr=\E4:ku=\E1:le=^H:nd=^L:se=\Em^C:so=\Em^L:up=^K: cops10|cops|cops-10|cops 10:\ :am:bw:\ :co#80:li#24:\ :bl=^G:cd=^W:ce=^V:cl=30\030:cm=\020%+ %+ :cr=^M:do=^J:\ :kb=^H:kd=^J:kh=^Y:kl=^H:kr=^L:ku=^K:le=^H:nd=^L:sf=^J:up=^K: # (d132: removed duplicate :ic=\E5:, # merged in capabilities from a BRL entry -- esr) d132|datagraphix|datagraphix 132a:\ :da:db:in:\ :co#80:li#30:\ :al=\E3:bl=^G:cl=^L:cm=\E8%i%3%3:cr=^M:dc=\E6:do=^J:ei=:\ :ho=\ET:ic=\E5:im=:kb=^H:kd=^J:kl=^H:le=^H:nd=\EL:nw=^M^J:\ :sf=^J:sr=\Ew:ta=^I:up=\EK:ve=\Em\En:vs=\Ex: # The d800 was an early portable terminal from c.1984-85 that looked a lot # like the original Compaq `lunchbox' portable (but no handle). It had a vt220 # mode (which is what this entry looks like) and several other lesser-known # emulations. d800|Direct 800/A:\ :am:bs:da:db:ms:xs:\ :co#80:it#8:li#24:\ :ac=``a1fxgqh0jYk?lZm@nEooppqDrrsstCu4vAwBx3yyzz{{||}}~~:\ :ae=\E[m:as=\E[1m:bl=^G:cd=\E[J:ce=\E[K:cl=\E[1;1H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:do=^J:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOT:k6=\EOU:k7=\EOV:k8=\EOW:kd=\E[B:kl=\E[D:\ :kr=\E[C:ku=\E[A:le=^H:me=\E[m:nd=\E[C:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[>12h:\ :vs=\E[>12l: digilog|digilog 333:\ :bs:\ :co#80:li#16:\ :bl=^G:ce=^X:cr=^M:do=^J:ho=^N:le=^H:nd=^I:sf=^J:up=^O: # The DWK was a terminal manufactured in the Soviet Union c.1986 dwk|dwk-vt|dwk terminal:\ :am:\ :co#80:it#8:li#24:\ :ac=lJmFkCjXtEuPv\wKqUxWnNo~s_`+a\072f'g#~_\\054Q+\136.M-Sh#I#0\177:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:dc=\EP:do=^J:ei=:ho=\EH:ic=\EQ:im=:k1=\Ef1:k2=\Ef2:\ :k3=\Ef3:k4=\Ef4:k5=\Ef5:k6=\Ef6:k7=\Ef7:k8=\Ef8:k9=\Ef9:\ :k;=\Ef0:kD=\Ee:kI=\Ed:kN=\Eh:kP=\Eg:kb=\177:kd=\EB:kl=\ED:\ :kr=\EC:ku=\EA:le=^H:me=\EX:mr=\ET:nd=\EC:nw=^M^J:se=\EX:\ :sf=^J:so=\ET:sr=\ES:ta=^I:up=\EA: env230|envision230|envision 230 graphics terminal:\ :xn@:\ :pf=\E[4i:po=\E[5i:ps=\E[0i:\ :..sa=\E[%?%p1%t;1%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m:tc=vt100: # These execuports were impact-printer ttys with a 30- or maybe 15-cps acoustic # coupler attached, the whole rig fitting in a suitcase and more or less # portable. Hot stuff for c.1977 :-) -- esr ep48|ep4080|execuport 4080:\ :am:bs:os:\ :co#80:\ :bl=^G:cr=^M:do=^J:hd=^\:hu=^^:le=^H:sf=^J: ep40|ep4000|execuport 4000:\ :co#136:tc=ep4080: # Adam Thompson tells us: # Informer series - these are all portable units, resembling older # automatic bread-baking machines. The terminal looks like a `clamshell' # design, but isn't. The structure is similar to the Direct terminals, # but only half the width. The entire unit is only about 10" wide. # It features an 8" screen (6" or 7" if you have color!), and an 9"x6" # keyboard. All the keys are crammed together, much like some laptop # PCs today, but perhaps less well organized...all these units have a # bewildering array of plugs on the back, including a built-in modem. # The 305 was a color version of the 304; the 306 and 307 were mono and # color terminals built for IBM bisync protocols. # From: Paul Leondis ifmr|Informer D304:\ :am:bs:\ :co#80:li#24:\ :cd=\E/:ce=\EQ:cl=\EZ:cm=\EY%r%+ %+ :dc=\E\:do=^J:ei=:\ :ho=\EH:ic=\E[:im=:le=^H:me=\EK:nd=\EC:se=\EK:so=\EJ:sr=\En:\ :up=\EA: # Entry largely based on wy60 and has the features of wy60ak. # (untranslatable capabilities removed to fit entry within 1023 bytes) # (sgr removed to fit entry within 1023 bytes) # (terminfo-only capabilities suppressed to fit entry within 1023 bytes) opus3n1+|Esprit Opus3n1+ in wy60 mode with ANSI arrow keys:\ :am:bw:hs:km:mi:ms:ul:xo:\ :co#80:li#24:ws#80:\ :ae=\EH^C:al=\EE:as=\EH^B:bl=^G:bt=\EI:cd=\EY:ce=\ET:cl=\E*:\ :cm=\Ea%i%dR%dC:cr=^M:ct=\E0:dc=\EW:dl=\ER:do=^J:ds=\Ez(\r:\ :ei=\Er:fs=^M:ho=\036:if=/usr/share/tabset/std:im=\Eq:ip=:\ :is=\E`\072\Ee(\EO\Ee6\Ec41\E~4\Ec21\Ed/\Ezz&\E[A\177\Ezz'\E[B\177\Ezz(\E[D\177\Ezz)\E[C\177\Ezz<\E[Q\177\Ezz`\E[F\177\EA1*\EZH12:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kD=\EW:kI=\EQ:kN=\EK:kP=\EJ:\ :kb=^H:kd=\E[B:kh=^^:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\EG2:\ :me=\E(\EH\003\EG0\EcD:mh=\EGp:nd=^L:nw=\r\n:sf=^J:sr=\Ej:\ :st=\E1:ta=\011:te=:\ :ti=\Ezz&\E[A\177\Ezz'\E[B\177\Ezz(\E[D\177\Ezz)\E[C\177\Ezz<\E[Q\177:\ :ts=\Ez(:uc=\EG8%p1%c\EG0:up=^K:ve=\E`1:vi=\E`0:\ :tc=adm+sgr: teletec|Teletec Datascreen:\ :am:bs:\ :co#80:li#24:\ :bl=^G:cl=^L:cr=^M:do=^J:ho=^^:le=^H:nd=^_:sf=^J:up=^K: # From: Mark Dornfeld # This termcap is for the LANPAR Technologies VISION 3220 # terminal. The function key definitions k0-k5 represent the # edit keypad: FIND, INSERT HERE, REMOVE, SELECT, PREV SCREEN, # NEXT SCREEN. The key definitions k6-k9 represent the PF1 to # PF4 keys. # (v3220: removed obsolete ":kn#10:", # I added / based on the init string -- esr) v3220|LANPAR Vision II model 3220/3221/3222:\ :am:bs:mi:xn:\ :co#80:it#8:li#24:\ :RA=\E[?7l:SA=\E[?7h:al=\E[L:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:\ :is=\E>\E[?3l\E[?7h\E[?8h\E[p:k0=\E[1~:k1=\E[2~:\ :k2=\E[3~:k3=\E[4~:k4=\E[5~:k5=\E[6~:k6=\E[OP:k7=\E[OQ:\ :k8=\E[OR:k9=\E[OS:kd=\E[B:ke=\E>:kh=\E[H:kl=\E[D:kr=\E[C:\ :ks=\E=:ku=\E[A:le=^H:me=\E[m:nd=\E[C:se=\E[m:so=\E[7m:\ :sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: # `rasterconsole' provided by 4.4BSD, NetBSD and OpenBSD on SPARC, and # DECstation/pmax. rcons|BSD rasterconsole:\ :tc=sun-il: # Color version of above. Color currenly only provided by NetBSD. rcons-color|BSD rasterconsole with ANSI color:\ :AF=\E[3%dm:AB=\E[4%dm:Co#8:pa#64:op=\E[m:ut:tc=rcons: ######## ICH/ICH1 VERSUS RMIR/SMIR # # Some non-curses applications get confused if both ich/ich1 and rmir/smir # are present; the symptom is doubled characters in an update using insert. # These applications are technically correct; in both 4.3BSD termcap and # terminfo, you're not actually supposed to specify both ich/ich1 and rmir/smir # unless the terminal needs both. This requirement is now rare; most ich # sequences do not require previous smir, and most smir insert modes do not # require ich1 before each character. # # For ncurses-based applications this is not a problem, as ncurses uses # one or the other as appropriate but never mixes the two. Therefore we # have not corrected entries like `linux' and `xterm' that specify both. # If you see doubled characters from these, use the linux-nic and xterm-nic # entries that suppress ich/ich1. And upgrade to ncurses! # ######## VT100/ANSI/ISO 6429/ECMA-48/PC-TERM TERMINAL STANDARDS # # ANSI X3.64 has been withdrawn and replaced by ECMA-48. The ISO 6429 and # ECMA-48 standards are said to be almost identical, but are not the same # as X3.64 (though for practical purposes they are close supersets of it). # # You can obtain ECMA-48 for free by sending email to helpdesk@ecma.ch # requesting the standard(s) you want (i.e. ECMA-48, "Control Functions for # Coded Character Sets"), include your snail-mail address, and you should # receive the document in due course. Don't expect an email acknowledgement. # # Related standards include "X3.4-1977: American National Standard Code for # Information Interchange" (the ASCII standard) and "X3.41.1974: # Code-Extension Techniques for Use with the 7-Bit Coded Character Set of # American National Standard for Information Interchange." I believe (but # am not certain) that these are effectively identical to ECMA-6 and ECMA-35 # respectively. # #### VT100/ANSI/ECMA-48 # # ANSI Standard (X3.64) Control Sequences for Video Terminals and Peripherals # and ECMA-48 Control Functions for Coded Character Sets. # # Much of the content of this comment is adapted from a table prepared by # Richard Shuford, based on a 1984 Byte article. Terminfo correspondences, # discussion of some terminfo-related issues, and updates to capture ECMA-48 # have been added. Control functions described in ECMA-48 only are tagged # with * after their names. # # The table is a complete list of the defined ANSI X3.64/ECMA-48 control # sequences. In the main table, \E stands for an escape (\033) character, # SPC for space. Pn stands for a single numeric parameter to be inserted # in decimal ASCII. Ps stands for a list of such parameters separated by # semicolons. Parameter meanings for most parametrized sequences are # decribed in the notes. # # Sequence Sequence Parameter or # Mnemonic Name Sequence Value Mode terminfo # ----------------------------------------------------------------------------- # APC Applicatn Program Command \E _ - Delim - # BEL Bell * ^G - - bel # BPH Break Permitted Here * \E B - * - # BS Backpace * ^H - EF - # CAN Cancel * ^X - - - (A) # CBT Cursor Backward Tab \E [ Pn Z 1 eF cbt # CCH Cancel Previous Character \E T - - - # CHA Cursor Horizntal Absolute \E [ Pn G 1 eF hpa (B) # CHT Cursor Horizontal Tab \E [ Pn I 1 eF tab (C) # CMD Coding Method Delimiter * \E # CNL Cursor Next Line \E [ Pn E 1 eF nel (D) # CPL Cursor Preceding Line \E [ Pn F 1 eF - # CPR Cursor Position Report \E [ Pn ; Pn R 1, 1 - - (E) # CSI Control Sequence Intro \E [ - Intro - # CTC Cursor Tabulation Control \E [ Ps W 0 eF - (F) # CUB Cursor Backward \E [ Pn D 1 eF cub # CUD Cursor Down \E [ Pn B 1 eF cud # CUF Cursor Forward \E [ Pn C 1 eF cuf # CUP Cursor Position \E [ Pn ; Pn H 1, 1 eF cup (G) # CUU Cursor Up \E [ Pn A 1 eF cuu # CVT Cursor Vertical Tab \E [ Pn Y - eF - (H) # DA Device Attributes \E [ Pn c 0 - - # DAQ Define Area Qualification \E [ Ps o 0 - - # DCH Delete Character \E [ Pn P 1 eF dch # DCS Device Control String \E P - Delim - # DL Delete Line \E [ Pn M 1 eF dl # DLE Data Link Escape * ^P - - - # DMI Disable Manual Input \E \ - Fs - # DSR Device Status Report \E [ Ps n 0 - - (I) # DTA Dimension Text Area * \E [ Pn ; Pn SPC T - PC - # EA Erase in Area \E [ Ps O 0 eF - (J) # ECH Erase Character \E [ Pn X 1 eF ech # ED Erase in Display \E [ Ps J 0 eF ed (J) # EF Erase in Field \E [ Ps N 0 eF - # EL Erase in Line \E [ Ps K 0 eF el (J) # EM End of Medium * ^Y - - - # EMI Enable Manual Input \E b Fs - # ENQ Enquire ^E - - - # EOT End Of Transmission ^D - * - # EPA End of Protected Area \E W - - - (K) # ESA End of Selected Area \E G - - - # ESC Escape ^[ - - - # ETB End Transmission Block ^W - - - # ETX End of Text ^C - - - # FF Form Feed ^L - - - # FNK Function Key * \E [ Pn SPC W - - - # GCC Graphic Char Combination* \E [ Pn ; Pn SPC B - - - # FNT Font Selection \E [ Pn ; Pn SPC D 0, 0 FE - # GSM Graphic Size Modify \E [ Pn ; Pn SPC B 100, 100 FE - (L) # GSS Graphic Size Selection \E [ Pn SPC C none FE - # HPA Horz Position Absolute \E [ Pn ` 1 FE - (B) # HPB Char Position Backward \E [ j 1 FE - # HPR Horz Position Relative \E [ Pn a 1 FE - (M) # HT Horizontal Tab * ^I - FE - (N) # HTJ Horz Tab w/Justification \E I - FE - # HTS Horizontal Tab Set \E H - FE hts # HVP Horz & Vertical Position \E [ Pn ; Pn f 1, 1 FE - (G) # ICH Insert Character \E [ Pn @ 1 eF ich # IDCS ID Device Control String \E [ SPC O - * - # IGS ID Graphic Subrepertoire \E [ SPC M - * - # IL Insert Line \E [ Pn L 1 eF il # IND Index \E D - FE - # INT Interrupt \E a - Fs - # JFY Justify \E [ Ps SPC F 0 FE - # IS1 Info Separator #1 * ^_ - * - # IS2 Info Separator #1 * ^^ - * - # IS3 Info Separator #1 * ^] - * - # IS4 Info Separator #1 * ^\ - * - # LF Line Feed ^J - - - # LS1R Locking Shift Right 1 * \E ~ - - - # LS2 Locking Shift 2 * \E n - - - # LS2R Locking Shift Right 2 * \E } - - - # LS3 Locking Shift 3 * \E o - - - # LS3R Locking Shift Right 3 * \E | - - - # MC Media Copy \E [ Ps i 0 - - (S) # MW Message Waiting \E U - - - # NAK Negative Acknowledge * ^U - * - # NBH No Break Here * \E C - - - # NEL Next Line \E E - FE nel (D) # NP Next Page \E [ Pn U 1 eF - # NUL Null * ^@ - - - # OSC Operating System Command \E ] - Delim - # PEC Pres. Expand/Contract * \E Pn SPC Z 0 - - # PFS Page Format Selection * \E Pn SPC J 0 - - # PLD Partial Line Down \E K - FE - (T) # PLU Partial Line Up \E L - FE - (U) # PM Privacy Message \E ^ - Delim - # PP Preceding Page \E [ Pn V 1 eF - # PPA Page Position Absolute * \E [ Pn SPC P 1 FE - # PPB Page Position Backward * \E [ Pn SPC R 1 FE - # PPR Page Position Forward * \E [ Pn SPC Q 1 FE - # PTX Parallel Texts * \E [ \ - - - # PU1 Private Use 1 \E Q - - - # PU2 Private Use 2 \E R - - - # QUAD Typographic Quadding \E [ Ps SPC H 0 FE - # REP Repeat Char or Control \E [ Pn b 1 - rep # RI Reverse Index \E M - FE - (V) # RIS Reset to Initial State \E c - Fs - # RM Reset Mode * \E [ Ps l - - - (W) # SACS Set Add. Char. Sep. * \E [ Pn SPC / 0 - - # SAPV Sel. Alt. Present. Var. * \E [ Ps SPC ] 0 - - (X) # SCI Single-Char Introducer \E Z - - - # SCO Sel. Char. Orientation * \E [ Pn ; Pn SPC k - - - # SCS Set Char. Spacing * \E [ Pn SPC g - - - # SD Scroll Down \E [ Pn T 1 eF rin # SDS Start Directed String * \E [ Pn ] 1 - - # SEE Select Editing Extent \E [ Ps Q 0 - - (Y) # SEF Sheet Eject & Feed * \E [ Ps ; Ps SPC Y 0,0 - - # SGR Select Graphic Rendition \E [ Ps m 0 FE sgr (O) # SHS Select Char. Spacing * \E [ Ps SPC K 0 - - # SI Shift In ^O - - - (P) # SIMD Sel. Imp. Move Direct. * \E [ Ps ^ - - - # SL Scroll Left \E [ Pn SPC @ 1 eF - # SLH Set Line Home * \E [ Pn SPC U - - - # SLL Set Line Limit * \E [ Pn SPC V - - - # SLS Set Line Spacing * \E [ Pn SPC h - - - # SM Select Mode \E [ Ps h none - - (W) # SO Shift Out ^N - - - (Q) # SOH Start Of Heading * ^A - - - # SOS Start of String * \E X - - - # SPA Start of Protected Area \E V - - - (Z) # SPD Select Pres. Direction * \E [ Ps ; Ps SPC S 0,0 - - # SPH Set Page Home * \E [ Ps SPC G - - - # SPI Spacing Increment \E [ Pn ; Pn SPC G none FE - # SPL Set Page Limit * \E [ Ps SPC j - - - # SPQR Set Pr. Qual. & Rapid. * \E [ Ps SPC X 0 - - # SR Scroll Right \E [ Pn SPC A 1 eF - # SRCS Set Reduced Char. Sep. * \E [ Pn SPC f 0 - - # SRS Start Reversed String * \E [ Ps [ 0 - - # SSA Start of Selected Area \E F - - - # SSU Select Size Unit * \E [ Pn SPC I 0 - - # SSW Set Space Width * \E [ Pn SPC [ none - - # SS2 Single Shift 2 (G2 set) \E N - Intro - # SS3 Single Shift 3 (G3 set) \E O - Intro - # ST String Terminator \E \ - Delim - # STAB Selective Tabulation * \E [ Pn SPC ^ - - - # STS Set Transmit State \E S - - - # STX Start pf Text * ^B - - - # SU Scroll Up \E [ Pn S 1 eF indn # SUB Substitute * ^Z - - - # SVS Select Line Spacing * \E [ Pn SPC \ 1 - - # SYN Synchronous Idle * ^F - - - # TAC Tabul. Aligned Centered * \E [ Pn SPC b - - - # TALE Tabul. Al. Leading Edge * \E [ Pn SPC a - - - # TATE Tabul. Al. Trailing Edge* \E [ Pn SPC ` - - - # TBC Tab Clear \E [ Ps g 0 FE tbc # TCC Tabul. Centered on Char * \E [ Pn SPC c - - - # TSR Tabulation Stop Remove * \E [ Pn SPC d - FE - # TSS Thin Space Specification \E [ Pn SC E none FE - # VPA Vert. Position Absolute \E [ Pn d 1 FE vpa # VPB Line Position Backward * \E [ Pn k 1 FE - # VPR Vert. Position Relative \E [ Pn e 1 FE - (R) # VT Vertical Tabulation * ^K - FE - # VTS Vertical Tabulation Set \E J - FE - # # --------------------------------------------------------------------------- # # Notes: # # Some control characters are listed in the ECMA-48 standard without # being assigned functions relevant to terminal control there (they # referred to other standards such as ISO 1745 or ECMA-35). They are listed # here anyway for completeness. # # (A) ECMA-48 calls this "CancelCharacter" but retains the CCH abbreviation. # # (B) There seems to be some confusion abroad between CHA and HPA. Most # `ANSI' terminals accept the CHA sequence, not the HPA. but terminfo calls # the capability (hpa). ECMA-48 calls this "Cursor Character Absolute" but # preserved the CHA abbreviation. # # (C) CHT corresponds to terminfo (tab). Usually it has the value ^I. # Occasionally (as on, for example, certain HP terminals) this has the HTJ # value. ECMA-48 calls this "Cursor Forward Tabulation" but preserved the # CHT abbreviation. # # (D) terminfo (nel) is usually \r\n rather than ANSI \EE. # # (E) ECMA-48 calls this "Active Position Report" but preserves the CPR # abbreviation. # # (F) CTC parameter values: 0 = set char tab, 1 = set line tab, 2 = clear # char tab, 3 = clear line tab, 4 = clear all char tabs on current line, # 5 = clear all char tabs, 6 = clear all line tabs. # # (G) CUP and HVP are identical in effect. Some ANSI.SYS versions accept # HVP, but always allow CUP as an alternate. ECMA-48 calls HVP "Character # Position Absolute" but retains the HVP abbreviation. # # (H) ECMA calls this "Cursor Line Tabulation" but preserves the CVT # abbreviation. # # (I) DSR parameter values: 0 = ready, 1 = busy, 2 = busy, will send DSR # later, 3 = malfunction, 4 = malfunction, will send DSR later, 5 = request # DSR, 6 = request CPR response. # # (J) ECMA calls ED "Erase In Page". EA/ED/EL parameters: 0 = clear to end, # 1 = clear from beginning, 2 = clear. # # (K) ECMA calls this "End of Guarded Area" but preserves the EPA abbreviation. # # (L) The GSM parameters are vertical and horizontal parameters to scale by. # # (M) Some ANSI.SYS versions accept HPR, but more commonly `ANSI' terminals # use CUF for this function and ignore HPR. ECMA-48 calls this "Character # Position Relative" but retains the HPR abbreviation. # # (N) ECMA-48 calls this "Character Tabulation" but retains the HT # abbreviation. # # (O) SGR parameter values: 0 = default mode (attributes off), 1 = bold, # 2 = dim, 3 = italicized, 4 = underlined, 5 = slow blink, 6 = fast blink, # 7 = reverse video, 8 = invisible, 9 = crossed-out (marked for deletion), # 10 = primary font, 10 + n (n in 1..9) = nth alternative font, 20 = Fraktur, # 21 = double underline, 22 = turn off 2, 23 = turn off 3, 24 = turn off 4, # 25 = turn off 5, 26 = proportional spacing, 27 = turn off 7, 28 = turn off # 8, 29 = turn off 9, 30 = black fg, 31 = red fg, 32 = green fg, 33 = yellow # fg, 34 = blue fg, 35 = magenta fg, 36 = cyan fg, 37 = white fg, 38 = set # fg color as in CCIT T.416, 39 = set default fg color, 40 = black bg # 41 = red bg, 42 = green bg, 43 = yellow bg, 44 = blue bg, 45 = magenta bg, # 46 = cyan bg, 47 = white bg, 48 = set bg color as in CCIT T.416, 39 = set # default bg color, 50 = turn off 26, 51 = framed, 52 = encircled, 53 = # overlined, 54 = turn off 51 & 52, 55 = not overlined, 56-59 = reserved, # 61-65 = variable highlights for ideograms. # # (P) SI is also called LSO, Locking Shift Zero. # # (Q) SI is also called LS1, Locking Shift One. # # (R) Some ANSI.SYS versions accept VPR, but more commonly `ANSI' terminals # use CUD for this function and ignore VPR. ECMA calls it `Line Position # Absolute' but retains the VPA abbreviation. # # (S) MC parameters: 0 = start xfer to primary aux device, 1 = start xfer from # primary aux device, 2 = start xfer to secondary aux device, 3 = start xfer # from secondary aux device, 4 = stop relay to primary aux device, 5 = # start relay to primary aux device, 6 = stop relay to secondary aux device, # 7 = start relay to secondary aux device. # # (T) ECMA-48 calls this "Partial Line Forward" but retains the PLD # abbreviation. # # (U) ECMA-48 calls this "Partial Line Backward" but retains the PLD # abbreviation. # # (V) ECMA-48 calls this "Reverse Line Feed" but retains the RI abbreviation. # # (W) RM/SM modes are as follows: 1 = Guarder Area Transfer Mode (GATM), # 2 = Keyboard Action Mode (KAM), 3 = Control Representation Mode (CRM), # 4 = Insertion Replacement Mode, 5 = Status Report Transfer Mode (SRTM), # 6 = Erasure Mode (ERM), 7 = Line Editing Mode (LEM), 8 = Bi-Directional # Support Mode (BDSM), 9 = Device Component Select Mode (DCSM), # 10 = Character Editing Mode (HEM), 11 = Positioning Unit Mode (PUM), # 12 = Send/Receive Mode, 13 = Format Effector Action Mode (FEAM), # 14 = Format Effector Transfer Mode (FETM), 15 = Multiple Area Transfer # Mode (MATM), 16 = Transfer Termination Mode, 17 = Selected Area Transfer # Mode, 18 = Tabulation Stop Mode, 19 = Editing Boundary Mode, 20 = Line Feed # New Line Mode (LF/NL), Graphic Rendition Combination Mode (GRCM), 22 = # Zero Default Mode (ZDM). The EBM and LF/NL modes have actually been removed # from ECMA-48's 5th edition but are listed here for reference. # # (X) Select Alternate Presentation Variants is used only for non-Latin # alphabets. # # (Y) "Select Editing Extent" (SEE) was ANSI "Select Edit Extent Mode" (SEM). # # (Z) ECMA-48 calls this "Start of Guarded Area" but retains the SPA # abbreviation. # # --------------------------------------------------------------------------- # # Abbreviations: # # Intro an Introducer of some kind of defined sequence; the normal 7-bit # X3.64 Control Sequence Introducer is the two characters "Escape [" # # Delim a Delimiter # # x/y identifies a character by position in the ASCII table (column/row) # # eF editor function (see explanation) # # FE format effector (see explanation) # # F is a Final character in # an Escape sequence (F from 3/0 to 7/14 in the ASCII table) # a control sequence (F from 4/0 to 7/14) # # Gs is a graphic character appearing in strings (Gs ranges from # 2/0 to 7/14) in the ASCII table # # Ce is a control represented as a single bit combination in the C1 set # of controls in an 8-bit character set # # C0 the familiar set of 7-bit ASCII control characters # # C1 roughly, the set of control chars available only in 8-bit systems. # This is too complicated to explain fully here, so read Jim Fleming's # article in the February 1983 BYTE, especially pages 214 through 224. # # Fe is a Final character of a 2-character Escape sequence that has an # equivalent representation in an 8-bit environment as a Ce-type # (Fe ranges from 4/0 to 5/15) # # Fs is a Final character of a 2-character Escape sequence that is # standardized internationally with identical representation in 7-bit # and 8-bit environments and is independent of the currently # designated C0 and C1 control sets (Fs ranges from 6/0 to 7/14) # # I is an Intermediate character from 2/0 to 2/15 (inclusive) in the # ASCII table # # P is a parameter character from 3/0 to 3/15 (inclusive) in the ASCII # table # # Pn is a numeric parameter in a control sequence, a string of zero or # more characters ranging from 3/0 to 3/9 in the ASCII table # # Ps is a variable number of selective parameters in a control sequence # with each selective parameter separated from the other by the code # 3/11 (which usually represents a semicolon); Ps ranges from # 3/0 to 3/9 and includes 3/11 # # * Not relevant to terminal control, listed for completeness only. # # Format Effectors versus Editor Functions # # A format effector specifies how following output is to be displayed. # An editor function allows you to modify the display. Informally # format effectors may be destructive; format effectors should not be. # # For instance, a format effector that moves the "active position" (the # cursor or equivalent) one space to the left would be useful when you want to # create an overstrike, a compound character made of two standard characters # overlaid. Control-H, the Backspace character, is actually supposed to be a # format effector, so you can do this. But many systems use it in a # nonstandard fashion, as an editor function, deleting the character to the # left of the cursor and moving the cursor left. When Control-H is assumed to # be an editor function, you cannot predict whether its use will create an # overstrike unless you also know whether the output device is in an "insert # mode" or an "overwrite mode". When Control-H is used as a format effector, # its effect can always be predicted. The familiar characters carriage # return, linefeed, formfeed, etc., are defined as format effectors. # # NOTES ON THE DEC VT100 IMPLEMENTATION # # Control sequences implemented in the VT100 are as follows: # # CPR, CUB, CUD, CUF, CUP, CUU, DA, DSR, ED, EL, HTS, HVP, IND, # LNM, NEL, RI, RIS, RM, SGR, SM, TBC # # plus several private DEC commands. # # Erasing parts of the display (EL and ED) in the VT100 is performed thus: # # Erase from cursor to end of line Esc [ 0 K or Esc [ K # Erase from beginning of line to cursor Esc [ 1 K # Erase line containing cursor Esc [ 2 K # Erase from cursor to end of screen Esc [ 0 J or Esc [ J # Erase from beginning of screen to cursor Esc [ 1 J # Erase entire screen Esc [ 2 J # # Some brain-damaged terminal/emulators respond to Esc [ J as if it were # Esc [ 2 J, but this is wrong; the default is 0. # # The VT100 responds to receiving the DA (Device Attributes) control # # Esc [ c (or Esc [ 0 c) # # by transmitting the sequence # # Esc [ ? l ; Ps c # # where Ps is a character that describes installed options. # # The VT100's cursor location can be read with the DSR (Device Status # Report) control # # Esc [ 6 n # # The VT100 reports by transmitting the CPR sequence # # Esc [ Pl ; Pc R # # where Pl is the line number and Pc is the column number (in decimal). # # The specification for the DEC VT100 is document EK-VT100-UG-003. #### ANSI.SYS # # Here is a description of the color and attribute controls supported in the # the ANSI.SYS driver under MS-DOS. Most console drivers and ANSI # terminal emulators for Intel boxes obey these. They are a proper subset # of the ECMA-48 escapes. # # 0 all attributes off # 1 foreground bright # 4 underscore on # 5 blink on/background bright (not reliable with brown) # 7 reverse-video # 8 set blank (non-display) # 10 set primary font # 11 set first alternate font (on PCs, display ROM characters 1-31) # 12 set second alternate font (on PCs, display IBM high-half chars) # # Color attribute sets # 3n set foreground color / 0=black, 1=red, 2=green, 3=brown, # 4n set background color \ 4=blue, 5=magenta, 6=cyan, 7=white # Bright black becomes gray. Bright brown becomes yellow, # These coincide with the prescriptions of the ISO 6429/ECMA-48 standard. # # * If the 5 attribute is on and you set a background color (40-47) it is # supposed to enable bright background. # # * Many VGA cards (such as the Paradise and compatibles) do the wrong thing # when you try to set a "bright brown" (yellow) background with attribute # 5 (you get a blinking yellow foreground instead). A few displays # (including the System V console) support an attribute 6 that undoes this # braindamage (this is required by iBCS2). # # * Some older versions of ANSI.SYS have a bug that causes thems to require # ESC [ Pn k as EL rather than the ANSI ESC [ Pn K. (This is not ECMA-48 # compatible.) #### Intel Binary Compatibility Standard # # For comparison, here are the capabilities implied by the Intel Binary # Compatibility Standard for UNIX systems (Intel order number 468366-001). # These recommendations are optional. IBCS2 allows the leading escape to # be either the 7-bit \E[ or 8-bit \0233 introducer, in accordance with # the ANSI X.364/ISO 6429/ECMA-48 standard. Here are the iBCS2 capabilities # (as described in figure 9-3 of the standard). Those expressed in the ibcs2 # terminfo entry are followed with the corresponding capability in parens: # # CSI k disable (n=0) or enable (n=1) keyclick # CSI 2h lock keyboard # CSI 2i send screen as input # CSI 2l unlock keyboard # CSI 6m enable background color intensity # CSI <0-2>c reserved # CSI <0-59>m select graphic rendition # CSI ;H (cup) cursor to line n and column m # CSI ;f cursor to line n and column m # CSI @ (ich) insert characters # CSI A (cuu) cursor up n lines # CSI B (cud) cursor down n lines # CSI C (cuu) cursor right n characters # CSI D (cud) cursor left n characters # CSI E cursor down n lines and in first column # CSI F cursor up n lines and in first column # CSI G (hpa) position cursor at column n-1 # CSI J (ed) erase in display # CSI K (el) erase in line # CSI L (il) insert line(s) # CSI P (dch) delete characters # CSI S (indn) scroll up n lines # CSI T (rin) scroll down n lines # CSI X (ech) erase characters # CSI Z (cbt) back up n tab stops # CSI ` cursor to column n on line # CSI a (cuu) cursor right n characters # CSI d (vpa) cursor to line n # CSI e cursor down n lines and in first column # CSI g (cbt) clear all tabs # CSI z make virtual terminal n active # CSI ?7h (smam) turn automargin on # CSI ?7l (rmam) turn automargin off # CSI s save cursor position # CSI u restore cursor position to saved value # CSI =A set overscan color # CSI =F set normal foreground color # CSI =G set normal background color # CSI =H set reverse foreground color # CSI =I set reverse foreground color # CSI =J set graphic foreground color # CSI =K set graphic foreground color # CSI =g (dispc) display n from alternate graphics character set # CSI =

;B set bell parameters # CSI =;C set cursor parameters # CSI =D enable/disable intensity of background color # CSI =E set/clear blink vs. bold background # CSI 7 (sc) (sc) save cursor position # CSI 8 (rc) (rc) restore cursor position to saved value # CSI H (hts) (hts) set tab stop # CSI Q define function key string # (string must begin and end with delimiter char) # CSI c (clear) clear screen # # The lack of any specification for attributes in SGR (among other things) # makes this a wretchedly weak standard. The table above is literally # everything iBSC2 has to say about terminal escape sequences; there is # no further discussion of their meaning or how to set the parameters # in these sequences at all. # ######## NONSTANDARD CAPABILITY TRANSLATIONS USED IN THIS FILE # # The historical termcap file entries were written primarily in 4.4BSD termcap. # The 4.4BSD termcap set was substantially larger than the original 4.1BSD set, # with the extension names chosen for compatibility with the termcap names # assigned in System V terminfo. There are some variant extension sets out # there. We try to describe them here. # # XENIX extensions: # # The XENIX extensions include a set of function-key capabilities as follows: # # code XENIX variable name terminfo name name clashes? # ---- ------------------- ------------- ----------------------- # CL key_char_left # CR key_char_right # CW key_change_window create_window # EN key_end kend # HM key_home khome # HP ?? # LD key_delete_line kdl1 # LF key_linefeed label_off # NU key_next_unlocked_cell # PD key_page_down knp # PL ?? # PN start_print mc5 # PR ?? # PS stop_print mc4 # PU key_page_up kpp pulse # RC key_recalc remove_clock # RF key_toggle_ref req_for_input # RT key_return kent # UP key_up_arrow kcuu1 parm_up_cursor # WL key_word_left # WR key_word_right # # The XENIX extensions also include the following character-set and highlight # capabilities: # # XENIX terminfo function # ----- -------- ------------------------------ # GS smacs start alternate character set # GE rmacs end alternate character set # GG :as:/:ae: glitch (analogous to :sg:/:ug:) # bo blink begin blink (not used in /etc/termcap) # be end blink (not used in /etc/termcap) # bb blink glitch (not used in /etc/termcap) # it dim begin dim (not used in /etc/termcap) # ie end dim (not used in /etc/termcap) # ig dim glitch (not used in /etc/termcap) # # Finally, XENIX also used the following forms-drawing capabilities: # # single double type ASCII approximation # ------ ------ ------------- ------------------- # GV Gv vertical line | # GH Gv horizontal line - _ # G1 G5 top right corner _ | # G2 G6 top left corner | # G3 G7 bottom left corner |_ # G4 G8 bottom right corner _| # GD Gd down-tick character T # GL Gl left-tick character -| # GR Gr right-tick character |- # GC Gc middle intersection -|- # GU Gu up-tick character _|_ # # These were invented to take advantage of the IBM PC ROM character set. One # can compose an acsc string from the single-width characters as follows # "j{G4}k{G1}l{G2}m{G3}q{GH}x{GV}t{GR}u{GL}v{GU}w{GD}n{GC}" # When translating a termcap file, ncurses tic will do this automatically. # The double forms characters don't fit the SVr4 terminfo model. # # AT&T Extensions: # # The old AT&T 5410, 5420, 5425, pc6300plus, 610, and s4 entries used a set of # nonstandard capabilities. Its signature is the KM capability, used to name # some sort of keymap file. EE, BO, CI, CV, XS, DS, FL and FE are in this # set. Comments in the original, and a little cross-checking with other AT&T # documentation, seem to establish that BO=:mr: (start reverse video), DS=:mh: # (start dim), XS=:mk: (secure/invisible mode), EE=:me: (end highlights), # FL=:LO: (enable soft labels), FE=:LF: (disable soft labels), CI=:vi: (make # cursor invisible), and CV=:ve: (make cursor normal). # # HP Extensions # # The HP library (as of mid-1995, their term.h file version 70.1) appears to # have the System V capabilities up to SVr1 level. After that, it supports # two nonstandard caps meml and memu corresponding to the old termcap :ml:, # :mu: capabilities. After that, it supports caps plab_norm, label_on, # label_off, and key_f11..key_f63 capabilities like SVr4's. This makes the # HP binary format incompatible with SVr4's. # # IBM Extensions # # There is a set of nonstandard terminfos used by IBM's AIX operating system. # The AIX terminfo library diverged from SVr1 terminfo, and replaces all # capabilities following prtr_non with the following special capabilties: # box[12], batt[12], colb[0123456789], colf[0123456789], f[01234567], kbtab, # kdo, kcmd, kcpn, kend, khlp, knl, knpn, kppn, kppn, kquit, ksel, kscl, kscr, # ktab, kmpf[123456789], apstr, ksf1..ksf10, kf11...kf63, kact, topl, btml, # rvert, lvert. Some of these are identical to XPG4/SVr4 equivalents: # kcmd, kend, khlp, and kf11...kf63. Two others (kbtab and ksel) can be # renamed (to kcbt and kslt). The places in the box[12] capabilities # correspond to acsc chars, here is the mapping: # # box1[0] = ACS_ULCORNER # box1[1] = ACS_HLINE # box1[2] = ACS_URCORNER # box1[3] = ACS_VLINE # box1[4] = ACS_LRCORNER # box1[5] = ACS_LLCORNER # box1[6] = ACS_TTEE # box1[7] = ACS_RTEE # box1[8] = ACS_BTEE # box1[9] = ACS_LTEE # box1[10] = ACS_PLUS # # The box2 characters are the double-line versions of these forms graphics. # The AIX binary terminfo format is incompatible with SVr4's. # # Iris console extensions: # # HS is half-intensity start; HE is half-intensity end # CT is color terminal type (for Curses & rogue) # CP is color change escape sequence # CZ are color names (for Curses & rogue) # # The ncurses tic utility recognizes HS as an alias for mh . # # TC Extensions: # # There is a set of extended termcaps associated with something # called the "Terminal Control" or TC package created by MainStream Systems, # Winfield Kansas. This one also uses GS/GE for as/ae, and also uses # CF for civis and CO for cvvis. Finally, they define a boolean :ct: # that flags color terminals. # ######## CHANGE HISTORY # # The last /etc/termcap version maintained by John Kunze was 8.3, dated 8/5/94. # Releases 9 and up are maintained by Eric S. Raymond as part of the ncurses # project. # # This file contains all the capability information present in John Kunze's # last version of the termcap master file, except as noted in the change # comments at end of file. Some information about very ancient obsolete # capabilities has been moved to comments. Some all-numeric names of older # terminals have been retired. # # I changed :MT: to :km: (the 4.4BSD name) everywhere. I commented out some # capabilities (EP, dF, dT, dV, kn, ma, ml, mu, xr, xx) that are no longer # used by BSD curses. # # The 9.1.0 version of this file was translated from my lightly-edited copy of # 8.3, then mechanically checked against 8.3 using Emacs Lisp code written for # the purpose. Unless the ncurses tic implementation and the Lisp code were # making perfectly synchronized mistakes which I then failed to catch by # eyeball, the translation was correct and perfectly information-preserving. # # Major version number bumps correspond to major version changes in ncurses. # # Here is a log of the changes since then: # # 9.1.0 (Wed Feb 1 04:50:32 EST 1995): # * First terminfo master translated from 8.3. # 9.2.0 (Wed Feb 1 12:21:45 EST 1995): # * Replaced Wyse entries with updated entries supplied by vendor. # # 9.3.0 (Mon Feb 6 19:14:40 EST 1995): # * Added contact & status info from G. Clark Brown . # 9.3.1 (Tue Feb 7 12:00:24 EST 1995): # * Better XENIX keycap translation. Describe TC termcaps. # * Contact and history info supplied by Qume. # 9.3.2 (Sat Feb 11 23:40:02 EST 1995): # * Raided the Shuford FTP site for recent termcaps/terminfos. # * Added information on X3.64 and VT100 standard escape sequences. # 9.3.3 (Mon Feb 13 12:26:15 EST 1995): # * Added a correct X11R6 xterm entry. # * Fixed terminfo translations of padding. # 9.3.4 (Wed Feb 22 19:27:34 EST 1995): # * Added correct acsc/smacs/rmacs strings for vt100 and xterm. # * Added u6/u7/u8/u9 capabilities. # * Added PCVT entry. # 9.3.5 (Thu Feb 23 09:37:12 EST 1995): # * Emacs uses :so:, not :mr:, for its mode line. Fix linux entry # to use reverse-video standout so Emacs will look right. # * Added el1 capability to ansi. # * Added smacs/rmacs to ansi.sys. # # 9.4.0 (Sat Feb 25 16:43:25 EST 1995): # * New mt70 entry. # * Added COPYRIGHTS AND OTHER DELUSIONS. # * Added AT&T 23xx & 500/513, vt220 and vt420, opus3n1+, netronics # smartvid & smarterm, ampex 175 & 219 & 232, # env230, falco ts100, fluke, intertube, superbrain, ncr7901, vic20, # ozzie, trs200, tr600, Tandy & Texas Instruments VDTs, intext2, # screwpoint, fviewpoint, Contel Business Systems, Datamedia Colorscan, # adm36, mime314, ergo4000, ca22851. Replaced att7300, esprit, dd5500. # * Replaced the Perkin-Elmer entries with vendor's official ones. # * Restored the old minimal-ansi entry, luna needs it. # * Fixed some incorrect ip and proportional-padding translations. # 9.4.1 (Mon Feb 27 14:18:33 EST 1995): # * Fix linux & AT386 sgr strings to do A_ALTCHARSET turnoff correctly. # * Make the xterm entry 65 lines again; create xterm25 and xterm24 # to force a particular height. # * Added beehive4 and reorganized other Harris entries. # 9.4.2 (Thu Mar 9 01:45:44 EST 1995): # * Merged in DEC's official entries for its terminals. The only old # entry I kept was Doug Gwyn's alternate vt100 (as vt100-avo). # * Replaced the translated BBN Bitgraph entries with purpose-built # ones from AT&T's SVr3. # * Replaced the AT&T entries with AT&T's official terminfos. # * Added teleray 16, vc415, cops10. # * Merged in many individual capabilities from SCO terminfo files. # 9.4.3 (Mon Mar 13 02:37:53 EST 1995): # * Typo fixes. # * Change linux entry so A_PROTECT enables IBM-PC ROM characters. # 9.4.4 (Mon Mar 27 12:32:35 EST 1995): # * Added tty35, Ann Arbor Guru series. vi300 and 550, cg7900, tvi803, # pt210, ibm3164, IBM System 1, ctrm, Tymshare scanset, dt200, adm21, # simterm, citoh and variants. # * Replaced sol entry with sol1 and sol2. # * Replaced Qume QVT and Freedom-series entries with purpose-built # terminfo entries. # * Enhanced vt220, tvi910, tvi924, hpterm, hp2645, adm42, tek # and dg200 entries using caps from from SCO. # * Added the usual set of function-key mappings to ANSI entry. # * Corrected xterm's function-key capabilities. # 9.4.5 (Tue Mar 28 14:27:49 EST 1995): # * Fix in xterm entry, cub and cud are not reliable under X11R6. # 9.4.6 (Thu Mar 30 14:52:15 EST 1995): # * Fix in xterm entry, get the arrow keys right. # * Change some \0 escapes to \200. # 9.4.7 (Tue Apr 4 11:27:11 EDT 1995) # * Added apple (Videx card), adm1a, oadm31. # * Fixed malformed ampex csr. # * Fixed act4, cyb110; they had old-style prefix padding left in. # * Changed mandatory to advisory padding in many entries. # * Replaced HP entries up to hpsub with purpose-built ones. # * Blank rmir/smir/rmdc/smdc capabilities removed. # * Small fixes merged in from SCO entries for lpr, fos, tvi910+, tvi924. # 9.4.8 (Fri Apr 7 09:36:34 EDT 199): # * Replaced the Ann Arbor entries with SCO's, the init strings are # more efficient (but the entries otherwise identical). # * Added dg211 from Shuford archive. # * Added synertek, apple-soroc, ibmpc, pc-venix, pc-coherent, xtalk, # adm42-nl, pc52, gs6300, xerox820, uts30. # * Pull SCO's padding into vi200 entry. # * Improved capabilities for tvi4107 and other Televideo and Viewpoint # entries merged in from SCO's descriptions. # * Fixed old-style prefix padding on zen50, h1500. # * Moved old superbee entry to superbee-xsb, pulled in new superbee # entry from SCO's description. # * Reorganized the special entries. # * Added lm#0 to cbunix and virtual entries. # # 9.5.0 (Mon Apr 10 11:30:00 EDT 1995): # * Restored cdc456tst. # * Fixed sb1 entry, SCO erroneously left out the xsb glitch. # * Added megatek, beacon, microkit. # * Freeze for ncurses-1.9 release. # 9.5.1 (Fri Apr 21 12:46:42 EDT 1995): # * Added historical data for TAB. # * Comment fixes from David MacKenzie. # * Added the new BSDI pc3 entry. # 9.5.2 (Tue Apr 25 17:27:52 EDT 1995) # * A change in the tic -C logic now ensures that all entries in # the termcap translation will fit in < 1024 bytes. # * Added `bobcat' and `gator' HP consoles and the Nu machine entries # from GNU termcap file. This merges in all their local information. # 9.5.3 (Tue Apr 25 22:28:13 EDT 1995) # * Changed tic -C logic to dump all capabilities used by GNU termcap. # * Added warnings about entries with long translations (restoring # all the GNU termcaps pushes a few over the edge). # 9.5.4 (Wed Apr 26 15:35:09 EDT 1995) # * Yet another tic change, and a couple of entry tweaks, to reduce the # number of long (> 1024) termcap translations back to 0. # # 9.6.0 (Mon May 1 10:35:54 EDT 1995) # * Added kf13-kf20 to Linux entry. # * Regularize Prime terminal names. # * Historical data on Synertek. # * Freeze for ncurses-1.9.1. # 9.6.1 (Sat May 6 02:00:52 EDT 1995): # * Added true xterm-color entry, renamed djm's pseudo-color entry. # * Eliminate whitespace in short name fields, this tanks some scripts. # * Name field changes to shorten some long entries. # * Termcap translation now automatically generates empty rmir/smir # when ich1/ich is present (copes with an ancient vi bug). # * Added `screen' entries from FSF's screen-3.6.2. # * Added linux-nic and xterm-nic entries. # 9.6.2 (Sat May 6 17:00:55 EDT 1995): # * Change linux entry to use smacs=\E[11m and have an explicit acsc, # eliminating some special-case code in ncurses. # # 9.7.0 (Tue May 9 18:03:12 EDT 1995): # * Added vt320-k3, rsvidtx from the Emacs termcap.dat file. I think # that captures everything unique from it. # * Added reorder script generator. # * Freeze for ncurses 1.9.2 release. # 9.7.1 (Thu Jun 29 09:35:22 EDT 1995): # * Added Sean Farley's kspd, flash, rs1 capabilities for linux. # * Added Olaf Siebert's corrections for adm12. # * ansi-pc-color now includes the colors and pairs caps, so that # entries which use it will inherit them automatically. # * The linux entry can now recognize the center (keypad 5) key. # * Removed some junk that found its way into Linux acsc. # # 9.8.0 (Fri Jul 7 04:46:57 EDT 1995): # * Add 50% cut mark as a desperate hack to reduce tic's core usage. # * xterm doesn't try to use application keypad mode any more. # * Freeze for ncurses-1.9.3 release. # 9.8.1 (Thu Jul 19 17:02:12 EDT 1995): # * Added corrected sun entry from vendor. # * Added csr capability to linux entry. # * Peter Wemm says the at386 hpa should be \E[%i%p1%dG, not \E[%p1%dG. # * Added vt102-nsgr to cope with stupid IBM PC `VT100' emulators. # * Some commented-out caps in long entries come back in, my code # for computing string-table lengths had a bug in it. # * pcansi series modified to fit comm-program reality better. # 9.8.2 (Sat Sep 9 23:35:00 EDT 1995): # * BSD/OS actually ships the ibmpc3 bold entry as its console. # * Correct some bad aliases in the pcansi series # * Added entry for QNX console. # * Clean up duplicate long names for use with 4.4 library. # * Change vt100 standout to be normal reverse vide, not bright reverse; # this makes the Emacs status line look better. # 9.8.3 (Sun Sep 10 13:07:34 EDT 1995): # * Added Adam Thompson's VT320 entries, also his dtx-sas and z340. # * Minor surgery, mostly on name strings, to shorten termcap version. # # 9.9.0 (Sat Sep 16 23:03:48 EDT 1995): # * Added dec-vt100 for use with the EWAN emulator. # * Added kmous to xterm for use with xterm's mouse-tracking facility. # * Freeze for 1.9.5 alpha release. # 9.9.1 (Wed Sep 20 13:46:09 EDT 1995): # * Changed xterm lines to 24, the X11R6 default. # 9.9.2 (Sat Sep 23 21:29:21 EDT 1995): # * Added 7 newly discovered, undocumented acsc characters to linux # entry (the pryz{|} characters). # * ncurses no longer steals A_PROTECT. Simplify linux sgr accordingly. # * Correct two typos in the xterm entries introduced in 9.9.1. # * I finally figured out how to translate ko capabilities. Done. # * Added tvi921 entries from Tim Theisen. # * Cleanup: dgd211 -> dg211, adm42-nl -> adm42-nsl. # * Removed mystery tec entry, it was neither interesting nor useful. # * shortened altos3, qvt203, tvi910+, tvi92D, tvi921-g, tvi955, vi200-f, # vi300-ss, att505-24, contel301, dm3045, f200vi, pe7000c, vc303a, # trs200, wind26, wind40, wind50, cdc456tst, dku7003, f110, dg211, # by making them relative to use capabilities # * Added cuf1=^L to tvi925 from deleted variant tvi925a. # * fixed cup in adm22 entry and parametrized strings in vt320-k3. # * added it#8 to entries that used to have :pt: -- tvi912, vi200, # ampex80, # * Translate all home=\E[;H capabilities to home=\E[H, they're # equivalent. # * Translate \E[0m -> \E[m in [rs]mso, [rs]mul, and init strings of # vt100 and ANSI-like terminals. # 9.9.3 (Tue Sep 26 20:11:15 EDT 1995): # * Added it#8 and ht=\t to *all* entries with :pt:; the ncurses tic # does this now, too. # * fviewpoint is gone, it duplicated screwpoint. # * Added hp2627, graphos, graphos-30, hpex, ibmega, ibm8514, ibm8514-c, # ibmvga, ibmvga-c, minix, mm340, mt4520-rv, screen2, screen3, # versaterm, vi500, vsc, vt131, vt340, vt400 entries from UW. # The UW vi50 replaces the old one, which becomes vi50adm, # * No more embedded commas in name fields. # # 9.10.0 (Wed Oct 4 15:39:37 EDT 1995): # * XENIX forms characters in fos, trs16, scoansi become acsc strings, # * Introduced klone+* entries for describing Intel-console behavior. # * Linux kbs is default-mapped to delete for some brain-dead reason. # * -nsl -> -ns. The -pp syntax is obsolete. # * Eliminate [A-Z]* primaries in accordance with SVr4 terminfo docs. # * Make xterm entry do application-keypad mode again. I got complaints # that it was messing up someone's 3270 emulator. # * Added some longname fields in order to avoid warning messages from # older tic implementations. # * According to ctrlseqs.ms, xterm has a full vt100 graphics set. Use # it! (This gives us pi, greater than, less than, and a few more.) # * Freeze for ncurses-1.9.6 release. # 9.10.1 (Sat Oct 21 22:18:09 EDT 1995): # * Add xon to a number of console entries, they're memory-mapped and # don't need padding. # * Correct the use dependencies in the ansi series. # * Hand-translate more XENIX capabilities. # * Added hpterm entry for HP's X terminal emulator. # * Added aixterm entries. # * Shortened four names so everything fits in 14 chars. # # 9.11.0 (Thu Nov 2 17:29:35 EST 1995): # * Added ibcs2 entry and info on iBCS2 standard. # * Corrected hpa/vpa in linux entry. They still fail the worm test. # * We can handle the HP meml/memu capability now. # * Added smacs to klone entries, just as documentation. # * Carrected ansi.sys and cit-500 entries. # * Added z39, vt320-k311, v220c, and avatar entries. # * Make pcansi use the ansi.sys invis capability. # * Added DIP switch descriptions for vt100, adm31, tvi910, tvi920c, # tvi925, tvi950, dt80, ncr7900i, h19. # * X3.64 has been withdrawn, change some references. # * Removed function keys from ansi-m entry. # * Corrected ansi.sys entry. # * Freeze for ncurses-1.9.7 release. # 9.11.1 (Tue Nov 6 18:18:38 EST 1995): # * Added rmam/smam capabilities to many entries based on init strings. # * Added correct hpa/vpa to linux. # * Reduced several entries relative to vt52. # 9.11.2 (Tue Nov 7 00:21:06 EST 1995): # * Exiled some utterly unidentifiable custom and homebrew types to the # UFO file; also, obsolete small-screen hardware; also, entries which # look flat-out incorrect, garbled, or redundant. These include the # following entries: carlock, cdc456tst, microkit, qdss, ramtek, tec, # tec400, tec500, ubell, wind, wind16, wind40, wind50, plasma, agile, # apple, bch, daleblit, nucterm, ttywilliams, nuterminal, nu24, bnu, # fnu, nunix-30, nunix-61, exidy, ex3000, sexidy, pc52, sanyo55, # yterm10, yterm11, yterm10nat, aed, aed-ucb, compucolor, compucolor2, # vic20, dg1, act5s, netx, smartvid, smarterm, sol, sol2, dt200, # trs80, trs100, trs200, trs600, xitex, rsvidtx, vid, att2300-x40, # att2350-x40, att4410-nfk, att5410-ns, otty5410, att5425-nl-w, # tty5425-fk, tty5425-w-fk, cita, c108-na, c108-rv-na, c100-rv-na, # c108-na-acs, c108-rv-na-acs, ims950-ns, infotonKAS, ncr7900i-na, # regent60na, scanset-n, tvi921-g, tvi925n, tvi925vbn, tvi925vb, # vc404-na, vc404-s-na, vt420nam, vt420f-nam, vt420pc-nam, vt510nam, # vt510pc-nam, vt520nam, vt525nam, xterm25, xterm50, xterm65, xterms. # * Corrected pcvt25h as suggested by Brian C. Grayson # . # 9.11.3 (Thu Nov 9 12:14:40 EST 1995): # * Added kspd=\E[P, kcbt=\E[Z, to linux entry, changed kbs back to ^H. # * Added kent=\EOM to xterm entry. # # 9.11.4 (Fri Nov 10 08:31:35 EST 1995): # * Corrected gigi entry. # * Restored cuf/cud1 to xterm, their apparent bugginess was due to # bad hpa/vpa capabilities. # * Corrected flash strings to have a uniform delay of .2 sec. No # more speed-dependent NUL-padding! # * terminfo capabilities in comments bracketed with <>. # 9.11.5 (Fri Nov 10 15:35:02 EST 1995): # * Replaced pcvt with the 3.31 pcvt entries. # * Freeze for 1.9.7a. # 9.11.6 (Mon Nov 13 10:20:24 EST 1995): # * Added emu entry from the X11R6 contrib tape sources. # # 9.12.0 (Wed Nov 29 04:22:25 EST 1995): # * Improved iris-ansi and sun entries. # * More flash string improvements. # * Corrected wy160 & wy160 as suggested by Robert Dunn # * Added dim to at386. # * Reconciled pc3 and ibmpc3 with the BSDI termcap file. Keith says # he's ready to start using the termcap generated from this one. # * Added vt102-w, vt220-w, xterm-bold, wyse-vp, wy75ap, att4424m, # ln03, lno3-w, h19-g, z29a*, qdss. Made vt200 an alias of vt220. # * Improved hpterm, apollo consoles, fos, qvt101, tvi924. tvi925, # att610, att620, att630, # * Changed hazeltine name prefix from h to hz. # * Sent t500 to the UFI file. # * I think we've sucked all the juice out of BSDI's termcap file now. # * Freeze for ncurses 1.9.8 release # 9.12.1 (Thu Nov 30 03:14:06 EST 1995) # * Unfreeze, linux kbs needed to be fixed. # * Tim Theisen pinned down a bug in the DMD firmware. # 9.12.2 (Thu Nov 30 19:08:55 EST 1995): # * Fixes to ansi and klone capabilities (thank you, Aaron Ucko). # (The broken ones had been shadowed by sgr.) # 9.12.3 (Thu Dec 7 17:47:22 EST 1995): # * Added documentation on ECMA-48 standard. # * New Amiga entry. # 9.12.4 (Thu Dec 14 04:16:39 EST 1995): # * More ECMA-48 stuff # * Corrected typo in minix entry, added pc-minix. # * Corrected khome/kend in xterm (thank you again, Aaron Ucko). # * Added rxvt entry. # * Added 1.3.x color-change capabilities to linux entry. # 9.12.5 (Tue Dec 19 00:22:10 EST 1995): # * Corrected rxvt entry khome/kend. # * Corrected linux color change capabilities. # * NeXT entries from Dave Wetzel. # * Cleaned up if and rf file names (all in /usr/share now). # * Changed linux op capability to avoid screwing up a background color # pair set by setterm. # 9.12.6 (Wed Feb 7 16:14:35 EST 1996): # * Added xterm-sun. # 9.12.7 (Fri Feb 9 13:27:35 EST 1996): # * Added visa50. # # 9.13.0 (Sun Mar 10 00:13:08 EST 1996): # * Another sweep through the Shuford archive looking for new info. # * Added dg100 alias to dg6053 based on a comp.terminals posting. # * Added st52 from Per Persson. # * Added eterm from the GNU Emacs 19.30 distribution. # * Freeze for 1.9.9. # 9.13.1 (Fri Mar 29 14:06:46 EST 1996): # * FreeBSD console entries from Andrew Chernov. # * Removed duplicate Atari st52 name. # 9.13.2 (Tue May 7 16:10:06 EDT 1996) # * xterm doesn't actually have ACS_BLOCK. # * Change klone+color setf/setb to simpler forms that can be # translated into termcap. # * Added xterm1. # * Removed mechanically-generated junk capabilities from cons* entries. # * Added color support to bsdos. # 9.13.3 (Thu May 9 10:35:51 EDT 1996): # * Added Wyse 520 entries from Wm. Randolph Franklin . # * Created ecma+color, linux can use it. Also added ech to linux. # * Teach xterm about more keys. Add Thomas Dickey's 3.1.2E updates. # * Add descriptions to FreeBSD console entries. Also shorten # some aliases to <= 14 chars for portability. # * Added x68k console # * Added OTbs to several VT-series entries. # 9.13.4 (Wed May 22 10:54:09 EDT 1996): # * screen entry update for 3.7.1 from Michael Alan Dorfman. # 9.13.5 (Wed Jun 5 11:22:41 EDT 1996): # * kterm correction due to Kenji Rikitake. # * ACS correction in vt320-kll due to Phillippe De Muyter. # 9.13.6 (Sun Jun 16 15:01:07 EDT 1996): # * Sun console entry correction from J.T. Conklin. # * Changed all DEC VT300 and up terminals to use VT300 tab set # 9.13.7 (Mon Jul 8 20:14:32 EDT 1996): # * Added smul to linux entry (we never noticed it was missing # because of sgr!). # * Added rmln to hp+labels (deduced from other HP entries). # * Added vt100 acsc capability to vt220, vt340, vt400, d800, dt80-sas, # pro350, att7300, 5420_2, att4418, att4424, att4426, att505, vt320-k3. # * Corrected vt220 acsc. # * The klone+sgr and klone+sgr-dumb entries now use klone+acs; # this corresponds to reality and helps prevent some tic warnings. # * Added sgr0 to c101, pcix, vt100-nav, screen2, oldsun, next, altos2, # hpgeneric, hpansi, hpsub, hp236, hp700-wy, bobcat, dku7003, adm11, # adm12, adm20, adm21, adm22, adm31, adm36, adm42, pt100, pt200, # qvt101, tvi910, tvi921, tvi92B, tvi925, tvi950, tvi970, wy30-mc, # wy50-mc, wy100, wyse-vp, ampex232, regent100, viewpoint, vp90, # adds980, cit101, cit500, contel300, cs10, dm80, falco, falco-p, # f1720a, go140, sb1, superbeeic, microb, ibm8512, kt7, ergo4000, # owl, uts30, dmterm, dt100, dt100, dt110, appleII, apple-videx, # lisa, trsII, atari, st52, pc-coherent, basis, m2-man, bg2.0, bg1.25, # dw3, ln03, ims-ansi, graphos, t16, zen30, xtalk, simterm, d800, # ifmr, v3220, wy100q, tandem653, ibmaed. # * Added DWK terminal description. # 9.13.8 (Wed Jul 10 11:45:21 EDT 1996): # * Many entries now have highlights inherited from adm+sgr. # * xterm entry now corresponds to XFree86 3.1.2E, with color. # * xtitle and xtitle-twm enable access to the X status line. # * Added linux-1.3.6 color palette caps in conventional format. # * Added adm1178 terminal. # * Move fos and apollo terminals to obsolete category. # * Aha! The BRL terminals file told us what the Iris extensions mean. # * Added, from the BRL termcap file: rt6221, rt6221-w, northstar, # commodore, cdc721-esc, excel62, osexec. Replaced from the BRL file: # cit500, adm11. # 9.13.9 (Mon Jul 15 00:32:51 EDT 1996): # * Added, from the BRL termcap file: cdc721, cdc721l, cdc752, cdc756, # aws, awsc, zentec8001, modgraph48, rca vp3301/vp3501, ex155. # * Corrected, from BRL termcap file: vi50. # * Better rxvt entry & corrected xterm entries from Thomas Dickey. # 9.13.10 (Mon Jul 15 12:20:13 EDT 1996): # * Added from BRL: cit101e & variants, hmod1, vi200, ansi77, att5620-1, # att5620-s, att5620-s, dg210, aas1901, hz1520, hp9845, osborne # (old osborne moved to osborne-w), tvi970-vb, tvi970-2p, tvi925-hi, # tek4105brl, tek4106brl, tek4107brl,tek4109brl, hazel, aepro, # apple40p, apple80p, appleIIgs, apple2e, apple2e-p, apple-ae. # * Paired-attribute fixes to various terminals. # * Sun entry corrections from A. Lukyanov & Gert-Jan Vons. # * xterm entry corrections from Thomas Dickey. # 9.13.11 (Tue Jul 30 16:42:58 EDT 1996): # * Added t916 entry, translated from a termcap in SCO's support area. # * New qnx entry from Michael Hunter. # 9.13.12 (Mon Aug 5 14:31:11 EDT 1996): # * Added hpex2 from Ville Sulko. # * Fixed a bug that ran the qnx and pcvtXX together. # 9.13.13 (Fri Aug 9 01:16:17 EDT 1996): # * Added dtterm entry from Solaris CDE. # 9.13.14 (Tue Sep 10 15:31:56 EDT 1996): # * corrected pairs#8 typo in dtterm entry. # * added tvi9065. # 9.13.15 (Sun Sep 15 02:47:05 EDT 1996): # * updated xterm entry to cover 3.1.2E's new features. # 9.13.16 (Tue Sep 24 12:47:43 EDT 1996): # * Added new minix entry # * Removed aliases of the form ^[0-9]* for obsolete terminals. # * Commented out linux-old, nobody's using pre-1.2 kernels now. # 9.13.17 (Fri Sep 27 13:25:38 EDT 1996): # * Added Prism entries and kt7ix. # * Caution notes about EWAN and tabset files. # * Changed /usr/lib/tabset -> /usr/share/tabset. # * Added acsc/rmacs/smacs to vt52. # 9.13.18 (Mon Oct 28 13:24:59 EST 1996): # * Merged in Thomas Dickey's reorganization of the xterm entries; # added technical corrections to avoid warning messages. # 9.13.19 (Sat Nov 16 16:05:49 EST 1996): # * Added rmso=\E[27m in Linux entry. # * Added koi8-r support for Linux console. # * Replace xterm entries with canonical ones from XFree86 3.2. # 9.13.20 (Sun Nov 17 23:02:51 EST 1996): # * Added color_xterm from Jacob Mandelson # 9.13.21 (Mon Nov 18 12:43:42 EST 1996): # * Back off the xterm entry to use r6 as a base. # 9.13.22 (Sat Nov 30 11:51:31 EST 1996): # * Added dec-vt220 at Adrian Garside's request. # 9.13.23 (Fri Feb 21 16:36:06 EST 1997): # * Replaced minitel-2 entry. # * Added MGR, ansi-nt. # * Minor corrections to xterm entries. # * Replaced EWAN telnet entry. # * Dropped the reorder script generator. It was a fossil. # 9.13.24 (Sun Feb 23 20:55:23 EST 1997): # * Thorsten Lockert added termcap `bs' to a lot of types, working from # the 4.4BSD Lite2 file. # 9.13.25 (Fri Jun 20 12:33:36 EDT 1997): # * Added Datapoint 8242, pilot, ansi_psx, rbcomm, vt220js. # * Updated iris-ansi; corrected vt102-w. # * Switch base xterm entry to 3.3 level. # # The following sets edit modes for GNU EMACS # Local Variables: # fill-prefix:"\t" # fill-column:75 # End: ######## SHANTIH! SHANTIH! SHANTIH! ϰdTSFP\ht4F:r:>BFFFFFFFFFFJ-,+,-X,-,ZF'A.HA5 A <N{8gAD A% A4 "|_@ <N{NzJgA( A, A #| ) g#| ) gf ` #| ) gzA$ A g g ` ` ` A0 ` N{NzJgpN{A( A, A4 A0 A$ )  A g g g g ` ` `|A4 #| ) fA( A `>A0 #| ) gA `A A,$| f%|%| `$ g%|$%|$ ` pN{N#| pN{N{"<t A  䨒An A5*f*<(EHUHTA NPAV"ҍA(Jg, fN{`(A8 !AH ` t #_@ECvG4ٳeN <N{A(Jgj f@3_@3d_@pN{N{N{N{ <N{ <N{N#`_@ E@$@N#_@ #c_@ NOa 3D"yPOE΀%I"$|Nb#J4g B@/ a \Xa  (g <9N{J0g yd a XBgB?<BOA΀!O&`rHyax6main() returned/ NX o`/<`BWJ Pg#\/9 PaP/<` 4f o ,fN` 4fNl`BHNh/H oL`(RBHNh/HX"yOL iN`J4g&A@Jg (fB_(8(PFpNu"o@Nh#HH J4gA@Jg ((8pNu o"y#|"N<"o Nq Nq Nq Nqp`p"yB `Nu /"9 ,nNu oJg ((8Nu oJg (8(PNu (g <N{J0g yd A % 4C&"G&0ٳe (fNO (fpN{N{!pN{NJ(g @pN{N yd!| !pN{NMOTOROLA MICROPROCESSOR & MEMORY TECHNOLOGY GROUP M68000 Hi-Performance Microprocessor Division M68040 Software Package M68040 Software Package Copyright (c) 1993, 1994 Motorola Inc. All rights reserved. THE SOFTWARE is provided on an "AS IS" basis and without warranty. To the maximum extent permitted by applicable law, MOTOROLA DISCLAIMS ALL WARRANTIES WHETHER EXPRESS OR IMPLIED, INCLUDING IMPLIED WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE and any warranty against infringement with regard to the SOFTWARE (INCLUDING ANY MODIFIED VERSIONS THEREOF) and any accompanying written materials. To the maximum extent permitted by applicable law, IN NO EVENT SHALL MOTOROLA BE LIABLE FOR ANY DAMAGES WHATSOEVER (INCLUDING WITHOUT LIMITATION, DAMAGES FOR LOSS OF BUSINESS PROFITS, BUSINESS INTERRUPTION, LOSS OF BUSINESS INFORMATION, OR OTHER PECUNIARY LOSS) ARISING OF THE USE OR INABILITY TO USE THE SOFTWARE. Motorola assumes no responsibility for the maintenance and support of the SOFTWARE. You are hereby granted a copyright license to use, modify, and distribute the SOFTWARE so long as this entire notice is retained without alteration in any modified and/or redistributed versions, and that such modified versions are clearly identified as such. No licenses are granted by implication, estoppel or otherwise under any patents or trademarks of Motorola, Inc. (fnNV@'$_N^Nr (fHNV@' @fT'.$g</g X_N^`/g X_N^`X/g X_N^`xX_N^NV@'$gH@aHGRGQHGOLNu?A <H<tvA 4!n8!n<(BL< ҀXQgDlD@@-Ar:DX"(0vt:D#X"XQR og". ofrB(f$Rz(0\fPR(0\BtfXRQ ".lD(@@"|?B:Dtd1H8 Jf#`fBz(0\fSP(0\vtfYRQ ".nD("|?B:Dtd1H8 Jf &.&(ԀCD1(BdCAD`dC@`C? jD@B:Dd1H8 Jfg `# gLNu0.gg @ @8fPNuB.NuBV ., faj`.fa@`a h?ngNua(f .Nua(g.Nu.Nua(g.Nu.Nu0.@;g0.4 Af0C Af&J8f J @fJ.fNO4O( m6B.0.42.(@@g8P`0.`. ` @g `g gBNupNuafO(O4 mB.0.42.(@@gP$HBnA0.gfp` p`a^g.`$ .gV .f&a4fDO4O( m,`$afO(O4 m0.42.(@@g .ft0.(@@?=@( .0.H4.H"(A.h".HABVa g`0.4@@?=@4 .0.H4.H"(A.h".HABVa g` .flA4 .0".HA < 4V6a <6g4A 4!n8!n<Jn4nv`jA( .0".HA < (V*a *g(A (!n,!n0Jn(n 0.@ @fHB` .g .f&afO4O( m`$afO(O4 m0.42.(@@f .ft0.(@@?=@( .0.H(.H(4A.h".HABVa g`0.4@@?=@4 .0.H(.H(4A.h".HABVa 6g2`( .fpA4 .0".HA < n4Jn4n4V6a 6g4A 4!n8!n<`jA( .0".HA < (V*a t*g(A (!n,!n0Jn(n 0.@ @f8HB`( .g .f,afO4O( mxJn4l0Nua\fdO(O4 mLJn(mNuNu .gF .f a fO4O(Ёn `afO(O4Ёn$ (BnB.0.42.(@@gPA0.gfp` p`a[gR`J0.gfp`p` Jg&VaXgH orB.NuJgH g. g-nt-nx-n|Nu-nh-nl-npNu-n\-n`-ndNu-nP-nT-nXNu.g .g-n4(J.4mNuNuBn$. @fJhlN`D `f -n4(Jhl(` fJhl orB.4NuJgH g. g-n4t-n8x-n<|Nu-n4h-n8l-nUUUUU6?ڢ!h5ڢ!h5?R zQ?TEeI?@`bk ?5?R]?CbvV?Řb?y~Ck ?g9F?TLa??b$S>?(ځb@Lw?O??񔝾y?Xa~>?F! Y?#*0B?pҚ?Go\?v0IT??hЊR0?-S?E>?_^>?](? -?شk^z?W*k#5?*pꜪ?2d? (ff?/҈3-2?ѱ!Md??#?l?I8'?rD6?zr'?,7?0: ?!?3!?Ƀ0 p?րz,[?#1%*?㲨Uk?-vOd1Y?[Ѣ? \?0f?E?ۏdP?s 6^S?核ͺ?(2ڮ ?Fݷ`"?>}֢?hoj?ĐYİ?D}px/?AD?Jf(? L?IqY?ԄWN?۔;?8Ui j?w)52Y?Wn 7 ?|7y?uA?d_?UI{h]?5I?vQrK?.1?s/ѕWd?8*5?0?F.R?-ב?џRA?:DҠ?o ?w?2?U2V$?ulq?|l?&Yc ??_aҒ?~?*Qsg?:QS V?: u9Tn?rE;&?LoՏ?JJ`k?*-͍&<?eo"e?eqIj?o5?{D7f?Xc3?%RV"F?̩_?z?6X8?ϫ(~{6?^f!5?Z ?AJ?+{?Gv7}?Go?+hy?0j9G͆?1j?1 p?\1? 1(?kzw?Fc?ދT?efϿd9?4_V4 ?"`H 0(.h ?l` @o`:BnB.H.H("` @ n*:T(n:T(p/Ba:H#b`<Ѐ`r?eCa?UUUUD1?UUUU@?C?UUUUOZ?UUUUUU>wF>h?*?Vlp??UUUUUU?H70??dt?͆+؟չ?:(ì@Hri?gH{\?a\?څ()?uIn{? ?[~[ Zc?9ESQ?1Cfn)?s8x?Z+/,? ` E}?-7 Z7?7QpR?E d0?9NU8?>٧,PIM?2` PH?QqOĠsi?pC Ihz?5 怠yq&?֩Q8q@?͓e5h Ob?Z|(8?X>BJȠ[??;xi Ct&?#Ҭ%p_?$ g?3d2?(w 0?Gb ?Z>E*?X 6+p?zs ?,LfpXAA?F$d{?g*U h?Ǎtȫ\:.?ɹn/'??r|\}?$nS?c3+%\?Ҩ*\v?Z !?D֝j/?ٝx״ C?7T ?`^$u?* ,K??rZP ?|Hrz?9jP t?: /n^ h?n|.g6J(f .gaz`raZ`j .gar`ZaJ`RJ(faL`DaT`<g'<(HNuB"<@>aj".afapg'<(HNu?}?A???ry??I U?ə}0o~?UUUUU?T?I?`=f?=H?H+e?ˍ?.4R8?)uC?뽲a?90I?e{v?.?%* ?z:?xǀ?dUQ?\L7W?V{=H?aќYX?{?d?7/ ?++,?8ΐk?h 6h ?)H?жX ??w% ?3lfP?ˇ'eÓ? Z}܊?NF?n^ɲ?Ƙ iƘ ?,?7/]L?,_rV?ՕG?D L?/ ?JО5?iGf?>ꦲ?>!M ?!45??!C6.??Z6Y?*b? 抛?d<{?cR ?uQ]a?Ӹ <?*=?:ƀ:?XJ?`+X ?Lj9;?iY?V]?JGV8?B-Q`? ?׉I;X?U9-{s?Ĵ?7Q?>mjk?^?|? x\/[?k1.7}?9,Qy? ?$@a0?L#_: ?Β4f?`? ӁEc ?Lo:<?pB­?"ڽ?^I60?h ?zz?.\ ?"L.d_?%h ZW?{}?EEF?U??%? ?f挕[l?Z8c>;?tǾY?yâ?VC?R7iH ?# B?e#?XȐ뉐?p4JZ?:=/?BpViF?"O|?:遛P?&z??s;?Dz4?TF?7a,<?3~gq͋?J?H` CZ^?0R?3h?Y#<̤I? ?emkI?w?m`$h??q`?[ة7(q?;)\ m/Ba:H#` m~/Ba:H#` mb/BaL:H#`| mF (f( (Jf0?@`H/Ba:H#X`2`GJg" o o> /o ?ox:DNuJg gA>`A>`A>` Jg g$A?( o`A> or`vA?d o``d0Jg g4A@` o> o>`2A? o$ o$`AA o o L< -AJf0ЀNuHAҮ-p-p-pBA(Va6gЀNuB`-|H?6=C((*(Jf<&<?Jf(B B``"B`.D 쯈`?0(=@2.ı=A"($(Jf< <?Jf"B B``"B`.D 쯂`?-C-@BB"|Jl .`hJnff`DeBRJgփԂӁURS` .Jf"B B``B`k.D 쯂 Al4=@Bn-A-B,.=FBn-D-E.H-|`:-A-B?=@Bn,.?-F.H=F-D-EB,.g",.Smnff`ze.H(R<.lB<.~HCL. .g :H#`NuR l`B41*Y?Y=*㽩9oE>!r~O># ` a8?^?nND*@ڢ?`Y򺥨O4oY_?sJ?<ք_B;~ K?nND*@ڢ?ڢ!h5![]|#~R66^"F!HM; `x0c!\᣻%!bΪ׹X!e$K :Ovgzes!SJ Ӡf!81e{0ՠLCNXڢ!h5!~R6hM;\᣻% !`:OvSJ1e{ڢ!h5 M;  SJڢ!h5  `ڢ!h5ڢ!h5?ڢ!h5@ڢ!h5@`@ڢ!h5@SJŸ@@M; @ڢ!h5@1e{ @SJŸ@:Ov!@`@\᣻%ˠ@M; @~R6!h@ڢ!h5@ՠLCNX@1e{!0@Ӡf8@SJ @gzes@:Ov!@e$K@@bΪ׹!X@\᣻%ˡ@`x0cݡ@M;! @6^"FH@~R6!@[]|# @ڢ!h5`~H 0( ?׀l` @~m`$:T$C`H(D(Jml:U:U#:U:I"#:I:I"#:I# "٧,Q?2`?QqO?n?pC Ih ?5 怞??֩Q8??͓e5jt?Z|?7??X>BJ??;xi Cug?#Ҭ%_?$?E??X 6?zsQ?,LfpV??F$d??g*U??Ǎtȫ]?ɹn/' uC`8J(gC `0C`*J(g C`C` J(g1i!i!iNuNu nBCpa} Nua @faNu.$gJ .B g~ gv0. 3gd 0gX`V .D @g6 Dg. . 'g $g`pNupNuBNu .Nu.$gBNu .Nu.$gBNu . fpNu fpNuBNu?<?<*8Z xxC"q NCJ`C<`J(gCX`C`J(gC `C&`C`C`J(gC`C`|J(gC `fC`^C`DC`8J(g C`2Cx`&J(gCf `C` J(g1i!i!iNu &,28>DA pNnCNunGNu.Nu.Nu.Nu.Nu.Nu.Nu=nBNu=nFNu4.Nu6.Nu8.Nu:.Nu<.Nu>.Nu-n@Nu-nDNu$.Nu&.Nu(.Nu*.Nu,.Nu..NuNV@'H@.P.-nL@.P._N^`x o ,g lYNV@'H@ n CpXaxY . f fx @f(@|(Bo` Afx0A|0Bo=n-n .rӮ=| , B =@B$%L@` L@_N^X`w|NV@'H@.P..%g .Jg: g gL@.P._N^`vr. `g 0faJf <aN`0.(@ @?f .0a4`0.(@ @@d .0 gJ0j ,g`J,g`r. `g 0fa"Jf <a`V0.(@ @?fp .0H@a`:r. `g> 0faJf <av` 0.(@ @?f$ .0H@aX` .8aD` <Jn(m <a` <a`v-@/a "f, g f`"`,A"n auNu ,f n(g n(gpNuBNu.gL@.P._N^`t..g2| -n$L@.P._N^`sxL@.P.N^`uNV@'H@.P.a.gB.$gat-n$L@.P._N^`s@.gH.$ga*-n$| L@.P._N^`r$g:a-n$L@.P._N^`t L@.P.N^`s.$gA`A4Va @fnan`a`NV@'H@.P..f8a..g| L@.P._N^`q.gdaW @fp `p BBQ|`-n$L@.P._N^`q$W @fp `p BBQ|`-n$L@.P._N^`r n Jg g( g>Nu".8pJgL/"H Oarj"Nu".8pJg./"H OarL"Nu".8pJg/"H Oar."Nu-A/a0"  g f`^`R`L .  f.,f0.(`0.4g `v`l@ .$gZ .C1J(g f.PNu @f.@\Nu f. hNu f.tNuNua" g .`a "H n Jg gpB0)@? @@g@H@J)g ` <BJ)g#@`&")T#@")p#A")pIapNuB0)@? @@g@H@J)g` <J)g` ")W-@pJgIAapHNuaR@"`J)gB)p IapNuNV@'H@.P.a.gB.$gaz-n$L@.P._N^`nz..gH.$ga*-n$| L@.P._N^`m$g:a-n$L@.P._N^`o L@.P.N^`naBg?.$g A2.A A0g A3f B>`A(Vaҟaa faJg J(kSha`&aJf Jf(g.gNuNV@'H@.P. @fm .-@<<B.aB.av'J.faV`zNV@'H@.P.W @fmr<<"..f `@-APaa\B`z@ /@f.g0.@fBg$g gLgBfLrB.4<.4g ``-n-n-n B."_' W@`g n*g" mg. h`.@\`.P`.tpBBQ/<@`-n-n-n |/rB.4<.4g `P`FN.0.@ @Df0g f-n-n-n B.-n4-n8-n<"_' W@`g n*g" mg. h`.@\`.P`.tpBBQ/<@`-n-n-n |-n4-n8-n<*n*. $nBJgI#PG$* f<9SxB@&@2A@oF0jSt0*gd j0g!j44 j4!j00`@g/*Hy|PN`* j Jg/*$/*(/*NO `/*,/*a6PjB($/ Hy&NP gB@F`B@F`///*/ mNڂ؂O<9SxB@&@2A@oF0jSt0*gd j0g!j44 j4!j00`@g/*Hy|PN`* j Jg/*$/*(/*NO `/*,/*a^PjB($/ Hy&NP f4aSN$BJfh|;m|9SxB@$@2A@oFBHy&KN(@P f`aRJg^>9SxB@$@2A@oFRy#R f"aR9|BBC)I9|`"B@F`B@F`HxHxab(@PJg~,ކ)G)Dvd&LJo c>9SxB@$@2A@oFBHy|PN'@PfHxac BHy|PN'@O gB@F`aQ +g"'@k '|(B B$'K4'K0+g&<f$,r҂~‡~҇ )A d &'C ///+/"F iNڃOJo>9SxB@$@2A@oFBHy&N$@P f^aQJg\>9SxB@$@2A@oFRy#R f aP5|BBC%IBj`"B@F`B@F`HxHxa_$@PJgvl&&JJnV ` / aeBL0&n$n +0fBjBjBjBR"k`h2iA0i@0i @f` ItxBCl r‚$1 r‚$1QBDSd| |r芃r*"EJg*)Jfk0`k05|5|5|4L |N^NuNV n-hD ././. Ю/a N^NuNV n-hD ./.Ю//. a N^NuNV n-hD/.B .Ю /a N^NuNVH8&. $Y///.a BBc BቂRbxeJgA$0< g LN^NuNV//"n $." S&YJg AS SJf// /.a r$.&.N^Nua.out[ %s symbol table has bad start address %p ] [ %s a.out symbol table not valid ] [ %s has bad a.out string table index (0x%x) ] [ preserving %d bytes of %s a.out symbol table ] NVH>0&. *.(.g//Hz(aB`&C$C(" |† Vg/Hz(al`$Cc. g"l//Hz/aNB0|O `Ћ$E bJfB// /a(O|g//Hza pL |N^NuNVH00 n&. $h$(c6GJg"fHx_//a)O Jg `G E bBL N^NuNVH?0 n*. ,.&n&"h((cpAJg\fR gF")b> c&$If0~f g0Jf f&`fJg*fg$IA C bJf&`& L N^NuNV/ $n n"nJg Jg"$_N^Nugcc_compiled.NVH>< n*.vxB$h,(cIG g RJg" gfHz/a PJfxvB df"e( c &$` Df"e c(:jI G E bJgJg n n p`BL<|N^Nu???NVH88$n n (n(.&BBJg ("j$*crA $f\fVC cHG$DYG f4o0R Xf <D$ @` :g Rf :fBC b(p`A C bBLN^NuAll breakpoints used. NV yLJg #L `( 9H @g @C#H` HzaBN^NuNV n!yL#LN^NuAlready set. Too many breakpoints. NVH8$.&. (.//aPJg HzaZ`6aJ @Jf HzaD` !CB!D!D !yP#PLN^NuNot set. NVH00&.$. GP$SJg"//alPJggG$SJfJfHza` &`/ aL N^NuNVH0 &.$. $yPJg //aPJg f ` $jJfBL N^NuNV .//a.aN^NuNV/ JTfP$yPJg>/aXJg*BHx/*a%@HxNOHx/*a^O$jJfr#T$nN^NuNV/ JTg:$yPJg*/a~XJg/*Hx/*a O $jJfBT$nN^NuNo breakpoints set Map Count Address * %s%p %5d NVH8JPf Hza<``HzGN$yPXJgHI/*//aX"<Jg"</HzNHx/*NHzNO$jJfLN^NuNV .//a|.aN^NuNV/". .tfp///aT.a$.N^NuNVa0N^NuNV". n BgJfHg HfJfpN^NuNVpN^NuNV 9HN^NuNVarfN^NuNVH 8&n(nr$n `< K"@IfJf(B`PRRIgJftfr`(rE ftf hf +ef +lf +pfr LN^Nu%-12sNV/ $nJg/Hza|a,PEJf$nN^Nu? No such command Ambiguous Bad modifier Count missing NV|H08(n$. BENrf-T-y-A|B.`:rfBBBBa`rgZHzn`Hn/Hy-aO rgmrg `rg4`Hz;`HzD` n$( gNrfJf n( fNrf"NrgHz`jHy-HnaP`/aB.XHnGNXJg# #DTv` -y BNrf Hn|NXJf$Hzaa`/ar-A|X n( fa( TJgXHn/.|//. hN n( g.JXg # `$# `/aaR` # L hN^NuNV n fWIHyD//.a ON^NuNV n fWIHyD//.a P8N^NuNV n fWIHyD//.a RN^NucalloutprocspageobjectmapwatchesbreaksregistersallshowrebootkillpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintNV/ E Jg/HzhaaEPJf$nN^Nu db> NV# # B-y$pЎ#$/a8XJfHa:Jg HzaXBLHzataHy Hya8O Jg#$N^NuNV .g /a4Xa/9$a8NqBad function Too many arguments Argument missing %#ln NVH08BHnGNXJfHz`d(nENr f`HnNXJg.tv֎`r g./NXJg*XRNrg/a>XNr gHz` HzV`HzdaXaB`Rar mA,BRr l/./././././././././.NO$.HzaL N^NuNVHna XJfBarg HzjaXB/.a xNqNV/$. nJg/HyaPpft/Hy/.aB$.N^Nu: = 0x%lx %-*lr%-*lx%-*lz%-*ld%-*lu%-*lo%c\%03loNVH?<$.*n ,.` (Mxz `GNJfB/aHza#O pЃ~1e0; N|d.lt jxz`Xxz`Pxz `H/HzaX`6Hx//aBԄ//Hz`zB//a*Ԅ//Hz`bHx//aԄ//Hz`HHx//aԄ//Hz`.B//aԄ//Hz`B//aԄ//HzraO`BHx/a"RpЁO A~^e I/HzHzHy-NPJf4|`&HzpHy-NPJf4|`/a 4|XHnGNXJfHz:`@$.HnNXJfHz5`*HnNXJfr-ANrfHnNXJf"Hzaa p`(/a $.(. ,.*.&.Srg(#B//aO g ԄQBCSd#L|N^NuSymbol not found Syntax error NV/ / $nGNrf / Hy-a,PJfHzaV` rf $p`rf$ `rf$`rf$`rf$DT`rf/ aJVID`>r f./ aXJf HzBaXNr gHz.a`x/aB$n&nN^NuNV/ $narf/ aXJf Hza~Dp`>rf*/ aXJf Hza^XBHx/a$p`/aH/ a$nN^NuDivide by 0 NVH8 HnanXJfB`E`HnajXJf HzRaXxf(.L.H-D`R$.fHzaX$.xf(.LBH-D`(x f .LB-D` .ЂSLBL-@N&_xdrx gjx gb/a^ n pLN^NuNVH 0HnGNXJfB`VE`0HnNXJf HztaXrf ".Ӯ`".N$Yrd/a n pL N^NuNegative shift amount NVH00HnG^NXJfB`nE`FHnNXJf HzatX".lHzabX".vf .` .-@N$pЂvd/a6 n pL N^NuNV/.abN^NuNV/ /$n$. SkI/a $XQBBSd$.$nN^NuNV//&.$. Sk/a $XQBBSd$.&.N^NuNVH 8$.J gBT/HxaP$yBT 96tIc G(I/a $B/a`0a|`( 9FT yBTb(Ih yBTAHxENHxN yBT(I/N yBT(I/N`HxHzZEN"96t 9FPd//N` y6tR6tp` y6t f Hxa `jpЁt^e`"yBTdESS"yBTeRBTR6t/a ~ 9BT$96t//ax$96tBT/HxaB$.$nN^NuNVH00$.&. a#Fւ# #BT#6tGEXN/NXJgHx a y6tB 96tFL N^NuNV/ /E>N$rg l,rg `$BaXN$rf BaXrf$.$nN^NuNVpN^NuNVHxxHy(a&Jg#(5"(#+l`BN^NuNV#(5#(+lN^NuNV 9fp`/aVXHzaapL N^NuNV//&9P`< 9T$ԀL@(L(mo(Hx a RXn`Hx a RX"yH In#HP$.&.N^Nu--db_more-- NV/ /BEJgI/a pXJfa Drcgmr g `rqg `BL`BLt`SLEJgI/a  XJfJgBa&$.$nN^NuNVH0 $. 9XvlSLnaPpЂv]eXa/EN 9H&R#H"9\Xvl SRnHx NBHBPRL#HP`lv f$Hx a jBHBPRLa`Bv f 9T"9HҀL@L#H`v fRH`vf Hxa L N^NuNV 9HN^Nu NV 9H\m Hza2N^Nu%-12s%#*ln %s+%#lr NV/ / EI0JdGHn/ a/.Hx /HzNBHnHnHx/.aPO.aO$".g, .b g/HzwNP .g /HzkNPHziNXE Jex/9LJar$n&nN^Nu [after %6d] NVH80$n&n &*FODDa.a:Jg *FU%@F&*F/a @XJg ( (S!D xf!h &`Jg *FT%@FB 9sxfx#sB`~xgxf: 9F(S#FSJo$J4gHz$EN/axHzN`xsfBHx/a@$"BAO Nsg Nuf 9((S#(xgJ4g`  Ng  ag Nuf8/9C|HzGNP$y(`HzNXSJn/aHz[N  Ng afR(`xsfDBHx/ab" Ng&  ag B@ Nug NsfBspL N^NuNV/ /$n$*F 9srg rgrfBHx/aRC|O 9srf,J f/a`XJg r#s`abat`D@D$.$nN^NuNV nrsfr#sD@DN^NuNV/ .Btfp n pfrt#s#F#4BC|B{4Bs#$N^NuNV n pWIr#sD#4BC|B{4Bsr#N^NuNV n pWIr#sr#(D#4BC|B{4Bs#N^NuNV np cfp#sBC|B{4Bsp#N^Nunetbsd [ no symbols available ] [ %s symbol table nas bad start address %p ] [ no symbol table formats found ] NVH< (.$. *.&<JnHzs`Lg//Hz~a`HyD`.Hy`&Hy\`HyT`HyX`Hy`Hy// //a:`p-LN^NuUnknown variable NV/ / &narfbE̵ d /Hy-a `PJg.E  eEI0Jd&/Hy-a 2PJf&p`E JeHzra.B$n&nN^NuNVHnadXJg/./.a0p`BN^NuNVHna>XJgHn/.a8p`BN^NuNV/ n$n "hJf h$`B/ /N$nN^NuNV/ n$n "hJf h ` Hx/ /N$nN^NuNo value ? NV/ ENrg HzaJXHnaXJf Hzta0XNr g /a&XHnaXJf HzaXNrg HzaXHn/.a<$nN^NuAll watchpoints used. NV y,Jg # , `( 9( 48g @C#(` HzaBN^NuNV n!y, #,N^NuNo map. Already set. Too many watchpoints. NVH< (.$. *.Jf HzaP`t$y0Jg(&օ//aҺPJg fg$j Jfa$@JfHza`,Hzma` $%Bԅ%B%y0 #0B$L j//*//aьX"<Jg"</HzNO$j Jf$n&nN^NuNV .//aR.aN^NuNV//&.HnaXtJg$.a.///a.a$.&.N^NuNVaN^NuNV/ /J$fD$y0Jg2Hx 9P"*ҀF€// R/a rO$j Jft#$$.$nN^NuNVB$N^NuNVH8 (.$. B$y0JgH//a(PJg0 *e dp`< yP"Fe *Јc& $j JfJgB$/.aBLN^NuUnknown size %#*ln = %#*ln Nothing written. NVH8 nB(. hgn Jg bg ` lg ` v`v`v`vHzaԈXE`JB//aư$B/ab/.Hx /Hx HzbaO$.//a؃tO HnNXJfJf Hz?aX##aLN^Nupid? sig? ? no such proc NVH 0HnENXJf HzaӸXGNrfHnNXJfHzaӒ`/ar-AXNrg HzanX/.a,$Xf HzoaRX/./aL N^Numawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info VMSPACE/VM_MAPUAREA *STRUCT PROC *COMMAND PID %10s %18s %18s %18s WAITFLAGSUIDPGRPPPID PID %10s %10s %10s S %7s %16s %7s WAIT-CHANNELWAIT-MSGSTIMEUTIMEPRIEMUL PID %10s %8s %4s %5s %5s %-12s%s >%c%-10d%10.10s %18p %18p %18p %10d %10d %10d %d %#7x %16s %7.7s %10s %8s %4d%4ld.%1ld %-12s NVH?< nJfnI/Hza L,Pg "F mf"HzENHzNHzNHzBN` ng2n ag `z wgJ`rHzDHzOHzSHz]Hzaa O`RHzqHzEHznHzpHzpHzqHzra~O`*HzHzHzHzHzHzHz Hza~O *<"E Q$PJgfx؎&jDJ*-gL/*0BWIDA0I/Hz{KNO "F ng2n ag` wgp`/* /*"/ HjHzENO`"<CJhg *lg"/Hj/*(*-I/ j/( j/(pJg +0/HzNO `B*//*HjHzNHnHn// a`BO (DG P$L<,~ Ѐ//PHzNO R~lJhg *lg/HzNHx/*haOHzNX$jJfX"E  @JfL#O f"Hza{X 9gpHx/aԸ`b#4/B/a BO oFB$y/Hzet(Ԋ/a|P%B8BBHzSHxHj\aĘO ~RnL N^NuNVTH?<(n..K-M\BHx l A /ap)@BB`BBO "l ox*-nT-n XB&l*nT&HxB/a O E/ Hx/*nXXX/a $OfZBHx/a'@ ///a O *G m*nT"U O -|-IK-M-@-G 9 iLHn p N$Xf'n*G m*nT"UEd -|l-Ip-|dht-Jxr-A|-@-G 9 iLHnl p N$Xf nd ((`c-@` j$ ,rl"L@JgJgc&'BլXTr؁R"l n$,o .`lr ⠰orHx/+ E@NHx/,Np`Hx/,a8 `Hx/+ E@NHx/,N `Hx/+ E@NHx/,Np`v,g>&lK K c 'CG"l K lA b" L)A/ a6*n\*r+A <+@",L@+A rBL<,N^NuNVH?<*n(- RBHx/,<"FN+@/B/a "OJfTB(mB lhBHxHx&FN @)H ~()CB mְIO ER m`$BBB(mz ڌ`.Lmx)G)BB$m-J" m C G `V&j"ne4 JA   H@B@ЈD"E&Q',R m -mEC ".&AG b("n )"L(ւ$Lm (~ڇIBHx - /"FN&E&B$mO m AA c&" *dJg "nd-JEbJfBL-|H-JLBP 9 jLHnH p N. k/Hx/ a(p` k -|4-J8CT-I<-@@-KD 9 jLHn4 p N$Xg<-|4-J8B< 9 jLHn4 p N. k/Hx/ a `prTf.-|4-J8B< 9 jLHn4 p N n B`:-|4-J8B< 9 jLHn4 p N. k/Hx/ a9{0B@&@2A@oFBC -I/ aQd&@P gB@F`/ /.aT4P`a~'G BB&*,4gZB/<B/- a Ln m P-|-H-@C-IC-IC-I 9 hLHn p N$X m -|-HB 9 hLHn p NXJf~ftJg$>9{0B@&@2A@oF'B`C-IJg$.Ȕ` $.RL.(ȴo$>9{0B@&@2A@oFB/.aP$@P gB@F`a\%n$%B0%l,,B(%n<~ خ%DH%l %|7bLBP%m\%m`JXf BT%BX`( ,0"lT%IT ,0.,X d %@XJhf Bd%Bh`( ,0"ld%Id ,0.,h d %@h%Kt%jH4>9{0B@&@2A@oFJfR/ /.a./ Hma,/ aO gB@F`a<܂ծؚf>9{0B@&@2A@oF~ϫ Jf. +g)@( ,$@)@$/ /.aQn/ az2O gB@F`a`/ az L$PfJg^JngXHx/ aD$P`FHx/ a $PJg JfJnf&-|-JB 9 jLHn p NXJfHDg/ aXJg0g,Jng&-|-JB 9 jLHn p NXHx/ a$Pf(J$l"nB"n-i-iBx"GJg"n =WI-@DJgSR"G-iJf *(gZoBB,x-D`Z%@,&.ƀgB"[I-|-L-@-ABC-I 9 lLHn p N$Xfx-DR-jZ *,l4BBf\ .$Jg /a` X"*,[I-|-L-@-AB-B 9 lLHn p N$Xf|B n*hB0,($RXւB0,(m:/// a pO B+Gb)J l$0)E*J-g B`$~)G*B l$B0 BPB`~ϬpLHnHx/(pШ//( aEpOJf n&h<( ج` .g /aIX$F jJg * f / /.NPE * @Jf L0 n$n(.&. SkBSk ;frBJg|;g ( `ΓSk,B bC &BC RQBCSd֑SkBA &AA QBDSd `tg6 bI&BC Bg cB`DBI`8RSj>Jo*B|.g |;gp`p *;f` B``BL |N^NuNV/ /$n n "n$.BJg<=rR`2Jf( @o Zn `Jf .f ;g ;gRn n0$$_N^Nucd9660cd9660_mountroot: can't setup rootvproot_deviceNVH 0$9B yWrgp`Hyz@/9TaPJg Hza.HnHzHz|a$@O JfBHn//./9z@a$@OJg&"n iS@/ aRHx/.a `H$n$(G,%SA"Pf"` y, &/ SHh>/a/.aBL N^NuNVxH0<(n$n$.Hxpv֎//.a K&@O Jf ,6fp`g*l>JfHnHm / aB`B$r@%A(B$%B,/ awv&@XJf^$jrlg/ ap`D jp gm/ ap`$"B i PJgt/</ a"B i P-||-Jr-A-@-B 9 jLHn| p N&@X-||-JB 9 jLHn| p NXJf6,7f/// / a&@O` g6|`/ aXJg / a `^HnxHxYHl/. E >N .xrZ/BHt G$NHnxHxYHl/.N .xO,rZ/BHt NBL< `N^NuCD001NVH?<(n(. ..B lp-h |*Ḓ6BJfp`"/ a$Xf/ aXzlz@gp`BB/.*n m/Hx/ a$OfpJgp-|p-L-@z-E-n 9p lLHn p N$Xf-|-L-|cK-MBz-E-n 9 lLHn p NXJgBvHnHxHx ЮzLX// a=$Ofx n$h+n^Hza+@bB:m8'D'n'L lp*G -lPf|HnHx/+*nB-ЫBrҫ//+ a;$Ofn n/ /( L j hprè/</* a2 j P-|-Hr-Ar-A-n 9 hLHn p N$. aHx9/ aB>k8 L N^NuNVH80&n&. $k>$  / /af/xJWID//// aL N^NuNVp-N^NuNVH<*n&n (m>6'l'k'l BBBBp>Ѝg*HxZHmHkLEǘNPO.ZHmHkNO Hx m/Hk//a"@Jg n 0 nC4 B`p N^NuNVBB/./. /.aN^Nuisonodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] NVH?<(. *.$n*n(m>&,//af*E*PfHn/9&D/.Hxa{$Og*EB`HxHyrav&@HxB/ a YPOBBHzHxHk4aq n!K'H'C'D/ aHO Jf ,$઴m/.al/Hz`"&Ƭ*CE!o/.aH/ Hza("pF`HnHx/,|І//, a6L$Og&/.a/.a:/Hzea' ` n$h(XJlB(n lJg,JgHxT/.auP`,.ΜD (n l .g /a.X,*4.*8(n)F)G (n l <*.(n $l,KfN| dFHxHz/ a @O Jg`,B`$", p@d A"Њc  gRbbp``B A`R g g$g@  g gRRg, fJg"B`R g gJg &RRJf l l|!FHBHx?HxGN(BHx?HjN$D$//$<Ũ"BNO JgBHx?HmN$//"BNOBHx?HxN$BHx//a *nOJg Hzya BB $l l$(4/ /a)J&Pf|pH)@HfP/</ an"E i P-|-J|-F-@-E 9 jLHn p N.akXHx /ag| H)DLB` l!B4pH)@Hg|̀)FH/,P/adP`TJgP/</ a"E i P-|-J|-F-@-E 9 jLHn p N.akLXHx l/(4G@N$DPJgJgHx?/NPJfHx?/NPHla L<|N^Nuvm_map_lock: failed to get lockvmcmdset_extend: not necessaryNVH 0&n$Sc Hza 2Jg Ѐ&`r&BHx? SA /ab$O Jg(E //+/a ?PO.?/+af4'BL N^NuNVH8 $nJgDB"*c&B j ( g/ajX"*xքRbBBHx?/*aeLN^NuNVH 0&n Jgp"9P +f^ +fVHx/+ a J$@PJfp `B$+ //+/ /+Hk n/( a OJg j/ hNp`BL N^NuNVH0<(n$n "*gvKP F/< HxB ҀF€/G/ /, a ROJfb/ B l/HxB/*B/*//* BaO,Jf2 *vfB`$B/$"Ҫ ҀF€/Ā//, a L< N^NuNV/"n ")g@AP F$) /HxB ҀF€/Hi n/( a JfB$.N^Nuvm_map_lock: failed to get lock%sswappercannot mount root, error = %d cannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reaperNVH8$h$("  # JgB@F`a/NXB@F'"E QJfJgB@F`aL 9Rg6B@F&#l#h/a &X gB@F`a $.N^NuNVH0 nfd$yB*+gHx/(/ aO 9l"S#lSJnBtժ&*ׁ%C *cR `HR `@ 9l"S#lSJnd$yBJgBtժ&*ׁ%CR `R #hlJg,R`Jf 9d"R#dRf/ aL N^NuNV-y-y-y-yT@ 9Rf .-@HxHnB/. /.aN^Nufd_unused: fd_lastfile inconsistentNV/ /"n n $i$d RJ,fp `$HnB/ aO Jf/./.// a$.$nN^Nudup2: fdallocNVH>0"n n &n$i&$((*c& RJ<g"B i*(,(lep `Hf&B`>n$Hn// aTO Jf&gHzxa4// aVP/ /// aL |N^NuNVH?<(.*n &.&U"D(iz@-Eķd T$pJg -| e0; NdzBv$-"B"D i,(.(ljd`Hn//a$O fL//./ / aH`: l3z΅"C"B`$- g l3` l3`0jS"C"`2*A35A0- R@@̂@5Azʁ-E j/Hn/<f~/ hN$Of* ~@̇-F j/Hn/<f}/ hN$Og\jB j/Hn/<f~/ hN `\ j f j "C":` j///<@tw/ hN"CD`( j f j !m:` -nD+@` /aV @XJfp` h+h j/Hm/<tv/ hN`zP-E j f&j Hxv֎//-a $O f nf,*.*߮*.ۆ-E0. @gn @g`^ @g6`T* g2|"D(-|-K-Dz-E-C-n`X* fp `|"D(-|-K-Dz-E-C-n` -|-K-D|-F-C~@-G 9 kLHn p N` j f&j Hxv֎//-a $O f nf,*.*߮*.ۆ-E0. @g @g @fP-|-K-D|-FC-Iz@-E 9 kLHn p N$XfHx/-/a `pL%B$.$nN^NuNV/ /$n/ a$/ a%B$.$nN^NuNVH8< n(hBHx'Hx(<*DN&@"K L""""""""/+EbNO + g/NX7| +rmK &Kp'MtvP`>$+rclЀl$jRrcmBHx'&*CHu(*DN&Ѓ'@O 'B///EǘNPO./,/+N"S$+m QJgRh XQBBSd L<N^NuNVH 8(n&l0+2SA7A @fb$S$+m g B/ /ajPXQBBSdBrlHx'/aBP/+E6NX + g/NXHx'/ aBLN^Nuclosef: count < 0NVH 0$n&n Jg~Jgh++g` j fXBnBBBB=| j -|-H-Kr-AC-Ir@-A 9 hLHn p NX0* 2@SI5I S@J@oB`J@l HzPa *@ @fXBnBBBB=| j -|-H-Jr-AC-Ir -A 9 hLHn p NX jJg/ / hN$P`B/ a L N^NuNV/ /"n n "( id P p Jfp ` h gp-`"h BnBBBBg =|h-|-I-Ht`^g=|`fp`l=|h@f"-|-I-Ht-BE-Jt0` -|-I-Ht-BE-Jt -B 9 iLHn p N$.$nN^NuNV/ . n"t 䩂!AXp$N^NuNVH08$n&n (n". . R$0d "pJgfp `vg:vfvƒ0)Hgp `x! jRi o^%K`X! j RB jB4o%K l%@"*l HzafSk RJ g%@BL N^NuNVH8(n&l +m k2g/ / aP +RlLN^NuNVH<<(n&n *kB$+|D(/ a+8$XfH$m'J xlf l -|-Jz-E-@-L 9 jLHn p N$Xf l +$"-|-J-@-A-L 9 jLHn p N$Xf jH (6gt `f,*g k$h l -|p-Jx-D-@-L 9p jLHn p N$Xf<-|-JB 9 jLHn p N.Hn l/BHxBB/+/+/ Ban$O,f*+'E tBhl>Jg>A$ p>Jg"/ / NPJgxf$+KgJfRhmJf8 Dct ,b"+4B l(( *($ot JfB`jHkaX/</ a& l P-|-Jz-E-@-L 9 jLHn p NX/ a@Hx /-4a< L<O / a / a4/ a\*B".O pd -@E//./ a O .B2l0 ,g /a=X/.a>6)n ,(@@)@(Xgzʀ)E(/,DavX . g l P hf gl l P hg\/.aMT l XJgJm / aXX . g l P!n . g l P!nl*`l*"l Q#h"l Q#h/ as/<//9na IhHx /.*GN/</.aT nO -|-Hz-E-n-L 9 hLHn p N.a: n//./ h(NO,*gHx/ abP)nHx?/.*GN , P f/,/ /,a:p`vHna. .Xgzʀ-E/./ aP/</.an nP-|-Hz-E-n-L 9 hLHn p N.a9Hx /.*GN/<//9na HOHx?/.a5 `/<B/ a O .g HxT/*GNPHx /.*GN/</.a nO-|-Hz-E-n-L 9 hLHn p N.a90/<//9na GVHx?/.NHx/ ENO./ NBLX jJg8-|-Hr-A 9 hLHn p NX *g /a6XBBB/+/ a? k!|!|/ a׮/ a ^O kJg!k k |- k4Jg!k88 k8 4$kPJgL/9aaXIZ$*H/9a/ N *(P g%@(Hx / a]fP$BJf7n.HxH/+/+2a LPOB k2Hh// aLdrHҫ//+2aON$kDO*)g/9a/ aPJPf / a.XBB k ("S!Arf/+HyOaP/ a G0LN^NuNV/ / "nE{, #@g y{,G!K $#J / a~$n&nN^NureaperNVH8G{,$SJfBHzHx/ ayO` jJg!j j / a 5XCa %@g yaI!L "%I *)fHx/*Da[P/*Da~X`zNqwaitNVH <*n&n (nJf m$(D&pgp`RB$mPJg tg0g jDfR*- f(0 +g$B=j.Hx/Hna O Jf + gHxH//*2a O Jf**gR jD *T0gD/a9XJf 9a// aBT(Hx/*DaZ/*Da|`r yB"(\Ҫ\p$d !@\Bj./*2tHԭ/aL/*2HyE<&n$.(9BJf DHxa*@BHxT*P/a(@( )n& POJo,,< $kl$B/ // FNO Jf ֊PJn+L$*/ /./arO HxT/ E@NHxT/ N DL<|N^NuNVH<8*.$. &.$n(.(yBHxa&@I-B-C-Z-Z-Z-R-DA'H$r&/ // aHxT/ a!L8(n$n (* *&rƁ|̀BBrgBr@-AB-R-LBHxHnar*O g `N&n-|-KB 9 kLHn p NXrlg / l/Hx/ aup `rf:$y-0Jgʷf/ HxHx/ / aOJfz$jJf`Jfz` * lJD/a)\ @XJgH$hJgjJg/ /// / aN` / /// / azO$jtĮ Jfv#BHzHxHyadOJf 9fv#B$.&.N^NuNVJg yJgr"h&Jg )g/a0X yJgPJ g"/(/( /9Ha ,\ yB O Jg$J*g/(./(*/9Ha ,0 yB*BN^NuNV 9fp `2 yJgJ(f aF 9r€#HyahRBN^NuNVH8<$. *n .B K gb( KgLb Kg&` Kg"` Kg&b K g` $Kg / / a"`&/ / a"`/ / a"`/ / a"`r $.$nN^NuNV"n IBBBBBBBBBPB .0p#@3n#n#np#@N^NuNV nBJhgp`JgpN^Nulockmgr: using decommissioned locklockmgr: non-release on draining lock: %d lockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myselflockmgr: unknown locktype request %dNVH><$n&. (yBBzJg*,0 *(0p *@gN *J@l Hzjan"|†|f *g /HzmaN *@%@Jm *@%@p"S|e0;N t *gg *tJfB *gNv Ƅ * R%@ /*/*0*:@/ / aV$ * S%@ OJfNJfF *fJf6 *R%@` *R%@JgRl *f0*f HzaP2j jC %@BjBj ` *g *S%@Jg,Sl`$ *g *n Hzfa *S%@JgSlg *f *|l`tM`f *f *@%@B *gF&| Ɔ * R%@ /*/*0*:@/ / aU$ * S%@ OJf Jf *f *@%@Jf *@%@%E0*gHza( *f * g / aYX *fL|gFf0* fgt `Hza0*R@5@gb0* fZ5j `Pg *f *g `tM`B *gP&| Ɔ * R%@ /*/*0*:@/ / aT$ * S%@ OJfJf *fJf *@%@`> * R%@ /*/*0*:@/ / aT4$ * S%@ OJffL *f *f *@%@Jfv *@%@%E0*g0Hz4a0*gT *g/*/HzXa2*0* AfBj 0*S@5@JgSl0*f, *@%@|%F` *g *S%@JgSl * g/ aXX` *f Hza g *f *f * gt`B *`: *@%@/*/*0*:@/ G/ aR$OffN f *f * f *@D%@%E5|g5| JgRl`/HzaZpM`$BHx(9X/NO(Jf$//Hz/./ BHzHzaBO 7|ޭp ЋAc ޭﰈb І Kc ޭf$XbB .g ..B@F`a7 L MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenNVH?<$n *n(yBB,.Jf9{0B@$@2A@oF`" *$%@$BHzHx/ aEpO *$f *$~%@$ gB@F`a2%n8B(%L Bl UGNJg  %@$ -"- &~$~ "%AH%k0%S9{0B@$@2A@oF`BHzHx/ aDBO *$ g *$~%@$ gB@F`a1Z// a `//*9{0B@$@2A@oF *$%@$Jg/ a` *$g *$%@$/ aGX g B@F` p`a0Z L&9[I` &9[I "*o$%C *"* o%B%C *"M J"""BL +g// a0B`,tgJg `HxB/`BB/` BD//+/ a L<N^NuNVH88(n&. .&lBJg~$y-0Jg x0l^**fVgR S"(g: j"k (g*g& P (ggxf""j l"i fRJg // afP$jJf`Jg/a @XJf p` l$hJgrx0lb**fZ S"(g: j"k (g*g& P (ggxf*"j l"i fRJg *-g // aP$j<&n*n $.(k$+*f S(, rz"F 1HgE 2Hf kR< + r f// C /4/ /+a^O k// / & փ$ԍ/4( h NOB@F'A(""("("( 4(g* F"FHrgA0gI ЍBa `)B<)M8/ / a L<|N^Nupsignal signal numberNVH?0$n,. &S~d Hzav2A *0l**g`b" ~t 2 f 2 g2|`6 2 2|f(g *c|g jJg(~ ȇg0 9-TF 9-XF 9-\F 9-`F~ʇg0 9F 9F 9F 9F$A ~rᩃ(|~fJg$ *-fB@F'&G*- g gj`J*+l *( fJgJg~JgJff ~ <5F. jD(+f Hx/aLP/ a`x**fr~ gTJgJfFð(~g@JhgH|-`JJgFð(`>Jhg8J*+l2/ a`&Bf R` *2c|2/ a"6X g . B@F`azL N^NuProcess (pid %d) got signal %d issignal NVH?<(nzڎ,<z// "FNP,+g0 9-TF 9-XF 9-\F 9-`F ./a XJVI&Ɓf B,B`(S$K ~r F( 4) g ,*gh ,( f9C.GNE=$<,)fHx/,DaP` ,*g/ NN."BNXJg,*g0,.gB6(S$ ~r 4) fFõ(A^"0< l$"CC: 0g ~g` ,0~m//HzVavO `gP,*fx lJfff9C. lDGNE=(+f Hx/aP/ NNX`2f*`"f ,*fHzavX` ~rꌃL| L&S"A ~ *څ І(3 * ~ f.B +7g $////*a.OJf // a`A~g$"~‡p,g Hz8ap +4g" $~΀'G4`" jR/asP`HkHzc$>/asxO BB~-G-B-KHx/<Hna$O fT$n|lf<-|-JCT-I-D-K 9 jLHn p NXJf\gt`$T/ahBpBtX-|-J-K-D|-F 9 jLHn p NX-| -J-B-D-K 9 jLHn p NXk0BHxHk&Hna B k$-h8&-h<*B. ,~ -@2 ,-@6",*<P"E ҀF€-A:/// / a $OfJfJ.f-| ./ B/Hx B/..B/.6/,/ HxKE"N$O,f/ B/Hx B ..Ю6/B/.: ,| "<"E F€// HxN`>/// / a r$Of./ B/Hx HxBBB0. /// Hxa @$O,-|-JB 9 jLHn p N./Hx/ aJf$ L"C")"n C" z #T` E5x(J$TJg./9PHja PJg$jJfJg zf& `/Q U/a(Pf"/9THzIadz%P`~& `jG$ HxB/ a O 9T"z ꩂAJl^//Hz / N$TOJgHj/a PJg$jJfJf(/9T/HzadRz%O `B`#W"C zgzfJ`` 9T"z ꩂ K4tԃJl^"AHia/HzNz-EtO `Hzacz%X`l 9XgHz/a 4PJg09%gJg8`. `JXg 9\zg/ /ah&PgtԎHxB/a @O 9\"z ꩂE5xAJl^//Hz/N$ROJgHj/a PJgf$jJfJgr`4z"Cgh.! U"G")R z #\K4 9\"z ꩂ l^"AHia"GHiHzHN`z#\Jtg HzBabbL<*n$. *.(.JfB`|fHz/ a RPJf BHxa ^I( bI @GB`| D `&n$y5xJg||fTtԊ// a PJf@//a $Pl HzNa\"*G" |  D `"|fHj/ a PJgv$jJf L<|N^Nu NVH><*.,. HxIN$EBXKG4N$rgLmr g&mr`r g`r@g0mr#`rg&R`(HzdNBBN `>JgSSHzz`B$EHzB`orm HzdNX`/Hz8(9 ؄Hy-,ar$y-0XJg Rp*-W bRt$*dL9(z %Bd|teB@F&"9R"DCG?f"9zdfԪ`` j`I A LAԀ%BdB` L*\*, LFP%E\/ N*X 1cDBg6 *-f.*+g& *g/ aj/ aP`j gB@F`a$jJfa /9BHzac,L|N^NuNVH8 n"(\ 9 &փ"CC $(tdB\`2S!BtJg$$ (t(S!Dtxg LLBf!A\/aLN^NutsleepNVH?0&.*. ,.$yB(JHfJ#,gHB@F' 9ng.9nB@F`a g B@F`a` * @~@fBHx/*aO B@F'Jg *-fJg Hz>aX%Ch%nlBtEGAhCJf"` i #JBJg// Hy:raaO Jg@j*J*g/ aX&@`JgJhg/ aX|-`JhfB`|- jR@a: gB@F`a *(~F΀%G( g0@%@(Jf8 * @~@fBB/*ap#`Jg/ Hy:raa`PJgTJfJ*g / aX&@Jg: * @~@fBB/*aG" $j$Ap0g$p` * @~@fBB/*aVBL N^NuNV/ /$nB@F'Jhg *-f/ ad`/ aXj* gB@F`a$.$nN^Nusleep called with priority %d > PZERO, wchan: %p old sleepsleepNVH0 .". $yBvl//HzaYHzaUB@F'JHfJ#,g8 9ng&9nB@F`a gB@F`Jg *-fJg HzbaU8%@hBlBtAGAhCJf"` i #JB|- jR@ * @v@fBHx/*aO a * @v@fBB/*aO  gB@F`aL N^NuNV/ $nB@F' *hg*GAhC Ig Pf f#HBh gB@F`a$nN^NuwakeupNVH00$.B@F'GAhG K`Jf *-W c HzaSִhflBh f'H *-fVrtd/ a\XBt|-*+g/ apX*+fHy΀abX`~RLR`n J$PJfj gB@F`aL N^NuNVH<8&yBHnI NA 8 ."+Ҁ .(+؀XJl B@S` B?oR'A'D$k&[I "*nL *"* nHx / aTP`.Hx/ aD$&*P *"* o BZՅ$%C 9Hg.l* k PJg +f9OE/ aFXRP/ aHy 4NL<(.*n vBBJg"DHi0 i/a˜$Pf"- U| dp`/Hn/E N$O f .S|e\0; N,<4T$DTLIBT| g:B`6IE`.I :`&I2`I2`I J`I |`p-` - gHxHn/N$O f -grB/./a2O Jfp`E$ Jg(EG|$HxHjarRPJf|"B"Jg/./-/a"O *.//-/-Hn/-,-S/HnN$O -g2EGJg///a O BJg B/ aXJf - gHx/Hna m $ L<|N^NuNVH<0 n$n "n".$.&.&n zg zg zgp`6 Sz%e(0; NLV`jtnBD|Hy<``p-L Bj< jJVID%@@ k h fr%A@HxrҪ/HjDa xx$n&nN^NuNVH80"nB@F&A-d "-AG$K (&) -@lS-AB@-@JmJlxlp`&()#-d#-hB@F!C"Ү"A Ъ B?o R" C 4"Ү"A 8 Ы B?o R" /.aX gB@F`aa RXBL N^NuNV/ $n Jf:Hna P|-n n 눐A -@Hx/*Hna a`p$nN^NuNV/ / n$n Hh0 h/afPJfPJgp`HHxHn/*a `O Jf.-n .$L<,bMЀ-AHna(JfB$.$nN^NuNV n BJgp`. hJg&B <;Ly-@Hx/Hna `N^NunanosleepNVH80&n HxHn/a `6$O fr-nE .$L<,bMЀ-A/ aXJgp`B` B//Ba$.&.N^NuNV// n$. B `( L< fffg Ѐ"AC Ѐ0$v m0 $&N^Nuconfig_attachcf->cf_fstate == FSTATE_NOTFOUND/u1/NetBSD-1.4.2/usr/src/sys/kern/subr_autoconf.cdiagnostic config_attach: device name too longconfig_attach: memory allocation for device softc failed%s (root)%s at %sexpandcreatconfig_attach: %sing dev arrayconfig_attach: duplicate %sNVH?<..&n -k,r+*Fe Hza506+H0+ @fRk` J@gHzHxHzHza oX7| *n/-a i$@/tԎ/a(pЄ ЂO rd Hza4HxHx*F/ab(@O Jf Hza4*F/B/ a iO BC5|)Q y5| K"*n()K )Cv֌/ /-/*<ǘ*ENPO./HtNO )G$r)A(Jf/Hzla8j`(*GHm/Hzba8VO JgB/.*nNP ,*n$m ntJg$ Ԃl*n+B HxHx /ah&@O Jf <[LJg <[E/Hza3/B$ Hs(a hO Jg$/*n// *ENPO.*n/aP*n* ,*n UJ g /Hza3(! G +g>CEаf0Qf0f4p @fRQCEG +f/./ a 1/./ /*F mN/ a L $n&. *$(S%D$Jf/*Hza-HHza(B@F& 9Д"9И-@-A gB@F`a2".H-A .L-@lS-AB@-@"*PҮ%AP *TЮ%@T B?oR%AP%@T(.*.%DH%ELJo&"[IӪ<**8ۀ%E8Bz۪,,*(݄%F(L|N^NuNVH8 $n69{0B@$@2A@oFB(B,B8BJg(%i QJg!i i / / EyNP` #MEy/ / N`,Jg / / a l`'MK('M &g R!K$'JL<N^Nuextent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extntNVH<<$n&n (n(.K& Jf HzJa!JfB/HzYa&Hz}a!c/ / /Hza%Hza! * bc(/*//HzE4N// HzNHza!V// a $PfHza%p `v jJgZ"z…eN b@g.zBHzpA8Jg <// NOJg`&// a p#`"H QJf// // / / a4BL<Jg8Jgc *-J-n ) @&nG" ®$nb-I"QJf8G( bbJgT R&S"D$.$|@ĆfЃJf &nA` @SdEG b8b2b,b( ,RJfvJgrJgc *-J-nJfJg $n-n`H.'g2|BHzp.'g <// aOJg`,/./ a|p#`/././.$/ / / a&n(&BL$RJf/ a//HzaHzax%D `R%BJg / / aP ,gzʀ)E/ a.BL8(n *.$y5pBB@F',*fj&GgJgB@F`ap#`|BHzHx/ a|(OgJg B@F`a`~,*g GgB@F`a|͓`J j"*j"* $d$Jg2/ /HraV(O f *Ђ%@m mB ,f L|N^NuNV// . BB@F'rAg& y5p"(g&`Hy/.aN^NuNV/./9HauN^NuNVH00&n+gf|B@F& 9Д"9И-@-A gB@F`at$kJg>&"k,$c0Jf ". -A .$-@lS-AB@-@"nm kD"+<  eJf$ +f Hzazc HzalS'@'HD RJg!j`'j j /+X/+0/* kTNS,RO +gfD jJg!j j B@F'/ HyaP gB@F`aTf kJg Jf PJf'H$CJfL N^NuNV//69SxB@$@2A@oFJdf 9#dg yd#d/aX gB@F`a$.&.N^Nu%s: table is full NV/.HzHxarN^Nupanic: NVH8 (.&<J#,g&<`##,t ԎHzE4N//aHzNOJga p\B/a "NqNVH8 .(. B@F'/atԎ/BBHx/ENOJLf/BBHx/NO gB@F`aaLN^NuNV/ .B@F'/a&X gB@F`al$.N^Nu%dNVH 0$.BHxHxNL N^NuNVH8 (.B@F't Ԏ/BBHx/ENOJLf/BBHx/NO gB@F`aaLN^NuNVH>*.(. &.J#,gBp$|ĆgJf 9pg &|$|Ćg&Jg"//aPJlJgpfBpghJgd| g^|gXJ#0gP y5p 0agB#0`: (R"(m mBB (f,R!FR mBJgJpfJg / yNXg/ahL|N^NuNV yB(+g$"h i JgHn B/( Hx/.aN^NuNV"n)+g i h Jg R i ( `BN^NuNV nJg "S rf Hx/aYN^NuNVH8 $nBxJgJgB/* arPJgx&* B@F'HxaFHnB///. aO gB@F`avaLN^NuNVHnB/.Hx/. aN^NuNVHn BBHx/.aN^NuNV// .B@F'&9BHn BBHx/alO gB@F`aJ#,fa#$.&.N^NuNV//". . B@F'&9B/BBHx/aO gB@F`anJ#,fa#$.&.N^NuNV/ $nHn/ BHx/. aB2$nN^NuNV/ $n/./ BHx/. axB2$nN^NuNV n . g&C-IHn/HnHx/.a@ nB`pN^NuNV n . g&C-I/./HnHx/.a nB`pN^Nu%qx%qd%qoNVH?<$n$.&n/B/ a /"(SO |dlI|fI` |g"| g|WI(@, (F` I`IJg(/. /./ K/ a MOJgSJf,. g|d~<|g^Igz S$&[I .". ƒ,g$Sg` SgRI| m~,`R  nIf`~-n-n `fIpЃ|,eR0; N HH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHZHHH//. /.a ),O g`SgIf~,`I//. /.a (O -@-A/HxBa *zO BSî|FgxSg~,`SgxIf=Sgj/././ / aOIAg:SgFIf`,f"|=f=Sg*IgSgIf`JfIf| .L`/./. Hx>aO `.g 9Dxgh"SgP-j-j`,fgX8*H[I` X(*[I-C-DJjD@|-xVID`.gh-|8|x"SgP-j-j`,fgX8*H[I` X(*[I-C-Dpg(.gJjD@|-`|J.f*| ` v`X-jl Dx`|+` nRI(Cv*fX$*&BJl6|`BpЌx e& BA, I $ nRI(CpЌv d&BJl6|`xF`B BA, I $ nRI(CpЌv d-B`^x@`H n lgx`6Rv `*A-HXv-C`x"SgP-j-j`,fgX8*H[I` X(*[I-C-DJjD@|-p`.g& 9D8|xxg8|uvf8|o`gX j([I !D`fg X j0`X j `x"SgP-j-j`,fgXvx8*-C-D` X-jBB`6X-jBp-|Ќ8|x"S`X-jf-|Jm,/ B/.a 'O Jg-@Էl^-K`V/.a $-@X`Bx"SgP-j-j`,fgXvx8*-C-D` X-jBp`l-|`-|"SgP-j-j`,fgXvx8*-C-D` X-jBpg (.gB.-KmvF̃-A(.fJg6 `/./. / ahO x{F fH$.ܔ SJo:GBv fJgg0`/./. Hx0NO SJn$.ؔ SJo:Gx fJgg0`/./. Hx0NO SJnSvgFGx fJgg^ nR`/./. nRI/NO Sdg$.ܔ SJoGTv fJg fR`8 `/./. Hx NO SJn`Px f Jg n L<*n&. $.JoJn@/-Hza %B$`( P// /a `ת` %B$`( P$D"U* cI"*g R ЈfP"҃$d * gԃnAưl/-Hz$aҔ$pЕ/Hj/ N UB` ЃgNoJgNJgl&JPPbvg *Ъg A4m.//-HzN P,/// a  UBO`//-HzNL<|N^NuNVpN^NuNVpN^NuNVpN^NuNVpNN^NuNVp-N^NuNVBN^NuNV/ $n"n  jd P p Jg( fp `/.HxHh/)/)/// a$nN^NuNVH00$n"n .-n-@G-Kr-A-@BB-JJlp` * rf -n-n&. i/. /)Hn/./ PN$Oggrg rgr#fB * rfJfB/HnB/. /*a n$ L N^NuNV/ $n"n  jd P p Jg( fp `/.HxHh/)/)/// a$nN^NuNVH?8&n$n(.*|d bBHx/a>.&O `Jfp`.v֎B-C-DBB-K///.a v$O fBBo$ CX .А-@JmJlt`PRn + |f&BHxT/a=(@//./ a O O &. j/. /*Hn/./ PN$Ogg|g |g|#fB + |f*Jf&B// B/. /+aHHxT/ aA O n$ Jg Hx/a@ L|N^NuNV/ $n"n  jd P p Jg( fp `/.HxHh/)/)/// a$nN^NuNVH00$n"n .-n-@G-Kr-A-@-AB-JJlp` * rf -n-n&. i/. /)Hn/./ hN$Og.grg rgr#fBr fHx / al,P * rfJfB/HnHx/. /*a n$ L N^NuNV/ $n"n  jd P p Jg( fp `/.HxHh/)/)/// a$nN^NuNVH?8$n&n(.*|d bBHx/a;d.&O `Jfp`Hv֎B-C-D|-FB-J///.aP$O fBBo$ CX .А-@JmJlt`PRn * |f&BHxT/a:(@//./ a O O &. k/. /+Hn/./ hN$Og.g|g |g|#fB| fHx / aj\P * |f,Jf(B// Hx/. /*a HxT/ a=O n$ Jg Hx/a= L|N^NuNV|H<<*n(n &m"Td S$pJg fp `&, fg ff k1B` k1B`@ cp`B cBHx/a9n*&EO `GJlJg ,g//HrLa$O f" , g//&DGL Hra`$O ЄЀ c HxT/ a8 L<N^NuNVH?<(n*n-mBBo-K, -F*n X (B`PS"ҀoTt FȀ*n U$pJfp `\ j/.C,./1h/ h NO JgR/a BXJf*nX*| ֆnR|lf n BL @Jg hfj`$$.$nN^NuNV/ /$nJg0*gRz,@5@HyaZX/a>" @BXJg\B@F' hf (-f /aRX`/aX` ((gr€!A( gB@F`ajx$.$nN^Nuptrace: impossibleNVH0<(n&n *nJg/+a=z$@XJfp`$L r$e80; N..J.....................$*0p0g. *( fz j&, h"CfgHl0"C/aGVPJfafJl/ / aPJf0p` *( gfDf *-f fp`BB r$e0; NJbb``(&j* jD%h0TB`.v Jgp Ћ-@t-BC-Ir-A$+[I-A-Bt-Br-ADD-C-LHnB/ / a`t p e *"@R%IJf*+f / a7Xr WID// a NPJf +tg// a NPJfrSr f8 jD *T0g /a;XJf 9a// aPBTj* *-f5k./ a@` + g// a\`S`t 'B `j* jD%h0Tg / / aVPr'A `v/ aXJgX-ktH-BC-Ir-ABB-BBDD-C-LHnB/ / aü`fv/ a@XJfp`R-ktl-BC-Ir-ABB-BBDD-C-LHnB/ / a0` Hz,aL< N^NuNVpN^NuNV n h BBB/.B/ hNN^NuNV n h BBB/.B/ hNN^NuNVH0 n". $n$."h @s gb @fgh @sgt`| f~gb f}g `h sgJ`^Jgi`8i`0Jgii`i`ii`i`$BB`\#R:`$:`0A$`vif// // a `,vrg i /B/ /Hx / hN` // /a}L N^NuNVH? n*. ..$h BB@F! rAg "*BRd*f Jj2fJj8g$&rƁg@ jhd *pl8*l tmf j ( g fJj8ggJ>f*g r}FJf4gHjZ/aj`PJgHj|/ajP gB@F`ad, LN^NuNV/ / &n$n Hx`B/ a O %| k BBB/ Hx / hN$n&nN^NuNV/ $nB"* g/a@B $nN^NuNVH88&n$n &."+g fB0*gB0fB`p`BB0*gB0fg$<JlZxF`RB0*g(/ /INPJfB0*g / /NJggt Jlx`gtJlxB0*Vx LN^Numsginfo.msgssz not a small power of 2msginfo.msgseg > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULLNVH8pA@"gЀ og HznaGD$So HzzaͨJ5f Hza͖Bo"K y5Jo1 1 RmBy\#hJ4f HzOaVBAmsg_spot out of rangemsghdr->msg_spot != -1NVH 8$nJjgfIDG@BJj m2j m Hzab y5001\3 \Rh5@ 2*m 4+j`BjJjf j g Hzfa$#LN^Numsg_cbytes is screwed upmsg_qnum is screwed upNVH88 n"n ")$) h$PB8) DJmj4l`I A  yG J gB8k f8xgmJg`&xg`Hx/ / a&O f$kJgB4*S $R/a~XJfJg HzaJg HzaB / av`Hx/ / a&O fHxTHn/a&f".$ cpJfx 98d-@"JgT7n7n0.@'n A-d'P<`,Hx/ / a &O f"HxT// a&`p` Jf nB LN^NuNVH<<"n n &(( i&PJg|BI4"ob 9*@A C $@ CTggATpTЊRn䴔l2  fp`// / adJg`Jg gBI4"o. 9 @P*@C $@ CTfgATpTЊRnⴔfp`p%C 45k5k5kD5DRj BBBB%y8 B$B(B,B4A-d%P<`p` n4j : HE: BL< nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segmentsNVH?<$n .**j-j "n i"B:* EJmb4lXC A  yI J g::l f0Hx/ /a&O f& 9@C, L@`-F&, e8,0D4BVID-l .Ѝdr$yhlr&y-KfrJgT.fXA8JBgB` D9DtBHzHx/ N&OJglJf &, fjpR`p* gHzad&, 8,&ylHzaH&, 8,&y .ЍdHza&8,&yJfHza 8,&yD9D#7| 7MJo(<D&9hnHza&y49\ BfHzaŰ&y BnHzaŚ&y4B"DmHzał&y y53\S#h1 7B SJntHxE/ /,< "FN&O fXJn/ al/ aqp` 4+ Jgd(<D 9@$Md$@ Bn HzaH"Dm Hza/ Lй'//"FN&O fTފ y540*Jf Bg HzaĔlJ f/ a/ apdpR`nJf&)K`&p#`^p`Z/ al/ ap8 `B l )K lBB0+ѬR"n)i0$A-d)P,/ ao nBBL- GJm04l(K A  yG J g *n >k gp`"Hx/ /a&O f BJf@$kJg. >*(Gc g*f BB`'RfzHza²BC I$QJgfB"*g DmF4*c g f8Jfg HzahBB`f HzaR'C` & J$RJfJfH fBHzrHx/ aiROJf|J g=k *n B0gpR` JgB0*S*n'm0(A-d'P4B0*d,Hx/.Hja4&O g(`p`pS`p`/ a/ amv `X2* BcnI@ 9@(d( An HzaT4H´Dm Hza>//.Lй'/aߤ&O fٮ y520*ڔb/ al/ al n BL 9-pG"@X$@P @Jf Ќ#ЌBR"`VCbEbpbЈRm"<ЌJf$B"A`Jhf B"p`"H QJfJf `HzTaRxl|BLN^NuNVH>8 .&n &.(.$.$SJf:$yЌJgg$RJfJf Jf B`&`/a $@Jfp`~&C B8joF" &If20if*JfBQ`QJQfSj0jo*2 ,2&'F`PRPnJg0* @ gC R@5@2#C3D`lpL|N^NuNVH80$.". "yЌJg\E BJioJ&Jf4vg0jf Si0io&1 (1&'DQSQxfPRP0in"QJfL N^NuNVH?<"n(. *D,&m&-$- i(P/ aXmNlD 爐刐 y-4E *g&*D8j fB~ e0;:Nj.p,Hx/ / a&O f45lB0*(9 # "95 jA   H@B@$ԀD₸o2&AB*BK, Ѐ2* BAAC""2~ ЇRnBA l< 9-4&H*@A"@P0C6 g"c 0* A6RmBj`Hx/ / a&O fHxHn/G N&O fHx6Hn/.N&f5n5n0.@A-d%P`Hx/ / a,&O fHxHn/a"&O f|Hx6/./ a٦&`XHx/ / a&fRJm:B0*o. jG 00 -@`Hx/ / a&fJmB0*o jG -p `Hx/ / ah&fJmB0*o jG 00 -@`Hx/ / a&&O fHxHn/a&O fvBB0*oZBBHx nHp*.*ބ/a؄&O f>~ ؇R:*n` Hx/ / a&fJmB0*o jG 00 -@`Hx/ / aj&O fJmB0*oHxHn/aN&O f jK 1 / `pHx/ / a&O f|HxHn/G N&O fbBB0*o0BBHx.*ބ/ nHp*N&O f~ ؇R:*nHx/a / ad`p`Jf n LHx/ /aO Jf*B jJjn/ a4B0+#6`p`BL N^NushmgetNVH 8 n(n &n h"C 爐 y E 0* g"@5@BHzHx$/ aSJfNp#`J/./ /a,Jf8 ,g cp`( , g n4j 4 HB4 B`pLN^Nushmseg free count inconsistentNVH><*n "n i*A -ecp`tE$np`^&C( | йop `0 96l2Bo y P0A. fRnf Hz>aL(A` (@|#6 y C 爐G 7| 'U 0+ R@@7@ BHxHxa$@<+ 4HB4 B/aR$'J*"E0)7@60)7@7@0+@2.AA@7@'m"n'i0OBkBB"BA-d'P&| ٹR n 0+ g@7@/ aV@BL<|N^NuNVH8 (.$n &.$*Jg2/aXJm//// /aLOr#g`* fp` /// /aLN^NuNVH0<(n*n JfB``G$BHx/ab$@//,/ a P+JBl. y "*vg"AC 爐Rp RPmL< N^NuNVH 8(n$lJg8BGlrg / / aPRPmHx/,anBLN^NuNVH 0A t BEl$ 9 &@C @P0A.BQC.RmB6BBL N^Nuttyclsttyopnttybgttyinttyout@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@NVH8 $n$. 89-8B@&@2A@oFJg2 *ngf gB@F`x%Dn`Jf^ *nffr *ffRrBHzYHxHj/ a*$SrOJg gB@F`a;8 `>*qg gB@F`a;p` gB@F`a:BLN^NuNVH8$. n 89-8B@&@2A@oF!Bj (nfx@!DnBBBv gB@F`a:BLN^NuNV/ $npfBpHx/ a@RjBzB~BnB$nN^NuNVH?<&.&n +g$+g/ a , g6Jm Hx/ aP/ /a!BHxB,rf ,gr/`2B, f: , g2Jm Hx/ aP/ /a HxHx/+za+2O` gtB, fV , gN +n f*@'@n k"@C AgB/ pN`B, f , f`zB, f , f~ fJmjgv `~ fgv +fJgB,f( ,g Jg(/ Hka=.aP`B,f ,gxg20k +f&f JgRE/ / a=.aPJf`6/ /EN~ćPg / Hx NP +g/Hka8PBkkp` gBB,f ,g-B$ PK,` / /aDP/N&X~ g~ g~g*/ /,< "FN/N&O g ~ g\~ gV ~FE2~@ȇ`Jg ~F2~@f&/ /"FN/N&O ~g~ g~ f//a8P`B,f ,g / aX`|B,f6 ,g.JlHxHx/+za(O fH/ a xX`< +Ы( o2 g0kرHo/ HxaPP` Hx/ arP`( P//a7PJmJf/ a`/ /aO `~ g*BgB,gB,f* g$ gBkHk(/a;/ a O `0+2@RI7IJ@f7k +n g@'@n/ Hx/aP4k/ /a.BPf2 g,g&0kґ~d0|$HJo/ HxaHSPJn+pg f , , fkp/ avL tgb: f}g|b @,tg~ trg` f~g tg` tvgpb tbg teg` tgge ,tb ,te`>9-8B@$@2A@oFJg|n`~Ϭn gB@F`/ ap*`t<9-8B@$@2A@oFlp gfB@F`< fp`~// a@`$JgB ypJggpHn|Hfp`Hj0 j/a "@Jf#p`޹pfBp`/ a"@Jg`C* M `B,h`,,.,*+G`| j h ~f*+g lz <u1Jg (` j h ~f*+g* `(>9-8B@$@2A@oFl@ gB@F`<9-8B@$@2A@oFlp gB@F`*H`>9-8B@(@2A@oF$ Ӌ|e8/ a"@XJg gTB@F`\ ,tf Hx/ afP- ff lJg$/ / N"@PJg g B@F`)m)m$)m(f l~JgJgHx/(a!NP/ a~X ,tg"- $, gJg)B/ aX`G(/ E/ a3-R-l -l-l-l-l-l $)l, )l0)l4)l8)l<)l@ &)n,)n0)n4)n8)n<)n@P)U)m,gm`m , )@A     gB@F`(*ljep`B,hg>9-8B@$@2A@oFE@// r8N Y/ / rN"@OJgBB,h/ / r-INP "ng B@F`-Ia*>"n`Dh gB@F`<9-8B@$@2A@oF ,n fJ,l@)@n/ aX gB@F` j PJg$g j h ~f*+fp `fB,hAP/ B/ pN`D>9-8B@$@2A@oF ,n f(@)@n k&@G AgB/ pNP g B@F`a) `"j i ff ,~JfJgfT)i ~)jz j h !L |(`/a8"@ j ( ~f*+fp`rJfp`j gp``)Iz`X/ a0`PHx/ E/ a ˔O Jg6,.-$%GHxHx/,za`/ // // a ` `BL9-8B@*@2A@oF$~Aćg/ aXJ^I&ƀ$~ćg 0jڱHmg*qf *f~Jf&~QȇgHj/aPJgHj/aP gB@F`a'H LN^NuNV/ $n *g / aJ *"*(fҪB*oJ*fB $nN^NuNVH80&nB89-8B@&@2A@oFJHf+qgP+qf +g< kJg4/ NxnBHzHxEH/ / a$Of Jf+qf gB@F`a&T L N^NuNV//&./aD$XfHx/a $.&.N^NuNVH8 $n$. 89-8B@&@2A@oFg> *(g/Hj(a(P *g/Hja(rPBjBjjp/ aXgPjp k"@C Ag// pNP *Hg/HjHa(PHjHaP/ NXJljpLN^NuNVH?<&nE-yBBBBB-k>9-8B@$@2A@oF.g/ a2X gB@F`a!"n i.( ~fl )(gbzg\)f)f fJfp`HxHx"n/)aFBHzHxHy-,/ a(O g>`>9-8B@,@2A@oF*n. *GJfB*B*If n`"BC*" Ҁ"BC" "BC$ Jo"-TootJg"nn`(-TnZJf~-G-y-d-y-h*`2A-d P"뉒 툐A A-h"Ё*-nJoL9X B?"L<Cރ~Ѐ` I(JnB$+nf +grJf g gB@F`|a `t.g gB@F`ap#`/ <K$ PJg <X/Hx// a(O gB@F`aJ*f ~#fB`JgT~#gL` gB@F`ahvBB`j 紮fX * gP . f>HxHx/+zaO JgBHzHxHy-,/ aF(Ofx`f gJfd/. /a (PfR"n JgHJg2~ g>BgB*gB*f.g fB/ a$Xl*>9-8B@$@2A@oFJ+qlf n\+g.* g$HkHB@a!PJfkp/ a:X +g kJgB/ NPJgkp gB@F`a L $.$n *g f,%FgHJjgf |d@|FĆAC0(|?|e 0; N,Hx`*g,Hx/ a0`0jԱl / af`<9-8B@*@2A@oF6*Hjp5jHn( P/an$Pg"/ /.aPHn//a$O fjp gB@F`aT"C& j|lvSk`/ HxaPQBCSd`H//Hzha`8g$ *n f@ %@n/ Hx\aP/ /` / B*/aBSjL|N^NuNVH0 &.$. SJo(Eh/HxN/Hx N/HxNO SJnL N^NuNVH<0$n* g/ B@aP/ Hx a P:9-8B@(@2A@oFHnv(֊/G,*N$Pg / /.a|PHn//aP$O fHn& P/N$Pg / /.aJPHn//a$O fjp gB@F`a5j BjL x f / Hx aݮP/ /aݤ/ aO gB@F`aBLN^NuNV/ /$n4*/./././. a#PJfjVI$.$nN^NuttyplNVA,B#0B`Hx>HyHyhBHzBBBHxHyS|akN^NuNV/ nBE0!R"y0"$R`$_N^Nutty_detach: tty_count < 0NV"n 9`"S#`Sj Hza{P QJg!i`#0 i N^NuNV/ / HxHyS|ao&&@HxB/ a HPO.HxHkE$NHxHxHk(NOBHxHkHN $n&nN^NuNV/ / &nHkE%ZNHk(NHkHN/ HyS|aq$n&nN^NuNVpN^NuNVN^NuNVH8 &."x 詂 mp`"AC 刐AtE fa$$@/ adX`$@ *ng gV n h PJgFp`/ a2%|+x%D%|%|K%|%%|%/ aPJgxn . f:*qf2RrBHyKHxHj/ a2$SrOJf,*qgB*hA`t`.xl(Jg"/ E(/ a R.a JPJmxm +(xfE(/ a (X Jg(`0Jg B+hAD// / pN$O Hx/ aJ L<N^NuNV/ /". t 䨀$@E " 剒At"pJg B)hAH/./. / pN`p$.$nN^NuNV/ /"n")j t 䨀$@E " 剒AtA)pf (gtĀ!B|Hx/ a|$.$nN^NuNVH0 "n$. ")j v 樀$@E " 剒AtAJf tv`vǨ( vЀg// a L N^NuNVH00&n$. "+j v 樀"@C " 剒AtEgHjaHkPa!PgHjaHka!lL N^NuNVH 0 ."t 䩂 mp`r"AC 刐AtG fa&$@/ anX`$@Jf8%| B*hAXHx/ pNjBB+B+B`pL N^NuNV/ /". t 䨀"@C " 剒At$pB*hAXB/ pNtŪnBB$.$nN^NuNVH>8".(n *. | 쨀"@C " 剒AtE&RBB`8fB`Tgp#`HBHyXHxHkPa6$Of("+ng*gF*g@/ /a $Pf*g",p,d / /Hka0B*B`*l$*g/ B@a B$fB*B`JHg@ f8g/ Ba $P",gFJfBv֎xH؋E&Jpdd ///NO Jo/ //a$O ",gJg0kڱHm( +ng|̀'FnHkHaXHka8 L||N^NuNVH?<".*n ~ "@C " 剒AtA,$PBB *ngJ"F)g2J(f6`j(*( ndJfFrdv֎A%dd"$ <d $&C/ // NO Jf0*qgJgHj(// a O B -ft(Ԋ/Ba / a^/aB`Jf0rdv֎A%dd"$&C/ // NO Jf*qgpJoXBIPB"*( *Ё oJn*fHjaZX *n`,*h / / tNRSPJnB -fhB`Dfp`:.f&BHy^HxHjaBOJg|խ` խJW~#L<&.$. (n*.(. | 쨀"@C " 剒AtE&RK t`fXJg"*g*@Hx/ aDk` + g*g*@Hx/ a +@'@` "@C Ag pfF tigb. @twgZb t_g`" tg tfgh` t b t d tpg0` ,tb ,te`r kzBJg ((B`JgJ*mj|`|ͪ`Jg *fL|F%F`j`Jg| `|ͪHx/ a\`/+HHkHaP`R| dp`JmHx/ a*PHx//+zaO |fR+fH/ a``v+g`*gX t b t d6 tb@ t}e8`$ tugb tg`" ,tb ,te*@Hx/ aPB"*+g - f - WIDgJg<* @|́`Jf"*@|@%FHx/ ah L<|N^NuNVN^NuNVH88$n(. BHx>/GN%@O fp`z/B/I$NO JgDBHx>$S l \&R/N%@O fHx>/*a"p`*/B/*N`BB B"*҄%A%DBBLN^NuNV/ $n *gHx>/aP *g Hx>/aȺBB$nN^NuNVH<0 nv:9-8B@(@2A@oFJg^"hB$hJg $  l^B2爔gCG!K Rf!h *S zfB B gB@F`a" L 9-8B@*@2A@oFJoPJoL * "*$Aǘb$*l$///NO ؂ *Ђ%@f%j`JfB B gB@F`al LN^NuNVH?8&n*. B>9-8B@,@2A@oF"S gJf +(+ Jn(+`$k(J kgNSJozB0Rfn(kBEB"l^4 fLRgD So> Rf4` So,B0Rf $+BERg So  Rg gB@F`a` LN^NuNVH<"n$. :9-8B@(@2A@oF&f@B`DJo< ) i"b")l"" Ё#@f#i&JnJfB B gB@F`aLHzal(HxHx/ aOJg gB@F`a"p` *%@ %@ j $*  jJg,g"l^ 爔`"l^ 爔R * *R%E Rf%j gB@F`aBL n$. &.|f l^"牔F0`f l^* ("҃ l^$ &fpSF0(`(r S0XD0( Ro ABRnL|N^Nub_to_q: required clalloc NVH> &. $n(.JnB`<9-8B@*@2A@oF gJfJf"HzajPHxHx/ aOJf *%@ %@`n,lj"* $* *Aǘd$l$///NO *g/,* //axO ؂Ւ * Ђ%@ f%j Jn gB@F`a L|N^NuNVH80"n n &nf#h 9hgJg(S#hxfB`>Rf iB&$iJg"$ l^B2爔gC& L N^NuNVH00$n&n #hfB`8 jB&"jJg"$ l^B1爔gC& *L N^NuNVH< nv:9-8B@(@2A@oFJgZ ( f *(S!E `S!@ S"h B$hJg $  l^B2爔gCJfB B gB@F`a: L `:"h"(c.E0Rfgxff JRfJf E4C4bLN^NuNVH 0$n&n tpdh "*JfB`Z y \JgNg& hJf`@/./././.HkHjN`&"h (c0if i0JfC4bp*L N^NuNVH00&.$. &y \Jg4$k +c jJgB//NO +E4b&kJfL N^NuNV/ / R,&y \Jg*$k +c j(JgN +E4b&kJf 9jR/BHzag|$n&nN^NuNVH 0R6p&y \Jg*$k +c j$JgN +E4b&kJf 9$L<,fffgЀ/BHzagL N^NumbplmclplWARNING: mclpool limit reached; increase NMBCLUSTERSNV/ BBBBHzBBBHxHy&E*NO$BHy4Hy4vBHzBBBHxHy|PNO$.8&n(. &.:9SxB@$@2A@oFJW|̀/Hy&aIZ$@P ffaJgd:9SxB@$@2A@oF0kC#PRq f ar5kBBI%LBj` B@F`B@F`8k/ /a$@PJf / a>B`L+g**+,+%E%F<+Fw5FI%Lk$zce pd|Ѫ%D L|N^Num_copymNVH?<&n(.,.&. BJmJl HzaT(Jf +gzJ oJf HzaT + n&SJnI-LBJoJf ;gHzxaS>9SxB@$@2A@oFJW~΀/Hy&aG$@P ffaJgd>9SxB@$@2A@oF0kC#PRq f a5kBBI%LBj` B@F`B@F`:k/ /a$@P(n(g$Jg<(k*k%L%M>+Gw5GI%L ;f .. `%DB + d %@ +g֫%C%k%k %k$$%k((%k,,%k00%k44>9SxB@$@2A@oF0+@ j%k00%K4'J0 j0!J4 fa`B@F`/֫//*a O ;g B&S-JJn .fR{ `/.abR{ BL<&n&. :9SxB@$@2A@oFJW|̀/Hy&(<"DN*@P ffaJgd:9SxB@$@2A@oF0kC#PRq f a;kBBC+IBm` B@F`B@F`2k/ /a*@P(MJgF*+,+)E)F<+Fw9FA)H)k +g)k )k )k$$)k(()k,,)k00)k44:9SxB@$@2A@oF0+@ l)k00)K4'L0 l0!L4 ghB@F`/, /+/`l<9SxB@$@2A@oFJWzʀ/Hy&"DN$@P ffa^Jgd:9SxB@$@2A@oF0kC#PRq f a 5kBBC%IBj` B@F`B@F`2k/ /a<$@PJg**J%k +g%k%k%k %k$$%k((%k,,%k00%k44:9SxB@$@2A@oF0+@ j%k00%K4'J0 j0!J4 faN`B@F`/* /+/*a nO &SJf `/ a,R{ BL<|N^Num_copydataNVH80$n". &.(.JmJl$HzaN\Jf HzaNN * n$RJnJo>GǘJf HzaN& * $d$/Ҫ//NO ؂B$RJnL N^NuNVH 0$n&n `$@ fJgP*f"j k " ҈ b$`(//+/ a TO $+ ժ / a8&@XJfL N^NuNV/"n$. " IJgJm8Jo" ( m B P` !@ ըBJf I(gv`nD"( Jg PҨ Jf ( n!@ )gD`>!A `&jB I(g!A` ( oܒ PJf PJg B  @Jf$N^NuNVH><&n(. +f."+҄ c g n `$K&@ `zde<9SxB@$@2A@oFBHy&a@J$@P ffaJgd:9SxB@$@2A@oF0kC#PRq f ab5kBBK%MBj`"B@F`B@F`:k/ Hxa|$@PJgB +g**+,+%E%F<+Fw5FK%Mk *Ъ zЅ& Iǘ`Jg` 9C"j jc "d"$+ d$//+HqNO ժ + '@ Jgի` / a&@XJnJn$ `/ aX/ afR BL<|N^NuNVH?<(n,. (.&&LJg6 + d&SJfJg *+ ,g>9SxB@$@2A@oFJW~΀/Hy&a>d$@P fha޺Jgf>9SxB@$@2A@oF0lC#PRq f"a|5lBBK%M5|` B@F`B@F`:l/ /ar$@PJgJ%l.,%G$,)F+f&~dd(ߪ/// a$O f/ a()BB`pd`Jf$S`>9SxB@$@2A@oFJW~΀/Hy&a=@$@P ffaݖJgd>9SxB@$@2A@oF0kC#PRq f aX5kBBK%MBj` B@F`B@F`:k/ /at$@PJf`&B@F`pl~Ѫ+g%k%k %k$$%k((%k,,%k00%k44>9SxB@$@2A@oF0+@ j%k00%K4'J0 j0!J4 fna|*k%M`/.+ރ//*a ~%E 'C $B L9SxB@$@2A@oFBHy&GN$@P f`aJg^>9SxB@$@2A@oFRy#R f"aۜ5|BBA%H5|` B@F`B@F`HxHxa$@PJfB`/ a/.aXB`%n%F~d%G JoJg>9SxB@$@2A@oFBHy&N$@P f^aJg\>9SxB@$@2A@oFRy#R f aڴ5|BBA%HBj` B@F`B@F`HxHxa$@PJg&~l%G (.d($ c>9SxB@$@2A@oFBHy|PN%@PfHxa,BHy|PN%@O gB@F`a *g"%@j %|(B B$%J4%J0*gp <d $%B `("* oJf&9#( Ѓmת%D `$Jg//*/ nN`///*a {O ڂ((Jf * ` .Lڂ f,2j/ HxaF @PJg Є~ldpl!@ $ $@$* mJohIǘ * "d"$//"j/ NO ܂ԄBڂJg2 f(2j/ Hxa4 @PJg ~ldpl!@ $ $@Jn+g o'ELN^NuunixsockplNVHxBBBHzBBBHxHyOa2N^NuNVH88 .&.(.(yBg///a&@O `//a&@PJgJfp+`޶gp)`B@F!HxHyOa76$@HxB/ a xXO PBC%IB C %I$4%K %|S2%|Z@Jg l P%h/ B/BB/ kN&@OJg*j/ aDX gB@F`a ` gB@F`a n BLN^NuNV// n". 9BB@F!"h /B/BHx/ iN$O gB@F`aֈ $.&.N^NuNVH8 $n$. B@F! j BBBBHx/ hN(Og gB@F`a* `:J fjJlBpFd 5@4 gB@F`aBLN^NuNV/ $nJf<*g4JgB/ anPJgHjda &/ a/ HyOa8$nN^Nusoclose: NOFDREFNVH8 $nB@F!B*g:`B/a/aO $*f`Hx/a/aO $* fJg0*g\f / aj&XfJJ*lD@ @g4*g,0*HL9/HyjHxHj6at&OgJg" j BBBBHx/ hNOJf&0*g Hza@@5@/ aX gB@F`aR LN^NuNV n"h BBBBHx / iNN^Nusoaccept: !NOFDREFNV//"nB@F!0)f Hza?n2A3A f" i BB/. BHx/ hN$O`B gB@F`aӚ $.&.N^NuNVH0 $n&9B*gp-`jB@F!0*@g j ( f / aXJg4|8` j /B/. BHx/ hN$@O gB@F`a L N^NuNV// n . B@F!"h BB/BHx/ iN$O gB@F`aҬ $.&.N^NuNV//"nB@F!0)ft9`(gt%` i BBBBHx/ hN$O gB@F`a< $.&.N^NuNVH?<&n$n-yBB k ( fJgz-EJg "n,)`,*Jlv`rB.g+f( ~ʇDD-E"n iR4Jg"n(i 0+gZJ.m\Hkda"X`NB@F`B@F`B@F`B@F`B@F`B@F`B@F`@7@B@F!2+gv fa`x0+8gB6Bk8 f|a`TfP k ( g& f>JfJf6v9 fNaв`J fv' f:aД`$+h"d +pl-nzˮl -@JgJgedv( fa8` ЌoJgJf..辫tmozJ+lv# fa`\0+2A7AtdԋEmgA7AHka0X/N&X gB@F`aϜJf,` C-IJgB@F`ap*n* `JoJfB.g n`I(<%d`JoJgJf>9SxB@$@2A@oFHxHy&N$@P f`aJg^:9SxB@$@2A@oFRy#R f"aΪ5|BBC%I5|` B@F`B@F`HxBaޢ$@PvdBB`:9SxB@$@2A@oFHxHy&N$@P f^a$Jg\>9SxB@$@2A@oFRy#R f a5|BBC%IBj` B@F`B@F`HxBa $@Pvl c o:9SxB@$@2A@oFHxHy|PN%@PfBarHxHy|PN%@O gB@F`a8 *g"%@j %|(B B$%J4%J0*gBJg$Jf&9_"< d $ת`  c <$`4"d" .貀d $JgJfo pd~Ѫ/.//*"DN&"n,)%B * nըO Jf*JJn(.ghB@F!+gv fa(`JgkJok k /././. /.p Jgp// hN&OJgkJok gB@F`a˲BB*nJf Jf8Jfd0+2A7AgA7AHkaX .g /apXJg /.a^ LPjB()RV/ Hy&NP f>a,$lV`lg(JgHx/* B/ a>*n*O$R`,(* BpЬJ)@J*g()@JJg>*n m"h Jg jxf/ N,X*n*)RVB`B@F`89SxB@$@2A@oF2jA#PSp0*Ggd j0g!j44 j4!j00`@g/*Hy|PN`* j Jg/*$/*(/*NO `/*,/*aPjB()RV/ Hy&NP f>a$lVJg B*n-UJg0 jfJgJgf%n:j-Mxf~BB`$0* @f xf$`~gS@ @c Hz%a0l*n$-" ,>g d$ * ܰl$JfJ .G%dg (.B@F`a/./..ު/N,O B@F!-D` *n+A"* ܰfH*gx&~Ƈg $RB`b-jBpЬJ)@J*g()@JJg(*n*-J$R)JV*nB`(.B@F`89SxB@.@2A@oF-G2jA#PSp0*Ggd j0g!j44 j4!j00`@g/*Hy|PN`* j Jg/*$/*(/*NO `/*,/*aPjB()RV/ Hy&NP .f4az$lVJg@%n`8&~Ƈgծ`*JgB/B/ aڀ*n*Oժ B ,>g"Jf)@>fl@`ծgf$x@Ą`|Jl8f,fHlBa B,XgL0,`2A9A`gA9A`Hl`a$X .g (.B@F`a’B`j$lVJg-jJg"Jf"*nJg l ( fJg`Jg6*nJgJgJg"*n- gxfFHlBaDXf4Jf)nV*n- gJgBB/BHx/ mNO(.*nf^JgZfT,fL0,`2A9A`gA9A`Hl`aX .g..B@F`a|`xJg*n0,`2A9A`gA9A`Hl`aظX .g (.B@F`a& L0&n*. &.B$n g* k Jg hJgHn/// HxN`x*` gjn(|g|m |gt|`| gjm|`|@g^`b n* lv gBn g8`< g,`0 n&`Jg| f j7hJg| d jJgk`0F@k`Jg| d| j ot g@o gF` m/pBЋ fpdЋ/aPJfx7`"+hd '@t`n"+Fd '@R`^Jg| ex`x j$L9("(Ly Ё ox!`N0A g g`7@`7@b`x*Jf& k Jg hJgHn/// HxNOJg/ a L |N^NuNVH08&n . $.(n g$ k Jg hJg/ /// BN`HxBa$@r%A P gnLvgmgm rg`<*n&. *.(."CBJg"E)f HzaB"Eҩ&DJg ҫ g&@`$- - l m0<9SxB@$@2A@oFBHy&a$@P f^aJJg\<9SxB@$@2A@oFRy#V f a5|BBC%IBj`"B@F`B@F`HxHxa0$@PJgz"C lctHx0jI$/4B@aw%@O g8%@0*@@5@"CB%@(B B$0j%t,%J4%J0*f / aƎB`v"CB%@ B///*a TvJg&`($&JJg*,+ ݕ -+@+gЫ(+@&SJf&mJg`&@ +f'J`+JpL<|N^NusbappendcontrolNVH00$n$. &nJf Hza, K"+ Jg PҨ Jf"H BJg Ҩ PJf j * l lB`P" KJg*&( ג *%@(gШ(%@ PJf"jJg`"@ )f#K`%KpL N^Nusemi-panic: sbcompress NVH88(n&n $nBJg+x$+ f Jg SJf JJg8+hgJg0*f8+jff"j j ЈЂ" d00*HFx fV0fP"j j ЈЂ"*e4/+ /+Hpa R`O (+ ٪ (+ ٔ/ a>&@X`*Jg$`)K(+ ٔ ,)@+gЫ()@$Kj&RB`JgJgj` HzaLN^Nusbflushsbflush 2NV/ $n*gHza// a,PJfJfJg Hza$nN^NusbdropNVH><*n(. $mBJg**`Jf"Jf Hza$E**`B@F` * m𘀑pЭ+@I#PG*g(+@<9SxB@&@2A@oF0jSt0*gd j0g!j44 j4!j00`@g/*Hy|PN`* j Jg/*$/*(/*NO `/*,/*aw PjB($/ Hy&NP fa$BJnJg * fI#PG䑕pЭ+@*g(+@<9SxB@&@2A@oF0jSt0*gd j0g!j44 j4!j00`@g/*Hy|PN`* j Jg/*$/*(/*NO `/*,/*av0PjB($/ Hy&NP gB@F`a$BJg& * g Jg+J%E`%@ ٪`+EL<|N^NuNVH8<&n$kJg'jK#PI(* pЫ'@*g('@89SxB@&@2A@oF0jSu0*gd j0g!j44 j4!j00`@g/*Hy|PN`* j Jg/*$/*(/*NO `/*,/*atPjB($/ Hy&NP gB@F`a$BJf"L<N^NuNVH 0$. HxHxab&@PJg.$k//.Hj a Mr ԁ'B $%n%n `BL N^NuNVH 0 n$n &hHnHn/a-$O f^ n1|1| !| /*/*Hn/a $Og . SB /.a.V` n!n n L N^NuNV/ / n$n Hn//(a\$O f$Of-EHx/*/a*$O g Hx/ai L N^NuNVH?8(n*. &n,.BBؕHn//,a(O f-k-k BB-LBBB".B .䰄o&& AX .А-@JmJlp`PRPn , ~f,$.BHxT/ae*$@//./ a BO O -n n h HkJVIrҎ/BHnHn/ hN(Og..g~g ~g~#fBJg2Jf B..О// B//,aElOHxT/ ah*PJfV n..О Jg +-@"o"nJfB` + d-@/./,/+E bN$O fHx/,HnN$O / aT LN^NuNVH80&.(.rf cp`/Ba$@PrldTB0jG$/3/a^$%@O g2%@0*@@5@%C(B B$0j%s,%J4%J0%C //*/. a!$O g / a ` n rf jBL N^NuNV n . d P"p Jfp ` i f n B`p&N^NuNVH00&.$. n"h &Q (Eg$@)3g//.ad$P/// EB/ aOJf/E:nN/Np`0+`@<(n . *n(.$.*.&lB| fp-`"| g|gJg HzZaHza6Jg//a T&Pf0 @gj @fJg0,gv8`/// a&O g/E:nN/ N`,fv9`// // a&OJg/ a`z k Jf Hza$P (0g|̀!F0//a l$PJg$// xB؊/a O Jf/aX`/ xB؊/a\P k *J$p k !jJ$ k *B h k !jB 0*`@$O f<&ndJg` nh-|$H-HLCx-IP 9$ hLHnH p NX .hf/ E6NX`/a\XE6/ Nt0X`tԎ/aQr-A-| m$nh X-|4-J8-M<-@@r-AD 9 jLHn4 p NX nh-|4-H8Cd-I&nd"C'Qp#K#D#L-|4-K8B< 9 kLHn4 p NB`Hx / aW L<N^NuNVH8<&.$n &nBHx "* R/(<"DN$//* B/ ab * "BB1BrD-Ar-AT-I-KHnaCv$@O Jf*nrlg4|&` k -|-Mr-A-@-K 9 mLHn p N$@XJf$mpJg62"CQg4|)`~"C i ( gf*gB/ aӼ(@PJf4|=`P$j&lJg0BHx /*"DN'@/*/*/a /O 'jO 'j00$L/ /a4$@P/ aZ&XHx /aV L<N^Nuunp_connect2NV/ / $n&n "j2Sgp)`J k#H 0 @g @f(#h!I/ aђ`!I / Ej(N/ N` Hza.B$n&nN^Nuunp_disconnectNV/ / n&h JgbB "P0 @gB @fN +f'h`&@Jf Hza +f'hB Ph`/ Ek&NB /N$n&nN^NuNV"n Q Pf i Jg g/a N^NuNV/ / &n$S5n8/ a>XJg.B/ aX +gHx /aTPHx/ aTr$n&nN^Nuunp_externalizeNVH><(yB"n*iz ڍv֕B lJ gHG" |†&ABo6$[ j f&$j rlf/ l/( / a2O JgFRnG, ŕ&FJf// a PJf$Bo$SB/ aXRn fhp(`dx`BoF$[SjStHnB/ a ,O Jg Hza l . P! "EX"Rn r Ё*"n#@ BL<|N^NuNVH?<&n n .((k|f f$k gp`x؊C Bo"*G$- c *G UJ fp `TRn&pЊ$:+g +Ы(" Ҋe`EȀ" dgp`<9SxB@$@2A@oFHxHy|PEN'@PfBanHxHy|PN'@O gB@F`a4 +g"'@k '|(B B$'K4'K0+fp7`f// /+a +.O (k$k ` Ђ('@ C8pЌ|*@E8Bo$ *G U p Y$YRh RhRtRnBLPQBBSdHx&/ aMBL<N^NuNV .gHxHy/aN^NuNVH<8&n(n (.Jgj"KJg\ ifNr dF i f8zf0v֐E" z…$ABo JgB/NXXRn`"QJf&kJfL<(.*.&. $yBJfE΀BB/./. /a(@ ,$OfN ,$)@$|g\f"CRQ)C\-|8-L lP 98 hLHn p NX jR, n$ Bo*n&n//aPJf" $yBJfE΀BB///a @ ($OfV ($!@$rҎ|g\f"CRQ!C\-|8"A#H hP 98 hL/ p NX jR,`/aXXXRnT ,$f/ a d`BL<|N^NuNV/. /.HxHnHn/./. /.a`N^NuNVH< $n"yBJfC΀ *$& C7Ag$ jPJg hHJg(9g / aB`$*$zFą *$%@$:9{0B@(@2A@oFJg/*P/ aHP` iR0 jPRh gB@F`a~ *$%@$-|8-J jP 98 hLHn p NXJfB`/ a *$/ a$ L(<BB"EN$@PJg *$@ %@$ $g y!J(%L"+, *,$d$/ҫ9{0B@$@2A@oF$yRJf gB@F`|aw`t/ a( *$~%@$X K>(<JgB@F`awj"k,/ /*<.+<ރ/N"k,%I,'C,B0 *$@ %@$/ "DN'F0Lf.*jDf$*(If//+Hj)a O Jg$RJfJf RU|`D +f RUt` j JfJ$'@rgRUp jJg(!j j BC(%Q y( P"p`*j$DgRUx`FRUl jJg*!j j BC(%Q y( K" n p` jJg!j `# ( j  RJg!j j B"jJg jJg!I"j"BC$ %@g y$K!M ` K#("%I BL<N^Nucache_revlookup: found entry for .cache_revlookup: found entry for ..NVH8<"n(n *n&.Jg")D  yF$p Jg f$f|&jJgtgp(+Dff( @.f HzHa *(xF ..f HzOaRUJg$*(I$eBp"`*/Hj)/a J*(B`$jJfnRUBpL<N^Nucache_enter: name too longNVH8<&.(n $.r*Bl Hza,Jg"9{\l4HxHya$@HxHB/ a 4O R{\PG(`p$y$Jgd jJg!j G(` G(& j "jJg RJg!I"j"B"jJg jJg!I"j"B%L g%lD$`*B"-%A$%C*C%mD*Bm(x)؊*(I//-/a B%S y( K&*B -*C"-D y-lC $g Q!J"%IBBJgbg^rlfV*( n f*D .g *.*f f4 *.)g, ,D yFC %@g QK!M"%IL<N^NuncacheplNV/ A$B#(Hy BHx/9E'B~HGBB/./ / a`&@ n +$Og0.< ,* RJg* ڀ// aPJVID` +$'@$* B yB hR,JfJg",@ Rgg B)M`X,R-F&.L<-C-D .".&. (.b(Jf"tԎC-I-|-L-EB-B-I 9 lLHn p N-@Xfvg nJgfn ,rc")A `& ,l(@gJg Ѐd `p)@ nఈl-@ @Jg//././.// `f'nH .RL. -@-D .".&. (.b,// aPJf-|-L-FB-B-n 9 lLHn p N-@Xfxg nJgLn ,rc")A `& ,l(@gJg Ѐd `p)@ nఈl-@ @vJg(//./././B/./. / aT$@O$`4BB/./` BB/.// a$@ *$%@$%nHOf`Jg yB hR,Jg@ +$g Hza$-|8-K kP 98 hLHn p N-@XJgTJf *$g *$%@$/ a`$-|8-J jP 98 hLHn p NXJf$KJg *0LnЪDS)@Jf .`/ aLl$/֫JfR%|@L *$|@%@$BHx+ .$ @Hha,(@()DB C)I)j@%L@O "*,/ҪK + k$p //*$lc/aXbHx+/ a,//./+|/-0B/ aO `&$le/aNXdHx+/ a,x`$R,L-l0 . ".g^EH-|-K-DB-JC-I 9 kLHn p NXJf~f/ aB'R'B|'Dx`Z'nf'B|/ ar`:'D|`, +|Јf"/Hh/+|// / aB"DR'I|`/ ap'Dx'mHLKHg0//+H/+DHza /*H/*DHzaHzaˠ//./*9{0B@$@2A@oF-B/*P/ N jPRhP gB@F`a_ l!\ݮRRnJf$'l@ +$t'@$BLHx+/ a(@P/ aXo SR`XL$Ogrg/ a(BB`v$T&*D-|-KB 9 kLHn p N./ a'$PgB`Dg$/ a(XB/</ a$Pfp` / a)PB L< N^Nugetcwd: oops, forgot to null lvpgetcwd: oops, went back too farNVH?<&. (.*...$n jBB|Jf &( f&9t/GbN/.N/</.ILN$Of8Jg*n-U nf> .gj @S-H/`Zt`Tt`N/.a(ZBX`:Jo4rlfgD j -| n-H-F-@-J 9 hLHn p N$Xf| n"H)3gHg iH-h / a&X .gd/N/</.N$O fP"n)3f/HnHnHna$Orf/ /HnHnHna$OJfRJg Hz aJge Hz-a nJgK-M|/-nBS . @fJg*n* .g /a&X .g /a&X/a& LXJg s(/HzaHzaXXJfL N^NuNVH?8(n,.&n0+m @o @g `(*+`(. *..ګهJkJf~g 7|B` +"+ .ftv`$&ցՀBSBHx(Hx0a$@%D%E%B %C%n%L5kBO B A %H$4"~gm~g`.~f(/ a<`0/ a`/ / a$Hx(/ a `Hx(/ apLN^NuNVH?<&n-kv$ kfv(C(<֢`0fHx(/ ap#`>gd,g\B l"hhJgN$<lfB Rl6 i(g* hfHx(/ aNp `"hhJglg  E($<8 f7|/ a7|X'LB'l$, l$ )J$BHy// *BN(@OJg6"kJg RJg!k,,`#k,$ k, (Hx(/ a `@/ *DN(@XJf-n*n(Ut&<HnHnHx/ / *CNOJg$n(jze0; N "\vJg n 'n`(<@$n kf jf / aX$n5kHx(/ *DN` n:+hfHx(/ a`lE ("(,+.+f( n 'n n,+ .+BR݅!F!G` / /a@P/.`(<@$n kfN jfF/ aX`D i(Jg!i,,`%i,$ i, (B(#k$, k$ C('I$ .$@"j JfJg n n'hK-MB` "n n"Hx(/.*DNP`X n'h!K,+.+BS!F !GK-M/aLBX`EJg n 'n n,+ .+BR݅!F!G/NBL<&n(n $,&, +"+f(, *,BRن'D'E)K` + "+(, *,fBS'B 'C)k`pBHx(Hx0a$$@"J K""""""""""""(, *,BRن%D%EB K %M$(,*,BS'D 'E%k)J'LL<|N^NuNV/ / $n"j Jg6G< i(Jg!i,,`%i,$ i, (B/ NX"j Jf$n&nN^Nunamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsNVH><*nE$ m, h+P0J g jJf Hzpapg Hzua *g Hza&h fBHx Hxa%@O |fHmHx/*/a`HmHx/*/a$Of|ftJgHx /*a`B j ( |f/*/(a&P + +@ f+yt j /f$- `Hx /*at`b$+/&<b"CNX*<V`&m kH(6g> * "*-|-K|-F-@-A 9 kLHn p N$XfG|dBHx HxaD(@O `(j-L <'@-K|-FBBB-FB-@ m * -|-HC-I-@ 9 hLHn p N$Xg|d8Hx / a^P`&$<ft`"- Ё ct?`|d*//-Ht(a vPO. /*a %LP` jB0(խ/-"DN$- jX /f/a$- /"CNP%j+B/ "EN$Xf4"*f& fHx /*a`A%AB`v(<N f* m-|-HB 9 hLHn p NX - R |dt>Hx /*a&/-a/-"DNB L<|N^Nuleaf should be emptyNVH?<*nG$ +*~ʇ(~ ȇ D "~g Jg~gB-@B(mB/</ ,<L"FN k"P /fDR /g 'H~lgt`JfJf Jgt`+Lk`B B kgB /g ӫRf '@ ot?`j+H /fR /g&+H`BJfJgk@`kk` +@@@'@~f k (.f .fk `k+gd`.-L lH(h /.a^/ aj/</ "FNO gtf+L+L/ aXJf /-aX+f-|-LB 9 lLHn p N`\ + f* m-|-HB 9 hLHn p NX/-aX/ aB LBLN^Nuvflushbuf: not dirtyvflushbufvflushbuf: dirtyNVH80&n&. 89{0B@$@2A@oF +d$@Jgr"* *$f^ *$Jm Hza *$%@$ gB@F`a7PgJf/ aZX`~/ a^X`p$AJfJf gB@F``a7`XJhg$Ehk2BHz Hx/ aJHOJf gB@F`a7r +dg/ Hza P`L N^Nubgetvp: not freeNV/ / $n&n JPg Hza/ a'JP *lWre jp'h 8`r'A8 *`'@g j`C!I %K`E`'J $n&nN^Nubrelvp: NULLNV"n )Pf Hza, ieC!gJg!i i #|eC! )PBP/aN^Nureassignbuf: NULLNV/ / $n". f Hza`P jeC!gJg!j j %|eC! *$&AC`JlCd %@g QG!K "%I $n&nN^NuNVHx/. /.aN^NuNVHx/. /.aN^NuNVH 0$.&n rfB`FHn/9RBBaOJgB`*$n%nlB// a"-@O g / aJ$n&BL N^NuNVH08(n$. &9B ,lWrdB`// aP` Ђr?AaG $SJgH jp f$",llfJ4g/</ aPJf`$hJfJgJfrlgJBHxHxa @)Hp!B !SBB&O JgZl2j2/ a\`D-|-JB 9 jLHn p N.B/ a%lLL%lBl/./ a L N^Nuvgetvget: usecount overflowNVH0 $n". *0g@%@0BHzHx/ aFxp`r *4f$ jPJg!jTT`#T$ jT P *4&R%C4vf/ Hzna Hzkag// aZ$Pg/ a* `BL N^Nuvput: null vpvput: bad ref countvput: ref cntNV/ / $n"9BJf Hzaz *4&@S%K4SJo-|-JB 9`PJmJ8g/ Hza 0Hza2BPC$%QT y$ GP"-|P-J-A 9P jLHn p N$n&nN^Nuvrele: null vpvrele: bad ref countvrele: ref cntNVH 0$n$9BJf Hza *4&@S%K4SJnpmJ8g/ HzabHzadBPC$%QT y$ GP"/</ aXPJf$-|P-J-B 9P jLHn p NL N^NuNV nR0&n,. *.$9BB$kJg|Hf(*Xghg*3fZgJ8gNrlfFJ4gg8 *lWrd // a0P`"/B/ a%yRLB/ aO`R$DJfJVrL |N^Nuvcleanvclean: usecount overflowvclean: deadlockvclean: cannot reclaimvclean: bad ref countvclean: ref cntvclean: lock not drainedNVH80$n(.&*4g""R%A4rf/ HzPaHzOa *0g HzUa@%@0-|-J-| 9 jLHn p N.a2tĮ XgBB/HxHx/ adOJgNJg2-|-Jr-Ar-AB 9 jLHn p NX-|P-J-D 9P`-|-JB 9 jLHn p NX-||-J-D 9| jLHn p NXJg Hz`aJgJ *4&@S%K4SJn8mJ8g/ HzMaHz[aBPC$%QT y$ GP"/ aX jJg&Jhm / Hz+a@PHx/*aBP%yRdLB *0"A%A0 g@%@0/ aDL N^NuNV nJ4gB` /./a*@/B/ a źG/,X/ /,TE N$O$f*BXo[ ,`g*( جX///,\N$O f"DB`ocB+&*"E$q8Jf0 y \Jgf $h Jf2 hJf"E$q8Jft7`/ / // j NOJggd`/ // j N @O Jft`h @.(0f"h6 f.(:f>,h>f2h>/ HlHh@a O JfB` +T0E4HxLHl/ a 4B`Hx1/ a L<&.*n BBh|@-FlBH-mD-Cp*D/a&@XJf(nT/</ aA"-Pg,3f/ aVp`T$lH(*6$*gf/ a0p-`.|l  f: %A6"C&i S,*fgHi0/a&@PJf"C i PJg" -f|+Fg|+FBHx/ axO Jf-|8-L/ hN j/B/ hN&@OJg0/ a`&Bp"BS@/ aZHx/ a/ a L<|N^Numount: lost mountNVH8(nr4g lp"hHn/ iNPJg Hza>&y-0JgL$kf/ at/.a%nP f/ aT/.av%n P&kJf 9tf/a(/.aJ#tP/.a"LN^NuNVH <(n*n BrD-AB-U-LHna>$Xf|$n&jH"l Q"+fgHl0/a$Pg / a `F+8f*3f / ap`*/ aBB/ aTOJf / /-/ a&`pL<N^Nuunmount: dangling vnodeNVH88$n(. &n6/ ahHy'/<v֊/I.N *6OgBBBavO *6r€%A6/ aX*9f& j/ "k/Hx/ hN$Ogg j/ // h N$O Jg06Hy'/</NO *7g/ a* ` R <(f #,`!j j j JgBp/aX jS@Jg Hza~Hy'/</NO *7g / a*hXHx/ aBLN^NuNVH08(nA,$P Yg~&Hy'Hx/ avO Jg$*`V *6Gf<$r@ār€%A6/ a "j/ l/Hx/ iNOJgr@6$*/ NX$BfBL N^NuNVH 0$.&n Br@-AB-S-BHnaNXJf* n$hH/a j//+ /+/+/ hNL N^NuNVH 8$.(n Br@-AB-T-BHnaXJfB n$hHG>/a\ j// / hNOJf7j8Hx/,/ aZLN^NuNVH<*n(n Hn//-a,O Jf> n h $hHG> j/ / / hNO Jf7j8Hx/,/ aL<N^NuNVH?<..,. "F*)&B$y((gHy'Hx/ ahO Jg$`fIJgRoNG>*FK rg j// / hNO Jf$7j8Hx// aJ$O f,R$/ NX$B(frJgl"n"`/ N `*n*BL8(n&n l*d P$p\Jg* fp ` j j f|lfp`t$+&+-B-C *"*(*-|-H-@-A-B-C-D 9 hLHn p NXJf/.BHn/+/+/ // aL|N^NuNVH>8(n&n l*d P$p\Jg* fp ` j j f|lfp`t$+&+-B-C *"*(*-|-H-@-A-B-C-D 9 hLHn p NXJf/.BHn/+/+/ // adL|N^NuNVH>8(n&n l*d P$p\Jg* fp ` j j f|lfp`t$+&+-B-C *"*(*-|-H-@-A-B-C-D 9 hLHn p NXJf/.BHn/+/+/ // anL|N^NuNVH>8(n&n l*d P$p\Jg* fp ` j j f|lfp`t$+&+-B-C *"*(*-|-H-@-A-B-C-D 9 hLHn p NXJf/.BHn/+/+/ // aL|N^NuNVH<<*n(n m$P**(*%h m%h BrD-AB-T-MHna<&Xfp&n ,g^$rāgrgrg/ a&Xf0-|-K-B-J-M 9 kLHn p N&X/ ap%E%D L< n *-|-H-@-n 9 hLHn p N$.a $.$nN^NuNV|H 8&n(n Br-AB-T-KHna$Xf$nrlgt` jH(6g: k -|-Jr-A-@-K 9 jLHn p N$Xfj-l| ,-@C|-Ir-ABBBB-K-@ k -|-JC-I-@ 9 jLHn p N$X/ a n(l LlN^NuNV@H 8&n(n Bxr@-A|BX-TT-KHnTa$Xf$nd k -|@-JD-KH-@Lr-AP 9 jLHn@ p N./ atԎ/a-l k O -| @-JD-BH-@L-KP 9 jLHn@ p N$.a L0N^NuNVH 8&n(n Hn//+a$O f n$h k -|-J-K-@r-A 9 jLHn p N./ atԎ/a-l k O -| -J-B-@-K 9 jLHn p N$X-|-JB 9 jLHn p N LtN^NuNVH0 &.$n Br@-AB-R-CHna($Xf//*/.a$/.aĚ L N^NuNV/ / $n&n Hn//*a $.$nN^NuNVH>0*.$n (.$.$,.(&n,&rƁf/</ a8"n(n &n(.$i tlf ) gt) gzJ) m jHJg(9g|$` J)lz +-|-J-@-D|-F 9 jLHn p N./ ab*,,'E'F &+P-|x-J-K-B-D 9x jLHn p N(X .g(g*+,+ ()F`"BӬ,݀(-|-JB 9 jLHn p N L|N^NuNVH<8&n$n "n i -|-KI-L-@-I 9 kLHn p NJf$%n". +lSxe@0; N &,2A`*A@`$A``A `A`A` A`p `%A%n %n%n%n(.*.%D4%E8(.*.%D%E (.*.%D$%E((.*.%D,%E0%nD%nHBL .".&z$x "%@<%A@BLHz/ aHnHxYHj/. a^ .O$rZ/BHr a sEHxZB/ a sFC@=:7B$nN^NuNVBN^NuNV/ / &n k>$P Ѐr4lp`8// / aO Jf$/ ad/ a2Hx/+>aXB>B$n&nN^NuNV/ / n$n h>$/aJ/</aj$B$.$nN^NuNVp-N^NuNVH<8(n&n "n i&("i$)($Cd$B")o Б"@JfRRno '|'|z'E BBR'C'H6p>Ќg6'l^ 'lb$HxZHlHkLEǘNPO.ZHlHkNO Hx l/Hk h )") -| -H-@-A-K 9 hLHn p N`B` HzVa3L N^Nu%dNVH?<-n"n(iBB*i m ( xg zf B`2p`, l-hxd $l&l Jjp`B, . C-I IBBBBBBBB=| "n$)g&, mJ fL"9[Io|Jg8 9d &BHxT/a-@"n i i O E APE xd KGB"9[Io"zb@xd$zf4 l(+g h h Jf`t Y"ndf QJg^-RS"BHi/*Hna i O U/ Hx /.a-@O fzJgBzڇن"nP"#EK G E BR݄zdB`*Jg:"n )Td &BHxT/a-@"n i i O "BU"n&)[I’lGxdBrm6Jk2z-ER@( $D/ Hz/ a hO B3x|`4"n QJ|g`(T-D"GHiHzBHna6R@B.O A%d/ Hx /.N-@O f@JgBzڇن"nP"#EBR݄ "BU"n&)[I’m("nJg&Jg HxT i/a"n iB iB)F)G .LJ0> h B`* h B` h B` h r B`pN^Nutag VT_NON, fdesc vnode NVHza2BN^NuNV/ $n j * -|$-H-@ 9$ hLHn p N.abp$nN^NuNV/ $n j * -|$-H-@ 9$ hLHn p N.ap$nN^NuNV n hBpN^NufifoNVH0<$n(j&*&lpJfBHxHxa&@)KpBHxHnHxKMPN$OgHx/ aBp`&BHxHnHxN$Og/.aHx/ aNBp`'n/./.a4F$Pg&/.EON/.NHx/ aBp`B B nh  nh* g, +"@R'IJf khJ o Hk aFX* g* + "@R'I Jf ShJo HkaX *gdf^J fX-|-LB 9 lLHn p NBHzZHxHka$/</ avOJfJ g *gl"+gJf^t`^JfV-|-LB 9 lLHn p NBHzHxHk aҐ$/</ aOJf JgB`6 *"* -|-L-@-A-C 9 lLHn p N L< N^Nufifo_read modeNVH08&n(k"k ip$PJg Hza*&,fB`+gj"k&,-|-IB 9 iLHn p NBBB/ B/ jN$/</+afj+gjr#f k hpJ fB L N^Nufifo_write modeNVH 0$n"j ip&h jrg Hza)*g k"j-|-IB 9 iLHn p NBBB/*B/ kN$/</*a2*gk L N^NuNV/ $n * f~g`*g( j hp-P/*/* /HnaWvOJf2*g( j hp-h/*/* /*HnaWBJfB$nN^NuNV/ /$nB* g& j hp-Pg/* /*HnaX$O "* g" j hp-hg/* /HnaW΄ $.$nN^NuNV n h-|-HB 9 hLHn p NBN^NuNV n"h Jg""hJg" hJgBBN^NuNVH 8$n(j&lp* g +"S'Arf /+abX* g + "S'A rf /adXr4m,/EON$/+N$@Hx/ aBp f `BLN^Nutag VT_NON NV/ / &nHzE4N/+aHz/ axHnHxYHj/. aA .O$rZ/BHr a WEHxZB/ a WO <9630-*aB$nN^NuNVBN^NuNV/ / &n k>$P Ѐr4lp`8// / aO Jf$/ a>/ a Hx@/+>a2B>B$n&nN^NuNV/ / n$n h>$/a$/</aD$B$.$nN^NuNVp-N^NuNVH8(n&n '|'|r'A BBBB6p>Ќg6'l^ 'lb$HxZHlHkLEǘNPO.ZHlHkNO Hx l/HkBHxTHxav$@ n!J$B+ !@l/</av"E"B`/</ a^ L<`؀-CHxHn// NOJf$[I%A%B BLN^NuNVBN^NuNVH 0 n"h$htlfp-`> i" * G-KHxHn//aOJg/ //.aLJfBL N^NuNVH00 n"h&hrlfp-`Z i&"+ gp`F +tFd$/ /E/ aO Jf JfB2(/ a O// /a`pL N^NuNVH?<-n"n-iBB i|lgp`~"nྩd"n()*) Jjp`B$&"9",[InB`C-I IBBBBBBBB=| "nJg:"n") 9",d BHxT/as*-@"n i O $@!L|"n༩dBGK I B"9",[IoI Gf" j|g~Hn//aO Jgf.V-GS"DHi/*Hna OO R/.Hx /.a<-@O f@JgB~ރ݂"nP"#GRGKEBRՆ~"nྩe<"n iJg,Jg"HxT i/au"n iB iB` "n#B#C .LJ0> h B`* h B` h B` h r B`pN^Nutag VT_KERNFS, kernfs vnode NVHzahBN^NuNV/ $n j * -|$-H-@ 9$ hLHn p N.axrg`rg`( jD%h0Tg / / aEPv` *"R%AJf*+f / axpXrWID// aNSPJfrf: jD *T0g /a{XJf 9a// aDPBT( *-f5C./ a`6Jg2// a`&BHz(Hx / aOJf*-Y bB` HzaL N^NuNVH80(.&n nrgp-`r-AHnv֎//a R$O frt-/./Hy#E2N @O JgB/(`././Hy#N @O Jg0+*gDf/(Hx/ /ah$`/(/ aB L N^NuNVH80$n &n/ /.atPJfv֎ + (؀tl +d$ *"R%AJf*+f / avXJlp`B// aPJf2/ //aO Jfrf *-gp` // aSBB L N^NuNV n (( @N^Nuvm_map_lock: failed to get lockNCNNCCOWNCOW0x%lx 0x%lx %c%c%c %c%c%c %s %s %d %d %d NVH0< n (n&h Jgp-`X&, g B`Ht`$B yB gBHxHka`O $k*Jgp&Ћg"*f/*4/*(/*$ <~AC$CfKŘg <~/ g <~/"* p-gpx/p-gpw/p-gpr/"*p-gpx/p-gpw/p-gpr//* /*HzHx/NO<.NXb/ //a$O f $jJf yB gBHxHka_ L< N^NuNV n (( @N^NuNVH<0$n &n&+fB`(+ / /.a$Pfv"*( f j Jnp`^ **R%EJff / asX j R/ /* aw $S/* aO zf /// a E L Hz/ aY^HnHxZHl/. a" .O$rZ/BHt a 8xEHxZB/ a 8fO mjgda^[/ Hya&'LB`p-LN^NuNV/ $n. r€/B/ af~O Jf j>/a.Hx/*>a_B>B$nN^NuNVBB/. /.aN^NuNVBN^NuNVH8(n&n AP'P'Pr'A BB'y"9ܒ 'A6 p>Ќg6'l^ 'lb$HxZHlHkLEǘNPO.ZHlHkNO Hx l/HkJ0> h B`* h B` h B` h r B`pN^Nutag VT_PROCFS, type %d, pid %d, mode %x, flags %lx NV n h h/(/(/(/( Hza:BN^NuNV/ $n j * -|$-H-@ 9$ hLHn p N.a`p$nN^NuNV/ $n j * -|$-H-@ 9$ hLHn p N.a_p$nN^Nu%ldprocfs_getattrNVH0<(n l*h$lv e`$ -g/aeX&@`G΀Jfp`B/ aT l$l%m%mBD%yP$Hna %n8 n 눐A %@< *8"*<%@0%A4%@(%A,P - vb>vdv e2`+*gjv%C k P%h k P%h - v e 0; N*Rv%CB B`Fv%CB B yB/(0HzHna`Rv%C k P%h k P%hB%| BL%|P`t-`| k (ШШv "[I%@%A %@L%AP`PB%|H BL%|HP`6B%|l BL%|lP`BB BLBP` Hza& L< N^NuNVBN^NuNV/ $n j * "*-|-HC-I-@-A 9 hLHn p NXJf/* /*/./././.aoT$nN^NucurprocNVH?< n(h *(*h.,"EB Urep`$,rf"G .f"E"/ a^B`~,-"F ) g rg|`\,gp`Zrf$Hx/,Hzpa 2O Jf HxB`/,/ab$P u1gJg/abX&`&<΀JgHx/`,g//-Ha`"F )g/abHX&`&<΀JgE%B%lBG%G ,f(///*a 1O Jf j Jg/NXJfER%m`L *rf(/a$/a]|/</a"E"B`"/"F/)//-Ha` p`pJfpLJ0> h B`* h B` h B` h r B`pN^NuNV n"h/(/(/( /(BBrҩp/a(N^NuNVH?<*n . (n~ en0; N:fffff(:2|` B,xv`B,xv`B,x`B,BB*-n ,op(` <dp`>9SxB@$@2A@oFHxHy&GN$@P f`a|Jg^>9SxB@$@2A@oFRy#R f"a|5|BBC%I5|` B@F`B@F`HxBa$@PJfp7`B%Fpdd>9SxB@$@2A@oFHxHy|PN%@PfBa HxHy|PN%@O gB@F`a{ *g"%@j %|(B B$%J4%J0*ft7`JJoת / //*a{$O f(Jg//*Hla ٪*%E n B` / ar L0 .&n "| 쩂"AC" AE,+gp`Z<9SxB@(@2A@oF*Jf&J*2g *fJgB@F`axp#` * |g/HzZHx/ a$O`t#|g|fJgB@F`|#f>JfD *fJgB@F`axB`%j%@%j BB ` Jf`JgJ gB@F`ax0&n$n *+$JfDJf<9SxB@$@2A@oFB$/ aTX gB@F`( b$BHx/a8`&O fp `///*anO Jfd//a PJgT<9SxB@$@2A@oF'C$/ aX gB@F`arJg Hx/a;B`Hx/a;rpL |N^NuNVH0<(n*n BB- MJg btRJfJf( Mtԍ c c0Rl&y|Jg$kJg/ Hja ^PJf|*1fp2`zJf / aXJfh69SxB@$@2A@oF ,gJg/ aX/ / aTP/ aX gB@F`aqB` &SJfbpL< N^NuNV"n n    N^NuNVH< .$. "z ꩂ"AC" AAB:9SxB@&@2A@oFzAąg&Jf J(2g Jg(`HhB/.anP gB@F`ap L"Bb0Jf K + n PJg ( o hB1`B1`"jb,Jf K + n PJg ( o h1`1zą`"*`$*` *A"0 ` *A$0 ` *A! `x *A! `h *E`\c4B*`2e&B*`$fB*` gB*`B*E $@`e` c`g` gB*E`B*E`҂`֒`L`JgzLB`‚````Ҫ``L*`Lj`ª`x`p**`f**`\D`V$`P"`JBL  Ѕo4 Ѓo*0@ @g@ @`f~e B4fJfB`(PPPPPRn~&F03N@ @WIDL/// IȀNO Jg"+1g jJg// /NO Jf `$jJf&kJfBL< N^NuNVH 8(n&y4JgP+1g@$k Jg8B R(,f"Jg//*/ a O Jf `$jJf&kJfBLN^NuNVH?< nBB(*T~f"&E0g(n y $ 0 `*y4JgvB$m JgdB"R)fP jJgH(ET-IC"҃c&nRf bJg&D/+/*a`PJg( $jJf*mJf L k@0(.n /avX`S@1@.'J@Rj. j(Jg,g /./ /NL N^NuNV/ / &nk0$k Jg/BalP$jJfHka./ a$n&nN^NuNV nh0/aN^NuNV/ / &n$S`$j/atFX fBBB$n&nN^NuNVH0 69SxB@$@2A@oF$y4Jg*0*.g6SC5C. @f jJg/ NX$jJf gB@F`a^/9BHzaL N^NuNV/ /$.$y4Jg/Hja PJf ` $jJfB$.$nN^NuNVH8<*n&. &n(n ig i$f / /a`/ a$@XJfp` igb: igjb i{g igp` i2b i1e`Z i5gPb ig" ig$`~ i~g" (i6g@`h7j0`4'j<`*'j8` Hl0 l/a;&"Pf 2*0gJ0+fJ89SxB@$@2A@oF/ alX gB@F`a]2*00+gJfD89SxB@$@2A@oF/ adX gB@F`a\2*00+AR@q@5A0 jJgH/ // N`"C&)~e"nܕ Ln g `T 5gB`J/ afXJfx%P9 A`,%Q9 A+`/ a.`t/ ai8`j69SxB@$@2A@oF(( mR/ aiX`B"hJf `#J!JR gB@F`aSLN^NuNVH00$nABG(B(:RvlB( <L N^NuNV/ $n|4|5|6%|8%|˰x jJg0 (f(|j5B(B*5//. Hpa 6B%|($nN^NuNVH08 n(n 69SxB@$@2A@oFB(g vg`-h=h`AJfby(y(y(y(y(y(y(y(y(y(y(y(`T|B.|^(Chh-n=n` gB@F`aQp/`..g.f gB@F`aQp`$lJg^GȀHxHn/ NO JfHxHnHjNO Jg$jJfJg"R gB@F`aQJB`HxHx7Hxap$@O Jf gB@F`aQp7``$5n%n5n %L v%C ,%@g lC!I)JC%IR gB@F`aPp4L N^NuNVH08 n(n 69SxB@$@2A@oFB(g vg`-h=h`AJfby(y(y(y(y(y(y(y(y(y(y(y(`T|B.|^(Chh-n=n` gB@F`aOp/`$lJg Q (f4#|V(`* i e i2b i1eJg )gp/`pN^NuNV nB BB !n!nN^Nuifmedia_add: can't malloc entryNV/ $nHxHx Hxaf"@O Jf Hza#n #n #n j "g!I%I E #J$nN^NuNVH88(. . &.Bo0(@P @G E/E/G/I/a`ORnLN^Nuifmedia_set: no match for 0x%x/0x%x ifmedia_setNV/ /$n$. /// aO Jf"F//HzaHza%@$.$nN^NuNVH<0*.&n $n .BJg@Jg:Jg4 i5g (i6gb` $+/// aPO Jfp` gf fB`&j(*%@%B/ jN&g%K%D`B jpJg ('@'@'RB/ / jNB$j P + g:BHxT/af(O Jg$ D l $RRJfJg v`R$RJf$C + JgrfJg//+$/a&O + Jf& Jg HxT/a'B `p` L <(n yBHh0 h/a$$PfP ,hf B`Bp7`X` T\bz<9SxB@&@2A@oF0kC#PSq0+gh k0g!k44 k4!k00`Dg/+Hy|Pa*`* k Jg/+$/+(/+NO `/+,/+aZPkB($/ Hy&aP gB@F`a?@&BJf/Hx"ENPJg/aFJ/Hx"ENRT`R\RL`LJg^89SxB@$@2A@oFRy#R f"a>t5|BBA%H5|`"B@F`B@F`HxHxaNj$@PJfB`xcdt$+HxHxHxaN'@O f / aR2B`f'@%B%B0*@@5@%|(B B$x%D,%J4%J0%k`//+/*a %C %C%K L N^NuNVH88$."n R`&iJg f)qfJim v`xFĄRX+1ghvfTJgA-d"+P nBA-d"+R n0 +(R'DJf'Pvl/ az`\BA-d'P g@n g@` g fJgt$F`Jgt?F`x'D` +g vƀ'C` k(kșxlJgHx/Hna zO ktFĀv@g~JltF` xpfO0+0 g Hk// Hkau(@OJoP`>gFvpf>x'l6HkHxp/ Hkau~(@OJok0Jg4 kEBHxHnHha O Hl/ /+aO / / ar"@PJgRD&9-d(9-h'Cp'Dt89SxB@$@2A@oFE&mRRHRh/ aPX`2BIJf%I` y!I(Rx%P9  gB@F`$a:` kȱdR`vRH +'@'@BLN^NuNVH80&n"n n89SxB@&@2A@oFB$S i2b i1db i g ig&`^ ig* i~g8`L P (fk0`< P (g2t/`."( W ib%A8`!j8`Jg (g`t gB@F`a9 L N^Nuppp%dNVH8BA.t YQB@SdB C %IA-d %@F%@B $.$nN^NuNV/ $n/ aJj0BB`/NX jJg$ (%@C:nfBBS`/NX jJg$ (%@C:nfBBS`/NX jJg. (%@C:nfBBS`%h /aLhX j Jf *g/aLPBX/ aB6B>X *JgHx/aBJ$nN^Nu%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x NVH>8&n . (n$n @tJgb6 @tSgFb tNg @fgb`& @tVg^ @tZg^` tYgZb tQg tRg` tMgdb tKg` tLg`(`(`(`Hj0 j/a&Pf *B@F!&+gf / aX&+<9SxB@$@2A@oF'C g.B@F`0Hj0 j/a0&f" $ b7A`B0+(`Hj0 j/a&Pf +JgB@F!//ajTP gB@F`Hj0 j/a&f'j0`Hj0 j/a&Pfr$,| dt /zڎ//a&O fL .c~E( RJg8B.ఐf BJgB@F! +6g k2/ hNX'R2 R// hN'@6Pf+gHkHzaPv7<9SxB@$@2A@oFk gB@F`B@F! +>g k:/ h NX'R: R// hN'@>Pf+gHkHzahPv7<9SxB@$@2A@oFk gB@F`a3R ` X  @Jf+g0/B./B./B./HkHz>a`|!gp` tLf )k.`Hj0 j/a&Pf$,.g<9SxB@(@2A@oF'B.|g/ aF/ aP g:B@F`>B@F!A-d ,B(F)@ gB@F` a2L`p`BL|N^NuNVH88(n n $n"yB&T89SxB@&@2A@oFB i2b, i1d ig^b i gT` ig0` i~gpb igD`Hizg Hi{gj`0,0fx@9@0`l R (g`t/`ZHi0 i/a2$PfB'j8`8%k8`.Jg *g `CBBBBB B$B(B,B0B4B8Bg k:/ /+> h4NP`t gB@F`a0 LN^Nu%s: af%d not supported %s output: NVH?<(n$n *n&TJg0,0gfJ-fx2*A5AB-g(|f>zFvt!(+. j(g@A5A`6B-B-B-ኄ-B`/HlHzFat/O `~ft2`|fB`0*f$ jgpЈ~l`2pЈ|m&HxHx/ aD$@O Jft7`\B `Y%H j X B JJg ֨ PJf+gHlHzaX/ aJO jJBm A-d'PBJ*g/ /+*ahP j>9SxB@$@2A@oF|f k BX'J`lA*gA.( m.J-g(R gB@F`a-RPR&t7`\B"hJf `#J!JR/ aX,9-d.9-h)Fp)GtRL׬\ gB@F`a-rB` / aBx L9SxB@$@2A@oF"D" gB@F`a)/ kNX` / / aP>9SxB@$@2A@oF$TJg *(fBBS gB@F`a)(JfRKIG~l( gB@F`a(L %p+%x) NVH>0$n n *.| m"PJgf i ` "H ) @X&) $ԃ(XeBB(ቂ( Ёd"*g$//)//HzXa` BS|e0; N^xJ*l<9SxB@$@2A@oFj gB@F` *|?F|@f|l~B(XnpJfp *6gd j2,*/B/*&AHk// h NOJg4<9SxB@$@2A@oFj gB@F`$*>g j:,*/B0*/B/*&AHk// h$NOJg<9SxB@$@2A@oF *@ @?%@ g~B@F`|J*lvJf *6gl*gd j2/ hN`V *>gP*gH j:/ h(NX<9SxB@$@2A@oFj gB@F`a&(L |N^NuNV/ $n *6g j2/ hNB6X *>g j:/ h NB>$nN^NuNVH8 $n"n $.89SxB@&@2A@oFJgi B jJf%I`!I%IR%P9  gB@F`a%^LN^Nu%s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full NVH?<*n&n BR-g,B$KJg ڪ $RJf/HmHz4aX/ aJO(kTlB,ገ,0+ gB@7@<9SxB@&@2A@oFm gB@F`a$ f"->g - f m:Hn/ / h,N$@O Jf(/ a8X .g~&@(kB,ገ,`$-g/ HmHzRadO $->9SxB@&@2A@oF,F+F~fBH`B+B gB@F`>a#2`6 ->g-g m:/ / h0NP fHx/ / aPO B$K$-Jg ڪ $RJf gX -Jg/BBBa\O$-<9SxB@&@2A@oFB+B gB@F`a"~-f-f& -JgHnHn/Hx"EHi,+ Y/Hla\&On-gHmHz`>9SxB@$@2A@oFBHy&IN$@P f`a!Jg^<9SxB@$@2A@oFRy#R f"a!5|BBC%I5|`"B@F`B@F`HxHxa1$@PJg B B .X|dd>9SxB@$@2A@oFBHy|PN%@PfHxa20BHy|PN%@O gB@F`a *g"%@j %|(B B$%J4%J0$.X*g *Ъ("*Ҫ b`""*Ҫ |҆ c/ a5X`:(jnB,|!x!/./.HlIǘNO ..X%G kA8'H$+ Y'B *g""*Ҫ(-j j .Јl"`-j j "nC" m/+ /+,.HphNO .+ ߪ <9SxB@$@2A@oF8kA#PSp0+gh k0g!k44 k4!k00`Dg/+Hy|Pa`* k Jg/+$/+(/+NO `/+,/+a"PkB($/ Hy&aP fa` B@F`$&J .ڀ`l~/ff-f -JgHnHn/Hxp"EHi,+ Y/HlaYOJl-gZHmHzarP`Fx!|!~de+g<9SxB@$@2A@oFBHy&a}$@P f`a9SxB@$@2A@oFRy#R f"a5|BBC%I5|`"B@F`B@F`HxHxa-$@PJg"/*/B/ a:/ a2&J'E O'E'M kBJDm A-d+PF -*g / /aP k|!fN-1gJ.g / a2`` YXY / a,XJf~%P9 A`A4|<9SxB@$@2A@oF.( m:R gB@F`a-gHmHzaPRh`^B(hJf `)K!KR gB@F`azRDۭX,9-d.9-h+Fp+GtJg/ mN`/ a1ZRHRLB/Hzva|L \N^NuNVATB#XAVB#Vp#N^NuNV//&.$. Jfag rr//HyTaLO grār//HyVa.$.&.N^Nuno memory for packet filter hookNV/ /$n$.  @/Hx Hxa"@O Jf Hza4#n g R"g!I`%I$#J`B#j j %I$.$nN^NuNV//&.$. Jfag /HyTaXPg /HyVaF$.&.N^Nupfil_list_remove: no function on list pfil_list_removeNV/ $n . "RJg4f( QJg!i`%i i Hx / a`"QJfHz|alHza$nN^NuNV .Jgrgrg ` 9T` 9V`BN^NuNVH08(n &yBHk0 k/aPJf69-8B@$@2A@oF ,hf$$lJgf gB@F`/+0a$@XJf gB@F`ap` jJg/ NXBjBvANBBBBBBBBv%CN%|`ZBn%L%|6%|%| Br/ a j@0%l@)JHx/ aO gB@F`aBL N^NuNVH00&n69-8B@$@2A@oFHx/ aB+h$kPJgBηf/ a./ aߦP gB@F`aBL N^NuNVH0 $n69-8B@$@2A@oF *rg/a,bBrX *vg/a,NBvX*g/ HyajP gB@F`aL N^NuNVH>8&n(n *.$kBJfB`T<9-8B@(@2A@oF$` +nf JkmgJgB@F`a`fgJgB@F`abp#`BHyXHxHk/ a&OgJg B@F`a(`f +hgJg B@F`2a`(JgNHk(a*&jXJg +%@fBBS gB@F`a$KJg$Jg/ /* /*a&O f$RJf/ a* L|N^NuNVH<< n*n (((qf JhmB`P (hgp`BJg"Dgp`0"D )8X"-eze&p(`/.a*p7`/.a* `GJgI:9SxB@$@2A@oFHxHy&N$@P f^aJg\:9SxB@$@2A@oFRy#R f ap5|BBC%IBj` B@F`B@F`HxBa#$@P&g B G%d c:9SxB@$@2A@oFBHy|PN%@PfHxa$BHy|PN%@O gB@F`a *g"%@j %|(B B$%J4%J0"-*g$*Ԫ( *Ъ ` *Ъ zЅ$ d$/ //*N&O fH%B &JJfZB. n hXXXP nXY BHn//"D ixNL<8*."n &iJgHf@R`Rg$+g/HkHz`|Fʆ)grB)f> )g6 )n f@#@n k(@I AgB/ pN`B)f )gip iJg/ N`<9-8B@&@2A@oFJl`$A*"|†p,g` gB@F`a+g // a0P|~fB6+BkJo Hx/ a P$+" fJo kgz<9-8B@&@2A@oF"'A f*gB0+/HkHziavO RHR` ?'A gB@F`Z|m`JgNg/HkHz)avlO <9-8B@&@2A@oFRHR g8B@F` kz ( (@S!L |f$kv R +zg$H Rf'Jz kzS $kv kz'PvB,+ // / a$+O g<<9-8B@&@2A@oF'B gB@F`a/ av`D$+ Bg g0`&|m pnf<9-8B@(@2A@oF&Jl'B E `,|}f&'B g B@F`a` gB@F`aJkf"kvJf(/ aX"kvJf$+g"HkHzq`B kv2(g (`pЈgpЈ#@'Iz'i~7| g>$+gg/HkHz$` k~PR~ k~R~TkT 0+2 @f|g$+gx/HkHz`V Af g k~BR~Rk kzR 0+ @f<f6$+g. k~(H(EHtHkHzasO $+`R@7@B2B0+\l$+gHkHz`b$kz*g *Ъ($* "*҂Jo`~$* "*҂|҆ Jnh RJf./ aX RJf $+g|HkHzSarP$+`f$H'JzB 2*g *`pЊgpЊ!@'@~$( R%B k~R~0+A(H20A7A`XfR<9-8B@&@2A@oFRHR'B gB@F`al+g// aBL|N^Nu%s input: NV/ /$n". m * R *teJl JoHjHzaq/*HjaB$.$nN^Nu%s NV|H? $n,| F$. S~g<*WBC+Bb>`$H8 QBBSdB/HzaqTL`N^NuNV"n n Jhm ( ( 1g h` h` N^NuNV/ / &n$n n Jhm""h ( 1g 1g h` h` $_&_N^NuNVH8 $n n BC$ B&RxJo`IIF€f gBbcJgB`JgJl"JócJgp` SDLN^NuNV/ / . $nBJg" R/( Hx/a @O JfB`($( / /.a @JgJgg hJf $.$nN^NuNVH00&n n $.$h "hBBd "Jf "y`B`0Bd "ҋA(cfRRRbpL N^NuNVH><*n n (P* ", BJlm , 5g(l`(l , Jll$lJgBA"@ԍcf RRb, gF ,g@(@`< `Ա2|gSn(CN& F$ Jf.`(, g0lm `// / aO Jf(lJf(B(l&TJgj+g 0SmT +`\ , $Abd$/+/ / N$@O Jg* +g$jJfJg// / aNO Jf8&kJffBL<|N^NuNV//$. "nA1B"vƒpF@ !I!B 3|#n #H| | $&N^NuNVH8<(n n *n&P$+ B/ / aT @C($h ЃPc fbx* `B)*" JgSJf$K&J * 4* g$j`$j0je/.// a @"( + 4+ f'H`'H%H!K ( 4( f!J`!A!J L<N^Nurn_addmask: mask impossibly already in treeNVH?<(n(."DB 9{l$Jf8|l|l"Hl"yR/ ,9R/a O &B"K/ HtH,9܌/*<ǘ"ENO y EdJ*f" SSdS"AJg$ m+.m#+.p,й} `b 9+.o/BHsa O y#+. y} //9aX&@PJg//+ /9a O JgJfJ fHxHx|0ܹ{/a&@& O fB`|0ܹ{/B/ a E0( //9/ "ENPO.Hn/9} / aJ&@OJgHz*HxagHx/a`b. ނz̾c fRbg.IrFJl R fA+$5f SgBK< FF7FJg+ L<,.$n*n&. *BBBDJg*"E/) B/a&@O JfB` 8+4FB&+ / Hn/ /aV(@$LOJg LJgJ ,gJg>Jg0lm4//-HaP nJf/,/aXP nJf L(lJff0 (M)Hh &h)K!Lf'L`'L$M&@`(M)h!L)H lJg!L+F ;|| Jg)C9k+ , jJfn8(FD&hf&hJkl<*HJgPJg&kn JfB/ -Ha$@*P ngK&kJf` g*K$@Ro K$UJf BJgho`R (`8,`g &H kho*K`X0@nNmV*g j$(, gHzHxact`8$*g//aPJf//aPJf K$UJf// a * L<|N^Nurn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us rn_delete: Orphaned Mask%s %p at %p NVH<<*.&. n$P/ /a&(@&j *EB$ ( PJgg/*l / HsXa O JfhJg2/ Hx/a$@O BJg * g(lJg8f ,g"T" g, g fJ oRHzHxaaB`Dg(HzHxaaP` #yє#є`P ) *@S#M Sj^0,HF*B&m0kmH`g$K&k0kl J"PJggA"PJfJfHzJHxaaHP, f`, fV&l*B -gf$@%Kf'J`B'J`< B$HJg& (g @JfJg!l"lJg#H`HzHxa`G+ gE J  $ ( , kf!J`!J j!J j!J`$kf$k kf!J`!J%H gjJjm J`A"PJf `R"@Jg2f&")B ) *@S#M Sj#yє#є"A$jJfJg/ / Hz4HzIHxa_Eg< K  $ ( , k!K k!K jf!K`!K, ,# L<V"JgHi0 i/a˨PJg4| `4// a$@P`"/ aX`/ a3p/ a*P`/ a5X`JgJ g/E:nN/N4|P`Jg>,g4|8`" l / B/BHx/ hN$@OJg/a>X`,f4|9` l / / hN$@PJgf/ aX`ZB`p4|-`P/E:nN/N4|-P`:Jf4|`.// aP`"J f4|9`// aP` HzaX$ gB@F`a LN^NuNV/ / &n$y \Jg j Jg/*$ Hs NP$jJf$n&nN^NurtentplNVHxBBBHzBBBHx|HyCaFO(a HyKHa~N^NuNV/ $n RJgJ8&n*. ,.B(rȁg&+`&rfbJf*Jg$HxBaZ(@$,/+//a0&OB/a$@PJg$Sj6@gJg/ ap3JgpA`Hnk,//+///a$OJg / ajXrf4Jf0$nJg(/ B/ Hxa0*6OnR@5@6/ a~XrfJf$nJgSj6 *@gj// HzaQ j@O "h(JgB/ HxNO j@0(.n /aX`S@1@.%K@%k HhLHj"/*a nSh6!nDO `Hn/*/././.Hxa$Of(nRl6`f&nB+AKH p Jft/`//./ h N(@O Jft`Rl6B*|gm |gB`|gb`-l -l0-l-lDp0 gB&,%llB%lpF%n O`P .g//, / aO JgtE`. .g:/at*@XJg*&- g$ .fJg/Jf ./av*@P`< .g/as*@XJf" .g //, 2l4/ a*@O JgT&- JgL l@gDJg&h(Jg/./ HxNO l@0(.n /aX`S@1@.)M@Rm.)C<,.*n HxHxa$@PJgr nr lrg`v`vR`vJrdd Hza?%C %CB&j/B/ a tBO BI \Jg2p騁CL$g Sr$R`t//// NւORrlf6|F ` / aBL<|N^NuNVH?<*n (.&nB-M"MXBr nr l rg`z`zR`zJ$DJg؅BB(n \Jg4p稁g Sr$R`tJg///a u6O ؂ڂRrlJflJgdJf` + Ѕ'@ nTJgNo2 +gHx/aPHxHx/a'@O g'E +g(~`('Ep7` Jg|n 4Jg"n"BL#jlB#jpF j<3h,BBB#n /./+/ aXRJgB`".ӫL<N^NuNVH<<*.(n v֎ CBBBBBBBBB*y4JgDB ,g 4-,f(&m -SHn/ B/Hx(<Q DNOJf BJg$lJgJ n5m, 0m0%HHxDHm4Hja oO %n/./,/ `|Jg SB(f-S-k-kHn/ B/Hx DNOJfxJgP"lJgHJ nB k 3h, B0+,#@#k0#n/./,/,aVO Jf*".Ӭ&kJffBBB*mJfBL<`NtBEKL ZJg"JgfHnHzZ/ h(N(O fR|l`HnBEa(P g , B@F`a˖|7fJf .f(JgHx/.aR n-HJg .&c"p ` C 刐$L<,fffgЀ& L+Uf>+mfx>+mfl, "E) fT~d "BHiHkHma kO Jf. c&~"@Hi"EHiHla kO Jf, g&B2, S cBAT`x`"E>)lf0,"EiB2g AcBAT`~$,"Eg& b BcBB T`~","Eg& bN AcBA T`~~eh0;JN ```````N``":``"0+ mgg*`괁f"B0+ fx `B0+ fx$nB2-B0+ ~g S cBAT`~ , g~B4,// HkIǘNO " Jg "F)+g"FkYE8@` WE8"n ש //./ N"FR pF`// Hka hk "FkppLԀgJo//r‚/a g8O rā .ր//./a h$ L N^NuNVH<<(n(. .&nzpg g`, b@"牒*@K" E hk| zƅpЃef8 *CK & zlePeJ$ P// /a gT5CR*n**n *B`,RB Lf+gR$` bkXB+ 爐*AK E h*zƅC8IB@(@3ATg) `) zz gzg`4B0* B2*ѩѩ`B0* ЩB2*#@`g,) f(IB@(@3AV`B)@R`) g$f(HBA(AiV` @iRg$fB(ሀ(ѩV` ѩRg$fB(ሀ(ѩV` ѩRg&f(HBA(Aj V`@j R`Rj "H̘kh0*In5@ G KBjBJg B0ԀUf "BAHA$ԁ "BAHA$ԁFB5B*n*B0**n * ` kR pL<S0 RJg!j j BHk4 * g /ahXHx/ a,L N^NuNVH <*nHxHxaѠ(@PJgB-5ҁt҂)A )Apdt$l)J/B/ a _ <m5|pB*//.HjGǘNO B*B*//. HrNO B*B*A //.HpNO ||lBHn/ / mxNL<N^Nuarpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 NVH0<*n$n $.Jg&jH` BHx"nHia &@O Jg $kJgJfHzjHxa)/aҬ` j0"*Xg I-d d: (f2(g,B(BB-5d /Hp(/.a _p` + I-dg /aDX'B JXfHza,%TXXJXgfj4Jg XgR%TX"9+ +Ro( mB(Hp"nHi j@ PX// a`j4&9+תXBBL< N^NuarpintrNVH< A+(JgB:9SxB@$@2A@oF$PJg * A+fB+BS gB@F`a*Jg*f Hz~a'"* zd@ jJg8(B(ЃЀPb$ g f/ af`/ aX DJf,-GB,AXXXPB,B,G @hh h h $.g&.g L<! &AG "$y"rJgJ"\f i (1f"iHJfJg*&F"+ g )\`\g"iHJfJfJf L<! &AG ""rJgH"\f i (1f"iHJfJg(&F"+ g )\`\g"iHJfJfJf"&D"k Jg Q (g"iJfJg*)\&DB+5/ kB(Hp$ P/&<Ȁ&CNO Jgp&DB+5//+/&CNO Jf/.a/&DHkHzHx`κf6B,//a//.az.HzHxa$6-EO`BWID/Hna$@O Jg*jJg-m0g&n+gB@B+Hs/&CNO Jg-4g4/.a/B,//aXO.HzpHxa#O`\ mHh/.a.&DHkB,//aXO.Hz[Hxa#NO`B,//a//.a`.Hz\Hxa#O&n+g2,g,B@B,//.a$.HzCHxa"O&D+5,g.BAB,//.a.Hz0Hxa"O`h&nB+ABA/Hsa XO JXgA-d й++@Xm4BJ g/ /- /* /&D kxNB O~g /aP`8f>B,B,A//HpEǘNO &D kB(B,/Hp`\HxBHna$@O Jg*jB,B,A//HpEǘNO -m0&nB+B,/Hs/NO B,B,A /HtHpNO B,B,/HnHtNO 9|9|&FkB,B,Ѐ @PA"'A 'A||BHn//&D kxNL&@BHzINXJo B$L/HzNSPg HzNXJnHzNL N^Nu ifa_addr= ifa_dsta= ifa_mask= flags=0x%x,refcnt=%d,metric=%d NVH8(nJgDHzGN/E8NHzN/,NHzN/,N/,00l./B0,,/HzNLN^Nu la_rt=%p la_hold=%p, la_asked=0x%lx NV nJg/(/( /(HzaPN^Nurtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p NVH8$n/ HzjGN/*X/*82j6/ 2j4/ HzUNHzyNO. INHzkN/*NHzfN/*0N/*<*n*-(m$. R "PB0,o R `-f o// az*@PJf R `*(-؂+D B0,// aXPJg R ``&-+Cխ DB|gm |g`|g`R E(1f D(f/a"@|#FBX C gR `&l` $y4̗˙Jg(j *P$@JfJfJgLfLJfFpF g8|)Fa I8$L<$Q AA$ AA.$ԂR)@#Rp(KJg&l`Jg(j *P$@JfJfJf` C ( gR ` &l`(&ft$y4̗˙Jg(j *P$@JfJfJg~fl" |F gZ C ( gfH ,S|e<0; N .d$|)Fa H6LBR)A#Rp`|)F(KJg&l`Jg(j *P$@JfJfJfh`R E(1f D"(  f Cf C ( f( E"h Jg Q (g"iJfJg C!i< E"h Jg Q (g"iJfJg(iJgJ D (g(lJfJg2BR ,|gb|e|` l |g|` E"h Jg Q (g"iJfJg C h \gR E(1f D"(  f CgR / a ` C ( f Jg!i< E"h Jg Q (g"iJfJg(iJgD D (g(lJfJg.BR ,S|e0; N  |)F/ a|@L<|N^NuNVH8 $nB@F!x%DpF gX j(1fL/ ar// ax%Da E$L<$Q"AC$ "AC.$ ԂR%@#RpO `B gB@F`aLN^NuNV"n )rb6re0pF g" i(1f i rg Hx/ a@N^NuNVH 8JRpgB@F!BRp$y4̗˙Jg(j *P$@JfVJf`l ,gD"S)Arf.f0 l C.fHx`Hx/ NPr)A`r#Rp(KJg&l`Jg(j *P$@JfJfJf gB@F`aLN^NuNV/B@F! yJg,tf ($R!BR ot!B h Jf gB@F`a:$.N^NuNVH08(n69SxB@$@2A@oFBHy&a&@P f`aJg^69SxB@$@2A@oFRy#T f"a7|BBC'I7|`"B@F`B@F`HxHxa&@PJg k#('Hv'C 'CB(1|Bh| !y !T"kE'Jv׫ B*%TBjHx/ a5@׫v׫ -l|PJ/VD@HnBBB/ aeR L N^NuNV".J,g$ y4Jg8 84g hPJf`"p` y4Jg @%kxA|%X%X%P`$-1gx؎"D"hI-L(lC-I"pI-L(tCh-I"~lދ(G(|p܋"F"ztڋ(E( mJg4/ // N$O g$"n(D""G(n""F(n""E(n"`+-g|'DHxHx/ EBnN'nHxHx/ N`P-1fp`D'jh'jl'jp'jt`&HxHj/ / ad` *'@|'@@`BvB +Yf,J*f%kX%k\%k`%kd` "k\fBJ*0g(/ / a'j0xA| 4 8 <'k|@pP-1g, *!f$/ / a'j h'j$l'j(p'j,tpP *fJfJgBHj/ / a$-1g8 *!f.'j h'j$l'j(p'j,t`%kx0A|%X4%X8%P<0-0g +igg$ +if%kh %kl$%kp(%kt,`B B$B(B,`/ / aP kHJg!kLL kL H kJg!k`+k k  kPJg!kTT`#T4 kT P0+.n / aX`S@7@.a`2/ //.a?r`$Jg mJfp-`/ // N$at `BL<JgJfB`PBЄ҅Ё h p Jg*$HfhfhfDf / /NRP BJf L N^NuNVH80$n&. (.&nJg"Jg Rg$(Hf//NP BfL N^NuNV/ n$h JgB BBBBBBBBBA$-H-j0-jB2j4/ HnHxaO*5g B2j4/ /*/*0/* Hxa`/ a$nN^NuNV/ $n * g /arB $nN^NuNVH> $n&. *.B2|8. RgBhf4JHV|"(DfJg R`JgfJgJg o$"@Jg hf L|N^Nuin_pcblookup_connect: faddr=%08x fport=%d laddr=%08x lport=%d NVH< n*. .(.".64Ѕ҄Ё h E "R gHfif ifDg("QJfJ,g?Bg/?Bg/HzHaB`*g$ QJg!i i "g R!I$#J LHx/ akPJf,(k,5g l<(1g"-8b * bB`~S@0* @c@`@5@ -l f +B +B`// a@PR.r ҹ,'A> l )>bf"*2Ҫ. )2Щ.c"J$RJf$I89SxB@$@2A@oF jJg!j j  RJg!j j gB@F`/aX` a0/ NX j0(6 @oS@1@6Jg `./ Hy&a 9(S#PS-nBL N^NuNVH 0"y JgNG5 E5$$ )>g,b / aX`"#i.2 i").Ө8").ӓ").ӒB."BJfL N^NuNVH0<(n n &hJ-g + g/ a$@XJfP&9-mHxa $@X`BHy&a$@PJgRHxFB/ a $O `69SxB@$@2A@oF jJg!j j  RJg!j j gB@F`/a X`"a~/ aX j0(6 @oS@1@6B2B.B6B: L%X%X%X"%X&%P* TRh6%k%k kv ֹ,%C>A-d%PBB+//+ /+a"@O 69SxB@$@2A@oFG 3%@g sK!M 'G%K C $g y !J"%I gB@F`a|L< N^Nuicmp_erroricmp lenNVH<<*n&. (.&n(mzązgR0,f , fVzgP P bF4(g@ g: g4 g. g( g" g g g g R`$0-@fHxHxa"$@PJgB0,zdp"Ҁ P%@ zd zЪ%@"@zd HzaAR<zf#n`(Bz fDB`zfzf Jg3k:D// Hia #DO &jrҋpЊc Hzar%ApЪ %@ %@%m"A" L'X'X'X'P3jp| B)/ aTX/ aL<x#d+xxЄn  bRX`JA.( C."E.$BHhHxBHiHjaHjHxaO / aR:`/ ajL<N^NuNVH?<*.&E*k|x؀/- aXJf -  f$-+m  L<! &AG " y"pJg\f i (1f"iHJfJf0&E k(1g"$h Jg R (f"Jlg$jJfA. JfH&E/+Hhal"@PJf0"y4Jg i (1g"iPJfJf/aJX`*+i\ PJo ~ލ-Ga(@Jf.HxHxa|(@PJg|)F l Jg$DJoZB&nJgNtg B+g@e<|g|Dg f//.&l / a O լ ծJn", lV|$AJg`"l l B0R R|lmp&E +g|&Eܫ /HuH/a ZO &Ek/ /aPJg/ a2L<,<:9SxB@$@2A@oF*F&UJg +*AfBBS gB@F`auJg~+f Hz*aJ4gTR4z eHx/ a*&@PJg (k @g R5X`zƅze R5 ` o // a&@PJf R5 `(k ,  g// aXPJg R5`B2,o R5` +o R5`l f 'A 'A`// aPk-KHxaZ$@XJg6 jJg(HnB/+// NOJfZ&nJgP(k$RJfB.zd/ a 4XJf,$,( L<! *AK " y"pJg" \f i (1f"iHJfJf( k(1gD"h Jg<  Q (f(lgDgJ@gCg4R5`:9SxB@$@2A@oFBR fb`j0H9@JfJ@gR5BHyDa @PJfFR5d:9SxB@$@2A@oFBR g B@F`aq`B!K !L/ /a*&@PJf@:9SxB@$@2A@oFBR g B@F`ap`R5@(kzƅl` Jg/ a6X:9SxB@$@2A@oFBR gB@F`apZR54B, A 0 @K A A,,// p NP`8/ a$X`*L<|N^Nu%s:%d: ipq lock not held ipq lock checkNVH?<,.*n "F&) i~ćJRfHxwHzbHzatHza"Cթ JfHxHxHxa4*@O JgEG$ *g yG$!M$+J|<(F lh l;h B l+h  l+h`h jh//* aP`$m Jg"F i0( jhe&J$RJfJgP kB2(B0($Ԁ(F lB0(Jo*B0(o//, a lh lhPJgrBBB"F i:(8("҄ j6(lN$B0(n2-R/* aDX R"<Jg!j j / HyD(ANP$nJfJf" - "F"g m !F+F C (F)I` (F(g S!F&"F#KB$m & g BB j2(f<0(Ԁ&J$RJfJ+f&$C(*"D~(BI oR5h/ a`&* "C&QB/ /,<B(FN-R/ HyD*<"EN$nOJg,(n&l -T/ HyD"EN/ /(FNO$nJf"D3B#m #m UJg!m m Hx/ a5"D~(C l A )H 刑,gB&CJg Ы &SJf"C#@ `R5/a/HyDaBL`EI-L+vvgm Jg`vgJ` ^e#.(n/,Hy.a"@PJg~(n\] J^_`: ^e(n.. J..Hy.aXJg,X+a-@B+AX+JnLJg J.f v-Ct`RF//aN$P`6aP$`./a `/a`/a `/a `/a,$X`t* g/aq| L N^NuNV/ /$. $n"./gt*`@HxBan$Prjgrkg `/a`/a$X`t*Jg/aq $.$nN^NuNV . ". n/f u3g u4g `/a`/a`pN^NuNVH<0&nB@F!R& z"z ꩳ$+"zꩳ"z ꩳ_ y#$ p Jg "f fJJg" PJfJfR g B@F` $H`a[Jg'j2'j6 'j:`z'E'E 'EBL Hha @XJfp1`+gtgHzHxap-`xBHx8Hxa(@HxB/ aO B0/HzHlajB>BBBFBJBNv#/6O`@(h Jl0mp-`||-yHn/< i1/ lNO JfB@F!B%JHjaBBv %Ckk +"L<bM%@%k"%k &%L*B.B2B6B:X gB@F`aV0y/4eR@3/4J/g>/+B+//+ <̲+g <̪//+B0/HzHxadBL N^NuNV/ /$n RJg$(/ak`X BJf*g*Hx8/**aPHf@BH#D`.||-y j*Hn/< i2/ hNO HxRB/ a$.$nN^Nudel_vif %d, numvifs %d NVH<0 nJgz d$h0y/4ep`R(< @J"fp1`~B@F!/a29/4Xg B"D4 BSG A J "fSAf3/4 gB@F`aUJ/gB09/4/B0/Hz4HxaBL BJ$_N^NuNVH 8&n$kJI@Jg$*/aiHx8/ NO $BJf SJg!k k Hx8/ NLN^Nuadd_mfc update o %x g %x p %x multiple kernel entriesadd_mfc %s o %x g %x p %x dbx %p add_mfc o %x g %x p %x dbg %p add_mfc no upcall o %x g %x p %x NVH?< nJg~) e p`&H`l(hB@F!R& ~"~ $,"~"~ _ y#$ p Jg "f fJJg PJfJfR`V9/g B0,//,/HzHxaOJ>gS9̀/ / aP gB@F`BD"&~ ~ ", ~ ~ ƹ_ y#$&p<JgB.+f.+ f +JgRDKn Dg$/:,//,/HzHz-HxaO9/g$/+JB0,//,/Hz!HxaOJ>g ÀS08$kJ/ / NPJg.$*/ /*/a /afHx8/ aO$BJf&SJf0JDf9/g B0,//,/HzHxafOHxHx8HxNa&@O Jf gB@F`aQBp7`l'T'l B2B6B:ABBB/ / a0P y#$ 0<&g p<!K y#$!<A<'H gB@F`aPBL&@O Jf.Hx8/a/ a`O gB@F`Hx/B/ ab$@OJg *f o// ajn$@PJf8Hx8/E@N/ a`Hx8/ NO gB@F`C/>" j|B( RHi/ /9/aO JlTHzhHxaRHx8/E@N/ a`Hx8/ NO gB@F`aJp7`'m 'm B2B6B:~'G>ÀR0(BJy/4gBABR09/4n7| y#$ 0,&g p,!K y#$!,A,'H'FJ`NBAJ gBER~l,RHx8/a/ a_6O g2B@F`0 @P f "FB"#n  gB@F`aIBLgB"@S%I>SJn4S5(RG9/g/* /*HzpHxa"O/ NX$CJfR o gB@F`aI 9lV/BHzBaDL<" Hi/ /9/a`(- "fR2*.۰:` R.(.ٰ6(FR2(.٬6$BC29/4CcrB-| G>E6=C(n4hg6-d0R(.ٓ(ng /// a`/// a,O 29/4xRٮGRERԄRCCbBLPJfR/aW` // a/ aJL N^NuNV"n . B@F! i X#@R gB@F`aAN^NuNVH0 $nB@F!"RJgB/ aO`d$B-j* i(SA|HnHxBB/ aO9/g&/L<(/HzPHxaLO gB@F`a?DL N^NuNVH< $nB@F!Hna$. nXxgmJg,`zfB@B@`"뉒 툐A ԀL*(x *Ђ%@(.*.%D%E 'c%|' gB@F`a>L*n-mBJf"*n//./ /.*n mxN.O` / aL:X&nJfJfR5D*nܻf$Jf UJg0(6 @o|S@1@6*nB ` / aKX`L<,. $nB*F&UJf6BHx5HxXa&@O Jfp7``*F*B||BkpЮze0; N Jg"z f j$fB` L<! *AK " y"pJg\f i (1f"iHJfJg$i JgRJj0lJ&`Jgz f jP`jJgz fz j bl@`DJg^z fT(j  f>$,fNBBBBBB||-THnaBX nJg$hE/2,aRXB0+oB CA"R2+nSk`v-Jf + fHx5*F/aB L<|N^NuNVH 0$.&n $nHxBa>\ @$r gn~r gHr gV`p$hr!A Jg* SJg$"h Jg Q (g"iJfJg$\`4$`,"hr!A Jg`"hr!A Jg`B`p-L N^NuNVH00$nJg.BJjgBG/aXR4*nHx5/ aL N^NuNV/ / Hx/<;B/. aB&@OJgT+fr eHx/ aJd&@PJg0$kBj r<€// aR5@ B/./ /.aݺ$n&nN^NuNVHxHxHyEaN^NuNVH<<(."D(iB||-l BnBB@Hl*<E"E&Qg+Ag, f +Dgf +Hg fJgHx/<;B/aA$Og*7v֎KqpJf j(g// Hn/ aɆO j/.//HhBNOJf/E:nNX .g$/NX` j0(`@vR50S54L<"@O Jg)gvש iB(BhjA 1i!jD !jHP *L`R") o / a=xp(`R iB0(g / a=^p`8Jhf1y-|Ry-|BvR5\HjT/*P/Hj // a>L N^NuNVH00". n "n .&n$hBJgt*vf g/a;`JgnvfvimvdoLvg`vkg<` SJgv et` hJgv4`vǪ4 SJgv/a;`l/ //a|`\vf&Hx Ba8 @&v!C S h17 `2vnvkmvjn/ //a`/ // //az$ L N^NuNV/ n $hr gp`:J4g"*U cp/`"Jg/ ajJfp1` n!jDB$nN^NuNV n "hr gp`(J4fp1`)U b n!iHB`p/N^NuNV n!yHN^Nurip_usrreq: unexpected control mbufrip_usrreqNVH88(n . &.$. n"nr f/ //// ax`JB@F!&lr grgJg Hzva*Jf Jg4|`re0; N$Jg4|8`JgHi0 i/a PJg4| `JhgJFf /9/T/9/P/ an$@O JflHyE/ a$@PJfT&lBA`H/faʞ/ aX`,// a$@P`// a"$@PJf / aifX`/ ajV/ a@P`/ alX`JgJ g/E:nN/N4|P`Jg,,g4|8`// a$@PJg/a98X`,f4|9`/ /a$@PJgh/ aX`^ gB@F`a#B`\4|-``HxBHj6aøJg,%[ K%X%X%X%X%X %X$%X(%X,%P0`(B BBBBB B$B(B,B05n4L //* a>d.* (* *ڀO`Jo, j$$ ,D//a>•P j"DųfZڪ,*"/* /a=P RJg!j j jJg!j j Jg/ HyDaP`VJnF-J`@ RJg!j j jJg!j j Jf&J`/ HyDa\P$nJf&Jf.BHyDaL&@PJfR,/a4B`\&J`RD,.ݹHJgR<, ݹ@'G 'D'E'n"Jf(n &g T!K(n`(n &g T!K(n('L(n ,'@g lI!L(n)KI'L(n loV(n$TJgJ *Zf>Ъ(n)@Z|̪"-F RGJg!j j jJg!j j (n,g/* a3X`/* (nHlBaiP/ HyDNP(n0,`@+"B*`B>+"-G(h0,ggF=A K#P#T#X#\#`#d#h#l#p#t0,g ~~gXg / a!TX` ~gg/ / a(@PJg~g` l$hB*..-G`L"k f>+kf R`L>,4l2m@Hn/.// / a#dOJg$`0* @f Hza~Bjv @o"y,/%I JgHn/ /.// aPO jff ~7~fX".g .kF$+Zf:Jg2..ྪNf&"j:jfJg&"* JnB0+ Ђj%y %n0+ f"+ 6JoؒjJn.*nNe0j/XlRtJg y Hh`Jjxg +zJo2jx/ / aP(+6Rdٹh/tdԌ/ajl%k6/ a.O .*6jfB`Jf0j,%H0,@"9/f,B4* Ѐ"<c" d `B@F`B0*L%@n/ a= XJg *6JJo R/ a[/ a<`4*$0@`P @`f jj>9SxB@&@2A@oFg gB@F`$a`B@5B$ fHat`/ Hx_HzHzGa6HzcaBB/ a0O >9SxB@$@2A@oFj$ gB@F`a Jjxg2jx/ / aP`5|RB2+ *Vd0$.D// a37jX ~ʇRLչPP,~̇"kS%IB%k^`Pg"+ JJo :jJn 0JgHfB *g<.. l2 9 ?HnR4B0+ ѹ8Rp` B +$*ZJoAClJg&~ʇR'@0+& @cS@7@&`~ʇBk&SB0+ mf$f~ʇj$B4+ չ8R4` R<չ@// Nիk B0+&Plk&`~ʇBk&,g$ joJk g/ a2$@RTX` B0+ $+Ԁ *ZЪVJoRLB0+ APnhѐg> j f6 +ZJo*/*:Hx/ a:/ a2d$@ݭ O`,JVf p"kZf dj$RX`ՐACl.D// Nk ~ʇP&~ƇJgD .k:$+"* Jn*B0+ Ԁg Sk`j%y %nJgT0*W@0@~eF0; ACN0009|=8`9|68BjR/ N`/ N`gHx6/ a0$@P`,~̇f*%ff`0* @gmt @ nl`"B@F`"+ *6JnNjJnDR/ aWL/ a74*$0@`P @`f jj>9SxB@&@2A@oFg gB@F`$a `B@5B$ fZa`/ HxoHzrHzaHza}lBB/ aO >9SxB@$@2A@oFj$ gB@F`a"kS%IB"+6JnJk f..ྪNfR\Jg"k6fRj0j 9/Xf(*:"*N&*n d "B4* LB +Rj ւ%CnBj`t~erL%Ar%jjRBBjx%k:B0* %@n/ aB0* 2*HLЪr%@n :XJo%D:`lVB0* Ѫn/ aX`Bj`6J/f0j/XmJ *rnd@%@n`:0j/Xm2/ / a PJf$%jrn"*jrd B0* Ҁ%AnBj"+ jJo R``(6RdٹhJg y Hh`Jjxg +zJo2jx/ / aP.+jfB2|-I`Jf0j,%H&*nB4* rcL(LC J/g +RkB*rFAԃᩴd"%An ,ddN/,dtdԌ/a_v`/tdԌ/a_晪NBP0,@P`$Jg / a,$@X`p~x޹,%G`Jgv&*B$+ k "+f *FkFfR..ྪNcHJk f"jFf..ྪNcRl%nN%kB%kF..ྪc%G2|-Ig4+&g0* @g @o @ fB2 ЬB c Bk&~ʇ`xҫ ^Jo0%A^Z ,BЁS)@>fl@/ aQ*X4+&k b4,f,/ / / aO `B@F`"*Z ^Jo%A^Jk fg0* @g @o @ f>9SxB@$@2A@oF0*$g gB@F`$a `@@5@$ fja `/ HxHzHzea|THzaw"*ZfJf jf4*$0fJ/g+!g B5B$`8f2B5B$$<W"B %@.g yWC.!I2"B"%B2"*ZB0+ Ҁ%AZ+!~ʇRB0+ ѹ / tBԌ/aV`P0,`@9SxB@$@2A@oFj$ gB@F`a Z`/ a b~ʇXg0* @o @g$ @o @ f/ aSZj$RZX0* @g n @g`P @ g @ g8`B5|`:5|`25| / a3~x޹,%G/ aPP` ~x޹,%G,gBHyP/ 2n/ BaOJf**%g`R` fx/ apj$/ aV`fX0-@fN + g<g Hx/+B`gRk HxBB0+ Ы// / / a$<`:Jg. j* h(gBHyP/ 2n/ HxaPO/ aL-!g4jj9n `xf-!g k@$j+ cHx/- B@HzHxat|O`x f Lx jjjjj j j -!gk$'l'y `lxff-!g^k$`V+$fN"l^x„ xf:x l4TUJo, JXXXP JXXXPQQJnԖJn|L<N^Nutcp_pulloutofbandNV/ n $nB0(&"Sk * m$RJgJlHzas *Ё n h h"@Y( j Hh/ /aS $nN^NuNVH8 $n6.RSC2*~g:4J0@@0B5@~n5|~JBlDB2*0@@B5An5|`0H5@~0H5@BjxBj2j0CT2TAl2*0*~H@B@x0jЈ5@@o5A` @o5|BjLN^NuNVH80$n&n +Rj`(*:&*6$*nBBjx%k:B0* %@n%k6/ a<%Bn%C6 :Jo%D: +6B2* np`BL N^NusynplNV/B"9-첀oApB\RnBC4 8*P uN B0*PP+$LJgJDfPRr lX$y4JgJDgB*jD,b(jR RCtGJg!j j j(ASq jJg!j `4*PK48+ . j Sl *Tg /aX jJg0(6 @n /aX`S@1@6/ HyNP$LJgJDfD .g ".B@F`aXL<(.*. "E*iB@F!Hn/ a&@PJf gB@F`a%@j%@:%@6 *bR%@Z%@f5|"y,C%I R5k^B0+\// a ~PJkPgB0*`4"9/f"B4* Ѐ"<c" d ` B0*L%@n/ a!h%k<B,+ *JR%@:%@j0j,%H +$Xo"*ZҀ fJo%Af%jZR +Tg/NX kJg0(6 @n /atX`S@1@6/ Hya]` `zHxBB0- Э/// BaOJg /a&dX +Tg /aX kJg0(6 @n /aX`S@1@6/ Hya\RpL<|N^NuNVH 0&nB@F!Hn/ a$@PJf g6B@F` k"*< k SJo g B@F`a` RJg!j j j(ACtSq jJg!j `B0*PA48!  j Sl gB@F`atR *Tg /a X jJg0(6 @n /aX`S@1@6/ Hya[L N^NuNVH 0 n&n -h-h =k=SB@F!HnHna$@PJf gVB@F` &k@g g8B@F`0*Rg jPb&@5@R g B@F`az` RJg!j j j(ACtSq jJg!j `B0*PA48!  j Sl gB@F`a R *Tg /a *X jJg0(6 @n /a ^X`S@1@6/ HyaZJL N^NuNV\H><*n(. $n*."D&i0)@f +  g + g"-FB -NJl & ovFCa$Jg*J/xV<F=F// /./ Hn`aO`BnHn\/ a$@PJgBRJg *Tg /a X%BT%n0// aJfRR`BHyaV<$@PJfJg/a B`ZBBBBB I$%k 4%k85kX5kZBjR%BT%ko6"+nL@L c '@nB0+ "+rL@L c '@r7m $+6jWI-@DJ/hg$"9/lL. +:$+nҀd"'An`LJgF<+kvn< 9/f $. Ѐ"<c" d `L."+nd '@nB*k:6"+N +nd -@2kA/\B1J+"g Jf"Edd|Ȇ~-G`BBk"E )dc &.|Ȇ`&Jl(B~ȇJfBBk'k6:Jf/ a"X".ܲl &|Ȇ~-G"E$)F B,)NJ-Fl-@-nJgJg"E)fJf+%g Ѝ"EddJ+"f +∰c +:jkxJo0B+rFAᩲc". +fZ .ЀoHҁoB+%f:Cf4 +>6Jn("EJdg JfJfBk/ a$`Egx/+*ae @'kJ:XBJg (9SxB@$@2A@oFRy#T f"a*5|BBC%I5|`"B@F`B@F`HxHxa $@Pp7JgF 9#( j%H%n |d аd,Hx// "E/)xa$Of0/ ap7X`,.Hph// "E/)xa ת O Ѓ-| D"Edf|` +%gR`(CgR` +>6JoR `R>9SxB@$@2A@oFBHy&N$@P f`aJg^<9SxB@$@2A@oFRy#T f"a5|BBC%I5|`"B@F`B@F`HxHxa$@PJfp7`,9#(ݪ%n -| DB*j k&Jf HzaV"M""""""""""Jf fJg+k:`+kj+kZJg / HnHm(a"O pЌ D!"E )F䈰o,.lBB+tFB 㨰l-@ +fZo-@ .;@" +>:Jo c ;@&- !`'k6> Ќg 0@L;@ (n/ / "nN;@$PJ+"gJf~$+: g ,R'F:R"҃'A: jJo'AjJkxf7|x'BzRJfJ.+:6g@0k,'HJg,BBk`"/a2X`"+:҃ jJo'Aj"E)gB/ / 2k/ HxaO%L;j k*h@ k*h9"n QJg(5f`(nXJg0(6 @ovS@1@6"nB| k*)hH/.a"n QXJf/ aR5TpAX`@J.g(Ofm@B"E)~̇//. k*/(L/ aOJg6|7fB/+*a V`~Ag|2f ko7@`R+%gRJo".ҫZ fJo'Af'kZ0+$>G7G$g@7@$ k.Jg!k22 k2 .Jl,.D/HzaWPJgJ/gnSffBLJlg6 4(vAg v3gv@f / / a@`// /-Hy{8aN\BL< N^NuNV n hJg B0( !@nN^NuNVH 8&n$k/ I$N @XJghJgV(5f/. / aN/ N @O JgB$(Pg. 9/f"ҁ0|c A "d" `L%@n%j6:/ aLN^NuNV/ nBJg (8J/f "94c t(dtЂ"9/pc $N^NuNVH08&n$. k*(h/aQ$@&9/pXJg&p c &7C/ a0$/+*a.ԀPJg"*`f",hc&`("AC8" LCL 9 d"/Hlda$7C Jg *dg"ҁc '@rL N^NuNVH 0$n j*&h/aQ8 @5|"y,/%I XJg"(\f"+FB4*d("AC(" LBL 9 d"/HkBa$6L N^NuNVH0 $n/**aP @JgJj~f$(hg(Og4 L< Cރv Ѐ5A An5|` Ao5| L< Cރv Ԃ5A~ (lg"L<Cރv `0@5@0*~H@B@v0jЈ5@2*@o5A` @o5|L N^NuNV/ $naw"JgE 0" ` 9/Ҁ#/J/gJl $nN^NuNV n0($@ @Wr N^NuNV//B@F! yWJg$(.h$/aX BJf gB@F`ah$.&.N^NuNVH0`dJjfBB/ a>$O f7|`JjfBB/ a>$O fh// a@$PfV/ a'@&Xf / aB`+  b$BvFC+ 娰FdRGR  c/ aLR7|.9,'G BHx/ aF'@J'@R'@>'@j'@:'@6/ aX$O`t-`/ a&@X`/ aD/ aJ&@PJg/ a$X`t/ a X`fJgJ fZ/ Hmda/ a$O `>Hx5/ av&@P`* gB@F`aѪB`HJgJ g/E:nN/ NtP`J>f-g-f +gt`ft#`~)G lf +`"-hd -pll  l/ at7X`l/ Ed/ a.+6ޒ'G>|"/ a$B+"O `:// aAP`,// aBP`// a&@ወP` HzVa<"Jg-g/B/ /Hxa O gB@F`a` L&*/a8 @XJgBhB`"0*4BH@5@/a>jp7L N^NuNV/ / $n j*&h jn / a$@`BJ+lJkfB/ a$@`(/ a~HkBax/ a $@O Jg/ a $n&nN^NuNV/ $n0jre40;N &Bj/ a$@X`5|`5|Jg0 jo( j*/(aF j f 94o й,%@ $nN^NuNV//$."n".v gp`R n PveDA ЀA/J0l00g/0// /a`/0/.// /a`p*$.&.N^NuNV/90/90Hyxa7N^NuNVH?<(nB$. R~dB/ ah)kf +Dgf +Hg f"E>kfJgHx/<;B/ a:$Og*7v֎(<qpJf j(g// Hn/ aiO j/.//HhB"DNOJf/E:nNX .g$/NX` j0(`@O j/./ /HhB"DNOJgD j`$"EB0)//-B0//- Hyxa=&@OJfxR"EB0)//-Hyxa>L&@O JfNR0,@g R`"n*"n$ J"n "F "B BBHxHx/ aF`||-m "E=QBB+7f k(g/ / Hn/ ah(O$ լ/./ Hn~Bޫ/aOJg k0(`@b r`~HxHxTHxa$@O Jg6Hx// abh%y0BB$(%S&#01`,t `&AN 0Hx0Hh/ab`"900gJA_\Jg> ЁЀHx66d//aa 90*R#0zfB0B`BHz~Hx(Hy0a&$Og`HxB//aaO &nz e& "ҋҁA6:.pgp`R A_\$pI6hz)K6l+BB@F!JgJ.g*BHxBB/ a$OgRN`lRN`dA*( mR/ aӶt7X`,B"hJf `#J!JRz%P9 JgRN` RN`tz7f`S0 ЋЀz)B0fB" @ABRz f A#0 90g zgڰfB0B0B0 gB@F` a`t L< blockdisabledIP Filter: initialized. Default = %s all, Logging = %s %s NVH0 B@F!J1fE f*HzTa+fX gB@F`atp`a$nvga\vg a\\vfp`Hx/ av#1HxlBHyV@a[O # P# P gB@F`a"91 <i>f <iIg <iCHz/HzE4NHy1HzN 9jR/BHya/BL N^NuIP Filter: not initialized NV/BHya0DPB@F!J1fHza*X gbB@F``#P Hx Ba (B1HxHyaaDa>aitaO gB@F`aB$.N^NuNVH8 (.&<1$Hx//EǘNO -y1-y1-y1-y1-y1-y1-y1-y1y1-y1 -y1Hx//NPO.B/aYLN^NuNVH<0(. . &n$.Bzl gp`"z ꩂzdp`B@F!zf(/// a#&O gB@F`zf(/// a[R&O gB@F` r=bp rgb Ar@g` rHg rIg` rAgjb2 rFgb rDb rCe` rGg` 6rMb 6rLdt 0rNgp` rKg rJg`|ghC KJga&fXz#1`La&fBB1`8g"1 K111`1 K111`g/91/ //a`gz1// //a`gHxlBHyV@aW\O &1z1#1`$HxHy1/EǘNO -y1-y1-y1-y1-y1-y1-y1-y1-y1y1-y1 -y1y1-y|-y-y-y-y-yB.-y1Hx Hy1HnaTHx// NO O `g~/ aX`glC K/./ap-@C KP`JaGBHx// aV.O B rKgT0+g"B///.?Bga.OJgp` rKg$0+gB///+`?BgaOJg@"+`  @|fK1`$ gA1`| †gA1A\K(MB0+g$B///+`/a$Og"B*i (MHxlBHyV@aSO J+mgHkmaTr'@Xf|'FJ+}gHk}aTT'@Xf|'FEaJ*gHjaT,$Xf|$`aEJ*gHjaT$Xf|$$UJg"HxHk(Hj(aUO Jg(J$RJf rKf.Jfp`|Hx/ /aTxBBB B$B`XJf$TJg(J$RJf r=g rDfxJf2|`"| lp`Jg"B iJgS |f/ / `VJjg///+`B0*/aOHx/ / a(HxT/ azt`Jg2|`|f/ / //ax`HxHxTHxav$@O JgpJg"B iJgR Hx/ / aShO |%F BB$( AeHx/ / aO BB0*g/// /a`2| -I> .>L<N^NuNV/". t 䨀tdp`B$N^NuNV/". t 䨀tdp`B$N^NuNVpN^NuNVH0< n$. B*h*- gp`HxHxa²(@PJfp7`- gvr()A ,й#()@)ABHx(B/aPO &lE"B'i 'i 5U4%mתp | i 7| Hx(/ a5@"Bii 7|(/ / a L< N^NuNV n y.BBBB/.aqN^NuNVH<*nHxHxa(@PJfp7`r8)A ,й#()@)ABHx8B/aOO &lEpp| 7mBk |<m7|8JfHn/.axPrfp`r'n 'm nBj M%X%X %X%X%PrA XXXXX X!X"P#Hx$/ a5@/ / aL<N^NuIP Filter failed to attach NVaLJg HzaXa6RN^NuNV nBJg Ш PJfN^NuNVH?<*n$n n&MBB8*-D(kC-IBBBBBC-I| *&,Jg&J*g Jgfp`J"n#l` (f ,"n#@/.aLXJfJ j&Jhbm~`"n QJg,( @OJg0!F//,HxHx/a)O`&xƄxm ~(`~7`>-CC-Ix-D"n-I* o89SxB@$@2A@oFBHy&a &@P f`a^Jg^89SxB@$@2A@oFRy#T f"a(7|BBC'I7|`"B@F`B@F`HxHxa&@PJg$k#('J"J L"""""$<)E1G.EX!J*7i'i 'i~UD0)$g B) ~gdm ~g`~g`vJf g fvB2) ЃoJg S~e  h.c1R`B2)~~ЇcJg S~e fFJfXj `:B2)~PcJg S~e Jf h.c 1R1jE~ڇgBBng g.B*`(>(nBF*=F<.Njn`x c ~l|mx2| rBCI1K A (fB>(n fD*2|rI2fBBK A 0Bgxc`Sj`Pd`Sjf>JFg fF>.Bk 7G7n7FL*df xtg,Bvת(*ق%D g*n pr2-Ӫ$$* Հ%B `jl!7n"7j$ *g<'@&/./ /. /a,OJ&f7n"7j$'J&gv-Cf $RRJfJg L,.&. *.$.Bn ///a<(O Jf(`RSo L|N^NuNVH< n(. *.B P g:g PRJfJg* @Jg$Bg2(dg4 ЂnE1Ad PRJfLG3=G.f..Ϯf..ϮG2$SJg"HxFHj*Hm*a72O Jg&J$RJf prQgb& @@rRgb @fg` prPg,` rWgb rVg` rSg>`g|Jgx`Jfx `$FBHxp/ / a5O HjLa4%@ Xf~%G J*\g Hj\*lI/a0%@Pfx`6B& *HgV/*7E@7n<`-j0=j$f=nJf <.ngL'n 'm$'m ("- B@H@ҀB0.&ր". B@H@ҀB0.$ԀJg7n>7n@7n< "BAHA&ց "BAHA$ԁ "BAHA&ց "BAHA$ԁdS" BAHAҀ B@H@Ё'@'@ Jgnf <.ngJf"- `"- B@H@&ր". B@H@$Ԁ "BAHA&ց "BAHA$ԁ "BAHA&ց "BAHA$ԁdS" BAHAҀ B@H@Ҁ'A`'k'y2L#2"+ | ҀLy2 y2A 'HX'PP "+$ ҀLy2 y2A 'H\'PT 'nd"n'Q`'JHm FB4B8B,B0&2'i& i&JgR JfJg&"n2`HxT/ aPB` Jg "n3nR R R L<$n B/ /.a$&@PJfB` n| (**$DP* fz` fzJdf"* B@H@&ր"+ %A `"* B@H@&ր"+$%A B@H@$Ԁ "BAHA&ց "BAHA$ԁ "BAHA&ց "BAHA$ԁdS "BAHA$ԁJdfNB/Hj IN ԀO c "BAHA$ԁ bB/T/KN`LB/Hj KN ԀO c "BAHA$ԁ bB/T/INO Jg~|A Jdf602+>@gdB6B4dS B@H@0B"BHq/N`80(2+@@g,B6B4dS B@H@1AB"BHq/N&2 L<|N^NuNVH?0*.(.$n"n ..BGHG6@vƮ | ЉLy2 y2 pJg\B"(Jg`fD(f>$f8Jf |g(Ff"Jg< hB@H@&@vƮ | ЄLy2 y2 pJg\B"(Jg`fD f>(f8Jf |g(Ff"Jgh>gg< hg7E>` g<.kJ*\g/ / / aO Jg$pHgB?Bg// / a&@OJfN$jJf|Jf,Jo(4| y2S*.څ-EJm" g`$JgH$kHJg"G)g/ B// aO)k$ &2pr2,ӫ8(+4ـ'D4Bz۫0,+,݄'F,f"G)f0+@g g:3@, f@C-IHx// HkD/ a0N" 92Oc&"3f&3` fJmgC-IJg4JdfB0,//+ /.a`B0,//+ /.aO Jg0*ng Jgnf / // aZR p`BL0*,g@f4J*lg*lIB, fHx/./ / / a&@OJfL$jJf|Jf*Jo&v y2S..އ-GJm" g`$JgX$kH+k&Jg-g/ B/ / a2OJg"0*ng Jgnf/ / / aO xg&2pr2,ӫ8*+4ۀ'E4Bz۫0.+,߄'G,)k +k f-f0+>gg "n3@;@, f@xخ-DB/ / HkD/ a,~" 92Oc&"3f&3` f"nJig\-IJg$JdfB/+/.aB`B/+/.aR p`BL (.B@F!$y2JgJg`f*f jHJg|P jJg RJg!jHxT/ a=$nN^NuNVH 0$<EK0 RJgG$/NX RJfYQBBSd$<E@ RJg$GX$"hJg fB/NX RJfYQBBSdL N^NuNVH0X nrJg )f E-Jr J  f C-Ir I  fz ( fpT-Hr=GhnhO$n &* B"|F†|$.r.iBFBG////HzRHzSv֎/afO .a(*Xj // aP///.j/ aFOJg"n i4Jnh0-S@<HF</"n /)$n/* B*F/Hx/ahOJf-]v M-Xz-X~-X-X-X-X-X-X-X-X-X-X=P nnBBBBB"nn3| 2Bi=BBn-I$n &* "n%i BHx$v// /)Ha @OJg 2Hx// a$n %C L<@N^NuNV/./. /.aN^Nu227 227 Entering Passive ModeNVGBBBBBBBBBBBBB/.>a$FXJo/ p4e //.F/.>aOJg G4GN&, B"~F‡~$.J> BGBF////HzHzv֎/aO .a |(*Xj//.>a:P///.F/.>aOJgl0-S@H@B@//,"n/) B)F/Hx/aOJf-]N M-XR-XV-XZ-X^-Xb-Xf-Xj-Xn-Xr-Xv-Xz-X~=P nBBBBBB"nB3| BQ0H> G=@f3@Bnh-Ix&, (,)C"n)i BHx$N// /)Had @OJg 2Hx// ax)C )D L<N^NuNV/./. /.aN^NuNVHxBHya r# #P tBN^NuNV/ / n$n&h*r%AFHxHxTHxa0 @%H>gB5S5kB`p$n&nN^NuNV/ nBB` b H@@fB0$N^NuNVH><$n*n *.G(j*| "AC & j2$/a BB(Q/re"///a n h>O gfB./aF4Xg2j< HF<//-"E/) B)F/Hx/aOJf-Z J-X-X-X-X-X-X-X-X-X-X-X-X=P KBBBBB7| 6Bk=BBn-K&- "E+i BHxtԎ// /)Ha @OJg 2-|Hx// a ,+C BL<|N^NuNV/././. /.apN^NuNVHxBHya Rr##P 4BN^NuNV/ $nHxHxTHxBa.%@>O gHxBB/a  j>rB%AFr!AB$nN^NuPNANVH?<&n n$h>BBB~ g k*"n ~‡ (@I, (HxB/a O k2*/a&@XJo :G4 J(DT~%GJBf %G `zJf&(T~%G~fPfJ Bfp%GIB@(@5A ` Bf~IB@(@5A"BBJ gVBLJf(n,,*z…"FC (@G"n i2&/a"$XJohBBBBBBBBnB.x؎/pe // /a(F&,O"*>f4/Hx/Hzav,Og"B%C> zd p`pЁeܖ" zdp, @Jg"tG&ze 㨁:"FRSRJf :fJ gz%E|1܊"FBሀ)zf|3܊"FIB@)@5A$- &- (-| (G+l +l(G"nX& n-X-X-X-X-X-X-X-X-X-X-X-X=P nBBBBB-n-|(n9| pzfd0*$g^4*"89@=@=BBpJBf <// / "G/)HaR @OJg" 2JBWI// / a\O *gJ4* (n8Bl=BBnBHx/ / "G/)Ha @OJg 2Hx/ / aF +C +DBL$BF#2%L:)J kJg / / / /.N L<N^NuNVH><(n&n $."B$iJf// / iH/(a*"B#@O$@& gB, Bf , f<*k*/ / k2/aO mgB+"@C " 剒A1XR`| RBJ+g h&` h"Jg// / / NOJg // / / a*/ / k2/az;@pr2,Ӫ.(**ـ%D*(*2**6BRن"C#D2#E6p`pL<|N^NuNVH88(.&. I2J,g@BE2G2fHx/ /a0O JfR `E*G*I*JfBLN^NuNV nSN^NuNV/ $nJgHA2 g>f N` "@AN fJg& *>gJFgHxT/a*PHxT/ a*$nN^NuNVH?< n"n &.B$(*B(B8)-Dx„(BI *@K" Jg2(B&l"ҁ*CP-M-M0uJWx8|-L* 4cJWcJWHD@;0@"ҁ*CE Jrg2r(E 4d *B+K~Jg:JWx(Ec*JW*nG*n+JWx8n5*B&mrҁ(n0tJWx(CC$I 1cJWcJWHD@*n;0@ Ѐ(CCJqg8c0*B+K`&(B&l*CP-M-M0UJWx(CC* 1cJWc JWHD@:0@"ҁ:|-MJug4u(E 4d *B+K~Jg:JWx(Ec*JW*nG#JWx:n(n9(B&lrҁ*n0uJWx(CC 1cJWcJWHD@*n;0@ Ѐ(CE Jrgc *B+K~Jgp`BL0(.BB@F!$93Sk y3E,`|BJg4|f* )0f")^ b )_b )_b crJg@$GԢ )0fR`R y3J,fS/ NS3RX`$I"RJVrfzBBSjf gB@F`a]< L |N^NuNVH 0&n . B @8rUgPb @fg\`X rAfP KX$HXXP .re2/a-@ J`aHx8// a`t L N^NuNVH>8(n&n (.f$+f*933fR|#3B`E& Hx`B/ aO z-EB.B., @B", -Aԁ",-Aԁ|g|mg `zg` k*B| gBm zg`~|g0zg*`nB.0(=@Ԁ0(=@Ԁ`RFJR%y3`"k*=i=Q"fB0)ԀB0Ԁ")g@B0, AB0+ 刑) r€g RЈ` Ё%@JR%@NBT5iRf5|RR:*FQWID// / Hj^Hja O`4 k*=h=P"fB0(ԀB0ԀR-y3HxHxTHx`a$@O Jf R`,Hx`// aO Ly 3%k&$ j$"JgR j$$(``$91A@1%BB %|z|<,%E%F%k6|%F:5k>5|@5kB5|D+z |OF%@2 y3$<!<JfRJ+g B%S `%SB gz˪R3,*,VD@+g B// / a L|N^NuNVH?<(n"nB*n*m (WIDEJfET*EK\ G J-i&)8)*nB0- n*n B0- 刑) pgRJf$5|K%M) f&x` fJf& f R-H2+"@ *kB0".Ҁ$ k0mnJl&jc5D Jo$B0"Ҁ k'AJDfR'ARB~߬$, Ն)B *npr2-Ӭ$,Հ)B//. / Hl^Hla|-F .Lf0+hDhBgB` g\g&Jf 1DF!jJ` 1CF!jJ.(JR!GN`* g$Jf 1CH!jT` 1DH!jT.(TR!GXh4JfJg`JfB(1g Jf!I` J f!I pL- G/c"n B0)IB Wxdz g| f~"n $i*PB2-!px$ЄnZj . f*Hkgf %y3`$RJfJf / / a"&Pg``=k=SB 93 y3".L@"B$pJg@*0f./ / /// a OJg/ / / / abOJf ` $RJfJfB0.ѮB0.ѮJfz|`%y3`L=k=SB 93 y3..L@p"A$pJg&*0f/ / /// azOJf$RJfJf*B0.ѮB0.ѮJf|`Jf RB`Txz:-۪$*Մ%BRBtժ.* ߁%G &*$)C& *,g @// / a` L4|I`r4|P`l (g2$@zgmzg `zg`4|J`F4|K`@4|L`:4|H`4rJ g rҨz…// ah"n"PJg "D"BJg / a_hXJg / a_ZX .g /a_JX/.at L<pBB((l/.t/.Hx/.aF.O gJf "n| )")()*) f 0)zfgx"nlfEx"nlfB/ a"n|BBPHx/.t/.Hx/.N.Of "n|#i#i `Tx"nlfH"n|){go"np")o S"n@fBlo*@R& ֍ L.x"[I"n|(*)d .xl$x L(//.NPJf^/.t/.x//.a $@OJg *$f* *$%@$/./ apPJg *$@ %@$/ a>X "npmJ/.D/.N*@PJg -$ f`X/.t/.x/.D/.a ,*@OJg8| -$f( -$+@$Bd/.t/./ a.O f nxh"n )d -@<"n|$&)"n () "[Io-Co"npJo"n|()ft){fl/.tHx /,$/.ab$@OJgN *$f8(*,%Dl%Ep *$%@$/./ a PJg *$@ %@$/ aX8|`"n/)lHzNPJ`xg Hzar&nhJfBg HzaVxlgp`0,zg@9@z ,t`&n`+g+f/// / a>O .dx&g~,{g BXHx//Hx/ a$Of(.ggNBX-|-MG-K-G-F 9 mLHn p N$Xf(*,&nh'D'E &nh$+&+ Jjp`&nh"+BցՀ&n` +"+dp`&nhJgJg@&F k ("(l,Hx/a-p`` *$@%@$/ a `F&n`-kl`JXo0/ aX&n`+gA-d ho mH h>((m,{ftA&//Hx/ -HPN$O nP gJfz ,",(,*, f,{grHx//Hx/ a<$Of@)l)l ,{gBz&nhf6x-DHnHn// / a-$OJg/-Ha\`R'".l[I//&nh/+ /+aRO .lS -@T .lT-kXXd-@X .llx L-A\//.l/.\/ a$@OJg".X[Iz`f&GRS%G`lz&nh$+&+ ցՀ ",d()C/// aO *XoNTm nTXTl:%F -|`xCx#J jP 9` hL/ p NXxfHp`&n`+gA-d ho mH h>((m ,{fA&//Hx/ -HPN$O nP gJfV ,",(,*, f,{g4/ aRHx//Hx/ a$Of)l)l `/.h/.X*.Tڪ*gRBHx/// G NOJfF/B/ ahO Jf 9Ѐ/B/// NOJg`B`BB/// aXLN^NunfsvinvalNVH><*n,. *.(.&.$m mH&h>+fBJg8|$9Ԃ`BB`<A5Az/HzHxHjzaEOJgJg/B/ ahO Jff0*z2f@5@zB/ //// I`NJg>/B/ agO Jg*0*z2A5AzgA5AzHjzaJp`>/B//// NOJf0*z2A5AzgA5AzHjzaIBL<|N^NunfsaioNVH8<&n(n BBJ>f(`K*g&<BC"JfRxlJfhJo0|Jg`V5|/HzZx/HjaDFOJg*/+ B/ afO Jf f B$9ԂJgn0j 9>Ѐo +$gx\f*g&RT'L\` +$'@$x`f gRT'L`B'j j G%KRjB`p`pL<N^NuProcess killed due to text file modification nfs_doio: type %x unexpected NVH?<$n"n B-jP(n-l lH-h>K-MI*x-D-D-n *$g *0-@-@-j<"*H <&L<-B-C *$gBR'/ / /.a6`z-E-ER'HnHn/ /./.a&&@O`f *$gt *0-@-@-j((l ,",(,*, ff(n lH*l\0gHznaHx /.a#h(nRO `BBR'/ /./.a&@O `R'(*l**p-D-E(n,g8/ /./.-Iā&@O "n'f*n-f/ /./.ax&@O Jf@(n(,*, %Dl%EpBd*j0%Mh`(n/,lHza&PJgR *$@%@$%K(`>$*T *X-@-@"*H <L-A-D"[I(.*.ځـ-D-EԪ<-Bz-ER' *$xfB`z-E *$%@$HnHn/ /./.a"&@OJfJf *$x` *$z%@$ *$%@$xgJfD *$gX *$zF%@$ *$g/./ aP`8Jg4 *$@%@$`& *$@%@$(n)Kt%K(lzBXBT*n%m4Jg(n/,HaX/ a" L0*.,. $nv*gv(TGװ`SJo^/Hx//</N$Of/a//aR-@O gBHnHx//</aԴ$OrKgJg/HzLa`rgj nr lv h$fpf%h *r@mZP`r %Ap$"n o// a? @-HPfpH`: h Xrf P/*//*aO `p `tH/.a5 L |N^Nunfs_boot: SIFFLAGS, error=%d revarp failed, error=%d nfs_boot: client_addr=0x%x (RARP from 0x%x) nfs_boot: set ifaddr, error=%d nfs_boot: bootparam whoami, error=%d nfs_boot: server_addr=0x%x nfs_boot: hostname=%s rootnfs_boot: bootparam get root: %d NVH8<*n&. &UHx// (< DN$O g/Hza` +4 g f*HnHn/ an$O g/HzaP`+n/./.HzI4NBB/.// a$O g/HzNP`EBBBB|r-AHnHn/ a$O g/Hz`2/.HzNHyxHzNHmHz/ a0$Og6/HzNPJg(/.// aRO JgB// DN/ a L<N^Nunfs_boot: bootparam_whoami: bad reply NVH 0&n$. HxBa/-@ @$hr!A $r%A%A/a"@ n %i 7|oBHnHnHxHx/</ a$@O$Jf nr eHx/a<(-@P @Jg h4(Hx/.a;< n h7B'h# Hy Hyx/.GHN-@Og8#F HyF HyV/N-@O g/./al-@PfHza4|HX .g /a1X .g/a1 L N^Nunfs_boot: getfile name too long nfs_boot: bootparam_getfile: bad reply NVH <$. &n/9 HyxE@N-@Pg/a://N n O fp `BHnHxHx/</.a4OJfKXrY-AHn/ /.IHN-@O gHn/a8-@PgvrY-AHnE/ /N-@O gXAHBBLBPBT|!n(nR nC rZdHz`:/ / HsYaNO ` HzaX/.a0BL<N^Nunfs_hashlocknfsnodeplnfsvaplNV/ HyDHBHx/9a#pBBHzHxHyKaӤO .HyHyhBHzBBBHxHysE*NO$.HyHyhBHzmBBBHxdHyF\N$nN^NuNV/ "n $nBȳo BЁRn$_N^NuNVH><(n&. $.(.//aDH ypG P$SJgH jLHf60jxf.//*D/aO JfHx/*LaPJf` $j,JfBHx"HyKK.NO JfHn/9Rh/ HxaD$@OJg"DBBHxHyKN `(nHxHys*<"EN$@HxB/ ,<$"FNO )J%LLP %@,g SC,!I0&%K0r@lBHxJ/a%@DO `C|%ID///*DaO 5Bxr%AHxHyF\"EN%@HHxdB/"FNPOBHxHyKN"D"BL<|N^Nunfs_inactive: pushing activenfs_inactive: lost vnodeNVH<(n$l l*hJgJ4g/HzalP lrlg &m(B(`Jg lJ4oHx/ /B/a6OE6`>B/aPJg Hz[aHx/ /B/,a/,E6NO/ aN/a|/+NHx/ a*Omz l-|-HB 9 hLHn p NBL<N^Nunfs_reclaim: pushing activeNVH8 n(h$l lH&h>JgJ4g/ Hza4P j,Jg!j00 j0 ,+g6 j4Jg. f'j8`!j88 j8f 4`!j44rlf$J(gHx/ aHxI/*(aO j@xoHxJ/*DaP/*HHyF\EN/ a/,HysNBBLN^NuNqnfs server, too many leases nqsrvnumlnfs_nqlease.c: Phoney lppNVlH?<*n..,.˙$-l Srd rBf 93 n d -|l-MpC-It-n(x-n| 9$mLHnl$r N$Xf$n$ n"n$%IB@F! -t*.rʁfR(Jf$mH j^"jb-H-I$jHn/ $j(N$Pg gB@F`a `: .V y6G $SJgBv֎"n f(".$f4. BHhHj(/aO Jg$RJf` %M8+Jt`$@Jg*f JfHj//aO Jf0*.gfJfHj//K:NO JfB *g (@X&@v`GB`6,g./ //NO JfRr fB g(@X&@`PJf/ a%*XJf,BHx0HxTaذ&HxTB/a*O (SXO /// a/ a%2O`.@5@/ a$/.(/// / a/ a */ a%O Jf n // aP*g"n B`r n .gj g B@F`Va`L gB@F`aJf.I(tԎ"T3o2HzaXXE8BHzHxHy-,NO"3nBHx/Hx MLENmbuf siz=%d Bad nfs svc replyNVH?< n K-hv-CB-g,/ /./.aO JgU`20@fg89SxB@$@2A@oFHxHy&anf&@P f^aJg\69SxB@$@2A@oFRy#V f a7|BBI'LBk` B@F`B@F`HxBa&@P kv'C |!m1m y&X`"J-l &m yp` m(3gԗ,(g(F8T-L(F l CqI-LtԎ( gz4ڭ`BHnHx HxBN-@$@Hx@B/.ajO (n lH&(^((b(n()D h//. h(NO(n,g ,Ь(",Ҭ vd `(n",Ҭ v҃ xe69SxB@$@2A@oFHxHy&al$@P f^a Jg\89SxB@$@2A@oFRy#R f a 5|BBI%LBj` B@F`B@F`HxBa$@P(n(B -j nv ת I -Lv (nX "n "nBJg ԩ "QJf S c/Hza{HzawHnHn//.BBBHxHxHxHx/.a\\"@O0vfr0)f4g")pЁxm`")pЁvl Y#AX `BHx/ a!x"@O Jg )gX i )Y -f m(3gJg&(E g/ a >`0B@F`v@(E(B/ / /a#2OJg /aA X-g69SxB@$@2A@oF2kA#PSp0+Egd k0g!k44 k4!k00`@g/+Hy|PN`* k Jg/+$/+(/+NO `/+,/+a@PkB(/ Hy&NP fa 2RfJg Bx -D*nX(n-T`PvfL9SxB@$@2A@oFHxHy&ab$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@P n4 -J4B -j8 J"n8~ߨ K-M8" "\",#n0 n4(g (Ш("(Ҩ ~Sl`"(Ҩ ~҇ ~Sm>9SxB@$@2A@oFHxHy&aaj$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@P n4 -J4B -j8 J .8~Tߨ ހ-G8/Hn/ a} LBXJg*Og|HfB`(<:nJg n (Ш ".|df "AK-M`$Hn/HxHnHna_nOJfR"nA& *OfR n (Ш ".|e4/HxHnHnabOJg/*DN`(J`bR~`X-A/*DN + V y6$p XJg2, f$*k$fHxHj(Hk a*O Jg$RJfJghvBE&lx*g2/ /./aO JfpRfJgv BE&S`PJf0,gJg@9@HlapLR(,HnHx$Hx/ aJ&@-K"l0ix V|&XO$K K+g +Ы("+ҫ l`b"+ҫ |҆ mL*g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a]&$@P f^a|Jg\<9SxB@$@2A@oFRy#R f aF5|BBK%MBj` B@F`B@F`HxBa d$@P|ld Hzah n -JB -j J"nר K8-M l0hx"B< l:hx/ /(D/ aO `,2ix/ l/(DHnHna_p&Og$/ ` n(g (Ш("(Ҩ |l`"(Ҩ |҆ |m<9SxB@$@2A@oFHxHy&a[$@P f^aJg\<9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa $@P n -JB -j J"nP K-M"*D".<-d*G&HnHnHn/./.Hx/ / a$O gl$l n (Ш ".|lf "AK-M`$Hn/HxHnHnaZOJfJ"n Y֙*G l> B////// /a b-LBHnHnHnafhO,Jg $`$</.a L<,.B*F mH(h>R(0HnHxDHx/aF&@-K$m0jx Vz&XO K"K+g +Ы("+ҫ l`d"+ҫ z҅ mN(g )Щ(")ҩ m`")ҩ z҅ l:9SxB@$@2A@oFHxHy&aY$@P f^ahJg\:9SxB@$@2A@oFRy#R f a25|BBK%MBj` B@F`B@F`HxBaP$@Pzld Hznadp n -JB -j"J nש K8-M*F"m2ix B<"m:ix/ /)D/aO `.:jx/ /*DHnHna[^&Og(/ a |`$KBJg Ъ $RJfHnHn// BBBHxHxHx//. aH$@O0zTfr0*f4g"*pЁzm`"*pЁzl Y%AX `BHx/ a $@O Jg *gX j *Y B-L,_gBHla-PHn/ /,`/,PaO,_g Hla-t L<|N^NuNVH><*n&n E4%K,%n0%n@BHn/ a.$O f^ j0-H"*@-AzDg/ a p`8v֎|*Og (Ш zlf "AI-L`2Hn0/HxHnHnaVVOJg$/ a `"n0,f CBBBBBBB`XzgRtH%BTHn,Hn(BHn BHxHB/ BaO$Jg / a PXJg*OgzHfB`f(<:nJg n (Ш ".zdf "AI-L`$Hn0/HxHnHnaUOJfT"n0 CX(C( *OfF n (Ш ".ze(/HxHnHnaX(OJg$/ (DN`X-A/ (DNHnHx//-aV$Og `$4`L"n )L")4gdBhiz IgRG$Kf+h8`(A)i88 n"h8g#h44"n#m4#J8f+I` S!I8+n/aš L<|N^Nucld kerbnqnfstimrNVH?<(n$.,.g",  f g Hza_Jmd*n - nN*-nD//,/-E NO Jf*/-/,/-NO Jf)m)m )m`l `A )AlHla VX` pQ`lB`zgzfBHx/,azO Jfn/B/,aLO JgX*F-$FEg/a:XS-` <&$28Jg/aXSzr ` %8B`x,g( J_f2 lPJg*JBg$-|-LBBHnaX$,$l`&jL&+D"*h 9-doHx/ aPJfb)K$<6DfD j4f)j8`!j88 j8gr!j44B4*{gJl^A&<zlfB/ -Ha[P n/ NB//. Hx/ *CNjz/. / aO `*D*4`zlf-|T-K-n -E-F 9T kLHn p NXjz`hW 9-do0*z@` @@fXJdgRHx/ aPJf@)K$<6Df$//. Hx/ aOJf %j%j / *BNBX ,$,g$@gg\  f2*n+lHx/./ a{O Jg. ,@)@$fF  g4 9$L<,UUUVЀ/Hz)HxHlaz.O$,g"lE@JgB$ iJg!i i  QJg!i`)i i Hx3/ NP"BJfHx/ Nz#BL)g i g רh h4f$/ NX$BfL N^NunqlcNV/ $n`A5ABHzHx/ aO0*2f@@5@$nN^NuNV n0(2A1Ag/adN^Nubuild > MLENNV H?<&n,+, k0-H<*+8"+@-A@. Kt+Og (Ш xlf $AI-L@`&HnD/HxHn@Hn n (Ш ".ܐxe /HxHnHnaDOJg `X-AK-M/ a XJgB n (Ш ".ܐxlf "AK-M`&Hn/HxHnHnaADOJf@"n"Q|$f\ n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna@OJf"n(-D n (Ш ".ܐzlf "AK-M`&Hn/HxHnHna@OJf"n"Q|$fT n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna@4OJf0"n-Q n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna?OJf"n"Q|$fT n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna?OJf"n-Q n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna?2OJf."n"Q|$f` n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna>OJf"n B-@-A n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna>xOJft"n xgdzf n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna>OJf"n-Q-i`$A-d-PA-h P 눐A -@ n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna=OJf"n xgdzf n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna=8OJf4"n-Q-i`$A-d-PA-h P 눐A -@ n (Ш ".ܐxlf "AK-M`&Hn/HxHnHna9SxB@$@2A@oFHxHy&a/$@P f^a"Jg\<9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa $@P n4 -J4B -j8 J"n8| ݨ K -M8|"*n "" K"""""`. n4(g (Ш("(Ҩ |l`"(Ҩ ~҇ |m>9SxB@$@2A@oFHxHy&a.$@P f^aJg\<9SxB@$@2A@oFRy#R f aθ5|BBK%MBj` B@F`B@F`HxBa$@P n4 -J4B -j8 J .8| ݨ ~ ހ-G8Hx /. /apO Jg0Hn8Hn4HnB/ ExNHn8Hn4Hnh/./ N`( n4(g (Ш("(Ҩ |Cl`"(Ҩ ~҇ |Cm>9SxB@$@2A@oFHxHy&a-8$@P f^a͎Jg\<9SxB@$@2A@oFRy#R f aX5|BBK%MBj` B@F`B@F`HxBav$@P n4 -J4B -j8 J .8|Dݨ ~Dހ-G8/Hn/ aI\ L n (Ш ". |e /HxHn Hna&hOJg `X-A Jgb n (Ш ". |lf (AC-I `&Hn$/HxHn Hna#OJf(n$-TB,,`V n (Ш ". |lf (AC-I `$Hn$/HxHn Hna"OJfV(n$-TB n (Ш ". |lf (AC-I `2Hn$/HxHn Hna"ZOJg&@/a׮` 6(n$-|N-T-OgJ n (Ш ".xe /HxHnHna2OJg `X-AJgn n (Ш ".xlf "AK-M`$Hn/HxHnHnaOJfn"nIN-QtBx()xC -Y`n n (Ш ".xlf "AK-M`2Hn/HxHnHnanOJg&/ a`"nINX-QxBtP.BJolv JJgd-np-n|pf"B$(".| ( !@ o Joԁ!BJgB ` "( ol !@ vJoR PJf bov'CT+Of"HnHn/.Hn/.Hx/. / B`"HnHn/.Hn/.Hx/. / HxNO$Jg / aXJg+OgxHgHnHnHnHxHn8Hx`>Bx`ȫL/Hn/./. /.HnHx/.a2&O$g'CT+Of HnHn/.Hn/.//. / B` HnHn/.Hn/.//. / HxNO$Jg / aXJg+OgxHgHnHnHnHxHn8Hx`vJg> n-|-HK8-M-n-n 9 hLHn p N-@X n (lxgvJfnv xfvJf`/.HnHn/+8/./. pLfp/Hk\/.a|O ./././.Hx/.a&Og/.a'CTXg(+Of HnHn/.Hn/.//. / B`0HnHn/.Hn/.//. / (.D-DxxȮ/NO$Jg / aǀXJg+Og`xHgXHnHnHnHxHn8/./ a)`4JoBHxT /awX$"B*n*+F JO JgJ o "#h P PJfpJgp,*n+Gx+D+DB+nt+nx n-|x-H-M-@-n 9x hLHn p N&XR(HxT/azZP n-|-HK-M-n-n 9 hLHn p N$.a~"XJf&'CTg(+Of HnHn/.Hn/.//. / B`BHnHn/.Hn/.//. / .DxrLҀJgr`Ҁ JgP/NO$Jg / aŸXJg+OgxHgJg`HnHnHn/Hn8/./ a'OJf` n(g (Ш("(Ҩ xl`"(Ҩ x҄ xm89SxB@$@2A@oFHxHy&a$@P f^aJg\89SxB@$@2A@oFRy#R f a5|BBK%MBj`B@F`B@F`HxBa$@ n -JB -j J"nx٨ K-M"JfB`x"""`& n(g (Ш("(Ҩ xCl`"(Ҩ x҄ xCm89SxB@$@2A@oFHxHy&aR$@P f^aJg\89SxB@$@2A@oFRy#R f ar5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J .xD٨ ؀-D/Hn/ a*x L n (Ш ".ze /HxHnHnabOJg `X-AJgh n (Ш ".|lf AG-K`$Hn/HxHnHna OJfh n B+@+A A +XH`j n (Ш ".zlf AG-K`4Hn/HxHnHna OJg/.aX` nX+P BP&+CP"[I*-,- ܁ۀ+E+FxB"nJgR n..f B$i" ) #@ o Jo#JJgB `") ԁl #A x"QJf bo/.aL|+FTX.<NJf"HnHnHnHn/.Hx/. / B`"HnHnHnHn/.Hx/. / Hx&GNO$Jg$HnHnHnHxHn8Hx/ a!BO+n4B,BBB@F!B&n kH$HJg$&- "*d -J$j JfJg&&n + +@ g k G !K$&n'M z ` +H g&n kHG !K$&n 'MHzHڋ+E$J,gRpt&n C B$QJg8HxHjhHmh-IaLO "nJg-J$jJf`-J$jJg8 *"* *-,- l"HxHjhHmh-IaKO "nJgJg&n ++@g kG!K&n'Mzڋ+E`:$lr`&n«Lp`Lf HxLHlHkNO Jf / / aP(JJgP&n +"+*,,, m6HxHlhHkhKȀNO Jf` +@g QG!K"+I gB@F`B@F`aA-d L< B@-@-EA-h "[I$.&.ցՀB@F!&n (kH LJg>-l ",b*J4f.<NzHڮ -EEJg &n'l$$ l$ lJg!l l  gB@F`a-l,B,( zʬL-E|-F6|-KBz`ʬL/Hn/,8/. /HnHxHlhN&O$fdJg< n-|-HG8-K -D-n 9 hLHn p N-@X n (lzgvJfpv |fv`dBJf\/HnHn/,8/./. pLAE5fp/Hl\/.NO ./././Hx/.N&O4|JHg4|,z&n'E'EB*,,, 'E'F , '@g"nBAK@JgJ oR"QJf&n'BBHxT/N$ B&"nO JgJ o !i P"QJfJf< n-|x-H-n -J-D 9x hLHn p N&XR(HxT/NP/.aX nJgB-|-HG-K -D-n 9 hLHn p N-@.aqnX-LJg)CTJf HnHnHnHn/.//. / B` HnHnHnHn/.//. / Hxx&GNO$Jg HnHnHn/.Hn8/./ aO`BTHnHnHnHn/.B/. / .DzrLҀx؎Jgr`Ҁ JgP/&GNO$Jg^HnHn//.Hn8/./ a"nOK(<)g )Щ(")ҩ zl`")ҩ |҆ zm<9SxB@$@2A@oFHxHy&a$@P f^aJg\:9SxB@$@2A@oFRy#R f a5|BBG%KBj` B@F`B@F`HxBa$@P n -JB -j"J nz۩ G-K P&n H &D `,"nK)g )Щ(")ҩ zCl`")ҩ |҆ zCm<9SxB@$@2A@oFHxHy&a\$@P f^aJg\:9SxB@$@2A@oFRy#R f a|5|BBG%KBj` B@F`B@F`HxBa$@P n -JB -j"J .zD۩ |D܀-F/// NO )n4J,g Hza B@F!g.BB&n +H)@ g kHG !K$&n 'LH)n$&n(k(Jg l Jg!l$$ l$ gB@F`aJfB@F!&nBB&n +H&n'@ g&n kHz ڮ!E$&n 'nH&n'n$ f|`(nJf gB@F`a&n kHB@F!(HJg4J4g& l Jg!l$$ l$ &n&4&n&`(l Jf gB@F`aBL n$$(Ԩ .(ze /HxHn(Hn$a$$Og `X-@( n$$(Ԩ .(|lf "@G-K(`&Hn,/HxHn(Hn$a$Of"n,$ ov?JnvHJgT+CTINHn Hn/.Hn/. //. / BNO$Jg /aBXJg-OgzHg-G|-F-| Bz`ʭL//.HnHn(Hn$/./. //.G-K/ a &O, nJgLJg8-|0-H4G8-K8-G<-n@ 9 hLHn0 p N-@` /ahBXJg+CTIN-Of Hn Hn/.Hn/. //. / B`*Hn Hn/.Hn/. //. / *.D|x̅/NO$Jg /aXJg-OgzHgHn HnHnHxHn8/./ aO .gx/ah&`lG-K/ a\tXJg n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a$Of"n, zgmJg`|g`Jgv` n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a$Of"n,"Q|$f\ n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a$Of"n,*-E n$$(Ԩ .(|lf "@G-K(`&Hn,/HxHn(Hn$ah$Of^"n,"Q|$fT n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a$Of"n,-Q n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a$Of"n,"Q|$fT n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a`$OfV"n,-Q n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a $Of"n,"Q|$f` n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a$Of"n, B-@-A n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$aR$OfH"n, zgd|f n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a$Of"n,-Q-i`$A-d-PA-h P 눐A -@ n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$ar$Ofh"n, zgf|f n$$(Ԩ .(zlf "@G-K(`&Hn,/HxHn(Hn$a$Of"n,-Q-i`A-d-PA-h P 눐A -@`t n$$(Ԩ .(zlf @G-K(`&Hn,/HxHn(Hn$a$Of n,CDz-EJfB|-FIN` n$$(Ԩ .(zlf "@G -K(`2Hn,/Hx Hn(Hn$a $Og/a`X` r"n,INA-p fz-E,-F .ze|c*zg `&|g` ) zg,[I-E-F`$i JfN".|gzf/.aa/HnHn /-8/./. pLfp/Hm\/.a} nO(-|0-H4G-K8G-KX n-|$0-H4G-K8 9$ hLHn0 p NXJf .".z|gB/.,.//Hx/ a&Of/HnHn /-8/./. pLfp/Hm\/ ay$.&.O .aP-B-CX-| 0-J4-n8-G<-n@ 9 jLHn0 p N&XJg/ a[ L"n4"Q|$fV n,$h $.0|lf "BK-M0`(Hn4/ HxHn0Hn,a$@OJf"n4-Q n,$h $.0|lf "BK-M0`(Hn4/ HxHn0Hn,a$@OJf"n4"Q|$fb n,$h $.0|lf "BK-M0`(Hn4/ HxHn0Hn,a4$@OJf0"n4 B-@-A n,$h $.0|lf "BK-M0`(Hn4/ HxHn0Hn,a$@OJf"n4$|gf~f n,$h $.0|lf "BK-M0`(Hn4/ HxHn0Hn,ap$@OJfl"n4-Q-i`$A-d-PA-h P 눐A -@ n,$h $.0|lf "BK-M0`(Hn4/ HxHn0Hn,a$@OJf"n4$|gf~f n,$h $.0|lf "BK-M0`(Hn4/ HxHn0Hn,aތ$@OJf"n4-Q-i`$A-d-PA-h P 눐A -@|e~ n,$h $.0~lf "BK-M0`4Hn4/ HxHn0Hn,a$@OJg/aXX`"n4 $"| -@-|NJg~/.I6NHx /.aFv nO -|$8-H9SxB@$@2A@oFRy#R f ayD5|BBK%MBj` B@F`B@F`HxBab$@P n$ -J$B -j( J"n(|$ݨ K$-M("|$|"*n "" K"""""Hn(Hn$/B/aOHn(Hn$Hn/.Hn8/./aB` .g /aFRXJg/.aF@Hx /.aAOJf"nA& ,Of< n (Ш ".|e/HxHnHnaOJg`PX-A n (Ш ".|lf "AK-M`2Hn/HxHnHna՘OJg$/a`("n-|Nd$Qot?JntHJgN)BTHnHn/Hn/.x/// B*ndNO$Jg /aBXJg,Og|Hg-D|-F| -FB|`̬L//.Hn|HnHn/.t// / Hna^$O, n|JgHJhg8-|-HKT-M-D-n 9 hLHn p N-@p`/aBXJf*&n|lfB/aR$Pf+3gtJf/ a:/HnHnx/,8/./pLfp/t\Ԍ//.ENO$.HnHnx/,8/./pLfp/// N n .O$-|-H-@K-M 9 hLHn p N$`X n-|$-HK-M 9$ hLHn p NX .̷f/ aAXEN` /ENNX/ NX n|JgHJhgB-|-HK-M-D-n 9 hLHn p N-@l.|aA0X)BTg$,OfHnHn/Hn/.x/// B`&HnHn/Hn/.x/// .hD|x̀/*ndNO$Jg /aXJg,Og,|Hg&Jhg$HnHnHn/.lHnT/.p/ aBB` L< n$ (Ш ".(xe /HxHn(Hn$a~OJg `*X-A( n$ (Ш ".(xlf "AK-M(`&Hn,/HxHn(Hn$a.OJf"n,$Qot?JntHJgZ'BT-|NHn Hn/.Hn/.//. / B*nNO$Jg /a0BXJg+OgLxHgD*G-m-Gx-D-|Bx`ȫL//.HnHn(Hn$/./. / / HnIN$O, nJgJJg8-|L-HPK -MT-GX-n\ 9 hLHnL p N-@` /a=@BXJg'BT-|N+Of Hn Hn/.Hn/.//. / B`(Hn Hn/.Hn/.//. / DxFȅ/*nNO$Jg /aXJg+OgxHgHn HnHnHxHn /./ ENHn HnHnHxHnDHx/ NO8 .g/aHn HnHn/.Hn /./ ENHn HnHn/.HnD/./ NB` .g /a5X . g /a5xXJg/.xa5fHx /.a0bO JgV/.E6NHx /.a0> nO -|$0-H4K-M8 9$ hLHn0 p N.N/.N L n (Ш ".~e /HxHnHnaOJg `X-A4|+Og n (Ш ".~lf "AK-M`&Hn/HxHnHnaĔOJfx"n$QJf nBBBBBBB`\~gVtH'BTINHnHn/.Hn/.HxH// BNO$Jg /ayBXJg+Og~HgJg n (Ш ".~df "AK-M`&Hn/HxHnHnaOJf"n nX*n* +Of< n (Ш ".~e/HxHnHnajOJg`PX-A n (Ш ".~lf "AK-M`2Hn/HxHnHnaOJg$/axp`~"nIN$Qot?JntHJgL'BTHnHn/.Hn/./// BNO$Jg /axBXJg+Og~HgB~`ΫL/Hn/.//HnB/.a$O$g'BT+OfHnHn/.Hn/./// B`.HnHn/.Hn/./// D~XJg~xЇ/NO$Jg /awfXJg+Ogd~Hg\HnHnHnHx/ a@HnHnHnHxHnTHx` n~lfB/a?$Pf-D~-G~-GB~`ΫL//.HnHnHn/.// /.Hna$O, nJgJJg8-|-HKT-M-D-n 9 hLHn p N-@` /a/2BXJfJg t$n`$n n.(HHgtJf/HnHn/+8/./pLfp/t\ԋ//aKXO .HnHn/+8/./pLfp/// aK* n .O$-|-H-@K-M 9 hLHn p N$`V-|$-JK-M 9$ jLHn p NX .̰f /a.(`/a-6X .g /a.XE6Jg< n-|-HK-M-D-n 9 hLHn p N-@X nJg>-|-HK-M-D-n 9 hLHn p N-@.NX/.N'BTXg&+OfHnHn/.Hn/./// B`.HnHn/.Hn/./// D~XJg~xЇ/NO$Jg /atDXJg+OgB~Hg n (Ш ".ze /HxHnHnaOJg `"X-A n (Ш ".|lf "AK-M`&Hn/HxHnHnadOJf"n&Qot?JntHJgR)BTENHnHn/.Hn/./// BNO$Jg /aqnBXJg,Og zHg -n|-F-|Bz`ʬL//.HnHnHn/.// /.G/ a2$O, nJgLJg:-|-HK8-M -n$-n( 9 hLHn p N-@` /a)BXJfHnaXJg n (Ш ".zlf "AK-M`&Hn/HxHnHnaOJf`"n"Q|$f\ n (Ш ".zlf "AK-M`&Hn/HxHnHnaOJf"n*-E n (Ш ".|lf "AK-M`&Hn/HxHnHna>OJf"n"Q|$fT n (Ш ".zlf "AK-M`&Hn/HxHnHnaOJfP"n-Q n (Ш ".zlf "AK-M`&Hn/HxHnHnaOJf"n"Q|$fT n (Ш ".zlf "AK-M`&Hn/HxHnHna6OJf"n-Q n (Ш ".zlf "AK-M`&Hn/HxHnHnaOJfN"n"Q|$f` n (Ш ".zlf "AK-M`&Hn/HxHnHnaOJf"n B-@-A n (Ш ".zlf "AK-M`&Hn/HxHnHna(OJf"n zgd|f n (Ш ".zlf "AK-M`&Hn/HxHnHnaOJf4"n-Q-i`$A-d-PA-h P 눐A -@ n (Ш ".zlf "AK-M`&Hn/HxHnHnaHOJf"n zgd|f n (Ш ".zlf "AK-M`&Hn/HxHnHnaOJfT"n-Q-i`$A-d-PA-h P 눐A -@ n (Ш ".zlf "AK-M`&Hn/HxHnHnahOJf"n$Qo/aktHX`>BHxTHja-@-@A!J-J|BtBx-Hlz-Ep-EBBO JoHn/ HnlHnaOJfNJfh n (Ш ".|lf AK -M`4Hn/Hx HnHnaOJg$/ajX`z nB0(-@*.B2XJgr/.E6NHx /.a~ nO -|$-HK-M 9$ hLHn p NX .f/N`/a"B.NtX`p/.HnHn/,8/./pLfp/Hl\/.a?v nO$-|-HK-MK-M K-M-n 9 hLHn p N$Xg/.a"X`JgB .@z-E-n-n/ a $XfHx@B/.a8O n hH$n*(^,(b$$"n iH h/ / h(N$Pf< n-|-HK-M-n -n 9 hLHn p N$X/.a ` /.a!XHx /.aPENJgHxT/.aP nJgD-|-HK-M-n -n 9 hLHn p N-@.a!HX)BTg&,OfHnHn/.Hn/./// B`4HnHn/.Hn/./// p JgpJgzXЅJg|xІ/NO$Jg /ah XJg,OgzHgJgJfZ n&nXv֎(g (Ш("(Ҩ |#d`"(Ҩ z҅ |#e:9SxB@$@2A@oFHxHy&a$@P f^aRLJg\<9SxB@$@2A@oFRy#R f aR5|BBK%MBj` B@F`B@F`HxBaa4$@P n -JB -j J"nz$ۨ K$-M"|$z"*n"" K"""""HnHn/B/ a˞OHnHnHn/.Hn8/./ aB`Jg/.a"Hx /.aO .g /aX n-|$-HK-M 9$ hLHn p NX .f /a`/aX .g /aXJgHxT/.a L n,$(Ԩ .0|e /HxHn0Hn,a$Og `X-@0 n,$(Ԩ .0~lf "@I-L0`&Hn4/HxHn0Hn,aL$Of"n4$ ov?JnvHJgT+CTGNHn(Hn$/.Hn/.//. / BNO$Jg /acTBXJg-Og |Hg -n~-G|-FB~`έL//.HnHn0Hn,/ /. //.Hna&O, nJgLJg:-|8-H9SxB@$@2A@oFRy#R f aD5|BBI%LBj` B@F`B@F`HxBaS$@P n$ -J$B -j( J"n(|$ݨ I$-L("|$|"(n"" K"""""Hn(Hn$/.B/ a8OHn(Hn$Hn/.Hn8/. / a`T n$(g (Ш("(Ҩ |l`"(Ҩ ~҇ |m>9SxB@$@2A@oFHxHy&a$@P f^aCtJg\<9SxB@$@2A@oFRy#R f aC>5|BBI%LBj` B@F`B@F`HxBaR\$@P n$ -J$B -j( J .(| ݨ ~ ހ-G(Hx /./aO n$(g (Ш("(Ҩ |Cl`"(Ҩ ~҇ |Cm>9SxB@$@2A@oFHxHy&a$@P f^aBHJg\<9SxB@$@2A@oFRy#R f aB5|BBI%LBj` B@F`B@F`HxBaQ0$@P n$ -J$B -j( J .(|Dݨ ~Dހ-G(//./ aB`l .g /ajX n-|$8-HBXJg+Og~HgJg n (Ш ".~df "AK-M`&Hn/HxHnHnavOJf"nA( +Of< n (Ш ".~e/HxHnHnaOJg`PX-A n (Ш ".~lf "AK-M`2Hn/HxHnHnaOJg$/aT$`"n-|Nd$Qot?JntHJgN'BTHnHn/Hn/.x/// B*ndNO$Jg /aSBXJg+Ogh~Hg`-nh~-G~ -GB~`ΫL//.Hn|HnHn/.t// / Hna$O, n|JgLJg:-|-HK-M-nh-n 9 hLHn p N-@p` /a B|XJg'BT+OfHnHn/Hn/.x/// B`"HnHn/Hn/.x/// D~x΄/*ndNO$Jg /aRXJg+OgP~HgHHnHnHn8HxHn/.p/ aO .|g/a ,`(n~lg t n` nĹft`,3gtJf/.hHnHnx/+8/./pLfp/t\ԋ//ENO .hHnHnx/+8/./pLfp/// N n .O$-|t-H-@K-M 9t hLHn p N$`V-|$-HK-M 9$ hLHn p NX .İf/a XEN` /ENNX/ NX n|JgD-|-HK8-M-nh-n 9 hLHn p N-@l.|a X'BTg$+OfHnHn/Hn/.x/// B`$HnHn/Hn/.x/// D~x΀/*ndNO$Jg /aPXJg+Og*~Hg$Jg$HnHnHn8/.lHn/.p/ aB` L< n (Ш ".ze /HxHnHna(OJg `X-AJgd n (Ш ".zlf $zڂ-E`$Hn/HxHnHnaOJfd$.IN"B Bzԅ`l n (Ш ".zlf $"BP-I`2Hn/HxHnHnanOJg./aM`$.IN*BX"[I-@-A"B-Q$.B +Lg(<J/.a'GTXg+OfHnHn/.Hn/./// B` n-|(-H,B0 9 hLHn( p NBHxT/a-@O EC-IK-MC-I-n%D-J$@P n -JB -j J$.P *BP-M"B"#n$n, &n*g *Ъ("*Ҫ & ր`B` "*Ҫ K & *.d ".o "nJg p )g fB) Vz-@"nC-IJgP*nnC-Ib~If * ۪ :9SxB@$@2A@oFHxHy&N$@P f^a.Jg\:9SxB@$@2A@oFRy#R f a-5|BBC%IBj` B@F`B@F`HxBa<$@P:9SxB@$@2A@oFHxHy|PN%@PfBa>fHxHy|PN%@O gB@F`a-, *g"%@j %|(B B$%J4%J02*g *(` plgpd%@ "F", &j& ֪ &|$Jgb~If * ۪ :9SxB@$@2A@oFHxHy&N$@P f^a,pJg\:9SxB@$@2A@oFRy#R f a,:5|BBC%IBj` B@F`B@F`HxBa;X$@P:9SxB@$@2A@oFHxHy|PN%@PfBa9SxB@$@2A@oFHxHy&aw$@P f^alJg\<9SxB@$@2A@oFRy#R f a65|BBC%IBj` B@F`B@F`HxBa&T$@P n -JB -j J$.|ݨ ~ނ-G"B"#nP"BX"W"B"|$HxT/.E@NHxT/.N`6-nخ-D-n-A,.иcT .o@B"nJg )f."n2)Ӯ-nP,S-F..ؾdSJn"nسdJf(.`2|h-I|h-F"n#BTg&)OfHnHn/ Hn/.//. / B` HnHn/ Hn/.//. /./.NO$Jg /a*XJg"n)Og6|Hg.HnHnHnT//.a nO(g (Ш("(Ҩ ~l`"(Ҩ |҆ ~m<9SxB@$@2A@oFHxHy&at$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBC%IBj` B@F`B@F`HxBa#$@P n -JB -j J$.P ,P-F"B"#n&n* (n+g +Ы("+ҫ $ Ԁ`"+ҫ C $ ,.ؼd &K#RJo "nJg )g B),V-F~Ϯ$n jH hHn//*H h NO Jf nBBBBBBB$n jH,(^.(b"n"#G jH hHi/ h(NPENJf< n-|$-H(-n,-n0-n4 9 hLHn$ p NXJg /.NX` /.N"nA8 "nCt-I"nC8 ѮX"nijn ,.oB` Hn/./.a.~-G-y|$-n"n-Q|-iO C|-IbzEf , ݫ >9SxB@$@2A@oFHxHy&N&@P fZa4JgX<9SxB@$@2A@oFRU f a7|BBC'IBk` B@F`B@F`HxBa! &@P<9SxB@$@2A@oFHxHy|PN'@PfBa"HxHy|PN'@O gB@F`ad +g"'@k '|(B B$'K4'K02+g +(` plgpd'@ "E"* (k$ ԫ (|$bzEf , ݫ >9SxB@$@2A@oFHxHy&N&@P fZaJgX<9SxB@$@2A@oFRU f a~7|BBC'IBk` B@F`B@F`HxBa&@P<9SxB@$@2A@oFHxHy|PN'@PfBa!HxHy|PN'@O gB@F`a +g"'@k '|(B B$'K4'K02+g +(` plgpd'@ "E"* (k$ ԫ BbzEf , ݫ >9SxB@$@2A@oFHxHy&N&@P fZa0JgX<9SxB@$@2A@oFRU f a7|BBC'IBk` B@F`B@F`HxBa&@P<9SxB@$@2A@oFHxHy|PN'@PfBaHxHy|PN'@O gB@F`a` +g"'@k '|(B B$'K4'K02+g +(` plgpd'@ "E"* (k$ ԫ "n(ѴbzEf , ݫ >9SxB@$@2A@oFHxHy&N&@P fZa JgX<9SxB@$@2A@oFRU f a z7|BBC'IBk` B@F`B@F`HxBa&@P<9SxB@$@2A@oFHxHy|PN'@PfBaHxHy|PN'@O gB@F`a +g"'@k '|(B B$'K4'K02+g +(` plgpd'@ "E"* (k$ ԫ ((.PJobzEf , ݫ >9SxB@$@2A@oFHxHy&N&@P fZa JgX<9SxB@$@2A@oFRU f a 7|BBC'IBk` B@F`B@F`HxBa &@P<9SxB@$@2A@oFHxHy|PN'@PfBaHxHy|PN'@O gB@F`a P +g"'@k '|(B B$'K4'K00+g"+(` rlgrd'A "E"* (k$ ԫ Ѓ$Cd$B/ // aO ʖJo؊`XBl BRmv{F(.bzEf , ݫ >9SxB@$@2A@oFHxHy&N&@P fZa \JgX<9SxB@$@2A@oFRU f a *7|BBC'IBk` B@F`B@F`HxBaH&@P<9SxB@$@2A@oFHxHy|PN'@PfBaHxHy|PN'@O gB@F`a +g"'@k '|(B B$'K4'K00+g"+(` rlgrd'A "E"* (k$ ԫ Ѓ$Cd$B/ // aXO ʖJo؊`X"nB0)Ѯ-nPS,.ؼe/.aֲXb~Ef . ߫ <9SxB@$@2A@oFHxHy&N&@P f^a~Jg\>9SxB@$@2A@oFRy#R f aH7|BBC'IBk` B@F`B@F`HxBaf&@P<9SxB@$@2A@oFHxHy|PN'@PfBaHxHy|PN'@O gB@F`a +g"'@k '|(B B$'K4'K02+g +(` plgpd'@ "E"* (k$ ԫ (WԴb|Ef , ݫ >9SxB@$@2A@oFHxHy&N&@P f^aJg\<9SxB@$@2A@oFRy#R f a7|BBC'IBk` B@F`B@F`HxBa&@P<9SxB@$@2A@oFHxHy|PN'@PfBa\HxHy|PN'@O gB@F`a" +g"'@k '|(B B$'K4'K02+g +(` plgpd'@ "E"(k$ ԫ Jg(|$`(WXgc'L ` , ݫ HxT/.E@NHxT/.N .L9SxB@$@2A@oFHxHy&a[$@P f^a"Jg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj`B@F`B@F`HxBa $@ n4 -J4B -j8"J n8 ) ~Jg~4ހ#G ~Jg~4߮8Jgl + (L+L !D +(L+L!C!D +(L+L!C!D(+[I!C!D(+[I"B!A !D$!A(!D,B0` @!k!k !k !k L9SxB@$@2A@oFHxHy&aQ,$@P f^aJg\>9SxB@$@2A@oFRy#R f aL5|BBK%MBj`B@F`B@F`HxBaj$@ n$ -J$B -j("J n(~ߩ K-M( !n !n!n !yW!y|$ L<(.*. "DBP i`&h/)X/)TEP/ B+/a&Of(R l 0h "D#H\ +fJil<9SxB@$@2A@oFHxHy&aM$@P f^a8Jg\<9SxB@$@2A@oFRy#V f a5|BBC%IBj` B@F`B@F`HxBa $@P&j|%F |B4<7BKN` SB Bc7B/ / N&P|0g/ aXJf"DJ)l)_gv9`"D/)`/ a&PfB@F!,gxJl8fx 9Ѐ/Hz0HxHl6aO,gBHxHx@aj&@'L'n'B<'n4B$n O Jg Ҫ $RJf-A(<:nBB,gztԎ|-F4|BnJf"Hx/HnHn/./ ayOJghHnHn/HnHn/./ / aw&O g@Hx/ a\/. "DN`4|"n2) H ,mpЁ`|І-@HnHn/./. //./././ /.//.a-$@O0 .-n,.-FJgHxT/aP|Tfr0*f4g"*pЁ|m`"*pЁ|l Y%AX `BHx/ a$@O Jg *gX j *Y 'J'n ,g'lh(`|e'F(B,B8,<48"nJho|'F$`B$B R(B@F!B'y_ y_ #_*9-dJPg|Tf,f "ll gB@F`a۾,_g/ Hla&PJfzB/<;B/+a/ //,`/,Pa&O ,_g HlazXJf:+'f.|$` gB@F`a4|'F8Jg| f / a(&XB@F! SJg!k`#_ k gB@F`a +$g|̀'F$Jf"+'gHz<"lC/ /+,g45f,Jf"2|-I nB/ "DN/+"DNP`vP`v / "DN`: ",g.|f(/ HnHnHn//./ av&Of`LJoH n (Ш $.ҐV|†o&//HnHna<OJg&/ "DN`ԁ-B n (Ш ".Ґ|lf AC-I`0Hn/HxHnHna8OJg &/ "DN`\ nJfJ n (Ш ".Ґ|lf AC-I`0Hn/HxHnHna8VOJg &/ "DN` n$g&  gt 'fl/ "DNB 9-d$nX 9-d$劵o&K-dBHzHxHy-,aO nA4,.L0h(-F|mR`|Ff/.aiX  g "n""n ""n$"&` MLENNVH?<&.,. *.>9SxB@$@2A@oFHxHy&(<"DN*@P f`aJg^>9SxB@$@2A@oFRy#R f"a;|BBC+I;|` B@F`B@F`HxBa*@P&M~և4m>9SxB@$@2A@oFHxHy|P"DN'@PfBafHxHy|P"DN'@O gB@F`a* -g.+@m +|(B B$+M4+M0` .9_߫$m~+G v֊"F$X$ (~Igg0$ g$5.$Y Y`6$4~`$"F)Og$) L<= 爐"AC n(p,LJg^.,"Ff* )9SxB@$@2A@oFHxHy&"DN$@P f^aӔJg\>9SxB@$@2A@oFRy#R f a^5|BBC%IBj` B@F`B@F`HxBa|$@P*&JB &+$C~ ߫ և$$`BB~Jg m ~HgJ`N~Kg~Lg0`<~$`\~$+g +Ы($+ "+҂~l`$+ "+҂~҇ ~m>9SxB@$@2A@oFHxHy&"DN$@P f^aPJg\>9SxB@$@2A@oFRy#R f a5|BBC%IBj` B@F`B@F`HxBa8$@P&&JB &+B$CP'B P"F)Og ~$$`>~$~$`2~$`*B g+g +Ы($+ "+҂~l`$+ "+҂~҇ ~m>9SxB@$@2A@oFHxHy&"DN$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBC%IBj` B@F`B@F`HxBa$@P&&JB &+B$CX'B XJg//aQ$P`B"F )Lg@Jf:Cg,+g +Ы($+ "+҂~l`$+ "+҂~҇ ~m>9SxB@$@2A@oFHxHy&"DN$@P f^aJg\>9SxB@$@2A@oFRy#R f aϨ5|BBC%IBj`B@F`B@F`HxBa$@&&JB &+B$C~ނ'G ~և~"FΩL$$$\"n$%i`+g +Ы($+ "+҂~l`$+ "+҂~҇ ~m>9SxB@$@2A@oFHxHy&"DN$@P f^aδJg\>9SxB@$@2A@oFRy#R f a~5|BBC%IBj`B@F`B@F`HxBaݜ$@&&JB &+B$CX'B XBJ g"n " n$ n( Jg gR(BL n$h $.ؕ T"割nf &Bҋ-A`(Hn/ /HnHna%>$@OJf&nBoA|m `XXRn|m9C`9| lo2l/ HlaF MLENNVH<<*n&. :9SxB@$@2A@oFHxHy&IN&@P f^aJg\:9SxB@$@2A@oFRy#R f a7|BBC'IBk` B@F`B@F`HxBa&@P c:9SxB@$@2A@oFHxHy|PN'@PfBanHxHy|PN'@O gB@F`a4 +g"'@k '|(B B$'K4'K0B $kJgn mH((>"D)gZA-d*m "-hlJ-{m@A3&0<`$ VlA3 0<g&-{gv`BJg +g +Ы($+ " ҂zl`$+ C(" zm:9SxB@$@2A@oFHxHy&N$@P f^a"Jg\:9SxB@$@2A@oFRy#R f a5|BBC%IBj`B@F`B@F`HxBa $@&&JB $kB JP'B P "D `+g +Ы($+ " ҂zl`$+ C(" zm:9SxB@$@2A@oFHxHy&N$@P f^aJg\:9SxB@$@2A@oFRy#R f a5|BBC%IBj`B@F`B@F`HxBa$@&&JB $kB JX'B XB n L<9SxB@$@2A@oFHxHy&KN&@P f`aJg^>9SxB@$@2A@oFRy#R f"a7|BBC'I7|` B@F`B@F`HxBa&@Pp(Ю c>9SxB@$@2A@oFHxHy|PN'@PfBalHxHy|PN'@O gB@F`a2 +g<'@k '|(B B$'K4'K0`~ce p<ѫ`~D߫B , (k+g +Ы(~l`rҌ ~m>9SxB@$@2A@oFHxHy&N$@P f^a~Jg\>9SxB@$@2A@oFRy#R f aH5|BBC%IBj` B@F`B@F`HxBaf$@P&&JB (k$L~ ߫ I Jf(Jz@g Hna%d .~ ##6X 96"@R#6~f~#6 96 n4 $$А$}g$I~$ `$ ~Jg~$Jg$`A6"n$$$~g ~gH`H+g +Ы( k "+҈m` k "+҈~҇ l>9SxB@$@2A@oFHxHy&N$@P f^aJg\>9SxB@$@2A@oFRy#R f a~5|BBC%IBj` B@F`B@F`HxBa$@P~ld Hza&&JB (k$L'H IHBB"n$$ [$BoA $Rn`&o*<ǘ4+g"+ҫ($k k Јfn`$k k C fX>9SxB@$@2A@oFHxHy&N$@P f^ahJg\>9SxB@$@2A@oFRy#R f a25|BBC%IBj` B@F`B@F`HxBaP$@P c>9SxB@$@2A@oFHxHy|PN%@PfBaHxHy|PN%@O gB@F`a *g"%@j %|(B B$%J4%J0&&JB (k$L4+g"+ҫ( Ј`A " d $//./ "ENO ի ծ–Jn(vƮJoBoBRn׫ +g +Ы( k "+҈~l` k "+҈~҇ ~m>9SxB@$@2A@oFHxHy&N$@P f^ajJg\>9SxB@$@2A@oFRy#R f a45|BBC%IBj` B@F`B@F`HxBaR$@P&&JB (k$LP'H IJ$g~$$ &. o*<ǘ4+g"+ҫ($k k Јfn`$k k C fX>9SxB@$@2A@oFHxHy&N$@P f^aLJg\>9SxB@$@2A@oFRy#R f a5|BBC%IBj` B@F`B@F`HxBa4$@P c>9SxB@$@2A@oFHxHy|PN%@PfBaHxHy|PN%@O gB@F`an *g"%@j %|(B B$%J4%J0&&JB (k$L4+g"+ҫ( Ј`A " d $//.$/ "ENO ի ծ$–Jn(&. V~Ƈ JoBoBRn׫ `BB&( n,"nA("F#HB n0 L T&((l&-Co*g"*Ҫ("j j Ј`"j j K " f<9SxB@$@2A@oFHxHy&GN$@P f^aJJg\<9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa2$@PJg<9SxB@$@2A@oFHxHy|PN%@PfBaHxHy|PN%@O gB@F`an *g"%@j %|(B B$%J4%J0B *n*-J*g"*Ҫ("j j Ј`"j j K " $m$|f//HpaD&`/Hp/a+BO ժ ؂"[IӬ ,,݀)FJn T,.ݐ TJnJo*g"*Ҫ("j j Јm`"j j K" l<9SxB@$@2A@oFHxHy&a$@P f^aJg\<9SxB@$@2A@oFRy#R f a5|BBK%MBj`B@F`B@F`HxBa$@B *n*"j j ABoBRnߪ *n*`,*ܪ *n**n *BL< n*n *.$.($PJf (J$R g*(*$* ng`*g Jg&J$L 4*g<9SxB@&@2A@oF j0g!j44 j4!j00`Dg/*Hy|Pa0`* j Jg/*$/*(/*NO `/*,/*ah`PlB( f a``NB@F`DB@F`B@F`,HxBa&@'j'j 'j$$'j(('j,,'j00'j44'D'B P<9SxB@$@2A@oF0*@ k'j00'J4%K0 k0!K4 fba<9SxB@$@2A@oF j0g!j44 j4!j00`F*g/*Hy|Pa`* j Jg/*$/*(/*NO `/*,/*agPjB( fa&$B v֊(C`8pH`"n"؅*B`v֊(Cg///a?,O ւ%B &Rj%L"n",*܅*`:Jg@ + d $g//+/a?O "* ҂%A ւի &S"* tlf^|HL<|N^NuNV n"."P .o"QpHJg ) n n ҩ BN^NuNVH?<,.(.~"n&Q+g$+ԫ( +Ы ` +Ы zЅ$ Jo,"n Q BYX Jo///a>O ܂ի JoIKǘ:9SxB@$@2A@oFHxHy&N$@P f^a`Jg\:9SxB@$@2A@oFRy#R f a*5|BBC%IBj` B@F`B@F`HxBaH$@Pzld:9SxB@$@2A@oFHxHy|PN%@PfBaHxHy|PN%@O gB@F`a *g"%@j %|(B B$%J4%J02*g *(` plgpd%@ &&J jBJg Y 2|-IB * o$Vzą&o B `&$///NO Ԯ%B ܃JnB"n"**ڪ "n "BLBpr'AlHy-tBHxIHx@a@'@(OB!P!h !jl$RlB(`$ hJf` QJg "(g hJf L J(f/ aX*f <9`HnB/// a$@OJgfz$g^ *"* f *n(gt jJg!j`'j@ j  jJg!j j HxI/ aanP . k(I Jf^BHxIHx,a]$@BO *n-g<"n kT 0*R!"Rf kTRr .z%@ `tJf %kl$Rl`%n $$%D%F%G %n(Jf +p IfJ"k< i"<@Jg!i`'i@ i  iJg!i i HxI/ *AN`R'@p %@g TK!M(%LB%k@ k@ K'M@ Lplg HzaJ(g(gJgr"j %dbytes) Try reducing NFS_SMALLFH struct nfssvc_sock bloated (> %dbytes) Try reducing NFS_UIDHASHSIZ struct nfsuid bloated (> %dbytes) Try unionizing the nu_nickname and nu_flag fields NV//B v#}BАv# (# BB4#5#Cv## #{#IBPv#|$BWv#+hpdй$L<,QЀ#{$nv#{$Ba+aXJ3fL 9й3й3й3#3AQ #QHyVBHx/Hxad#6OA_B#_BaƂ$.&.N^NuNVBCABBRrlaypN^NuNVH8(n&n $n T hH"h> S (Ш Hn/pD)gpT// / aOJf /././ a LN^NuNVH?<&n "n(Q lH h>*g@pA6p&0 8+$+$"+( | -kD-kH``pA6P&0 8+~eA&0 $+-k4 k8|g 눐A -@`B~f|fv*llg~)Cl~f)ydL ,lW|eZ)y`L/,H// a]$@O Jg:%lB%lB)yRL/ a`v/ aeD+JL(J"n"P+n\$mH$,%F%BH,...%F0%G4 lH%h^JgjB0+ %@%k %k +B%@%A ~%|$ +B %@L%AP%k8%k<(%k@,%kL8%kP<&n(n (.*.BBHxTHxaTB&-C <-@K-M|-FB-F-D-@BBO -|-KK-M-EK-MK-MK-M 9 kLHn p NX"<JfJf HxT/E@NP .gHxT/`x"C$nJoXBB IJg@4(n8 "*Jg-yt`4tH`,*C/-aY*/-aX8BtP` t>`l)n(/.(<b*DNX`",f gA)AB`g4~*Cf* m-|-HB 9 hLHn p NXJgV*C - R ~efE~dBHx Hx*FN&@O `&l-K <%@-J~-GBBB-GB-@*C m , -|-HK-M-@ 9 hLHn p N$Xg~*CdHx / aRP`$<ft`*C"- Ё ct?`EN~d,/*C/-Hs(a+PO. /,aR|)KP` lB0(*Cխ/-N-m lX /f/.aW:-m /.*DNP)l*C+n/aB4$Xg Hx /,aR L n)h)h"HBJi o E zmA $ R"n0i n9@ J.l z&n &`&n BJ f& U-|-HB 9 hLHn p NBL</ aIxXJf *g"D)fB`|%F/."D/)//"n i// a`zg|Hx Hn"D/)a$O fhHn/."n/)a$O fH".g .fB`Hx//Hna$Of/./.a`Hxv/ "D/)a $O f"D)g*TJg&m +3g$, L<= 爐"AC $s,LJgh,*f. m (<&.(. (C&l k hf*y&X-3g/a|p` < Sf </// a$O g/aH ` Sf:9SxB@$@2A@oFHxHy&aג$@P f^awJg\:9SxB@$@2A@oFRy#X f aw5|BBI%LBj` B@F`B@F`HxBa$@P jz z%E / Hx/</ aO"k izf if:9SxB@$@2A@oFHxHy&a֢$@P ,<eJf^avJg\:9SxB@$@2A@oFRy#X f av5|BBI%LBj` B@F`B@F`HxBa$@P jz z%E / HxHx/ (FNOk`BkbkBkJg$M`JBHx2Hxa;p$@HxB/ aO O BI%L BCK%Q yK "%K%D(CRl %CB@F!'J'|e>k `z%E0/ aTX gB@F`auBL<|N^Nunfsdnfsd: locking botch in op %dmbuf siz=%d Bad nfs svc replyNVH?<*n(UBBz-EBB@F!-FJfLBHx4Hxa:X(@*HxB/ aO )nO BCz )Q yz "R:*nR", , fh`4zR: BHzHx/ a^(S: OJf", Jf@ 9gJf0g*&yKJg"+0 |gL&SJfJfz˹&l Jgp +0g&<j0E-d-|-hg/ aX`H|́'F0RD)K `g0zʀ'E0Bt4ԋ/aZB/ /+a/aOHn/ / *CN( L< B@-@-E*n "[I$.&.ցՀO Jg kHJg "(b Bz-Ev`B|`B&AJf+3f2 .E"ERK`B8S`$kJgI jJg!j`'j j SkJkg 0k 9>ЀoBkHka~X *$gB/*\`B/*`/ NO J:g ~ml$kJf~E`,A8JgS%(B(BHzHx Hr(N(O&u8JgJfJgJg"JgSB8"ES"FB8S> L MLENNVH?<(n "n()>"D*BHn/)LHi /.aF,Of* n*hLa>^-@"@Bi Jg"D)f/.// /aOR(Hnp JgpD/Hx/ a&@-KOJg$-"B0ix V~&X$K K+g +Ы("+ҫ l`Z"+ҫ ~҇ mD*g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&a$@P f^a_JJg\>9SxB@$@2A@oFRy#R f a_5|BBC%IBj` B@F`B@F`HxBan2$@P~ld HzaR n -JB -j J$nר C8-I m0hx$B< m2hx/ /(D/ `T"B2ix/ m/(DHnHnaD&Og6,/ `j K+g +Ы("+ҫ ~l`"+ҫ ~҇ ~m>9SxB@$@2A@oFHxHy&a|$@P f^a]Jg\>9SxB@$@2A@oFRy#R f a]5|BBC%IBj` B@F`B@F`HxBal$@P n -JB -j J .~ ߨ ހ-G mHx /(D/adO HnHnHn/./.Hx/ / a~,O glJgz-M n (Ш ".~lf $AC-I`&Hn/HxHnHnaTOJf$nJg"BHnHnHnaVOJf*nJg .g/apX` n (Ш ".$Jg~3m`&~l f AJg C4-I`FC-I`Юg2HxZ"nHiHlLEǘNPO.Z"nHiHlNO Hx"n i/Hl<(n,. R( HnHxDHx/a&@-K*F"m0ix Vz&XO$K K+g +Ы("+ҫ l`d"+ҫ z҅ mN*g (Ш("(Ҩ m`"(Ҩ z҅ l:9SxB@$@2A@oFHxHy&a$@P f^aYLJg\:9SxB@$@2A@oFRy#R f aY5|BBK%MBj` B@F`B@F`HxBah4$@Pzld HzaT n -JB -j J"nר K8-M*F m0hx"B< m:hx/ /(D/ aO `.2ix/ *F m/(DHnHna<&Og(/ `HnHnHn/./.Hx/ /ay(O gl-F n (Ш ".zlf "AK-M`*Hn/HxHnHna~OJg(`n"nJgBHnHnHna|OJfJfD n (Ш ".z/lf AK0-M`$Hn/Hx0HnHnaOJf n (",c c@)@"$( cJg @)@f)B (",c c@)@"$cJg @)@f)B (",c c@)@"cJg @)@f)B)|)|$(B *gpFrc)B)Cz/.ak` L<|N^Nu/root on %s nfs_mountroot: getattr for rootNVH <$9B yWrgp`:A-d r;mr< BHxHxa(@HxB/ aPO./ a*@$@OJf/HnHnHz\Hla*$@OJfHlhHzBaRP$n$(G,%SA"Pf"` y, &#z@ SB /al*B m"n X-|-IK-M-@-B 9 iLHn p N$@XJg Hzal/.aHX` // a)PHx/ a L<lN^Nunfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d NVH00&n$. Hn/Hza n!|:0vǨ6HxBae$@OJf /Hzna"* kB%@ ///a8PO././+D// /./ a$@OJg2"n iS@/ a/ /Hz,aÌHx/.a` n L N^Nunfs_args: retrying connect nfscn3NVH>0$n&n B@F!| fk$+  f '@$BJjm Jk]ID&"|F† g|$ gB@F`aR+gL"+,oF&9Ly8{$L Z"L<fffgЀ%Bdo%Cd` 鈐到l%@d+g +0|l%@h|dl%Fh$+  g"<| f"<@`"< g& + o $*@%@n%|g| *l%A  o%|+g& +$o $*@%@n%|g| *l%A  o%|$+g2 +(o,@%@ n%| o%| ` g%jl%A$+g +4m|m%@$+ g +8m|m%@$+ g +<|l|Jfp`". -A//aB`/.&//.NO JfHnHxYG^/ /. K >NOJf~ .zZ/BHsI$NHnHxYE/ /.NOJfJ .zZ/BHrNHx/./.Hna&OJf-C/.Hn/ / /.//a L<<*n(n (.&.*. ,7g/adB`JBHxHxa(&@HxB/ aO )K>O BC'IBC'IHz/ a&'L -Pg |)F: - f B'| 9Ly{$"@C 'Id| 'Fh'| '| '| |'F|'F|'F| 'FA 'HB'mLt ԋ/-/-/EǘNO 9|>Hx l/Hlza0HxZ/.HlNPO.Z/.HlNO 'D`'m T'mX/ / aBO|TfB/ a^$@PJf)|@FHn/+L// a3|$@OJf n"C"L"E i"C$Q -|-JC-I-@-E 9 jLHn p NX+g"C Q|lfa*$@%n%nBj / /Hk"C/a/ a*`/ acHx/ a/aa L<|`N^NunfsdismNVH0<*n&. $rԂ&m>Hn/+LHk / a2t$@OJf n(hLJfr4l/ a4p`rJg BHzHxHy-,a^OJf// / aH$@O Jg/ arë `Jr / E6N/ N/ a|/ ab/+`a` Of Hx/ aBL< N^NuNV"n i>Hn/(LHh / a1~Jf" n"hLJlfr#Alr#A0 n BN^NuNVH<8(n*. (.&.B$lJgGHf-|X'J 9X jL/ p NXJfbJdg\Hx/ aPJfrWI-|T-J-DD-@-C 9T jLHn p NXANJg$/ NX$jXJfl LHxL/Hy'aO Jf$Jg Lgp`/Hy'/aV`p-$.&.N^NuNVpN^NuNVpN^NuNVpN^NuNVBN^NuNVp-N^NuNVH8$.&. (.HnBB/a&HnHnHn//B//ak$O0gl/.a^f LN^Nubuild > MLENNVH?<(.&D(k lH h>**lB"-~gC-d  @-{f` &-\$L<,fffgЀ~l@ $L<,fffgЀ~9SxB@$@2A@oFHxHy&a$@P f^aGjJg\>9SxB@$@2A@oFRy#R f aG45|BBG%KBj` B@F`B@F`HxBaVR$@P~ld Hzar n -JB -j J"nר G8-K l0hx"B< l6hx/ /(D/ aO `02ix/ l/(DHnHna^&Og /a[~`z n(g (Ш("(Ҩ ~l`"(Ҩ ~҇ ~m>9SxB@$@2A@oFHxHy&a$@P f^aEJg\>9SxB@$@2A@oFRy#R f aE5|BBG%KBj` B@F`B@F`HxBaT$@P n -JB -j J"nX G-K&D +'ADD~lgg~ g~ `g~g~"HnHnHn&D/+ /+Hx// af&O gl-L n (Ш ".~lf "AG-K`*Hn/HxHnHnaDOJg&`"nJg BHnHnHnaBOJf(nJfX n (Ш ".~lf "AG-K`$Hn/HxHnHnaOJf"n gv /.aY` /a n`tJf2&D+ g$ lH(9g ,l~b~d~fvJg~ f6Jgf &D(+` A-d+P&D k +h+k+C L"*l Stdvg/Hzap `-gA-d ho"D i>$(l/+/+ Hx/ aD\O gJf ,",$,&, f ,{gpHx/+/+ Hx/ aOvg:/ a)l)l `4,{gHx/+/+ Hx/ aOtg/ aBXXvlfB/ aBBP + "+-|-JC-I-@-A 9 jLHn p NJf` + "+-|-JC-I-@-A 9 jLHn p NXJfh$,\gPvlfB/ aJBBPHx/+/+ Hx/ a Otfp`/ a)n\-fBXBL<lN^NuNVH 0"n&i$kBtlfn kH h>"fH*{g@ gB/)Hx/) / ajz`Hx/)/) Hx/ a 2BX2*zg A5Az *tL N^NuNVH<<*.*E(m"l lH h>$2)z0@gA3Az*E/-/ aPJfB`R'Hnp JgpD/Hx/ a&@-KOJg$l0jx Vx&X K"K+g +Ы("+ҫ l`Z"+ҫ x҄ mD(g )Щ(")ҩ m`")ҩ x҄ l89SxB@$@2A@oFHxHy&a$@P f^a?>Jg\89SxB@$@2A@oFRy#R f a?5|BBK%MBj` B@F`B@F`HxBaN&$@Pxld Hz~aF n -JB -j"J nש K8-M"l2ix B<"l:ix/ /)D/`R4jx/ l/(DHnHna:&Og6$/ `"K+g +Ы("+ҫ xl`"+ҫ x҄ xm89SxB@$@2A@oFHxHy&ar$@P f^a=Jg\89SxB@$@2A@oFRy#R f a=5|BBK%MBj` B@F`B@F`HxBaL$@P n -JB -j"J .x ٩ ؀-D lHx /(D/aZO HnHnHn*E/- /-Hx/ / a^$O g l^JfL-L*E/-HnHnHnaOJg$`$(nxlf*E m $n!|$/.aQ L<<(n&l*k$lBBzDgp-`$* |ff(f 0fg kH(9f~ *"* z|g +lU|eR0; N Jp`Tz0f(fff fB`0%|%| ` kH(9gp` /* /*/ &< |"CNO ** fHx/,/, B`Hx/,/, Hx/ a$Og/-// "CN`&(- mH *"* !@!A *+A`(R'Hnp JgpDr ҀJgr<Ҁ/Hx/.a&@-KOJg*n"m0ix V|&X$K K+g +Ы("+ҫ l`^"+ҫ ~҇ mH*g (Ш("(Ҩ m`"(Ҩ |҆ l>9SxB@$@2A@oFHxHy&a$@P f^a9hJg\<9SxB@$@2A@oFRy#R f a925|BBK%MBj` B@F`B@F`HxBaHP$@P|ld Hzap n -JB -j J"nר K8-M*n m0hx"B< m:hx/ /(D/ `\2ix/ *n m/(DHnHna\&Og<$/ ` K+g +Ы("+ҫ |l`"+ҫ ~҇ |m>9SxB@$@2A@oFHxHy&a$@P f^a7Jg\<9SxB@$@2A@oFRy#R f a75|BBK%MBj` B@F`B@F`HxBaF$@P n -JB -j J .| ݨ ~ ހ-G*n mHx /(D/avO JgP|g& n(g (Ш("(Ҩ ~l`"(Ҩ |҆ ~m<9SxB@$@2A@oFHxHy&aP$@P f^a6Jg\>9SxB@$@2A@oFRy#R f a6p5|BBK%MBj` B@F`B@F`HxBaE$@P n -JB -j J"nP K-M"|$"` n(g (Ш("(Ҩ |l`"(Ҩ ~҇ |m>9SxB@$@2A@oFHxHy&a,$@P f^a5Jg\<9SxB@$@2A@oFRy#R f a5L5|BBK%MBj` B@F`B@F`HxBaDj$@P n -JB -j J"nX K-M"W| g& n(g (Ш("(Ҩ ~l`"(Ҩ |҆ ~m<9SxB@$@2A@oFHxHy&a$@P f^a4\Jg\>9SxB@$@2A@oFRy#R f a4&5|BBK%MBj` B@F`B@F`HxBaCD$@P n -JB -j J"nP K-M"|$" ` n(g (Ш("(Ҩ |l`"(Ҩ ~҇ |m>9SxB@$@2A@oFHxHy&a$@P f^a38Jg\<9SxB@$@2A@oFRy#R f a35|BBK%MBj` B@F`B@F`HxBaB $@P n -JB -j J"nX K-M"W|g& n(g (Ш("(Ҩ ~l`"(Ҩ |҆ ~m<9SxB@$@2A@oFHxHy&a$@P f^a2Jg\>9SxB@$@2A@oFRy#R f a15|BBK%MBj` B@F`B@F`HxBa@$@P n -JB -j J"nP K-M"|$"` n(g (Ш("(Ҩ |l`"(Ҩ ~҇ |m>9SxB@$@2A@oFHxHy&a$@P f^a0Jg\<9SxB@$@2A@oFRy#R f a05|BBK%MBj` B@F`B@F`HxBa?$@P n -JB -j J"nX K-M"W ,", |~g. n(g (Ш("(Ҩ ~ l`"(Ҩ |҆ ~ m<9SxB@$@2A@oFHxHy&ah$@P f^a/Jg\>9SxB@$@2A@oFRy#R f a/5|BBK%MBj` B@F`B@F`HxBa>$@P n -JB -j J"n| ݨ K -M"|$"#l ` n(g (Ш("(Ҩ |l`"(Ҩ ~҇ |m>9SxB@$@2A@oFHxHy&a<$@P f^a.Jg\<9SxB@$@2A@oFRy#R f a.\5|BBK%MBj` B@F`B@F`HxBa=z$@P n -JB -j J"nX K-M"W",(|gXA-d g, n(g (Ш("(Ҩ ~ l`"(Ҩ |҆ ~ m<9SxB@$@2A@oFHxHy&a$@P f^a-\Jg\>9SxB@$@2A@oFRy#R f a-&5|BBK%MBj` B@F`B@F`HxBa9SxB@$@2A@oFRy#R f a+5|BBK%MBj` B@F`B@F`HxBa;$@P n -JB -j J"nX K-M|"` n(g (Ш("(Ҩ ~l`"(Ҩ |҆ ~m<9SxB@$@2A@oFHxHy&a$@P f^a+Jg\>9SxB@$@2A@oFRy#R f a*5|BBK%MBj` B@F`B@F`HxBa9$@P n -JB -j J"nX K-MB",0|gXA-d g, n(g (Ш("(Ҩ ~ l`"(Ҩ |҆ ~ m<9SxB@$@2A@oFHxHy&a$@P f^a)Jg\>9SxB@$@2A@oFRy#R f a)5|BBK%MBj` B@F`B@F`HxBa8$@P n -JB -j J"n| ݨ K -M|""0#l4`8 n(g (Ш("(Ҩ ~l`"(Ҩ |҆ ~m<9SxB@$@2A@oFHxHy&ab$@P f^a(Jg\>9SxB@$@2A@oFRy#R f a(5|BBK%MBj` B@F`B@F`HxBa7$@P n -JB -j J"nX K-M|"` n(g (Ш("(Ҩ ~l`"(Ҩ |҆ ~m<9SxB@$@2A@oFHxHy&aD$@P f^a'Jg\>9SxB@$@2A@oFRy#R f a'd5|BBK%MBj` B@F`B@F`HxBa6$@P n -JB -j J"nX K-MB n(g (Ш("(Ҩ |l`"(Ҩ ~҇ |m>9SxB@$@2A@oFHxHy&a,$@P f^a&Jg\<9SxB@$@2A@oFRy#R f a&L5|BBK%MBj` B@F`B@F`HxBa5j$@P n -JB -j J"nX K-M"W` n(g (Ш("(Ҩ |l`"(Ҩ ~҇ |m>9SxB@$@2A@oFHxHy&a $@P f^a%bJg\<9SxB@$@2A@oFRy#R f a%,5|BBK%MBj` B@F`B@F`HxBa4J$@P n -JB -j J"n| ݨ K -M",|f"+h`$*n -l|f 9` A 0 " , ~f #y+h`#@ ,|f #y+h`#@#l #l($,,~g"L<bMԂ#@`|#F#l0$,4~g"L<bMԂ#@`|#FHnHnHn/./.Hx/ /.aE$O glTJg n (Ш ".~lf "AK-M`&Hn/HxHnHna2OJf"n"Q|$fJ n (Ш ".|lf ~ށ-G`"Hn/HxHnHnaOJf-n n (Ш ".|lf "AK-M`$Hn/HxHnHnaOJfH"nJgBBHnHnHnaOJf$`$-nBHnHnHnahOJg$/.a7 L.-GH&nBB>G=GFg lH(9g U~ep` j~lgp` \~΁-GL-lh/ /.B/ a(O gr - "--|-L~-G-@-A 9 lLHn p NXJg &nBB` ~fh - "--|-LG-K-@-A 9 lLHn p NXJf l..̾dfp` / a nhBdX`&nB,&F$+Df/ aBX`Hx/a(PJf&FDfp - "--|-FG-K-@-A 9&F kLHn p NXJf& k..Ծ`fR'JgJnFg~`t/a@X/aRX&nBBBR'R'*-Hn(V ~r$ҀJHgrHҀ/Hx/ al-@>-@OJHg"l0ix V~&X$n> J*g *Ъ("*Ҫ l`^&n>"+ҫ ~҇ mD*g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&a~$@P f^aRJg\>9SxB@$@2A@oFRy#R f a5|BBG%KBj` B@F`B@F`HxBa.:$@P~ld HzՒaZ n -JB -j J"nר G8-K l0hx"B< l6hx/ /(D/ `Z2ix/ l/(DHnHnaN&Og>(/.>`" n>(g (Ш("(Ҩ ~l `&n>"+ҫ ~҇ ~m>9SxB@$@2A@oFHxHy&a}~$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBG%KBj` B@F`B@F`HxBa,$@P n -JB -j J .~ ߨ ހ-G lHx /(D/afO o/.>a2&x?`~ȇ&X n"H(g (Ш("(Ҩ l`R"(Ҩ ~҇ m<)g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&a{$@P f^aPJg\>9SxB@$@2A@oFRy#R f a5|BBG%KBj` B@F`B@F`HxBa+8$@P~ld HzҐaX n -JB -j J"nר G8-K"B`2Hn|HnxHnt/- /-Hx/.>/ a<(O glJg-Ll nx (Ш ".|~lf "AG-K|`*Hnp/HxHn|HnxazOJg(`"npJgBHn|HnxHnlaOJg(`r(nl`jJHgn nx (Ш ".|~lf "AG-K|`*Hnp/HxHn|HnxazOJg(`"np&o~@l/.ta/HxH`v nx (Ш $.|*V"~‡nf҂-A|`,Hnp/~΅/Hn|HnxayOJg(`$.p~fJLgJnFg"nh0ixf&///)DaO Jf/.ta.p`Hnh///,Ha(Og/.ta.x` nh,(LJHg-Fd nx (Ш ".|~lf "AG-K|`*Hnp/HxHn|HnxaxOJg(`"npJg&BHn|HnxHndaOJg(`,.d-L` nx (Ш ".|~lf "AG-K|`*Hnp/HxHn|Hnxax6OJg(`B"npJgLBHn|HnxHn`a4OJg0(`-F\BHn|HnxHn\aOJg(`,.\&nB&/.ta-*mB`b"nh0ixf$///)DaO Jf/ a, X`$Hnh///,Ha(OfR nh,(LJHg-FX nx (Ш ".|~lf "AG-K|`*Hnp/HxHn|HnxawOJg(`""npJg&BHn|HnxHnXaOJg(`,.X-LT nx (Ш ".|~lf "AG-K|`*Hnp/HxHn|HnxavOJg(`"npJgNBHn|HnxHnTaOJg(`v(nT`(-FPBHn|HnxHnPahOJg(`L,.PJg JnFgm-g*~fJnFf"nh iH#h8`/ // a~O &nB&/.ta+DXJg~~f2-g*~g$"lJdf iH#h0d/ B/ a0O Jg/a ~g~fJnFg~f lHx(9gxJg JnFgm L<N^NuNV n"hrlfB/(/( /(/ a `pN^NuNV n"hrlfB/( B/(/ a`pN^NuNVH><(n,. lH h>(R'Hnp JgpD/Hx/ aa&@-KOJg"l0ix Vz&X$K K+g +Ы("+ҫ l`Z"+ҫ z҅ mD*g (Ш("(Ҩ m`"(Ҩ z҅ l:9SxB@$@2A@oFHxHy&as$@P f^a(Jg\:9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa#$@Pzld Hzha0 n -JB -j J"nר K8-M l0hx"B< l:hx/ /(D/ `R2ix/ l/(DHnHnav$&Og6$/ `l K+g +Ы("+ҫ zl`"+ҫ z҅ zm:9SxB@$@2A@oFHxHy&ar\$@P f^aJg\:9SxB@$@2A@oFRy#R f a|5|BBK%MBj` B@F`B@F`HxBa!$@P n -JB -j J .z ۨ ڀ-E lHx /(D/aDO HnHnHn/.*F/-Hx/ / a3$O glJgv-L n (Ш ".zlf "AK-M`&Hn/HxHnHnaq2OJf"nJgBHnHnHna}4OJfJf n (Ш ".zlf "AK-M`$Hn/HxHnHnapOJf:"n  o/.a&tH`*JoHn//HnakFOJg$/.a% L<|N^NuNVH?<(n.. B lH-h>*n*-EB*G(-"[I*-,- ҆х*n*-,-cp`/.NvH`&/.N`xR'*n --DAql-@Hnp,JgpP/Hx/ N&@-KOJg"l0ix Vz&X$K K+g +Ы("+ҫ l`b"+ҫ |҆ mL-|ǘ*g (Ш("(Ҩ m`"(Ҩ z҅ l<9SxB@$@2A@oFHxHy&an$@P f^a Jg\:9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@Pzld Hz`az( n -JB -j J"nר K8-M l0hx"B< l:hx/ /(D/ ``2ix/ l/(DHnHnaq&OgD/ a#:`b K-|ǘ+g +Ы("+ҫ zl`"+ҫ |҆ zm<9SxB@$@2A@oFHxHy&amH$@P f^a Jg\:9SxB@$@2A@oFRy#R f a h5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J .z ۨ | ܀-F lHx /(D/*nNO n&<F(g (Ш("(Ҩ z l`"(Ҩ |҆ z m<9SxB@$@2A@oFHxHy&al$@P f^a hJg\:9SxB@$@2A@oFRy#R f a 25|BBK%MBj` B@F`B@F`HxBaP$@P n -JB -j J"nz ۨ K -MJg*G"#m #n` *G" "BHnHnHn/.*G/-Hx/ / *CN&O glE:nJg-L n (Ш ".zlf "AK-M`&Hn/HxHnHnajOJf"nJg"BHnHnHnavOJf(nJf n (Ш ".zlf "AK-M`&Hn/HxHnHnajTOJfZ"n-i`&-LBHnHnHnavNOJf,(n n (Ш ".zlf "AK-M`&Hn/HxHnHnaiOJf"n$*nشnJoHn//HnadjOJf/.NXJg JfJf `lBJn LBB"G(-Dx-D"nB"n -i".[I()ҩ ф"G()*)c$p` -@`@x-D`-@/.N`Jo,<#RR'"G )-nAql-@Hn .Vxr4ҀJgrXҀ/Hx/ N&@-KOJg*l0mx Vz&X$K K+g +Ы("+ҫ l`^"+ҫ x҄ mHKǘ*g (Ш("(Ҩ m`"(Ҩ z҅ l89SxB@$@2A@oFHxHy&ag$@P f\aJgZ:9SxB@$@2A@oF"FRQ f a5|BBC%IBj` B@F`B@F`HxBa$@Pxld Hz>as n -JB -j J$nר C8-I l0hx$B< l2hx/ /(D/ ``:mx/ l/(DHnHnai&Og@-C/ a` KKǘ+g +Ы("+ҫ xl`"+ҫ z҅ xm:9SxB@$@2A@oFHxHy&af$$@P f\azJgZ89SxB@$@2A@oF"FRQ f aF5|BBC%IBj` B@F`B@F`HxBad$@P n -JB -j J .x ٨ z ڀ-E lHx /(D/NO K>Jg6 n(g (Ш("(Ҩ xl`"(Ҩ z҅ xm:9SxB@$@2A@oFHxHy&ad$@P f\aBJgZ89SxB@$@2A@oF"FRQ f a5|BBC%IBj` B@F`B@F`HxBa,$@P n -JB -j J$nx٨ C-I"n $%i P$"n$`( n(g (Ш("(Ҩ xl`"(Ҩ z҅ xm:9SxB@$@2A@oFHxHy&ac$@P f\aJgZ89SxB@$@2A@oF"FRQ f a5|BBC%IBj` B@F`B@F`HxBa$@P n -JB -j J$nx٨ C-I"n ) $$$$Hn/.Hn/. NOJfHnHnHn/."n /)Hx/ / a$-@O g lK:nJg\x-DB n (Ш ".zlf $AC-I`&Hn/HxHnHnabbOJfn$n$R|$fj n (Ш ".xlf $AC-I`&Hn/HxHnHnabOJf$nJg l h\WID-L n (Ш ".xlf $AC-I`&Hn/HxHnHnaaOJf$n&g"BHnHnHnamOJf(nJg-B`-CJf$ n (Ш ".xlf $AC-I`&Hn/HxHnHnaa OJf$n&gl0$.̔"n Q Qը"[I ()#Dթ-C zf-@`xfJfB"G )f#R#jx#D`VHx&GG/ / aO Jg:z"n"&"G#j`&-LBHnHnHnalbOJfF(nJg"l iH#h0\/.NXJf(.̙Jn,"n"Jg "n #n .L(-D" W|e*-H`H ]xd8-|$-n-G 9$(n lLHn p N.a̜p-`^*9+hR(Hn(G ,Vxr0ҀJgrTҀp ЁJgp<Ё/Hx /.aK&@-KOJg(n"l0ix Vx&X$K K+g +Ы("+ҫ l`^"+ҫ |҆ mH*g (Ш("(Ҩ m`"(Ҩ x҄ l<9SxB@$@2A@oFHxHy&a^($@P f^a~Jg\89SxB@$@2A@oFRy#R f aH5|BBI%LBj` B@F`B@F`HxBa f$@Pxld Hzai n -JB -j J"nר I8-L(n l0hx"B< l8hx/ /(D/ `\2ix/ (n l/(DHnHna`r&Og<*/ ` K+g +Ы("+ҫ xl`"+ҫ |҆ xm<9SxB@$@2A@oFHxHy&a\$@P f^aJg\89SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa $@P n -JB -j J .x ٨ | ܀-F(n lHx /(D/aO (G , o/ aHz?`rVx&X n"H(g (Ш("(Ҩ l`X"(Ҩ |҆ mB)g (Ш("(Ҩ m`"(Ҩ x҄ l<9SxB@$@2A@oFHxHy&a[$@P f^apJg\89SxB@$@2A@oFRy#R f a:5|BBI%LBj` B@F`B@F`HxBa X$@Pxld Hzafx n -JB -j J"nר I8-L(G"B(-D~f/ /(n/,/.a|`-_g-|R'Hn(F ,Vxr(ҀJgrLҀp ЁJgp<Ё/Hx/.a0&@-KOJg(n"l0ix Vx&X$K K+g +Ы("+ҫ l`d"+ҫ ~҇ mN*<ǘ*g (Ш("(Ҩ m`"(Ҩ x҄ l>9SxB@$@2A@oFHxHy&aC$@P f^ahJg\89SxB@$@2A@oFRy#R f a25|BBI%LBj` B@F`B@F`HxBaP$@Pxld HzaNp n -JB -j J"nר I8-L(n l0hx"B< l8hx/ /(D/ `h2ix/ (n l/(DHnHnaE\&OgF*/ ax` K*<ǘ+g +Ы("+ҫ xl`"+ҫ ~҇ xm>9SxB@$@2A@oFHxHy&aA$@P f^aJg\89SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J .x ٨ ~ ހ-G(n lHx /(D/(ENO (F , o/ a(z?`Vx&X n"H(g (Ш("(Ҩ l`\"(Ҩ ~҇ mF*<ǘ)g (Ш("(Ҩ m`"(Ҩ x҄ l>9SxB@$@2A@oFHxHy&a?$@P f^aJJg\89SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa2$@Pxld HzaKR n -JB -j J"nר I8-L(F"B9SxB@$@2A@oFHxHy&a>x$@P f^aJg\89SxB@$@2A@oFRy#R f aޘ5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L.gNx" n(g (Ш("(Ҩ ~l`"(Ҩ x҄ ~m89SxB@$@2A@oFHxHy&a=T$@P f^aݪJg\>9SxB@$@2A@oFRy#R f at5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nP I-LJ4g y4"\`" 9(R#R"`BB~g& n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a<$@P f^aVJg\89SxB@$@2A@oFRy#R f a 5|BBI%LBj` B@F`B@F`HxBa>$@P n -JB -j J"nP I-L"|$"` n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a:$@P f^a2Jg\89SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L"W n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a9$@P f^aJg\89SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L"W n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a8$@P f^aJg\89SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L"W n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a7$@P f^aJg\89SxB@$@2A@oFRy#R f aר5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L"W"-(xgXA-d g, n(g (Ш("(Ҩ ~ l`"(Ҩ x҄ ~ m89SxB@$@2A@oFHxHy&a6R$@P f^a֨Jg\>9SxB@$@2A@oFRy#R f ar5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nx ٨ I -Lx""(#m,`8 n(g (Ш("(Ҩ ~l`"(Ҩ x҄ ~m89SxB@$@2A@oFHxHy&a5($@P f^a~Jg\>9SxB@$@2A@oFRy#R f aH5|BBI%LBj` B@F`B@F`HxBaf$@P n -JB -j J"nX I-Lx"` n(g (Ш("(Ҩ ~l`"(Ҩ x҄ ~m89SxB@$@2A@oFHxHy&a4 $@P f^a`Jg\>9SxB@$@2A@oFRy#R f a*5|BBI%LBj` B@F`B@F`HxBaH$@P n -JB -j J"nX I-LB"-0xgXA-d g, n(g (Ш("(Ҩ ~ l`"(Ҩ x҄ ~ m89SxB@$@2A@oFHxHy&a2$@P f^a.Jg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nx ٨ I -Lx""0#m4` n(g (Ш("(Ҩ ~l`"(Ҩ x҄ ~m89SxB@$@2A@oFHxHy&a1$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-Lx"` n(g (Ш("(Ҩ ~l`"(Ҩ x҄ ~m89SxB@$@2A@oFHxHy&a0$@P f^aJg\>9SxB@$@2A@oFRy#R f aа5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-LB` n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a/t$@P f^aJg\89SxB@$@2A@oFRy#R f aϔ5|BBI%LBj` B@F`B@F`HxBa޲$@P n -JB -j J"nx ٨ I -L xf 9` A 0 "#y+h#y+hB #m($-,~g"L<bMԂ#@`x#D#m0$-4~g"L<bMԂ#@`x#DHnHnHn(F/, /,Hx/ /.a*O glG:nJfrJgT n (Ш ".xlf "AI-L`&Hn/HxHnHna-OJf"n$Q`4|JgJgf n (Ш ".xlf "AI-L`&Hn/HxHnHna-`OJf:"n&ox@l/.NzH`v n (Ш $. CV"~‡nf Ҁ-A`*Hn/x.ȇ/HnHna,OJf .A fHn//(n/,HNOJf n-hLJg n (Ш ".xlf "AI-L`$Hn/HxHnHna,jOJfD"nJg$Q`FJgB n (Ш ".xSm"/HxTHnHna/"OJg*`~Tށ-GJg*-nBHnHnHna8OJf-n`FJg/.aBXHn(F/,/, /,/,/.axZ*Of n-hLJgZB n (Ш ".xlf "AI-L`&Hn/HxHnHna+POJf*"n"Q|$fn n (Ш ".xlf "AI-L`&Hn/HxHnHna*OJf"nJg(n l h\WID-n n (Ш ".xlf "AI-L`&Hn/HxHnHna*OJf\"n$g$BHnHnHna6OJf6-nJg-C`-B/.NXJg6Jg.g 'f n`E6Jg8/.NX`.E6Jg".g(F/,/, / /.a*OJf*(F,g//./.aY:O (n l Hx (F/,a(n lhzPJf lBX/.N L,-FR(Hn(V |r$ҀJgrHҀ/Hx / a&@-KOJg"l0ix V|&X$K K+g +Ы("+ҫ l`\"+ҫ |҆ mF*g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a&$@P f^aTJg\<9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa<$@P|ld Hya2Z n -JB -j J"nר K8-M l0hx"B< l:hx/ /(D/ `R2ix/ l/(DHnHna)N&Og6$/ `r K+g +Ы("+ҫ |l`"+ҫ |҆ |m<9SxB@$@2A@oFHxHy&a%$@P f^aJg\<9SxB@$@2A@oFRy#R f aŦ5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J .| ݨ ܀-F lHx /(D/agnO o/ a0t?`6|Ȇ&X n"H(g (Ш("(Ҩ l`T"(Ҩ |҆ m>)g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a$$@P f^aZJg\<9SxB@$@2A@oFRy#R f a$5|BBK%MBj` B@F`B@F`HxBaB$@P|ld Hya/` n -JB -j J"nר K8-M"B,-FR( Hn(V"|†,.V-F |Jg (@I `(@IH /Hx/ a &@-KOJg"m0ix V|&X$K K+g +Ы("+ҫ l`\"+ҫ |҆ mF*g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a$@P f^a.Jg\<9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P|ld Hya*4 n -JB -j J"nר I8-L m0hx"B< m8hx/ /(D/ `R2ix/ m/(DHnHna!(&Og6$/ ` K+g +Ы("+ҫ |l`"+ҫ |҆ |m<9SxB@$@2A@oFHxHy&a`$@P f^aJg\<9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa̞$@P n -JB -j J .| ݨ ܀-F mHx /(D/a_HO n|Ȇ&X n"H(g (Ш("(Ҩ l`X"(Ҩ |҆ mB(<ǘ)g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a$@P f^a:Jg\<9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa"$@P|ld Hya'@ n -JB -j J"nר I8-L"B$/ ` n(<ǘ(g (Ш("(Ҩ |l`"(Ҩ |҆ |m<9SxB@$@2A@oFHxHy&a$@P f^aJg\<9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J .| ݨ ܀-F(E lHx /(D/(DNO o/ aHt?`|ͮ&.X n"H(g (Ш("(Ҩ l`\"(Ҩ |҆ mF(<ǘ)g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a$@P f^ahJg\<9SxB@$@2A@oFRy#R f a25|BBI%LBj` B@F`B@F`HxBaP$@P|ld Hya"n n -JB -j J"nר I8-L"B,-FR(Hn -V|rDҀJg"/Hx/ a&@-KOJg"l0ix V|&X$K K+g +Ы("+ҫ l`\"+ҫ |҆ mF*g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a@$@P f^aJg\<9SxB@$@2A@oFRy#R f a`5|BBK%MBj` B@F`B@F`HxBa~$@P|ld Hya n -JB -j J"nר K8-M l0hx"B< l:hx/ /(D/ `R2ix/ l/(DHnHna&Og6$/ `& K+g +Ы("+ҫ |l`"+ҫ |҆ |m<9SxB@$@2A@oFHxHy&a$@P f^aJg\<9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J .| ݨ ܀-F lHx /(D/aQO Jg*E"m0ix V|&X n$H(g (Ш("(Ҩ l`d"(Ҩ |҆ mN(<ǘ*g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a@$@P f^aJg\<9SxB@$@2A@oFRy#R f a`5|BBK%MBj` B@F`B@F`HxBa~$@P|ld Hya n -JB -j J"nר K8-M*E m0hx"B< m:hx/ /(D/ `^2ix/ *E m/(DHnHna&Og>$/ `" n(<ǘ(g (Ш("(Ҩ |l`"(Ҩ |҆ |m<9SxB@$@2A@oFHxHy&a $@P f^aJg\<9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J .| ݨ ܀-F*E mHx /(D/*DNO *n - o/ a^t?`V|&X n"H(g (Ш("(Ҩ l``"(Ҩ |҆ mJ(<ǘ)g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a *$@P f^aJg\<9SxB@$@2A@oFRy#R f aJ5|BBK%MBj` B@F`B@F`HxBah$@P|ld Hya n -JB -j J"nר K8-M*n"B.-GR'/,aH-@Hn(F",V~‡.V-G ~Jg(@IL`(@I( r ҀJgr<Ҁ/Hx / a&@-KOJg"m0ix V~&X$K K+g +Ы("+ҫ l`\"+ҫ ~҇ mF*g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&aN$@P f^aJg\>9SxB@$@2A@oFRy#R f an5|BBI%LBj` B@F`B@F`HxBa$@P~ld Hya n -JB -j J"nר I8-L m0hx"B< m8hx/ /(D/ `R2ix/ m/(DHnHna&Og6*/ ` K+g +Ы("+ҫ ~l`"+ҫ ~҇ ~m>9SxB@$@2A@oFHxHy&a$@P f^a,Jg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J .~ ߨ ހ-G mHx /(D/aFO (F , o/ azz?`V~&X n"H(g (Ш("(Ҩ l`b"(Ҩ ~҇ mL-|ǘ)g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&aD$@P f^aJg\>9SxB@$@2A@oFRy#R f ad5|BBI%LBj` B@F`B@F`HxBa$@P~ld Hya n -JB -j J"nר I8-L(F"B9SxB@$@2A@oFHxHy&a$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nP I-L"|$(D"` n(g (Ш("(Ҩ ~l`"(Ҩ ~҇ ~m>9SxB@$@2A@oFHxHy&a$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L"W n(g (Ш("(Ҩ ~l`"(Ҩ ~҇ ~m>9SxB@$@2A@oFHxHy&a|$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L"W n(g (Ш("(Ҩ ~l`"(Ҩ ~҇ ~m>9SxB@$@2A@oFHxHy&a`$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L"W n(g (Ш("(Ҩ ~l`"(Ҩ ~҇ ~m>9SxB@$@2A@oFHxHy&aD$@P f^aJg\>9SxB@$@2A@oFRy#R f ad5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L"W(D",(~gZA-d g. n(g (Ш("(Ҩ ~ l`"(Ҩ ~҇ ~ m>9SxB@$@2A@oFHxHy&a $@P f^abJg\>9SxB@$@2A@oFRy#R f a,5|BBI%LBj` B@F`B@F`HxBaJ$@P n -JB -j J"n~ ߨ I -L~"(D"(#l,`8 n(g (Ш("(Ҩ ~l`"(Ҩ ~҇ ~m>9SxB@$@2A@oFHxHy&a$@P f^a6Jg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L~"` n(g (Ш("(Ҩ ~l`"(Ҩ ~҇ ~m>9SxB@$@2A@oFHxHy&a$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-LB(D",0~gZA-d g. n(g (Ш("(Ҩ ~ l`"(Ҩ ~҇ ~ m>9SxB@$@2A@oFHxHy&a$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"n~ ߨ I -L~"(D"0#l4`8 n(g (Ш("(Ҩ ~l`"(Ҩ ~҇ ~m>9SxB@$@2A@oFHxHy&ab$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-L~"` n(g (Ш("(Ҩ ~l`"(Ҩ ~҇ ~m>9SxB@$@2A@oFHxHy&aD$@P f^aJg\>9SxB@$@2A@oFRy#R f ad5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"nX I-LB o/ az?`~Ϯ&.X n"H(g (Ш("(Ҩ l`b"(Ҩ ~҇ mL-|ǘ)g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&a$@P f^a Jg\>9SxB@$@2A@oFRy#R f a5|BBI%LBj` B@F`B@F`HxBa$@P~ld Hya& n -JB -j J"nר I8-L"B9SxB@$@2A@oFHxHy&aP$@P f^aJg\>9SxB@$@2A@oFRy#R f ap5|BBI%LBj` B@F`B@F`HxBa$@P n -JB -j J"n~ ߨ I -L.9(D"#y+h#y+h#y+h #l($,,~g"L<bMԂ#@`~#G(D#l0$,4~g"L<bMԂ#@`~#GHnHnHn(F/, /,Hx / / a*O glJgpJf n (Ш ".~lf "AI-L`&Hn/HxHnHnaOJf"n$QJgJgj n (Ш ".~lf "AI-L`&Hn/HxHnHnaTOJf6"n&o~@l/.azH`v n (Ш $.(V"~‡nf Ҁ-A`(Hn/~΄/HnHnaOJf .Hn///-HawOJf n-hLJg n (Ш ".~lf "AI-L`$Hn/HxHnHnabOJfD"nJg$Q`FJgB n (Ш ".~Sm"/HxTHnHnaOJg*`~Tށ-GJg(-nBHnHnHnaOJf-nB n (Ш ".~lf "AI-L`&Hn/HxHnHnaOJfz"n"Q|$fj n (Ш ".~lf "AI-L`&Hn/HxHnHna>OJf "nJg m h\WID-M n (Ш ".~lf "AI-L`&Hn/HxHnHnaOJf"n$g"BHnHnHnaOJf*nJg-C`-B/.aXJg /.a\XHx (F/,aW mhzPJf mBX/ a\j~fB L(-D*n-mR'Hn*.V xr$ҀJgrHҀp ЁJgp<Ё/Hx / aڌ&@-KOJg"l0ix V~&X$K K+g +Ы("+ҫ l`\"+ҫ x҄ mF*g (Ш("(Ҩ m`"(Ҩ ~҇ l89SxB@$@2A@oFHxHy&a$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@Pxld Hya n -JB -j J"nר K8-M l0hx"B< l:hx/ /(D/ `T2ix/ l/(DHnHna&Og8*/ ` K+g +Ы("+ҫ xl`"+ҫ ~҇ xm>9SxB@$@2A@oFHxHy&aF$@P f^aJg\89SxB@$@2A@oFRy#R f af5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J .x ٨ ~ ހ-G lHx /(D/a-,O o/ az?`xʄ&X n"H(g (Ш("(Ҩ l`\"(Ҩ ~҇ mF)g (Ш("(Ҩ m`"(Ҩ x҄ l>9SxB@$@2A@oFHxHy&a$@P f^aJg\89SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@Pxld Hya n -JB -j J"nר K8-M"B9SxB@$@2A@oFHxHy&a4$@P f^aJg\89SxB@$@2A@oFRy#R f aT5|BBK%MBj` B@F`B@F`HxBar$@P n -JB -j J"nP K-M"|$*n"` n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a $@P f^abJg\89SxB@$@2A@oFRy#R f a,5|BBK%MBj` B@F`B@F`HxBaJ$@P n -JB -j J"nX K-M"W n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a$@P f^aFJg\89SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa.$@P n -JB -j J"nX K-M"W n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a$@P f^a*Jg\89SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J"nX K-M"W n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a$@P f^aJg\89SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J"nX K-M"W*n"-(xg\A-d g0 n(g (Ш("(Ҩ ~ l`"(Ҩ x҄ ~ m89SxB@$@2A@oFHxHy&a~$@P f^aJg\>9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J"nx ٨ K -Mx"*n"(#m,`8 n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&aP$@P f^aJg\89SxB@$@2A@oFRy#R f ap5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J"nX K-Mx"` n(g (Ш("(Ҩ ~l`"(Ҩ x҄ ~m89SxB@$@2A@oFHxHy&a2$@P f^aJg\>9SxB@$@2A@oFRy#R f aR5|BBK%MBj` B@F`B@F`HxBap$@P n -JB -j J"nX K-MB*n"-0xg\A-d g0 n(g (Ш("(Ҩ ~ l`"(Ҩ x҄ ~ m89SxB@$@2A@oFHxHy&a$@P f^aRJg\>9SxB@$@2A@oFRy#R f a5|BBK%MBj` B@F`B@F`HxBa:$@P n -JB -j J"nx ٨ K -Mx"*n"0#m4` n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a$@P f^a~$Jg\89SxB@$@2A@oFRy#R f a}5|BBK%MBj` B@F`B@F`HxBa $@P n -JB -j J"nX K-Mx"` n(g (Ш("(Ҩ ~l`"(Ҩ x҄ ~m89SxB@$@2A@oFHxHy&aܰ$@P f^a}Jg\>9SxB@$@2A@oFRy#R f a|5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J"nX K-MB` n(g (Ш("(Ҩ xl`"(Ҩ ~҇ xm>9SxB@$@2A@oFHxHy&a۔$@P f^a{Jg\89SxB@$@2A@oFRy#R f a{5|BBK%MBj` B@F`B@F`HxBa$@P n -JB -j J"nx ٨ K -M(9*n"#y+h#y+h#y+h #m($-,xg"L<bMԂ#@`~#G*n#m0$-4xg"L<bMԂ#@`~#GHnHnHn*n/- /-Hx / / aF*O glJf.JgV n (Ш ".xlf "AK-M`&Hn/HxHnHnaOJf"n-Q`x-DJgJgj n (Ш ".~lf "AK-M`&Hn/HxHnHnaوOJf:"n&ox@l/.azH`v n (Ш $. CV"~‡nf Ҁ-A`*Hn/x.ȇ/HnHnaOJf .Hn///,Ha_POJf n,(LJg n (Ш ".xlf "AK-M`$Hn/HxHnHnaؖOJfH"nJg-Q`FJgB n (Ш ".xSm"/HxTHnHnaJOJg*`~Tށ-GJg$-FBHnHnHnaBOJf,.JgRB n (Ш ".xlf "AK-M`&Hn/HxHnHnaOJft"n"Q|$fj n (Ш ".xlf "AK-M`&Hn/HxHnHnahOJf"nJg l h\WID-L n (Ш ".xlf "AK-M`&Hn/HxHnHnaOJf"n$g"BHnHnHnaOJf(nJg-C`-B/.aX lhzJf lBXxg JfTJfJJg /aDBXHn*n/-/- /./-/ a#*Of n,(Lx*FlgzJgE6Jg4/NX`,E6*n-g/ // aO *n m Hx *n/-a?/ N L(f&/ E6N/ NHx *n/-a>p`R(Hn*n -V~r$ҀJgrHҀ/Hx / a>&@-KOJg"l0ix V~&X$K K+g +Ы("+ҫ l`\"+ҫ ~҇ mF*g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&ar$@P f^atJg\>9SxB@$@2A@oFRy#R f at5|BBK%MBj` B@F`B@F`HxBa$@P~ld Hya n -JB -j J"nר K8-M l0hx"B< l:hx/ /(D/ `R2ix/ l/(DHnHna&Og6$/ ` K+g +Ы("+ҫ ~l`"+ҫ ~҇ ~m>9SxB@$@2A@oFHxHy&a$@P f^asPJg\>9SxB@$@2A@oFRy#R f as5|BBK%MBj` B@F`B@F`HxBa8$@P n -JB -j J .~ ߨ ހ-G lHx /(D/aO *n - o/ at?`HV~&X n"H(g (Ш("(Ҩ l`\"(Ҩ ~҇ mF)g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&an$@P f^aqJg\>9SxB@$@2A@oFRy#R f aq5|BBK%MBj` B@F`B@F`HxBa$@P~ld Hya n -JB -j J"nר K8-M*n"B S$PBB|lgp`V.+-G$+BJfp`6'BJVID//, B/ / a&(OfJg$&BHxT /a3j-@ l O +f(Ю'@R'Jg lB l| B`Jg~fg HzaVS|gZBB SdP0*gJ*E-g4*nP+r(B`2,2.2*nP*+GB0*RQBCSd S ѫ Ѩ S l ,.ݫ lB L-mܕBx-DB*n*-E̸fgHzaHB` 4|H` dJg Jo*n -jR‰bR(Hnp AqJgpD"PJgrҀ/Hx/.N&@-KOJg*n"m0ix Vx&X$K K+g +Ы("+ҫ l``"+ҫ z҅ mJ,<ǘ*g (Ш("(Ҩ m`"(Ҩ x҄ l:9SxB@$@2A@oFHxHy&a $@P f^akvJg\89SxB@$@2A@oFRy#R f ak@5|BBK%MBj` B@F`B@F`HxBaz^$@Pxld Hya| n -JB -j J"nר K8-M*n m0hx"B< m:hx/ `b2ix/ *n m/(DHnHnan&OgF$C/ a` K,<ǘ+g +Ы("+ҫ xl`"+ҫ z҅ xm:9SxB@$@2A@oFHxHy&aɚ$@P f^aiJg\89SxB@$@2A@oFRy#R f ai5|BBK%MBj` B@F`B@F`HxBax$@P n -JB -j J"nx ٨ K -M*n mHx /(D/ *FNO &<FJgN n(g (Ш("(Ҩ xl`"(Ҩ z҅ xm:9SxB@$@2A@oFHxHy&aZ$@P f^ahJg\89SxB@$@2A@oFRy#R f ahz5|BBK%MBj` B@F`B@F`HxBaw$@P n -JB -j J"nx٨ K-M*n-g " #l` #l "P*n" "$` n(g (Ш("(Ҩ xl`"(Ҩ z҅ xm:9SxB@$@2A@oFHxHy&a$@P f^agdJg\89SxB@$@2A@oFRy#R f ag.5|BBK%MBj` B@F`B@F`HxBavL$@P n -JB -j J"nP K-M" *n"HnHnHn/./,Hx/ /.*CN$@O Jg l(( $DRJg-n n (Ш ".zlf "AK-M`&Hn/HxHnHnaOJf"nJg$BHnHnHnaOJf-nJf n (Ш ".xlf "AK-M`&Hn/HxHnHnadOJf`"n*n+Y +Q$ n (Ш ".xlf "AK-M`&Hn/HxHnHnaOJf"n$gJgJgf n (Ш ".x lf "AK -M`&Hn/Hx HnHnaĢOJf"n-QB(),)`` n (Ш ".zlf "AK-M`&Hn/HxHnHna0-l,B(x-D$B (n fg*HzapB$` 4*C/ auX` :|H` 6-nB@J$g J o(n0 ,jR(n bR(Hn`Hx\Hx/.a&@-K\(n"l0ix Vx&XO$K K+g +Ы("+ҫ l`l"+ҫ z҅ mV,<ǘ*g (Ш("(Ҩ m`"(Ҩ x҄ l:9SxB@$@2A@oFHxHy&aJ$@P f^a_Jg\89SxB@$@2A@oFRy#R f a_j5|BBI%LBj` B@F`B@F`HxBan$@Pxld Hyaʦ n\ -J\B -j` J"n`ר I8-L`(n l0hx"B< l8hx/ /(D/ (FNO `*2ix/ (n l/(DHn`Hn\a&Of n\KF(g (Ш("(Ҩ xl`"(Ҩ z҅ xm:9SxB@$@2A@oFHxHy&a$@P f^a^Jg\89SxB@$@2A@oFRy#R f a]5|BBI%LBj` B@F`B@F`HxBam$@P n\ -J\B -j` J"n`x٨ I-L`(n0,g(n " #l`(n #l "P(n," "$(n0""HnXHnTHnP/.(n /,Hx/ /.N*@O Jg l( *D-nH nT (Ш ".XG:nzlf "AI-LX`&HnL/HxHnXHnTabOJf"nLJg$BHnXHnTHnHadOJf-nHJfR nT (Ш ".Xx lf "AI -LX`&HnL/Hx HnXHnTaOJf"nL(n,)Y )Y$$gJ$g nT (Ш ".Xx lf "AI -LX`&HnL/Hx HnXHnTavOJf,"nL-QB().) S b&Vzƅ, <(f,Xr҆x„,Q$l@(nppppOG Ѷ`*RDR znLB/-//*/ /NOJg/ / /aL$O f"Hn/-//*/ /N n!J(B`"t/*a!/a1Hx/ a L<N^NuNVH?<*n*.B-m mH h>.-GR'Hn(V ~r$ҀJgrHҀ/Hx/ a&@-KOJg"m0ix V~&X$K K+g +Ы("+ҫ l`\"+ҫ ~҇ mF*g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&a$@P f^aRtJg\>9SxB@$@2A@oFRy#R f aR>5|BBI%LBj` B@F`B@F`HxBaa\$@P~ld Hyaz n -JB -j J"nר I8-L m0hx"B< m8hx/ /(D/ `N8ix/ /)DHnHnar&Og6(/ ` K+g +Ы("+ҫ ~l`"+ҫ ~҇ ~m>9SxB@$@2A@oFHxHy&a$@P f^aQJg\>9SxB@$@2A@oFRy#R f aP5|BBI%LBj` B@F`B@F`HxBa_$@P n -JB -j J .~ ߨ ހ-G mHx /(D/aO o/ aeTx?`l~ȇ&X n"H(g (Ш("(Ҩ l`\"(Ҩ ~҇ mF-|ǘ)g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&a $@P f^aOvJg\>9SxB@$@2A@oFRy#R f aO@5|BBI%LBj` B@F`B@F`HxBa^^$@P~ld Hya| n -JB -j J"nר I8-L"BHxJ/(Da6 nI|!LDP` ~@lBHxJ/al n!@DO ///(D(nNO n1Cx`\(n0lxf$///,DaO Jf/ a, X`0Hn///-Ha2(Og/.aa` n,(LJg-F n (Ш ".~lf "AI-L`&Hn/HxHnHnaOJfR"n$g&BHnHnHnaOJf,,.JfD(nJfB-fB`R((HnHxDHx/ a&@-K$,"B0ix V~&XO$K K+g +Ы("+ҫ l`d"+ҫ ~҇ mN*g (Ш("(Ҩ m`"(Ҩ ~҇ l>9SxB@$@2A@oFHxHy&a,$@P f^aJJg\>9SxB@$@2A@oFRy#R f aJL5|BBC%IBj` B@F`B@F`HxBaYj$@P~ld Hya n -JB -j J$nר C8-I l0hx$B< l2hx/ /(D/ aO `."B2ix/ l/(DHnHnar&Og$/ ` n(g (Ш("(Ҩ ~ l`"(Ҩ ~҇ ~ m>9SxB@$@2A@oFHxHy&a$@P f^aIJg\>9SxB@$@2A@oFRy#R f aH5|BBC%IBj` B@F`B@F`HxBaW$@P n -JB -j J$n~ ߨ C -I$%E%nHnHnHn/./.Hx/ / ai$O gl n (Ш ".~lf $AC-I`*Hn/HxHnHnaOJg$`J$n$R|$fH n (Ш ".~lf ~ށ-G` Hn/HxHnHna8OJf-L n (Ш ".~lf $AC-I`&Hn/HxHnHnaOJfV$nJgBHnHnHnaOJf0Jfx n (Ш ".~lf $AC-I`&Hn/HxHnHnatOJf$nHx/ G/ aO Jg&+j$<u1/.a[ LBB-|-|BBB"n`A-FJVI-@D h>(gJg>9{0B@,@2A@oF-F|"n$idJg(*|m *$~mF f/ aXAJf-j``"n`g|-F *$%@$!R *HL< *@(G"*T[I$ & ցՀ .".c-B-C *XT"[IցՀ .".d-B-C$DJf< .|g ,.|B@F`aCJo&~g*/./."n/ /././.a&O`fBBo^x؎"DX$Q *HL< -@x-Ft"*T[I/./*`.*XT/,.t..xށ݀///.a&OfRn u1f"n/)HaXBonx؎"DX$Q *$%@$Jg / aŒX`@"nRh *$|%@$ *$%@$BXBT/ / a Z/ aO Rn>9{0B@$@2A@oF"n$idJgB&(* *$g|fJf *$%@$/Hz~// aT-@OJgB@F`aBJgj/.B/.awO Jf fDB*9څ`4 *$Jm HzaaFJfJf *$fl/ a,XGJfJf *$|` *$%@$JgB@F`aAd-|`'J jP 9` hL/ p NX`$DJf gB@F`aAJgB"n iH`p`|fx`Z"ni2/Hzz|/HihaS-@Og./.B/.auO Jf f B*9څ"nJhf"nJdgJf"n0)zg-it@3@z .L<*n(-B(D"lH i>" -S| e 0; N0000$ m ` m | `JgR($HnHxDHx/aj&@-K(D"l0ix V|&XO$K K+g +Ы("+ҫ l`f"+ҫ |҆ mP*g (Ш("(Ҩ m`"(Ҩ |҆ l<9SxB@$@2A@oFHxHy&a$@P f^a>Jg\<9SxB@$@2A@oFRy#R f a>5|BBI%LBj` B@F`B@F`HxBaM$@P|ld Hya n -JB -j J"nר I8-L(D l0hx"B< l8hx/ /(D/ adO `42ix/ (D l/(DHnHna&Og*/ aS`HnHnHn"yB i// Hx/ /a_h*O gl-D n (Ш ".|lf "AI-L`*Hn/HxHnHnaOJg*`"nJgBHnHnHnaOJfJf n (Ш ".|lf "AI-L`$Hn/HxHnHnaOJf"n -|g m|g`@|g|g`2 m `* m ` m "i ` m "i|$WID /.aQ`pJg`$i>*f$/9B yB h/// a*Of<&n(.*.(n nB$k$*0e"[I@ªD,g"Hj//*0/+HzajHzHjHzqHxaz%EO ` Hj/*/+HzxaHza^Hy // /./ a n$Oo n**d!@H/+aD// / I NOo/ **T"BHq/ NO z ѫz//.az n ($@!@$/Bިg /.a`N/.ab`BrJ>f6-|-nxBBr-A 9"nx iLHn p NXo J>g /.|a.` /.|aX&.lBoD/*0"F i p, (H"*d// a"F i p, "*d!@HO R֪8nB`"o /.|aXdg /.apL<8N^Numode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free NVH0<(n*l&, lB$m&jJg  @f / a @X` j"+ L+,b LAHy //// a$Og mH h/,//-H h N$@O Jg,-|`-M-B-C 9` mLHn p N `~ l P$hJjvg$Hk/*B0*v/HzaLHza *g//HkHza*BBRB`"Hz l /(/ a!HkHzapL< N^NuNVH?0 n"(,.(LAx&h$ Bɲo6,(pE*(lF( " … r 0o n& $Rn LL N^NuNVH?8 n(. $.$n"h&)\"LCJg 2,f~ m$(Li `Jg 2,f"(LiLCH҄` "RLi&),LC()LCH$o*(ipE,)lF . "† r 鉸oZRnBm(,)pE&)lF "ƒ r 鉸o,RlB`p&)8(؃ )Xn^.)`в,g`L#BL)( Щ8`<")@g4L)DL) i| 눐A L@&AG8 LCL؀ LN^NuNVH<8&n$. (.(n*$k//.// NOJf^v`ԃn/B// NOJf@փ"*, n TLAvo$/B// NOJfR *,fBRnBL.`*+T-C( +8oA<4JfRnfJg// / l/(Ha.Lk&.O +8C4oJ8|"҃ l^$ UgA) ` Ъ` @ l^z 㨁R +8n&ת$׫ *+p"+lF́*n u װh |R</.a4 `/// / Bah.Ol/.aB`B(D* (EC4lF"҃ l^$ UgA) ` Ъ` @ l^zpFRm*.$"*+p$+lF *n u*. |SgRL/.a`L+h ЇL0 n&. (.$h0b"[I@ªD,gHj//*0HzTa}Hzkay$e /HzlayHnHx/*"* LAL$*FL*ҀҪ ,*d//( aOJg/.` n&h<$+ Ug Ug/a0B` Lj0f2,*`/ Ug ` Ы`// a$@O `f,*T줕ʓɸoF*"҉ l^$ UgA) ` Ы` @B$l^|ĆgRRnJgg Hzcaxb/.azJWIDL |N^Nuifree: range: dev = 0x%x, ino = %d, fs = %s dev = 0x%x, ino = %d, fs = %s ifree: freeing free inodeNVH<<*n(- m(h&l$+ L+,bHk//,Hzbaw&LB0HnHx/+"L+$+F L+Ҁҫ *+d//, aOJg/.an`* n$h< Ug Ug /aF`A-d%P Lk" UgA ` Ъ\ @B$ząf(Hk//,Hza{OJ+f Hzav" UgA ` Ъ\ @0d%D0R R"*+pC$+lF  qR -  @f"SS *+p"+lFƁ q S8|/.a@BL<&1hC? $1hBn n g,փԂRlڮnHm/HzawHzasn ЁL8(n"l iH(9f&iA-d-PC h 눐A -@ +Cgx'@g lJf I'P lJf I'h +g0 l Jf I'P l Jf I'hBz۫,,+(݄'F(g'n'i +x'@gzʀ'E$k|,m 7kz7k|HnHx/*0"+Lj L*$*F‚L*ЁЪLj0x(*`Ѓ**d//+ a{$Og/.a `V n"+LjxHxHkvШ" l^~‡ Є..g*&$"m f. ߐ҄*,8փԂRlXXXR"EnL<,.(. yn 爐A  yC & "F*iH )0z C$ $HcGHI0g *$ f jPJg-|-HBC-IBB 9 hLHn p NXJfR n"D fF"gB mP(`B vr₃1(`. vЀr䂃1(` v悃1(` Hz~aYR$.&.N^Nuffsffs_mountroot: can't setup bdevvp'sroot_deviceNVH00&9B yWrgp`Hyz@/9TazPJg HzaXHnHzHza$O f//./9z@a$O g("n iS@/ a6Hx/.a `$n$(G,%SA"Pf"` y, & S h>$h$ HxB/adPOBHxY/"./aw$/ nHh>/av/.aO. aeBL N^Nu%s: file system not clean (fs_flags=%x); please fsck(8) NV|H<<&.&n(.HxlHn/.auR$O fl"C )6gZ*i>(mJ,f`gZrgr///a($O fHx/ aPPJf,g|Hx/ a*PJf|"C )6g//+0/a$O fJ,g"C)6g"D i PJg~$m/</ aH"D i P-|-Jz-E-@-D 9 jLHn p N$X-|-JB 9 jLHn p NXJg `4B,,@|JfHnHmB/ap`B$z@'E(B&'D,/ a$Xf$kzlg/ ap` jp gm/ ap`"D i PJgt"C)9ft/</ a""D i P-|-J-B-@-D 9 jLHn p N$X-|-JB 9 jLHn p NXJf4"C)7f/// a$O `gt`/ a6XJg / a(`"C*i>(mHn|Hx$ //. E >N .|*</BHt G$NHxZ/"CHia.O Hn|HxY$//.N .|O,zZ/B"@Hq9 NO J,g:B,,g A-d)P `,I//HzBaX^O Hx/ a2BL<<\N^Nuffs_reload: dirty1ffs_reload: dirty2NVH?<"n)9fp`"n i>*hBB/./. B/ aOJg HzaS-|-M-|dhC-I|-F|-F-n 9 mLHn p NXJg$<` n$((HnHxHx "[I//Hx BaO ./ ae*Og/.aj `"n i>$hBHx/*haz&@ n/*h/(!n^Hz a"n #@b#j(:i8()n)M)jt$)jd()j8,tGBYQBBSd&mp| j0"j4)HB)IF"*0[IB&<,Ld-F-G|Ѯ$.&.BS *0"*4c%B0%C4B`Hx/.G@NPHx/ NP .g /abX/</ aPpJgp-|-M-@-n-n 9 mLHn p NX-|-MB 9 mLHn p NXJgHx/ aZ n B> L(kJ,f*Hx/ aPJf,g|Hx/ aP k hprè/</+a8PpJ,gp k-|-H-@r-A-J 9 hLHn p N$.aHx/,E@NHx/ NHx/ NB>m8 L<N^NuNVH80&n&. (.JfrƁ$k>+8g:r/B/ aO Jf.BEJg// /a>O Rrl/B/ aVL N^Nuffs_statfsNVH88(n&n l>$h T\g HzaHX6'j4'j0'j( $*L*(8Ԫ'Brd< *((LLHxdB//avO"j($ "A'I *,L*U'@'jp>Ќg*HxZHlHkLEǘNPO.ZHlHkNO Hx l/Hk<*n,. (.*.(m>B&lJ+gJ+gHkHzaKHzaG4$mJgHf$*X jfJdgf/</ aPJgrg`JrWI-|T-J-DD-@-E 9T jLHn p NXANJg&/ NX$BJfxrWI l-|T-H-DD-@-E 9T hLHn p NXJg&/ a?XJ+gB+A-d'P // aj& L<|N^NuinodeNVH?<,.(. *."F*i>&-E f`//N"E"PfBHx"HyI.NO JfHn/9/Hxa0$Og"EBBHxHyN `HxHy{`a9&@HxB/ azPOBBHzLHxHk4a n!K'H$m'J'C'DOpA$BYQB@Sd/ a BHxHyNHnHx/*0"Lj L*$*F‚L*ЁЪLj0x.*`Ѓ.*d//-aWj$O$g/.a$/.a[`V nLj@xHxШ h")td (,L(bpF`/./ / aE|$.$nN^NuNV n"n h2 #h#hBN^NuffsinoplNVaEHx-HyHyhBHzBBBHxHy{`a2N^NuNVH8&.$."n".x gp`T n xg mxg`// //a`p-LN^NuNVH?<(n$l-jP-j8-j<(*@**D,*0.*4tLf%BPv,m G8"+pCA "YYSJn&$,B&,F%B0%C4BB/*h *Td/Hx Bat^PO./,a[p&@/*h/ /+z$f6-|-nBB|-F 9"n iLHn p N& LBHxY"iC/ HhaV/ nHh>/a/.a OBaEJBLN^NuNV//". AA T\f (0 n abB`P# X.`#DD (4L($#x$9"v &<B$#TRR$&N^Numfs_mount: dup devNVH0<(n*nHxtHn/.aTv$O f ,6gJ l>&hJ+f*grgr/ // aP$fnJ+gP,6gFB+`>Hn/9NBHxa$Of4 nv!ClB"9 v &<A"/RR/a O Jg Hza5BHx.Hx$al$@ n!J%n%n$%m0 B/ / /a$Of l>&hHnHx$ //. E >N .&</BHs G$NHxZ/HlakO HnHxYHl/.N .O,vZ/BHt NB`v%C/.a: L< lN^NumfsidlNVH?<,.(n"F i>*("E&iB(+`JgBHx/aO Jf/ B/aO JgT,Eg/ aXS,` <&$28Jg/ axXS~r ` %8B`F$@K8Jg$'j// a/ aO $kJfBHz/9Fd/N"O +~f( L 1 mfs_closeNVH <(n*l&m$kJg($<<'j/+/ a/ BNO $kJfBB/,/, Hx/ aBOJf@ -4rl/Hzfa5zPr4mJg Hzja1r'A/ aBL<N^Numfs_inactive: not inactive (mfs_buflist %p)NV n"h i (grg /Hza0-|-IB 9 iLHn p NBN^NuNV/ n$hHx./*aBB$nN^Nutag VT_MFS, pid %d, base %p, size %ld NV n h h/(/(/( Hza4PBN^NuNV/ "n$i Jg i h$ )g/)BB//)/)aX`B$nN^Nuufs_bmaparray: invalid argumentsufs_bmaparry: indirect block not in cacheNVH?<&. $.$n,.B"n(i-iH"n*i>JgJg`Jg Hzta/ Jg"FBpH@"nLiF*S&BJfGJfE/ / //.a$Of-R".fv 4= .-("n"gJgR~ m"F"o E A Э,fR.R"F"~ mRn`/ aE `| +(4 ΕG "AS-I~g<$Jf//.aFPJg"gI Jg / aE,X~'GBB"n/)F//.N$@ *$OflrҎIJf Hz9a-.-(%DH *$%@$-|8-J jP 98 hL/ p NX yB hR,/ N$Xf + j<(0 ~fBJg>Jg:&R$d0"F"o( j< 0<Э,<fR.R"F"$dRnG ."@S-I~fJg/ aD.-("n"f~"BLJg"nB-GlDt ltB|8|vރ"n")$B$L$-B-C`0SJg\"n")$B$L$-B-C$L(ծ LѮ*.,.&[I-B-C "lJm( W .`p`( W .D*v+CBK ~tm-n-ng"n")$B////a]LO*,///./.a]2O"n-i$B/././/a[OR*+ABK R"[I$L$&B$C$L( BLRvlbJg"n"BL P*(FS-EJf$+^g"[I(+~*+cBBbz-E`'Bb,.̂gx"[I-|-L-@-ABC-I 9 lLHn p N$Xg8`:|-kbB8*-D'Dj-n"n i S`Jf:Ӯ~f-kb"nm:|=j(.ثb-D*.JgXB*"nfH/Hj/)aZO Jf0 lHJ:o *g'Rf6*'Cj/.a9\X`-kbB0*".Ҁ'AbB0*܀Jg-A +bm,xfz-EBb-k^` .g /a8X~g.xg&zf^"n i ( fBJng:Jkxg2"n )-|-Lx-D-n-@ 9 lLHn p N$XfxJfD$+~&+BՅ"~ x &,* E "'AbBV-A`J~f$'nb(.fBV`,*.'EV`'nb'nV .Юo-@ .j .@'@Z~"niJf$-|-LB 9 lLHn p Np`"n)gxg/ "n// aC`xfRU$PB*XzЂ"B(+~*+c.Hz/+b/ aTB*XzЂ'@B~~O JngJf (+bD'D^zfJng"n )-|-L-E-n-@ 9 lLHn p N$Xf +bfBV`'@V(+ff/ a"n"`^ lH hHn/+f/,H h N$O f<+vg,"n )g"g$n jg/ aNp`"n"`xfJgJng"n )-|-Lx-D-n-@ 9 lLHn p N$Xf*+ffp` lH hHn/+f/,H h N$O fn"n""niJfR-|-LB 9 lLHn p N`*.g-|-LB 9 lLHn p NX lH hHn/+f/,H h N$O g/</ aN `JgJngHx/ a,$Pg|/.a~`(+ff/ a"n"X`\ lH hHn/+f/,H h N$O fXJgJnf&-|-LB 9 lLHn p NX"n""n)g/ "n// a@BL P Bn HzabJf>$+~&+BՆ(~ r &*(㬊(E,*F'L~'M~`*ګb[I +~"+d'D~'E"+b[I-|-M-@-AI-LI-L 9 mLHn p N"@XJf$nB*Xr$PB6*B:*VlVB nJg5B`ւ, ("F X~$P8( րڄ/// -IaNO "nVm g(rfB(n B,/HlHjaOO Jf Ђd HzaB(n 9C`l Hza(n 9C5B/./. / aNfO n-|`-H hP 9` hLHn p N"@XrJfXJZgR*+Z[I +~"+c<-|-M-D-E|$-F-n-n 9 mLHn p N"@ L0&n*. (.EBB,+~gBHn/HxHx//Hx / /+BaȠO,Jf:Jf4Jjg."|d*B*|m *.f|g *. fgB`pr2*ցՀ +~"+bzpL |N^Nucheckpath: .. not a directory NVH8 $n n &. (-@"(tgBxg`t`B`BB/HxHxBBHxHn/BaǨ$O,fb .fX n..fP .gxgB/.at"n iH hHn/./)H h N$Of| . @lgvtxf Hza@X .g/atJ LN^NuundefinedgroupuserNVH 0$n&j kH$(>J f Hj B//*/ a OJgrf&J$fHj$Hx//*/ a JgrfBL N^NuNVH80&.(. &n$.f/alXJgl\B CG $[JgD`@5@Hx / a*P0*f *(Єk%@(`B(0*@@5@Rrl`vf.Jg(B CE Jg// //aOJfLRrlB CG $[Jg,`@5@Hx / aP0*f٪(jRrlBL N^Nu %s: write failed, %s disk limit reached disk quota exceeded %s: warning, %s %s disk quota exceeded for too long %s: write failed, %s %s NVH08&n(n".$$s "j( I * b@Jg<*f&+涬fAG/0 k hHA/HzaN` *$bJgcRC-d k hH h>A0 а%@8&+涬fxHzAG/0( k hHA/Hza`PA-d 8oB*f6&+涬f,HzAG/0 k hHA/HzajpE`BL N^NuNVH80&.(. &n$.f/aXJgl\B CG $[JgD`@5@Hx / a`P0*f *4Єk%@4`B40*@@5@Rrl`vf.Jg(B CE Jg// //aOJfLRrlB CG $[Jg,`@5@Hx / aP0*f٪4jRrlBL N^Nu %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too longNVH08&n(n".$$s "j4 I *,b@Jg<*f&+涬fAG/0 k hHA/HzA8 а%@<&+涬fxHzAG/0( k hHA/HzHaH`PA-d B(@C@GA Jg"fJf/*HzawtHza tRXRtlLN^NuNVH><,.*. (."E&i>$I(Br@-AB-n-FBHxHnax&O fT$n-|-JB 9 jLHn p NXrlg&/"F i/Hx/ ap `/ NX`g///aO K@5H"Ei 8r0("F i PRP i'(E0% :(I8) :(Hn// BBanOJf$ n (8o%( (("FK&uHJfB`"FI@4("G$iJgP*&*XHx/ ajPJf"jA 0XBX// ap/ ak *XO fHf$@Jf/ a rë0/."n i/Hx/ a&BH"FE/2Ha|zr%H4(B MJfRrlrf"Gi8 L/. Ba$Of"Hx /.r Ү/a'$/.Ba $.N^NuNVH08 n&.$(>Hx G/ /.a' O Jf@Hn///. Ba2OJf$$n`@5@Hx / aP0*f-j(-j4Jg -j8-j< .g("*(b *$gcA-d(BC0 б<-@ .g("*4b *0gcA-d(BC8 б<-@%S %n$%n(%n,%n0%n4%n8%n<(j($dj *04cjJfJ$fJ,fJ fj`jj/ BaBL N^NuNVH00 n&.$(>Hx Hn/.a%O JfHn///. BaOJf$n`@5@Hx / aP0*f *$g"(cbA-d&BC0 б<%@8 *0g"4cbA-d&BC8 б<%@<%n(%n4&j($dj&j40djj/ BaBL N^NuNVH08(nB"l>AJfRrlrgr$lJgjHf&*X/</ agPJgrg`>BGN"jA p,Jg(g // a PRrl/ NXXf$CJfBL N^NuNVHyјBHx/9ah#xADB#HN^Nudquotfree dquot isn'tNVH><,.$. *n(.*.&(u8Jg5H@g "EBp` Ђј yxG $SJgPBfB0*"jA f0Jjf jJg!j `# H j / aj`V$RJfADJf 9ЀWoZG"9W䲹Gl0BHxHx@a^$@Hx@B/ a:,O RWO `b$PJfHza"EBpD` *g Hza jJg!j `# H j  RJg!j j g/</ aP $g S!J&%K/ at5|%B%M5DC-Ir-AG -Kr -A-A-BBr-ABB 58X-|L-LC-IB-@ 9L lLHn p N$Xr f"JfBB$B(B,B0B4B8B//aq"@Jg n 0 nC4 B`p N^NuNV/ / n&n $n"hHn/+/ i NO JgB`* n"hJivg "ig/a_nBpF`$B$n&nN^NuNVJGfp#GaaN^NuNV n/( /(/("h A 0 /a%N^NuNV/ / n&h$h/( / /( A 0 /a$OJf4 R hr +Hrg!@/a^ RBl/adRBB$n&nN^NuNV/"n i h (gr ©ptgB$N^NuNV// n h"hr4lA-d-P h 눐A -@ itfP )Cgv#@g#n~ )g#nBtթ,&)(ׁ#C(gj#n`^ )Cg`t#@g #n#n )g#n#nBtթ,&)(ׁ#C(g#n#n )r€#AB$&N^NuNVH08(n&l$k&,$rāgV +lre80; N000000 kH(9gp`F/ aXJf8Jg *gp`$/, //*/*2*v//+lanL N^NuNVH>8 n&h"k$hA-d-P h 눐A -@ )Cg`x#@g #n#n )g#n#nBz۩,,)(݄#F(g#n#n )xȀ#D%i%i:)v%E8ix%L%i %i%iH()~*)%D%E %i(%i,%i0%i4%i8%i<%iD%i@ +lzf %|$`|f %|$` kH%hF$")B&x$z %@L%AP$l()(*),%DT%EXBL|N^NuNVH<< n$h(h&l*h ((Jf,zf$ff$fHf Pf@gp`pzDg lH(9fH"mg"DHi0/ akpPJf8Jf +gJnZ'jD`."+ fDB0*FDf8BAJf2BB0*F'@z *DgB` +gp`z fg* lH(9f// /*/* / aXOJf$*&* prgh ,lzgez`zg`p`V lH(9f8-|-L-B-CB-M-D 9 lLHn p NXJf &lz(f0g lH(9f"mgT"DHi0/ ajPJg@*_g-|-Lz-E-M-D 9 lLHn p NXJfz(g lH(6fzz0gz-|-LC(-IC0-Iz-E 9 lLHn p NXJf&Bzg lH(9gp` // /*/ a L<"Di/Hn/ a=:$@O Jf&m nJg(hJf"+"Bg HzaJg\JgV0+x @c4|`R@7@xr-|-MBBr-A 9 mLHn p N$@XJfr// /aF$@O JgLJgVJgNSkxr-|-MBBr-A 9 mLHn p NX`/ &<N"CNXE`x ,f"Bg Hza","Bf Hza+vg "D i (ggg4|`0,v@ @@fB"D/) /+/ aO Jg lxo4|B`fJf4|`Z/ aX` Jg4|`B/// a$@O Jf*&<NEJgJf Skxr/ "CN0,x2SA9AxXJg`S@2@SI9Ix @g Hza n"D ) &i-|-HBBr$-A-@-K 9 hLHn p NXr/."CNX"F )@r #A/Hn/.N$@O Jg"G/)aJ` nJg(h"n&i` Jg Hz}a$"G/)aJjB`~gJgHzWaJgJgSkxrBB"D/) HxHxBBHxE/ /.BKE"NO,Jfb .f n..gHzHx /aO `<-nBB"D/) Hx,HxBBHx/ /.HxNO(.a X//.a2$@PJf SlxrrìJg /."CNXJg /."CNX"G/)aIT`h&<NJg /,"CNX/+"CNXG6Jgr"BéHx/.anPJf"BSixr/.aH`/.N.N L P Bn HzaB~%|r/ / / a$O g&SkxrJgBjxr/.aE0X` "D i Hx /,aA/ aE L<N^NuNVH8< n&((h*h "C&i$lf/ aE/aDp` kxf/- /*/ aΖO JftB` *f +gt`~/ / a$PfnSjxx/ EN/ aDVUkx - "-P-|-CBBx$-D-@-A 9"C iLHn p N$.NXENJg/ NX/N L<N^NuNVH88&n$k/+ / /+ k"(A/a &Of(R/+a( lHX:l.$l//+HjaO $[I%A~%Bt`0BB k /( HxHxBB//+/ Hxa&O,/ aC. LN^Nuufs_readdir: lost in spaceNVH?<(n$l$*&* (* * Є"fp`f*D%A R!A l , -|L-H-JB-@ 9L hLHn p N-@XfJg|fg HzLa R"j P-H-B-C-j-j .".o&B8(gpr2ցՀR: .".nܓBHxT /a:@"@%B%C l l $.&. n *"* o&Bpr2(ցՀ""8( *"* n. ߪ"l l h,*.* ~fTID" .L *.$. ,.(9PS g HzLaѐ&9P g Hz4ax&ւJWr€/HyQaj$@PJf`Br%ABB$%C %EB/HxR$/a*%@O gP/HxR/a*%@O g(/HxR/a*%@ O f2HxR/*a.4PHxR/*a.$P/ HyQaǸPJg/B/* a L|N^Nuamap_freeNV/ / $nJfJg HzahHxR/*G@NHxR/*NHxR/* NO *$grg HxR/NP/ HyQa$n&nN^Nuamap_extend: amap changed during mallocNVH?< n,. &h0((,$( "9PS g Hzlaϰ&9P g HzTaϘ *ڂ-E(؀ +n" +$gH~g@Hx/// a`. nP k$Jg@~g:oHx/// a + k$"~f~! ` ~! ! 'D`ؙ +$g8~g2HxHxR /a((@O JfHxR/+$a,*'G$PBHxR$/EN&BHxR/N*@BHxR/N$@O$ n Hz~aΆ,-k +//./aO 'C-k +//./ aO $/B +Hr aj'J $k +// / aPO.B +Hu a<'M&+$OJgp +/// aPO.B +Ht a'L$ +O o Hx.9P/// aO +~f~) ` ~) ) 'D'D HxR/.a*HxR/ a*HxR/.a*OJg~g HxR/a*L%@O g(/ HxR/a$&%@ O f2HxR/*a'PHxR/*a'P/ HyQa8PJg&l0xfxɬS/ a`BoB"j ,,Ё k #  j pJgR j! * j! RRn +*@S'Mxf +gxȀ'D +$gxgHx*l / /,,/ aB,)J0xɬL<N^Nuamap_cow_now: non-resident wired page in anon %pcownowcownowpageNVH8< n *h0B -o m(0< m (pL&lJf / HzarlJ,f0+$g @ 7@$BHzBB/ aO`a$$gBBB/BBa$@O`JgJf/aNXHz@aX`P/ / a~S m !Lj$/ a~O -Rn*L<N^Nuamap_splitref: split at zero offsetamap_splitref: map size check failedNVH00$n&n $."9PS g HzjaǮ&9Pf Hz~aǚ j (Jn HzaǀJ$f/a'j kRԒ&L N^NuNV/ /$nHxHxR * /a "%A$O ft%B$`2 * /B/aR j$ *"*tfR `F !A$.$nN^Nuamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countNVH?<*n(. $.,."9PS g Hz(al.9P*ڂ$m$BozCA 2<o S"~ `F" <". ЁlH ".~fR%<` F%<%<$.".~fR%L` F%L%L-@"ցng HzaκoIG 2<o S(~&`F(&< ЮlF" .~fR%<` F%<%<$. .~fR%\` F%\%\-A$.Ԇ-B(l Hza@ .~fR%<` F%<%<Jf/.// aO ֮nHL0&n*. ". +o x$&ց`BB&`Jg k J,gp ` k 0,n`o\ k $p B k"p "+ Sg k! k 0 k! "+S'A ,S$|f / a*XRn|L |N^Nuvm_map_lock: failed to get lockuvm_anon_init: can not allocate %d anons uvm_anon_initNVH<"9P lpЁ$B&//9Ha4&(O f/HzaHzaÒ/B/aACPB#P#PBo"H  @P A"zЅRnBCTL<(."D")|@lv*)(RBK亃oP"D i$$p<Jg/. //(nNO g/a k"(/B/// S/aOXR 9P؀րnBHx&k X/ ad .LO Hn/./.a3O Jg$n * 谮d-@*g"$*BHx".X/aO -B` n-h$n(J$* gBHxHhap` -BXBTJ(frf:|-MTJTg-B,gB.fJf,BHx".X/aVO HnafRQ8X`r‚-AX-l0L.,JLfJfBHx*nX/ ap` 8JPf~ l4K( CHd-|P@HgHza$n&. *n@,AHh$0H쨴d &@* * AHl$0H @Sd BA,( ` *.|BJLg(K-MH// "/Hl,aՄO$n`BHr4f-|P@JLgJBoD(nH \Jg4$hJg,*%f$J,fJj(fB/*0a$/ a_O RnJg4"n E*G"mHx *n@"Hp// iNOJLg *nHK-MH *n@"ڀB&B@B@o-|PD(nHGdg/ n/aPJgr&`JLgJfB`xr&f :|-M@`f$T jJg\J,fV0($@fL/a_RQa/TX`ZNqNVH? BBBBB$y-0Jg` *("~fHJfB*- f *pd0, (`* m$ n *tHe / aVRX`d* &$jJfJf2 9P" F€.9PPe$EJf$FJg/ a LN^NuNV/ /$n j"Hh / yH/a j /aOB@F&rê( *-f / a)X gB@F`a.$BpRQ$.$nN^Nuvm_map_lock: failed to get lockuvm_init: page size not setNVJPf HzaBHxlBHyC apO # HnHnaQa/./.aaaaeaaaZ$HxHxa4N^Nuvm_map_lock: failed to get lockNVH?<*n $-g$B,- Gh cp`H cB`: c 9P(Ȁ"F́$ ԄԀāpH@d &BJgHxHn/9H///.a%*Og,~ f"9Pd 9PFƀc&`$A%dd$ / /خ/N*O f܃BHx&yHX/ I.NO "< hJg Hza"yHRHn nHp8// &ANBHx.9HX/NO .gHx/a!vPBJf L0&n,. &.*. g Hza~ 9PրFƀ-k.  @'/Hx//Hn/ aOJgB`g` nHp8// aB`~ yH .$.(JgdBBBB//aU @OJffHz.ae6X`h$C VEPBHxHx/(0//N ؀ԀO` .L |N^NuNV/$. "Ү 9PҀF€/Ā//.a$.N^NuNVH00$n&. BHx$ X/G.NO Jg Hza*RHn"Ү 9PҀF€/ƀ// a/ a;BHx/NO .g B/a L N^Nuuvm_km_alloc1uvm_km_alloc1: non-released pagekm_allockm_alloc1wNVH8<(n&. g Hzal 9PրFƀ-l.Hx'HxGCt*K//Hn/ aOJgB` yH .$.(Jg//aBn @PJg60($CƼ f Hz,a@ 1@$BHz9BB/NO`BBBB//aSL @OJfHzacX`h$C VEPBHxHx/(0//N ؀ԀO`T .Jg/B/aÔ .L<N^Nuuvm_km_vallocNV n g Hza 9P". ҀF-h.Hx'Hx/9Ct€/Hn/aJf .`BN^Nuuvm_km_valloc_waitvallocwaitNVH 8$n$. g Hza 9PԀFĀ"*. *2dB`LICtG -AHx'Hx//Hn/ NOJgBHzHx/ a4nO"*.` .LN^NuNVH>(.&. $.<9SxB@*@2A@oFJWID//9P//a:$O gB@F`a!: L|N^NuNVH<&.$. :9SxB@(@2A@oF/9P//aO gB@F`a LsBsCBB# #H# YBA BB # #H# l B BC\ACXB <"Y"@"C: t:҂RYoHxHyHyhBHzBBBHxHyhE*NO$.HyHyhBHzBBBHx:Hy N$.$nN^NuNVH88(n&n &.J|gHxHy ar$@B*8P`Z89SxB@$@2A@oF$yCXJg#CX gB@F`aJf HzDa~V|8"J K""""""""""""""%C Jgѫ'CJ0g/Hk,Hj,a,O R`$ S%h R!J j +g /*a `g k"hJg "iJg/NLN^NuNVH88(n&n &.J|gHxHy aq$@B*8P`Z89SxB@$@2A@oF$yCXJg#CX gB@F`aJf Hza} |8"J K""""""""""""""'C %C JgѪJ0g/Hj,Hk,aO R`$%k'J j +g /*a`g k"hJg "iJg/NLN^Nuuvm_map: unknown offset with non-kernel objectNVH?<(n,.*n(.&.*~ʇuC-Gv-GtC-G gp`BHxC-I/ a0O JfR-|.`:gp`BHx/.-|."nNO Jg Hzja{R./// /. /"n // a &@OJfBHx/."nNp`hRJfB`(~f"~g Hza{0 yH"n (."f"n $ fp&ЌgfJg Ыf|+ftfn.. fd..$fZ..4fPJ(fJ k0Jg~f:R|(Jg m hJg/ NXJ0g // aPݫ ݬd`fJfp&Ќ kg ІfRsJ|gHxHy an>$@B*8P`Z>9SxB@$@2A@oF$yCXJg#CX gB@F`aXJf Hzay|8"n %Q.*ކ%G %M%DJg~%G`Bg *~%Gf~ %G%E%n %n$B(%n4g.g p.9P`BB//aB,%@0O `B0R`$%k'J j ݬdxf&k e)JxBHx/."nNBL<&n$. &. +.c$ +2d&d$Hn// abO |f$nc// / aLO 'Rp` n$h kxb'RxB"nBz&ڋg"*c * K c// / a,O "* * (*$J(g//*/aB(O *gf j|fZ I  g Hzavt"j/ /*/N yH,* ./"j./ /*N|ͪBO`/* /*/NO S` j R!jd%n-J$Df "n"BL<|N^Nuunmap: still wired!NVH< $n(. JgJ(g HzauJ0g // aP *g /*a`g"j i hJg/ NX&**8f/ Hy alRP`B:9SxB@$@2A@oF%yCX#CX gB@F`a $CJfHLstart=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5NVH?<(n$. ,.*.Hn// a"O Jg"-n*nf f JfJ0gB`T$EBJgjR&*c Hzas$* ed//* /*HzawHz*as&jJggHz%asz*Eg Hz&asj$KJfg Hz!asTJg@*E"U)Ep nxf)Ix#h i n*E* U!E ,`SЮ)@``,*n)Up lxf)PxS` n"h""P#h n(8f/Hy ai`B>9SxB@$@2A@oF!yCX#CX gB@F`apL9SxB@&@2A@oF$yCXJg#CX gB@F`aJf Hzap|8JgZB$".҂%A n (Є h Ё%@ &.~Ƈ$.~ćbc%n n%h"jJg" i hJg/ NX n h%H`B n%hJg%h `%h n%h %h$$B(%h00g(.9Pب,%D,pA |Jgp// NP`B, n%h44RJf-J`(n)J-JJg" n ( c hggt`* n-hB n"HbJg(n(Իg(BHxHmaO JgB`Rp~fDz/./. n(nHt// a8OJf gBHxHmaO t`BJfJgJg(n'Tp kx.. b'Tx-n(.B n`p&ЋgJg6")҄$ ) A rd //Ԯ///NO nJg0$n$. &.*.BHx( X/G.NO Jg HzalR *.c$ *2d&d$Hn// aO Jg8 nc/// aO n d//./ aO n`BJgDf> f8Jf2J0f,"( | f |!F n!EB/aBX`tBHx/N L |N^NuNVH?8&n$n $.(.,.BHx* X/I.NO Jg HzakR +.c$@ +2d$d$BHn/ / aO Jg0 nc4/ // aO ` p`BHx/Np` n-h n$Hv&֋g""c*f  f$jf$Hgrcl d// / aO *Jg%D .΀%G`%D"*g. n ~C Ӓ(gp//* /*/NO$jfBHx/NBLN^NuNVH<8&n$. &.(.rmJlp`BHx* X/I.NO Jg Hz\aiR +.c$ +2d&d$Hn// a~O Jg$nc// / ajO ` n$ht&ԋg&c d// / atO %D$$jfBHx/NBLafnR` kn~ϫJfBHx/NB`BHx/NHx/.// a< L<&n&. $.*.BHx( X/K.NO +.c& +2d$d&Hn// aO Jf"`NBHx/Np`BHx/Np`$n"Jc:r&ҋ*f * d jggBHx/Np`p$jb|$I`J &j" * d"(A jJg""hJg/Ht/ / iNOJg`֌$j"*bBHx/NBL<|N^NuNVH<*.$. (.&.Hn//aJfB`. nc$r&҅g촨e (f$( hbpL9SxB@$@2A@oF$yCXJg#CX gB@F`aJf Hzna`|8$ "B K""""""""""""""(BB(J0gHx/aP(B"lJg i hJg/ NXR`$& m&%h R!J j /+.+ //*(D//(CNO`J|gHxHy aS$@B*8P`Z>9SxB@$@2A@oF$yCXJg#CX gB@F`aJf HzZa_l|8"J K""""""""""""""J0g B/ aP"jJg i hJg/ NXB(~ R`$& m&%h R!J j k0Jg(( fJ(g6BBBB/ / aO k0J(gJg/ / aP`&< rJg@ +f2+#g"~Ϋ//+ /+(D/aO +~'GB` !#DD/+(k / /*(D//(CNOJg~Ϊ//* /*/aO&kf(D+lddBHx/.a:O Jg / /a L0x%lx] #ent=%d, sz=%d, ref=%d, version=%d pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%x, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d NVH 8&n$. (n/+2/+./ HzN/+/+h/+d/+`HzNO$ S/(/Hz/NO Jg~$k*t&ԋgr/*,/*0/*/*/* /*/ HzNO.4/*(/*$/* /*"*pFgpT/pFgpT/pFgpT/HzNO$$jfLN^NuNVHy4/. /.ahN^NuOBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%lx> NVH00$n&nB/*/*/ Hz~N *Ovf HzNX` /HzNPJ g~HzN$jXJgF/*/ HzN L< UUUV Ѐ AA" O vfHziNX$jRJf L< UUUV Ѐ AA"vgHz9NL N^NuNVHy4/. /.aN^NuPAGE %p: flags=0x%x, pqflags=0x%x, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%lx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< NVH 8&n$. (n/ HzHN/+0B0+(/B0+&/B0+*/B0+$/Hz(NO.,/+/+ /+HzLNHzzNOJg0+*flg& k Jg (g`B/HzjNP`$.N^NuNVH0 B y-0Jg0(- m o f (b vteR hJfБ"nEH "L&< v LҀ"RvlL N^NuNVH<*.(.&.r gp`T n rgmrg`> g (bRl`.$(tHd"Rl`$(tHd` gRT`Rl hJfAP)P*GP CPБ)@ EP$ԑ)B&S)K)RBBB"B&LN^Nuvm_map_lock: failed to get lockNVpNN^NuNVpNN^NuNVpNN^NuNVpNN^NuWARNING: converted MAP_PRIVATE device mapping to MAP_SHARED (pid %d comm %s) NVlH?< n "n$i*-E,(tĨ-B(( -ht&h(h-F|Bx " &.xҮ|у.9PD&Bn@*yP. & ΃"B$ & &B(C܇܍" F́mg*"-A A & gp`B І bd"`"n i hK0 c-@ flJtm$.tl R&.t$p<Jfp ` j f*j -l"tgvgtgp`vf$ mp/( ah XJgD ` -lCftfv`tvf(g""nHi/)0Hz aWxtȂvO z0*f.gp `*zgxgd"n i -|-MC-I-@-n 9 mLHn p NXJf .ft` .gp`.g p `v$M `ttfJz6|8|JfgL.gD-F|Bx"n*i i (t "[I$- &-$ "$.x&.|op `,/ / ///./Hn"n/) aJf nޮ L@0g QJf#C ` QJg!i`#C( i i*SPRP0)(R@3@(N^NuNV/ $n0*(2SA5A( @f*BCC%i i #JRPj*SP$_N^Nuuvm_pagedeactivate: caller did not check wire countNV/ $n0**g, RJg!j`#C j j*SP0**fbJj(g Hz~aJ@0g BCC`BCC$%i i #Jj*RP/*0a/*0aJgj$$nN^NuNV/ $n0**g>@0g RJf#C ` RJg!j`#C( j j*SPJj(fX0**g( RJg!jCC` CC#j j `@5@*RPCCB%i i #J$_N^NuNV nh$/(0aN^NuNV"n n h$/(0/)0a,N^Nuuvm_page_lookup_freelist: unable to locate physsegNV/ n"(0$9Ppe TItf HzaHtA 0$.N^Nuuvm_pageinsert: already inserteduvm_pageremove: page is faultingvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %d page(s) in init uvm_page_initNVH? 0x%lx vm_page_physload: tried to add RAM after vm_mem_initNVH?<&.,. (.JPf Hza@ Jg /Hz a?"9H$A~fHzE4N//HxHz@N`̗˲o"AA A$fRnWIDf Hz?a?BKo"A M A$bRnI I $Al(ASCCA m(@()F)n)n JgB` (@B~)G(@)DRHJfaHL9SxB@,@2A@oF-FCC@*ACD-P" S#CHBl$E&EX"RJg~KPICH iJg!i `& i B$) ,")Ё yC@#p .҂” yC@ p ),Щ yC@P!"RJfPPRmp .g ..B@F`aѮ dg HxN/a~L0x%lx [0x%lx->0x%lx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d NVH89SxB@$@2A@oF 9PPmPl*yPPlHyC4aXB .f Jg ~fr 9PPnJgPnJg|*yBC8flJg mJ~mD`BAC G$SJf9SxB@$@2A@oFB%i i K#M gB@F`aB j%h  h jK!M j@$ jRBj* ` gB@F`a͠BL@0g TJf#C ` TJg!l`#C( l l*SPJl(g Bl(SP69SxB@$@2A@oFB/ GHNEC )r/ N r / N%O 9|*RP gB@F`azL N^NuNVH0 $n0*$ g HzMa4g *&9PЪCH yC@C69SxB@$@2A@oF jJg!j `#j  j  gB@F`a jJg!j` j!j j j$ jSBRj&L N^Nuvm_map_lock: failed to get lockuvm_pageratopNV/ //.Hya|PJf Hza3$9PA"9ಀbd B`rtg&t‚C nE A  qA `B$.$nN^NuNV/ /BBB/<@HyClHyCh/9Ha~#KBB\OAC`B!HBEH Z PJgNRrd$.$nN^Nupager_mapNVH<0$n*. &n(.Jg"/HxTHxap&O fB`&`BAPC $"B/<HxB/Hn/9KNOJg>rfJgHxT/a`r#\BHzZBB/9KahO`d&.Jg2 ZBHxHx/(0/ yK/avzO 9PրJf .L <(n*. *n&n,. .$UJg2 l h$Jg/. //// / / N$@*O`$r&B`($rāJg l/// / hN`/// /a.&OrgJf&JfDJl@rmJf6BHx/ / // a`"rmJf/Hx/ / // avOJf L<|N^Nuuvm_pager_dropcluster: no releasepg functionuvm_pager_dropcluster: object died with active pageNVH?<*.(n ..*n(.,.Jf$gJg"S/$FHj`//a,vPBl&G"SgJfB )+gJg. i B `"Jg B )"9P//)amO "S)%g / aX"S4)$ gp)+g(B3B$B S/(0an: S/( ajO `n i h h0JfHz-Ha,"S nB/ NPJg>Jf:Hza,t"SB3B$Jl" S/(0az S/(0azt Sh$PXRmJgBJm>$G$r*Jf2g,,+g l !F `/ ,"9P//,akL//.BBHyPaaO gB@F`aLN^NuNV//APCP $L<,fffgЀ $9P <@"9P䠲c  vHC 9P䣰d& AP $L<,UUUVЀ mR $L<,UUUVЀ#P$&N^Nudaemon_slpNVH?<#BC8a-yPa4IC`*<P.<P,<PKP89{0B@&@2A@oF$f"BHzBBHyC4a_RQ`O$$BJgB)L gB@F`a>JgGP(*$*/ RNX$BJfBa( 9PXg-@ap 9P"GБ$L<,UUUVЀ"E""F m R"E""F n "G("Ela@"UPn JPf/ aX`Nqpagedaemon: page with no anon or object detected - loop 1pagedaemon: non-loaned ownerless page detected - loop 1pagedaemon: clean anon page without backing store?uvmexp.swpgonly botchuvmexp.swpginuse botchpagedaemon: pageout returned invalid 'unlock' codepagedaemon: no pgo_releasepg functionpagedaemon: invalid nextpg! reverting to queue head NVH?G5G$ gTJg*B/ aa B/*0ad-R/ aO`l"n i h0Jf Hza# Hn/ NP`F-RG Jg|g / aغX/*0NX`/*0N/*0apj$P`B nJg(+fHza&"n-QX$nJfJf .L9SxB@$@2A@oF,<P"F& gB@F`a0KPlRQhaak2BIQl(*gJPg HyCaXJf,HyC$GNXJf*fJPg HyCNX(T( *9PPB"F$"o" 9P̰PfPo JWIÒƁ$yCJgJnJo &R0*$f8**4BfJf:J fHzPa 0*$JBf"$*,f Hzra S%B,D5D*0*$fJov0**g. j J g$Hx/( a j B j$SP0**g8B *.9P//*a`2O JgHx/a:j$SPJo B/*0aaz/ a"RQSO $KJfL9SxB@,@2A@oF-FBBAC Jf R-@$@Jo|g-y-y`ڮ&.օbdGP"K .A"9ಀbd B`t|g".peTIf&.$C"CQ .LS(؀|ĆA(p(oJ KK K 4+g2$40l 4"ҐfJgfK-M$M"Jnf,-C CoGPK A E / ahX RJg!j` AC ! j S5|$Bj*BB Bj(B,B*n%m m +J .,R-FRz< @RnzB .GPg ..B@F`aH PmPl*yPPl HyC4aȎ .L"F()B/ ,< ~"FNPJgt`BHxLHxEN&@BHxLHxN*@HxB/ aCO r'A'L0O&rlf lp ( `p&rlf"E i/aH'@X// / aN'nBHxL/+N'@B/+//a,O(Jg Hza / /a$PgBHx/ "FNaNPrlf /+a$XHxL/+E@NHxL/ NO`/ apX`t/ anXBHxHyU "GN L<(n&n $k0&z@g< l -|p-J|-F-@-L 9p jLHn p N$Xf *l|g6|f "牒Ae pJg/N&X|f` l -|-JC-I-@-L 9 jLHn p N$Xf .".&|$| "& jH h/ |>ܪH//*H hN$O f jH'hF<"jLRhf|'F@`|'F@`t`'C"[I&|$| KP$///a;O (|lf*Sv`*BJnt`TBHxLHx ad$/9HRHHz/aHxBBHxL"DHiB/a2'@,O4Jg2Hx/B/aOJg Hzea ׫ ׹P׹Pеz@f yt hHA> (| L( "9P$ԁFā,EPIPиl Hza "Hx///+,a"OJg Hza ѫ ђє/HzE4N"E/ Hz-NO// a'Dp|'FٹP/aFB`>z@g4 l -|-J|-F-@-L 9 jLHn p N L<|dN^NuNV/. Hy/</.BHy aj8N^NuNV/. HyB/.BHy ajN^Nuswstrategy: vnode type 0x%xNVH80$n$*Hx GP(/aB"@XJfx%D( *$@%@$/ a(z`Ԕ$(x i0 (lxgxg /Hzta|89{0B@&@2A@oF%BH&i0%Q8/ akJ *$Xf/ aaRhXJPg / aeX%KP gB@F`a~-|8-J jP 98 hLHn p N`// / a0L N^Nusw_reg_strategy: swap to sparse fileNVH?<*n(n >9{0B@$@2A@oFHx/9az&@P fa~'GBB &'M)l04-l< .,~ *,0g.B Lm< m0-|-H-@C-IC-IC-I 9 hLHn p N$Xf~f.Hza>9{0B@(@2A@oF'B`"-< LAJg&`B@F`P&.RL8o&>9{0B@$@2A@oFHx/9RlaR$@P fa ,$~@%@$%C0%C,B(%n<~ خ%DH%l %| 0LBP%|eC!%m\%m`JXf BT%CX`( ,0"lT%IT ,0.,X d %@XJhf Bd%Ch`( ,0"ld%Id ,0.,h d %@h%Kt%jH4>9{0B@(@2A@oFJfR / /.abn/ HmDa./ aO gB@F`a|܃׮ؚf>9{0B@(@2A@oF~ϫJ f0 +g)@( ,$@)@$/ /9a/ a$pO g$B@F`"/ /9RlaP`B@F`aLJ f8` J4f0 + g /Hz:a +f/ /9N/ a"O St/ aX gB@F`a@L< N^NuNVH<<*.&. JPo(ypJg$lGg*K$<P*g"E" * ЁnHnHxBBHx/ j,/(/( /*,a O$Jfb j4f)j8`!j88 j8g>!j44%M4%l8 Uf ` l!J4)J"E(٪ *"Bۑ .Ъ$`.&4`$j4fJ(l Jf*x"El Jg"` BL<0$n** rHA,9P 戟( *l Hza&*Bo&O/a&XֹPRm/*/*aBHxHj/BBaO <9{0B@$@2A@oF//9haP gB@F`aL |N^Nuvm_map_lock: failed to get locksbrk: grow failed, return = %d sbrk: shrink failed, return = %d NVH? "n n $i **-E&9P(؃$FȂ "[I i,( .($op ` *~ ЅЃ-@$Jo*g/ aBB`pLN^Nuuvn_flush: strange, got an out of range flush (fixed) uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%lx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushNVH?<*.EP$-|&.-C 戟-OBB~-Gg&B 9P"n&) ր-CFv-C`T 9P"Fî Ѯî"nЩ dHzaX$ . "nTI-@Dgn"n iJ$g`Jg((iJgR , e dl$(lJf`2(. d(EP//.az(@PJgl$ؒeJg "n(i`(. //.aD(@PBB`dJg , ḛe`عPJgg 0,$gB,%gh vf^~-G`Vg<g,+gB/,0a.P0,$g/,0a;XJgl$0,$@@9@$ @Jf$văJg,,`d//.aZ,PJg* ,(@JfB/,0a.J/ aO `g0,$g @9@$`rB/,0a./ atO `Vl$Hx/,0a-=l&P$. ~ E a-n-B/./. /HnHn/ /.N-@Ovfg Hz?a~ v `~fH v f@Jg>.l&f,,`"n,)`d//.a*,P`B". Rov*E& ~Ƈ*Co n"n 0g@&@`8&LJg6.l&f,,` "n,)`d//.a,Pvf"nf$vă`\2+$g/ aX2+$0@7@$ gB/ a4PJfp`2@@7@$$~ćJf /+0a8XJg" ,(@JfzB/+0a,./ a``Jg`vf0+$gN@7@$`D$< YJg"/,/,HzE4NHzNBOB/+0a+/ "BNO R". Rn(FJg\Jf^JgZ"nJg(E"niBHzBB/ aOJf"n )gE/ a @"n#@ .L//a$-@P @Jg 2($0@gggB` A1A$$RXRؓm( .Sz`B(l $AJfggG DH//N-@P @Jf*BBBB//a-@OfHHzarX`62($0@g A 1A$BHzBB/aO` A1A$$JgJfdBHxHxHn/a$Og. n(%g/aX nh$/.ap `, nh$/(0a5$XXRعPmBL<$n*n (.*.$. B' U&(J*l*|gRjBHzBBHjaOJ*mֶ ep`HxB// I ^N&@OJf |fp`RJfBB// N&@O-KIP$, Ђ"* d$-BC-I|-F-CB-F-E-BBB*f/<"/ a&PJfJf0 yB h -|L-JC-IB-@ 9L`. yB h -|x-JC-IB-@ 9x jLHn p N&X*f&-|-JB 9 jLHn p NXJf> BJgJfv`, L9PoJf ,/BHpalO // a: *"@S%IPJ*l|f HjaJV|L<|N^NuNV/ $n *rrgp`XrêJfJ/ aH6RX-|-JB 9 jLHn p N.a/</ a&p`B$nN^NuNVH< $n(. *.*g: 9PD&B "c(*"* BcHx/* // a%E L2 k,RHxB`R0@ @ f S6(4(T gHz`Hz/ E JNPpI8/4 / N k:Rp/4 / N k,R/4 / N k:R/4 / N k,RO JClCA/0 `C/4 / NP k@R k:RJBlCA\/0 `C/4 / N k@R`Z  g f" S6(RHz/ E J(JN%BPf t kb`zf t kw` t klR k RpE/2 / N k,R/2 / N` S6(R gHz[`HzZ/ E JNP%Bf t kb`zf t kw` t klR k RHx/HxHx/ a; k,ROJCl&CA`"  gn$ gn Jg(`2 g"`$ gn g` fHz/ E JN&Pf kbRt`$zf kwRt` klRt k R S6(R g$JCl CA0`CA^/0 / NP`Hx/HxHx/ a: k,ROJCl CA`CA/0 / N`"< `&"< `"< `"< `"< `"< $Jg// a.&Pzg,mJg `xzg:`p kbR k Rt`T kwR k Rt`8 klR k RHx/ a9 k,RHxHx`// a9 k,RHx/HxHx/ a8LHz/ E JNBHx?Bg/ a@ k,RA/0 / N`Hzy/ a-fP @f kaRrf kb`rf kw` klR k R$+B/HxHx/ E &N k,R"+//HxHx / NL N^Nubgndillegalnopresetrtd rtertrrtsstop trapvbkpt #extw extl extbl linkw linkl movl uspswap unlk trap #jmp jsr mov ccr,mov sr,nbcd pea tas mov clrnegnegxnottstb w l lea chkw chkl NVH<8&n . 4B Nsgn6 Npgn Jg\ Jg\` Nqgf Nrg` Nvgn NtgT Nugn` NwgZ N{nz Nzmr`"< |`h"< ``?Bg/ a(`"< `J"< `BHzy/ a+*Hx`r"< `("< ` "< `Hz`/ a+Hx`H"< Jg // a*`6C  Hgn. H@g|n Hg` HHgD HgP` NXgfn Igh NPgx`j N`g Nhg`RHz/ a*XBHx`ZHz/ a*DBBBHx`,Hz/ a*,BBBHx`Hz/ a*BBBHx` CNPfHz|/ a)Hx`Hzs/ a)HxBHxHx/ a4O k,R CNPfHx`Hx/ a5d`THz2/ E JNBPf"BBHxHx/ a4\ k,ROHz/ NPJBg k,RBBHxHx`:Hz/ a):BBBHx`"Hz/ a)"BBHxHx`0@ @N@fHz/ a(BHx?Bg/ a<|`6C8  H@gn2 Dgn @gr Bgb` Fg~ Hg^`~ L@g&n JgZ Lg`b Ng Ng`P?Bg/ a `"< `:"< `2"< `*"< `""< `"< `"< ` "< 8|JgB// E JNB/ HxHx/ a2O DFfHz`` CDfHzV/ N`0@ @Hf?Bg/ a#`f  Dg.n @g, Bg`8 Fg" Jg"`&"< %`"< )`"< -`"< 2`"< 6JgX// I JNPf "< :4|`zf "< =4|` "< @4|// NB/ HxHx/ a1`0@ @Af8Hz/ a&BHxHxHx/ E &N k,RBBHx``0@@ @Af\ @fHz/ a&BHx`Hz/ a&BHxHxHx/ E &NO k,RBBBHx / NLn g`P g: g*`>"< ʢ`6"< ʨ`."< ʮ`&"< ʵ`"< ʼ`"< `"< `"< Jg.// I J&LN j R R4(RP DfCA/0 / N j,RPHxBHxHx/ a+D j{REO g2@A\/0/ NP`Hx Hxz?ʀ// a2O j:R0@g2@A/0/ NP`J@fp Hx Hxz?ʀ// a1O j}Rg& Dg j,RCA/0 / N` jB`4BzfB`zg,mJg`tzgJzg.`f jaR js`L jlR js`6 jrR jo` jrR joR jxRg jl` jrRzg"mJg`4zg zg`&r jb`r jw` r jlR j R BfB/HxHx/ a)X`jgG/3 / I JNP`2 j#RfrHx Hx// a0OI JG< j,Rp/3 / NL`El/2 / N l,Rp/2 / N`Hz/ E JN&Prg mJg `6rg"`. lbRt` lwRt` llRt l R8DgA/0 / N l,RPB/HxHx/ a#tOJDf l,RA/0 / NLN^NuUNKNOWN COPROC OPCODENV//"n". 4 Q @gnJ@g`> @g @g&`0?Bg/ a`T?Bg/ a`H?Bg/ a`Hz/ G JNPre0; N 0@P`p@ jlRt`^ jsRt`N jxRt`> jpRt`. jwRt` jdRt` jbRt j RA/0 / N j,RHx/HxHx/ abOrf j{R gCAt/0 / N` j#RHxHx?Bg/ a$b j}R`Hz/ G JNPf jlR j R4B g$Hx/Hx/ a j,ROHxHxHxHx/ aOJBf j,RHx4/Hx` jxR j R gd4B gCAt/0 / N j,RPHxHxHxHx/ aOJBf j,RCA*/0 / N`j4B g$BBC// a j,ROHxHxHxHx/ aOJBf j,RBBCF// a vL N^Nuptestpbpdbptrappspsave prestore NVH80&n8.%re0;*N  S6(Rre0; N 0 ?Bg?Bg/ a`?Bg?Bg/ a `|HzX/ E JNP g kr` kwR k Rr?ƒ// a k,RHxBHxHx/ aj k,R k#RHx Hx ?Bg/ a!O,g k,RA /0 / N`Hz/ a.r?„// aOrf* kwR k RHxHx S0h` klR k RHxHx S/(/ aT`D S6(R @f`Hz/ E JNr?ƒ// a k RpA֌/0 / N k,RHxHx S0h// aR` @fz4B BcnHz/ a *r?ƒ// aO Bf kwR k RTHx`$ Bfv klR k RTHx/ aU`NHz?/ a r?ƒ// a( k RHxHx`Hz`Hz/ a BBHxHx/ aTL N^Nupflushr ploadpflushNVH< $n4.DU6C? BfHz/ a *`JDfBHz/ a P g jr` jwR j Rr?ƒ// a*PHz/ a PpSre0; N."." jaR jB`x jsR j Rr?ƒ// a j,R j#RHxr…// aOg" j,RHxHxHxHx/ aL8&n$. &.8EHx@Hz/ a`O |f B4BDB"<g 栈@R|lBBBI:g,|g&Jf t// a`J|fFt k-R`6Jg|l // aP k/RBB0g // axtPXXR|l|l Hz/ aX k( /g -f C'I IBL|N^NuNVH?<$n ...8K`JgKΘ|Jg|`&r gB4BDBzFg 栈@RrnBBotBI&M:g:Jf // aPJg j/R` < `6 < `. < a`& < ` < J` < ` < ` < // NPJBf2T j,RA &JCl BBHx`BBBHx/ NUL N^Numove16 @+,@+@,NVH 8&n4.Hz/ I JNPg8pE/2 / NHz/ N SC/2 / NHz/ NR`rg0mJg`rgPrgn`pA|/0 / NHzb`DHx/ a @ k,RpAP/0 / NHz:/ N`VpA6/0 / NHz#/ NHx/ a `2Hx/ a k,RpA/0 / N k@RLN^NuNV/ "n$n iRJfS$_N^NuNV/ "n$n iRJfS$_N^Nu(pc)#####NVH?<$n"n ,.*n&n T~d$$ Rr *S$ UDʁ R0Hʀ`x~f:$ Rr ,S( U$S F̀ R6H̃ [D*ʁʃ`8$ Rr *S( U$S Fʀ R6Hʃ [D,́̃~e 0;jNFFF,Jf AǢ/0\`A^/0\`/Hx0p// a RO~f j-R j(RA/0\/ a4 j)R~f~ j+`nJf(0p// a R j.R jw`B~f&/0/ a T j.R jl`~f"RHxHx R0p// a Hz`~f~f j#RHx R0I/`~f& j#RHx R0p// a R`~f$ j#RHx R/0/ a T`r~f XHz[`@~f THzS`0~f XHzM` ~f \HzG`~f*\Hz?/ a`60 *.R%GAuB&GtCGgR&xȃ~fB`~f T%@2H`V%@"~f`$~fR8P`~fT(P`BBI j(RJg j[R~g p~fp`p/// K N j,RO JgJl jzR~f`~fAĠ/0\/ aP` jpR jcRJgg j]R j,RJgg j0`vCdJClp.A0` p.AZ/0 / NP j.R jR gl`w> Jg$ j*R j" ~‡p0RJg:f j]R j,R~g p~fp`p// / N j)R jBLg8~g2A ~g p~fp`p// / N j,RO JgfzCJBlp.A` p.A/0 / NP j:R jR gl`w> Jg$ j:R j" ~‡p0RJgRfL~gF j)R j@R j(RA ~g p~fp`p// / N j)R jBLR jBOHz\/ aHx// a j R jB` Hx// a$.$nN^NuNV/ /$n". .Jf j0 jB(`>tf/9DHxI`tf/9DHx2A/ ` /9D/// a2O/*aѪ$.$nN^NuNV/ /$n". .Jf j0 jB(`>tf/9DHxI`tf/9DHx2A/ ` /9D/// aRO/*aȚѪ$.$nN^NuNV/ /$n". .Jf j0 jB(`Btf/9DHxBA` tf/9DHx?Bg` /9D/// aO/*aѪ$.$nN^NuNV/ /$n". .Jf j0 jB(`Btf/9DHxBA` tf/9DHx?Bg` /9D/// aO/*aǎѪ$.$nN^Nu0123456789abcdefNVH0 $n". $.v g j0Rvgt jxRCARLBJf` jRSf jBL N^NuNV"n . l i-RD/./.// adN^NuNVH0 $n". $.v g j0Rvgt jxRCA RLBJf` jRSf jBL N^NuNV"n . l i-RD/./.// adN^NuNVH8&. .(.g"$Rp"SD€ Fƒ&`Rr$SDāƂHx//.a@LN^NuNV//&.Hx$.Rr SD //.a$.&.N^Nu kernel: keyboard interrupt NVJI,f9%gHza/.HxaN^NuCaught exception in ddb. NVH00$.&. rg,mr`rg B/aPJ$g HzaB`VHxL/HyLEǘNO RI,HxGNB/a hBNSI,HxLHyL/NB@F'pL N^Nukernel: type %d%s trap NV/ /$.HzE4NXolJl/Hz`Ao/0,HzNXO. 8N$.$nN^NuNVNON^Nusrpcspa6a5a4a3a2a1a0d7d6d5d4d3d2d1d0NV n"n Jf h0P"` h0BN^NuNVH8(n&n r ALp4Ќ YYQBASdBHxHl8EN'@BHxHlFN&B/ aLN^NuNVH8 $n *&$*"* *f| fpATx YQB@Sd` // aP$BHx/*aX"%ABO J g$ 9l  nB%| `/ a *JgfBLN^NuNVH88-y$pЎ#$/aB-nB-|-|pABYQB@Sd|܎/aXJgKŸIS . f-| B`8BHnHnB/avPO.aO Jf-| -|/.HzNPJf4$nBHxHjXGNO  gbBHxHjZN(O `NJgJ/.HzNPJf8BHnHnB/aPO.aHO Jf-| -|B/.HzZN .P gHJgBBHnHnB/aPO.aO .gg..g /Hz NPHzN$nX$.Xg@S~g8GBHxX/ aP/HzNOJgHzNXQBBSd . f /.Hz`/HzNPJg". 9l o//a6PJgJfL< n ,.*yB(m$&m& JBp fC 4rȁDDJg &,֬`&+<-H-n"CC-I-nr-AHx@/ Hn*<ǘ"ENO BoRrJ: J :HԂEo2r(/ HkLHn<"ENO 42(kB JJJ4grHnaRX-k<-k8r҃-A-kFB0+D-@r¬ -A F-X-X-X-P$Hn/a_Hx$//aOJg Hx/ a'C<'l@FJgr L<|N^NuNVH8<*n n fHx,G/ /I NO Jgp`2 .@Jfb$m&$.g/a.&XxgDJgHxHn/NO JfgX:xmAo20Hm0jBop`jB:J : J/Hn9-8B@*@2A@oFfJrf/9L/ a / a|%|+~%G%|K%| 9L%@%@Hj/ a/ aO,Ggp o<@`+ gBHx/ G 1NO ,GfHxB/ NO Jl~n gB@F`a~ή /~ // a$O fBB*hA/// // a$OJl$ @t]gb* tygvb txgv` tzgP t{g8` tkgjb @tjgn t\g` tlgD tmg8`+ @@ `+ @ `HxHx`HxHx`B` Hx`Hx// aL`jHxB/ a>*`ZAGDzJllz`"CHi0 i/apJgp`* f*GgzDg l`p`BL<<*n&n -j"| 쩂 y(p$l,(+HyL/+(ab&Pm k$Jg (gp`  gnJg ` g ` B` t`t`t g| f| g|<9-8B@*@2A@oFJfBB/ aO k$g,Ggpo<@Jg* @  @B `* +k$+k(+D|*@ gB@F`aBL<|N^NuNVH0<&n"+j v 樀 y*p (m,69-8B@$@2A@oF"+n f0k +Hm.gvƁ'CnEH/ a X JgRHkaJX,g $n j0Jg(qg&*4f J8fJ|``|@|@`B(@|@`%I``B``A"#h#h #h$ #h#hv#C )l^"#A0h#H$#H )l^L#A(z(,z#-z.z/z0z1z 2z3v#CL *`g#@TЪ#@P`BPBTpAlBYQB@Sd`t L N^NuNVH 8$nJfD j %h%h 5h*05h..5h2,5h6*0*0j,l5@,0*.j*l5@*/*a| j| j|@ j|3@ j|@ jB@ j|@ jB(`# j|` j|` j|` jB(` jB(` jB(` jB(` j|`HxdG%NBP j@` jB(a jB(a jB(a jPa jPa jPaRtl jB(``HxdNX j(@Gf(@[f/ aX/ aY|B2j,/ 2j*/ BBBB/ I @2NO(`HxdNX j(@Gf(@[fHx 2j4/ 2j2/ 2j / 2j"/ 0*(Hr L@2*4HL0j6Hp0*(Hr L@0*2HL0j8Hp/ NLN^NuNV/ $nB2j0/ 2j./ BBBB/ aO ` HxdaPX j(@Gf(@[frÒ$nN^NuNVH0 "n$. pvfp /4i4/ 4i2/ 0i4&L.8/0i2&L.8/0)(H"L@2)4HL0i6Hp0)(HL@(0)2HL(0i8Hp(/ aZL N^NuNV/ / &n . rf8Hx0k4/0k2/2+4/2+2/0k /0k"// a`|rfHx0k4/0k2/2+4/2+2/0k /0k"// E @2NO.0k4/0k2/2+4/2+2/0k /0k"// N7k7k`6Hx0k4/0k2/2+4/2+2/0k /0k"// aB$n&nN^NuNV//"n$. ".B0)4HL./0)2HL./0i4&L8/0i2&L8/0i4&L8/0i2&L8// a$.&.N^NuNVH<0&n$. &. n ."2|4k&xf 2k$`.zf Ј0k$C`xf "҈` "Hx0k4* (LX/0k2* (LX/0k4*LX/ DLH/0k4*LX/0k2(LH// a L *&4/8j2/ B Ђ L,Lh/0j4.Lx/ Ђ L,Lh// aO Rn`~ff&ւ0j$$SkHx<*&4/8j2/ B Ђ L,Lh/0j4.Lx/ Ђ L,Lh// aO QBBSd`x~f$Hx0j& Ђ2j4,. Lh/8j2/ `"Hx0j&2j4,. Lh/8j2/  G,Lh/ L.Lx/ I,Lh/ L.Lx// a LN^NuNVH<8(n . ".&.$. (.$z &@$A"l)g I(f lVD@P l lVD@Po l@P`& l@P Yz G" E lL8&n$kHx;/ jN kHx=/ hNኄ(BHl/ jN$kHx;/ jNO kHx=/ hNኄ(BHl/ jN዆֫(CE :+0HEBE|0k4 ^jpЈ&B4+2H0k80+(H,L@h LЈL"k0+6H@B@|LЁBo Bo TRnR0k2$nR|lL|N^NuNVH8 "n". pxfp /4i4/ 4i2/ 0i4(L.H/6)2H(.LH/0)(H$L@(0i4"^jr҈L0i6HpL(0i8Hp(/ aZLN^NuNV/ / &n . rf8Hx0k4/0k2/2+4/2+2/0k /0k"// a`|rfHx0k4/0k2/2+4/2+2/0k /0k"// E VNO.0k4/0k2/2+4/2+2/0k /0k"// N7k7k`6Hx0k4/0k2/2+4/2+2/0k /0k"// aB$n&nN^NuNV//"n$. ".B0)4HL./0)2HL./0i4&L8/0i2&L8/0i4&L8/0i2&L8// a$.&.N^NuNVH<0&n$. &. n ."2|4k&xf 2k$`.zf Ј0k$C`xf "҈` "Hx0k4* (LX/0k2* (LX/0k4*LX/ DLH/0k4*LX/0k2(LH// a L ".g8.. |g ~gmJg `| g ` B``F XXSfJg@. ',. ~f"`"|gmJg `~ g ` B``"F, &QBDSd`E\ . ЮG .Ќ~lYS|g*"K JJg@. ',. ~f"`"|gmJg `~ g ` B``"F, &".g8YY.. |g ~gmJg `| g ` B``F SfJgNJgYY..g,. ~f"`"|gmJg `~ g ` B``"F,.fQBDSdLB@v!C@|@`B@v!C@|@`%I``B``A"#h#h #h$ #h#hv#C )l^"#A0h#H$#H )l^L#A(z(,z#-z.z/z0z1z 2z3v#CL *`g#@TЪ#@P`BPBTpAlBYQB@Sd`t L N^NuNVH 8$nJfD j %h%h 5h*05h..5h2,5h6*0*0j,l5@,0*.j*l5@* j(@GG%gHxdNX j(@Gf|9/<N j| j|@ j|@ j|@ jB(@/ a4: j!|@B2j0/ 2j./ BBBB/ I dNO(`HxdNX j(@GfB jB0 c jB0 d jB0 h jB0 l jB0 s jB0 t jB0 x jB0 |Rtl j|3@ jB(d jB(h jB(l jPd jPh jPl jB(t jB(x jB(| jPt jPx jP| jB(@ jt!B@ jB@/ a4Hx 2j4/ 2j2/ 2j / 2j"/ 0*(Hr L@2*4HL0j6Hp0*(Hr L@0*2HL0j8Hp/ NLN^NuNV/ $nB2j0/ 2j./ BBBB/ a O ` HxdaÚX j(@GfrÒ$nN^NuNVH0 "n$. pvfp /4i4/ 4i2/ 0i4&L.8/0i2&L.8/0)(H"L@2)4HL0i6Hp0)(HL@(0)2HL(0i8Hp(/ aZL N^NuNV/ / &n . rf8Hx0k4/0k2/2+4/2+2/0k /0k"// a`|rfHx0k4/0k2/2+4/2+2/0k /0k"// E dNO.0k4/0k2/2+4/2+2/0k /0k"// N7k7k`6Hx0k4/0k2/2+4/2+2/0k /0k"// aB$n&nN^NuNV//"n$. ".B0)4HL./0)2HL./0i4&L8/0i2&L8/0i4&L8/0i2&L8// a$.&.N^NuNVH<0&n$. &. n ."2|4k&xf 2k$`.zf Ј0k$C`xf "҈` "Hx0k4* (LX/0k2* (LX/0k4*LX/ DLH/0k4*LX/0k2(LH// a L Jf. *9f&B*rgnrmrn '|Vp`B$n&nN^NuNV"n yTr#A0B(/// aN^NuNV n (9 fB( rgnrm rnp`BN^Nu%s: can't map framebuffer NV/ / $n &n%k0 *0"9TbXd @'@`/a'@X'|**'A* * '@L'A*]*_2H@B@'@ "+ c'@Ё'@ )J"J)I `)J/+/+ a-<)@ * *'@ **'@$*[B+@2+Hp7@ @f$ l P@|@P@P@R@7@pLN^NuHP98550HP98549HP98548HP98547HP98545HP98544NVH00&n"nB . Sve40; N,,**'I``B``E"#j#j #j$ #j#jv#C )l^"#A0j#H$#H )l^L#A( k vgRm vg``vg vgl`Pz,z-z.z/z0z1z2z3`z,z-z.z/z0z1z2z3`z,z-z.z/z0z1z2z3`0* @gFn @gp` @@fz`,z[-zV.zQ/zL0zG1zB2z=3`bz6,z1-z,.z'/z"0z1z2z3`0z ,z-z.z/z0z1z2z3v#CL +`g#@TЫ#@P`BPBTpAlBYQB@Sd`t L N^NuNVH <$n jJf, j %h%h 5h*05h..5h2,5h6* j( gH0(Hg "H0)HfBhH jBhE jBhE jBhE jBhE j1|B jP@ jP@ j|@ jP jB*@@A jjA@ jjA@ jjA@ j|@/ a&nB:j0/ :j./ BBBB/ I sNNO$ j(@D2*@Hg&G%BHxdNX j(@D2*@H f/ a'X j@g. j(@D2*@HG%g BHxdNX j(@D2*@H f|@`HxdNX j0(`fBh` jBh` jBh` j1|` j1|`HxdNX j0(`fBh` jBh` jBh` jBh`HxdNX j0(`f1|` j1|` j1|` j1|` j1|`HxdNX j0(`fBh` jBh` jBh` jBh`Hx :j4/ :j2/ :j / :j"/ 0*(Hr L@2*4HL0j6Hp0*(Hr L@0*2HL0j8Hp/ NL<N^NuNVH0 $nB2j0/ 2j./ BBBB/ a2O j(@D2*@Hg$BHxda@X j(@D2*@H fP@vǒL N^NuNVH0 "n$. pvfp /4i4/ 4i2/ 0i4&L.8/0i2&L.8/0)(H"L@2)4HL0i6Hp0)(HL@(0)2HL(0i8Hp(/ aZL N^NuNV/ / &n . rf8Hx0k4/0k2/2+4/2+2/0k /0k"// a`|rfHx0k4/0k2/2+4/2+2/0k /0k"// E sNNO.0k4/0k2/2+4/2+2/0k /0k"// N7k7k`6Hx0k4/0k2/2+4/2+2/0k /0k"// aB$n&nN^NuNV//"n$. ".B0)4HL./0)2HL./0i4&L8/0i2&L8/0i4&L8/0i2&L8// a$.&.N^NuNVH<0&n$. &. n ."2|4k&xf 2k$`.zf Ј0k$C`xf "҈` "Hx0k4* (LX/0k2* (LX/0k4*LX/ DLH/0k4*LX/0k2(LH// a L Gg Gg`& Mgn& Ggn Ggr` Mg` @Ggn G g|` @pGg`&`/a$`/aZ$`Hx/ a$`/ aP$`/ / /a $`/ //a$O gr//a$`f/ a&XgXHk/a$PgJJXgDHx/*XasBX`0 j/ Hx/ hN$`/ /a$`//a$`t L N^NuNVH 0$n$9BJXg jPB jP *\J0fBTB\ *Tg:fp`\J fpR`RG8rBHyHx/ NOJf0JTf%BTJXg/ a$ jPB\@_ jPBL N^NuNV/ $n"*TBgp`6JXg jP *\B0 jPBB\*g / arÒBTB$nN^NuNV//$. vl y p Jg "h0)f v"v 橂`2 < Vg (,H@B@ gv`gv$&N^NuNVLH00$.&n v y p $h0"*Ҫ pJgp`&v-CAL-H!B BHn`/HxHx// n/( aŰ$O f j/Hx/ hN L 4QJg8 yB6(2BrAm0@fBP`J@g$RTlo kX0L N^NuNVpN^NuNVpN^Nu %s: can't allocate grf data %s: init failed : %d x %d monochrome%d color %s display NVH <(n*n &n",0 ".*. (.&.$. | 쨀 y p h,$hB*hAL///// pNOJl///// anFJlpL|N^NuNVH>0&nBB"+j | 쨀 y p $h,B@&@27A6Bk80k00+4H(L@H D7H(7A 2HpFLAR8+27D"`BBk67k*80+0H2+4HLA7@(Bk 2HpFLAR2+2HLk*7@"L N^NuNV H?8&n0k4 Sj \,R0+2HLh$kHx;/ jN kHx=/ hNኄ"BHi/ jN$kHx;/ jNO kHx=/ hNኄ"BHi/ jN዆"CE BO* 0k80+(H"L@0+2HL҈0+0HLҫ0k60+4HL((؈(EBo k/ / hNTPRn k/// hNO R~lLN^NuNV n"n hB1N^NuNVH0<*n$n &nBJm2oHp0m4o"Bg`BSjpRR0m4n8m22m0vmRRnL< N^NuNV nB( rBgmrg` g fp`BN^Nu %s: can't map registers ipl %d: console, : working fifo no fifo NVH0<(n n$l (9-8B@*@2A@oFfJrf/9P/ a / ae%|+~%G%|K%| 9P%@%@Hj/ aJ/ auO,9gp o<@`++ gBHx/ G NO ,9fHxB/ NO Jl~n gB@F`a$~ή /~ // aNO JfB*hA/// // aS OJl$ @t]gb* tygvb txgv` tzgP t{g8` tkgjb @tjgn t\g` tlgD tmg8`+@@`+@`HxHx`HxHx`B` Hx`Hx// aL`jHxB/ a>*`Z9DzJllz`"CHi0 i/aalJgp`* f*9gj8g l`p`BL<<*n&n -j"| 쩂 y((p$l,(+HyP/+(am^&Pm k$Jg (gp`  gnJg ` g ` B` t`t`t g| f| g|<9-8B@*@2A@oFJfBB/ aO k$g,9gpo<@Jg*@C @B+k$+k(+D|*@ gB@F`aBL<|N^NuNVH0<&n"+j v 樀 y(*p (m,69-8B@$@2A@oF"+n f0k +Hm.gvƁ'CnEH/ aX JgVHkaJX,g@vn-9g"JHg*HkHav@XRvm`HkHa\@X gB@F`aL< N^NuNV// n69-8B@$@2A@oF (ng fv !Cn gB@F`a$.&.N^NuNVH8 n$. "n h,xgJf Jgx` xfxĄ89-8B@&@2A@oFxgmJg`8xgxg$`*B`$(@`F(@`(B gB@F`a LN^NuNVH00$n$. B@F'PHxdG%N||HyP/ai@@||||HxdN*O gB@F`aLL N^NuNV/ $n "n*rBgmrg`^ g g`Lp`po#@ y%Jg")nBg$#% oB*Rr`pH@`B$_N^NuNVH 0"nB8"9m8o0Eg$< y8G gG#8 Rn 98#@BJtf / HzaL N^NuNV#(P/9P/9(aDp#N^NuNV/B@F' yP(f "H)g(B( gB@F`a} $.N^NuNV//B@F'Jf/9P/9Pav#P"<P yP`Sg (gn"<` yP`Sg (g( gB@F`a}($.&.N^NuNV nB( rg fp`BN^Nu %s: can't map registers ipl %d %s: self-test failed : console on port %d NVH<<$n n(j (Bf9-8B@(@2A@oF*DfJrf/9Q/./+,a/ aTx%|+x%D%|K%|%|%%|%Hj/ a r/ acpO+igpB//I N0+THO ..fHxB/NO gxn g . B@F`ayxȮ /~ // a9-8B@*@2A@oF$Ԃ2)02)0g.& <Lk/aptX290290f*m2)07)07r2ppP g B@F`ao`*m"ҁ20707r2ppP`HxHx`HxHx`B` Hx`Hx//a`tHxB/a*`d0,TH V~Jkl~`"EHi0 i/aMJgp`2"f,ig~fp騁lTg k`p`BL9-8B@,@2A@oF~g$mJg`p~g*~g<`bA@ p,C`XA@ p,(@`DA@ p,F(@`,A@ p,(B)igpAQ0IBg\*m~ʇr2p[p[2ppPHx aiX gB@F`ai LN^NuNVH> .*. y8"p i,$|Ć#BVDB Ѐ 0R oJf^BxE0"ZB) gԂ"0)0)0B) gԂ"0)0)0R|l|g,0pf(m0p pPL|N^NuNVH?0$n*. (.B@F'&փ290290G%g($ <LD/NX2)02)0fHyQL/aR~"0#p00!P*m2907907r2ppP <LD~ /NX gB@F`agL N^NuNVH80 n$h,BxB@F'|/<PG%NB*|@p`R N gXHxNX*g/<P`R g4HxNX2pg/<PN2pGX fB*B gB@F`af L N^NuNV/ $n "n*rg g`Lp`po#@ y%Jg")nBg$#% oB*Rr`pH@`B$_N^NuNVH 0"nBz0"9m8o0Eg$< yz0G gG#z0 Rn 9z0#@BJtf / Hza֐L N^NuNV#(Q/9QHx/9(a(p#N^NuNVH88"yQ(I$|B@F'*B G 0* f B* g L(m,m1pP+B+T@ gB@F`ae0 LN^NuNVH8 yQ$|B@F'Jf"/9QHx/aFx#O yQ*tĀ*xgB*f Ѐ 0!RxĄB yQ"H(m1p9p9 yQ0pp yQP*xgB*f yQ(m(l"H)m0pP gB@F`adLN^NuNV/ n2.4."h h1A)g0)g$N^NuNV n2."h h1A)g2)gB0N^NuNV n ( WIDN^Nu %s: can't map LANCE registers %s: can't subregion LANCE space %s: can't subregion buffer space ipl %dNVH 8&n n$PHnB/(/(a[P./ alOJgHkHzTaҐ`RHnHx/9R/./ I NOJgHkHz>aZ`HnHx@/9R /./ NOJgHkHz0a*`'J'n'n'n nPHxdabL n(@V/ Hz a7|@BH'|@L yR$O $nC|$ ZR0 T0Rd'| j'| Ď'| j'| Ď'| IJ'|  '| lB/ aHx/ / Hy a[ n|LN^NuNV//&.B/a4PJmB`8 gHx@BBaFO  gHxBBa.O /a$.&.N^NuNV n"(Ү A"n .SfN^NuNV n"(Ү A"n .SfN^NuNV/ n$(Ԯ Br .Sf$N^NuNV n( gJfp`BN^Nu %s: can't map registers internal HP-IB98624A HP-IBunknown HP-IB! ipl %d: %s NVH00&n $nt /*/*aXn.aѾ @'H,PfHkHzvaϮ`&VrfJDg < ` * f t < !` < .//HzoabHx// Hy TaY-|R-BOr g k,(r€`r-AC0-IBHy 8Hn/ a"L N^NuNV/ "n i$$h,|iC|@B*||||||||B*/ a ||/<a^$nN^NuNV/ $n| ||Hxda^||$nN^NuNVH8<*n(.&. m$$h,$(n| |Hx/ G nNPJfARH -@p|Hx/ NPJfAR( . pHx/ NPJfzJlrf(rf|` ARhpHHx/ NPJfH| Jg:$`\Hx/ NPJf(SJn|THx/ NPJf |  ` / a SL<N^NuNVH<<(n(. *.&. l$$h,$*nJm| |Hx/ G nNPJfAR( ,@p|Hx/ NPJfARHpHHx/ NPJfxJmARhpXHx/ NPJfZ|| JgF$SG nkHx / NPJf6QBBSd| <rfp^@Hx/ N ` / a SL< 9// HzaϚ`&rLfHx/ a<| jHP|$n&nN^NuNVH 8 n$h0&h,+fB`++(j8 *0gbB+ *0f *0t%@0 j4/(aFX` *0g/ Hzfa~P|  *0t%@0/*4aC`. *0g.B+/ a2rF$, Xg *0t%@0/, lNpLN^NuNV/ n h$$h,|HxaY0*|$nN^NuNVH8 $n(. $9S*fBSgHxaXX* gJWILN^NuNVH 0$n&j$ *0g>/ aV j8rF$( Xg k,|`JHfHx/ Hza͢L N^NuNV n ( WIDN^Nu %s: can't map registers 98625A/98625B HP-IB ipl %d: %s NV/ /$n n/(/(aPB.aɒ @%H,PfHjHzaǂ`^$VHz/HzafHx// Hy ԄaQ-|Rr-Ar-AC4-IBHy 8Hn/ a<$.$nN^NuNVH8(n l$&h,PHxdE%N||/ aL||/<N+@+g+@ ,0@)@0LN^NuNV/ $n*@*@HxdaV*@* @|@$nN^NuNVH<<(n*.(. l$$h,&&nB*| Hx/ K նNPJm|@|?,C@@. @Jlrf|` `@Hx/ NPJmJg~B*&`([$9S`SJolHxaUX*gSf|S` HxaUX*g|@rf/<aUX|?Hx/ NB* `B*/ a SL< BB/// INO$Jl BB/// N+m3 j4p.(Jg~`+|0S l%AP///// a/ a.`r$~ćgU`S%AP/// j4/(a=tBB/// IDNO$Jl BB/// N+m3 j4r.( ~Jgp @L  g6`6 `g& hg`$HxHz/ aO JfB`JBv`xJg<;DrJg +|n`Bn < ݘJg < ݍ/AS(/0XHzeapL<[Bj\Bj^Bj`5|pbO,. HjZHx//N//NHxHnHx//N*3 Ah|4i|8j|kO,.HjhHx//N//NHxHnHx//NL< N^NuNVH8 ". xl yx$p Jg *nfp`f j$&($*,*3 Dh|4i|8jg g| k`|kHxHjhHx//aVOxf@//a>HxHnHx//a^Oxf/.a%@tnB`pLN^NuNVH80(.&$rFā r yx&p +n f|4BB*C` ($g,*qg"g vƒv@%Cn!h04// a<`|v%Cn*3 C4|5Bj6%j^8|4<|=%jf>|4B ($gB*C`|CA%AnHxHj4Hx/ /aO/a^L N^NuNV/"n i"($ tDD///)f/)jHx/), i$/(a $.N^NuNVH8"n n ($f"!h04 ($@!@$x!D(ip`$)R")^ &Sxf BR#A^`#B^ x ((0!D4)Mf )ngpFnxȀ`0fgxbf x@xȀ`Jg x xȀ`x@#DnLN^Nu%s: bp == NULL %s: uninitialized media %s: not ready %s: write protect %s err: v%d u%d ru%d bn%ld, R0x%x F0x%x A0x%x I0x%x %s: request status failed NVH8<&n k$$h$+,*kJfHkHz>ad` +ng"xȀ'Dn/ aXJg/ a`f"// aPJfkp/ a`p@'@nHxHnHx// I ٺNOJ.g|+3 DD| EHxHkDHx// a HxvF֋/Hx// NO$.HnHx// NOJ.f2+L0@g/ / at/ aO `0+Jg / a``.f&0@Xg^gHkHz/+tahO 2+L gHkHz /+taHO 2+L gxHkHz/+ta(O ``/+R+GI/"CxȀ//HkHzE4N2kN/ 2kL/ 2kJ/ 2kH/ HzNO,`HkHza~P -$@+@$x+D(`B4"+n$g +bxe0; NV|*||xȁ'Dn +fx ѫ^/ a`xp'@nJ+ql x@xF` gTx xȀ'Dn`Fx„'An+qg xFx`x@'Dn` xFȁ'Dn`xȁ'Dn +fx ѫ^/ / a L<N^NuNV/ / &n$n "jJg#j`'j j / aHkx/+$aO JfB`/ a$n&nN^NuNV/. Hy/</.BHz$aN^NuNV/. HyB/.BHzaN^NuNV . n @8mg4 mf(0m$ @n (` @np/0P//.a`p`BN^NuNVpN^NuNV"n )rfR`("R#ARrf #|`A"i^S! N^Nu7974A79807979A7978NV/.BaN^Nu %s: impossible! NV/ / $n &n/ / apPJfHjHza`B n ("+C~%I%@,%A05|4%JN%AR%| rV%| Z%| ^$n&nN^Nu: %s tape NVH 8&n(n $9Sho6ESRCSP20\AfJg7AD/HzaBp` \RnBLN^Nu%s can't hpibrecv DSJ%s readdsj: 0x%x%s readdsj: DSJ 0x%x %s readdsj: can't read status%s readdsj: status is %x %x %x %x %x %xNVH00$n$. 2*4 fHxG6/ Hxp f *0//*,aj4Ovg62*8f A5P822ASI5I8 Afp`.Jfj4`Bj8Bj:B7BvgDmJg `vg`f.B`|7` B*6/HjHzHxap`2|:/ 0j:HrJ*=m*>mAS@`p`p5@B$xĄJgX*Jg"xgxgp jDfp` p`p`pB//NJf5BBB`pj4L N^NuNVH00&.$r ⪄ r y&p +5gHxB/E NBHx/NOfBHx/a O k4/+baBL N^NuNVH88".$. x y$p EB *$gp`L%n H%A8I rG`SJo %|$/ N/ N *$P g&*( *$x%@$ LN^Nu%s strategy%s: write record (%ld) too big: limit (%d) NVH00$np8 y&p *$fr"<@+=g*0+B @gn @g ` @g `"<`"< *0l2//HkHzb/+ba *$@%@$v%C(/ a`bCfB69{0B@$@2A@oF%i i E#JJ0f v#C0/ a.X gB@F`a1L N^Nu%s ustartNV/ $nHjF/*$aPJg/ a$nN^NuNVH0 $n69{0B@$@2A@oF/*,aD/ a$P gB@F`a1`L N^NuNVH8$.89{0B@&@2A@oF/atj~P"*2+5f| `HJ+5m| `6k 4|`&|`| `| `k 4| `Hx / atPtf 9// Hza|`ftft)BHBBHx/+0/+,a&OJgHkHzHxaO ` 9// Hza`|`b|`Z|`R|`J2+4 gt`z ,$gA7A4|`"A7A4| ,0@4|4J/ HnHx/+0/+,afOf+5f$/+,a`dk#4t)B( ,$@)@$k?4/ aL$lXJg%l`'l l HkF/+$a/B*=/xȁ/&YI وz@g$x`g < ? f < 6` < G` < P/HjHzHxa +$O gzHf/ Hz(aP*>glj4`bg&*?zȅ/HjHzHxa*< n,. (nVI ƀ(($,g@"9ULoBCS00QCgRngE AS0plB`Jgx/a~,  E|@|5HxHnHx//avHx%/Hx//E ٺNO(.HnHx//NCBBnB.OJ.f($C\ rA0SQBASdB0 !gXn  g `l "g"`bHxHzf/ aO JVz ʀ&E`BHxHzM/ aǮO 6| Jf&6|` HxHz2/ anjO 6|Jf6|$F5KG$ AS/0(HzG4NHxAS/0(AS/0(AS/0(HjHzNpL<|N^NuNVH0<$n j$&($** A$|%HxHj$Hx//K وN//I ڄNHxHnHx//G ٺN|/ |4!|;"|#O,.Hj Hx//N//NHxHnHx//N* A|>BjBjBj5|pO,. HjHx//N//NHxHnHx//NL< N^Nu%s: WARNING: %s, using old default partitioning NVH00$.&r ⫆ y$p<&jHxB/ aNO 7|'|(r 'A,r'A0r'A4'|87|Br'AB/ Hy (rār/aOJg"/HjHz0E4NHz6N/ /a >BL N^NuNVH> $.*.( | &|FƆ怰l y$p Jgx"*gn`Hx/ a7TP"* |fJ@f&|%F/a$|ͪ/ a8Jg `Trƒt|g jB0(m J0 fp`* g `g` <`8,*<8%F@BL|N^NuNVH0 ". v 樀" y$pA,vr fFè`Fè ( !@fjv69{0B@$@2A@oFJVgv HxHj&a6&PJVf gB@F`a RvǪ/ a7BL N^NuNVH>0"n )8"| 쩂  y$p G&()H&)0 j $| |†  jA B|gd*(g\Jm Ђc&$f#C4`Jl |#F(` | #@0 Ѕ|m Ђl )$f*f|#F(`\؅#D4<9{0B@$@2A@oF/ / a\PJ0f|'F0/ aX gB@F`a` )$@#@$/ aNL |N^NuNVH8$.89{0B@&@2A@oF/a$X gB@F`aLN^NuNV/ $n j>%h<%h0Hj/*$aѐPJg/ a$nN^NuNV/ / &n n E&B4%hB4/aHk/+$aќO *f B0 +gr€'A/ a5vB$n&nN^Nu%s: rdstart err: cmd 0x%x sect %ld blk %d len %d NVH>8$n&j> j$,((*& I وr* B|@|Bj +4Ѐ%@|4|%j +$W@Hx/Hx//NOzf(Hj,a_Btժ`**\ہ%E\/a`rê/ aX *ZRZtlR/*/+H/**I/HjHza +$@'@$r'A(/ / aL&@O Jg"%k<%k0Hj/*$aϢPJfL|N^NuNVH8 $n"j> j$((&*$)$Hj,a^:Hx BBaZO rDD///*/*Hx//aLN^NuNVH>0$n**&j>| j$$((*,+04/v,֊/a^2 *Pg"|̀%F/a4XJg/ a,`f(//aPJf /a]r|/aX`x|̀%FHxHnHx//aϰO|fJ.g6/ah"X *ZRZ|m Jg./ a^`& +$@'@$|'F(/ / aPJg/ aZL |N^NuNVH0 "n i$&($)) A|HB)| E JBBBBBHxHiHx//aOrf>Hx/ Hx//E ٺNOrfHxHnHx//NrfJ.gp`BL N^Nu%s%c: hard error sn%d readwrite%s %s error: v%d u%d, R0x%x F0x%x A0x%x I0x%x P1-P10: 0x%x0x%x NVH88 . y$p / aXJg / a`FG0+f6g / a`&g2t&*ZHj/*$aL9(// HzpaB`(*ZSm(j>$,8 v jA"0@@f 0+@g",H` + ‐"/xĄ"BHiatԊ/HzE4NO ,$"< @g"< ;//HzN2k/ 2k/ 2k/ 2k/ xƄ/0/HzNO$. vN/+ HzN/+HzNB0+/HzNpLN^NuNV/. Hy/</.BHzaN^NuNV/. HyB/.BHzaN^NuNVH<0&.$. "n(."z ꩂ  y$p &j dhg>b Adeg dmg@` dfgN dggj`Hx/ / aB`"z…G #K`g>Jgz@`z˪`g$BB*f *@// / a`Xfp `NBB*f *@// / aOJf*$*zA%EB/ Hzzƅz/ap%B`pL L0$.,. $nzچ/Hz:G4NPrg /Hz)NP*)B@*-B@*+B@/.HzNj))B*O*+gZ*-lR*9BHCBC*;ሆ*=(`Sk|`%$<`*-lHxa PSXgV*+l*+ f|@%*+@1*+g6|%*'f` Hxa X*+m*7`6//HzcNO `|7|%*'f` Hxa X*+m|%*-m.a{(@PJfHjHzay` V/HzG4N%L,Hx// Hy 3a/aHzNO *PgHzNXB*Q g nJg`. g g`Hz`Hz` Hz`HzNX`B*Q/Hzat,fHzNXB*S/HzN 9tl^L9Y#Y/ a L N^NuNVH? (SCSI-%d)type 0x%x, qual 0x%x, ver %d at %s targ %d lun %dNVH<<(.*. D&hf/(/HzavO pЎ*@BBB.pЎ(@BBBBB.BB.B+&<4rmfrn`Hx/ HkE 6 NHx/ HkNHxtԎ/Hk NO ./ / Hz CN+O c4B@Hz CNP`"B+/B+/B/Hz CNOJg D/(//Hz CNpL<()g| )B(1Br@7|9| ;|=| %B$N^NuNV/ $n` HxaX*)g@)*- @$nN^Nuixfer_start fail: i%x, w%d NVH00$n". $.&. H@H@9 @;A=B1B*'|%*-fjBG*)fSjBJYg/*)/Hzxap nJm R` B` <RB`@HxaX*-g nJm R` B` <ARpL N^Nuixfer_out fail: l%d i%x w%d NVH88$n(. (n$9YJo*-glBG*)fSjDJYg/*)//Hzao nJm R` B` <R `JHxaX*-f\5SJn nJm R` B` <ARBLN^Nuixfer_in fail: l%d i%x w%d NVH00$n&. &n$9YJol`V*)f Sj@`5S*-gJYg/*)B@/Hzan n>Jl.`4HxaX*-f5SJn nJm R` B` <A RL N^NuNVH<8$n*. (n.$9YB*'Bo*+g|@%*+mVG&\Sj( nJm R` B` <Rp`*+f~*-lxHxa8X*+lD1|%*+lDG&\Sj( nJm R` B` <Rp`HxaX*+m7|%Rn0 nJm R` B` <A&\R$9Y`SkHxaX*- g nJm R` B` <A>R L&LSj& nJm R` B` <R`vHxaX*)g nJm R` B` <RA)g*+`fBA/ / aO `B*<rFJYgr{F G ($gz-Pg GA?f"GC3f<z`z/ G/(0/(N/<Hx HnHn///aOBNB.%@B.HABAB.ሂ.%AL N/<Hx/ Hy[t/+/+ k$/(a@$OBNXE@`Jm HzaYZp`0$ oRk nB2+ +'@/ aNBL N^Nuunformatted/missing media%s: WARNING: %s, using old default partitioning defining `c' partition as entire disk NVH><(.&| 쫆 y(p<$l lVIDHxB/ aRO B,fJf4// aLPJg&n|g `|g`p`l@$< <BJf|5|%|(| %F,|%F0|%F4%|85|B ,f)| <| "TL@L%AB/ Hy AV|Ȇ|/al$OgDK/HlHzG4NO JfHzN+l 5|B`HztN/ /a BL<|N^NuNVH> $.*.( | &|FƆ怰l y$p Jgx2*gn`Hx/ aP2*0@fJ@f&A5A/a($j/ aXJg `Trƒt|g jB0(o J0 fp`* g `g` <`8,*<8%F@BL|N^NuNVH0 ". v 樀" y$pA,vr fFè`Fè ( !@fjj69{0B@$@2A@oFJgjHxHjaPJf gB@F`aj/ a.v%CBL N^NuNVH?<(n.. $,8 r ⨀ y-p BHxHxtEN&@BHx/N*@HxtB/ aO 'yB 'l88*,H$l0(,9{0B@$@2A@oF/ / a 8PJ0f ~'G0/a:X gB@F`a|` *$@%@$/ amL N^NuNV/ . y$p Hj/*$adPJg/ a$nN^Nu%s: scsi sense class %d, code %d, key %d, blk %dNVH08&n . t'@vgHxEz/ /+/+ k$/(avƒ/C/HkHzzI4NpO$ pf^*ƒ/HzwNPJl /*HzpNP*vrgmJg`(vg` B`0+ggt`@@7@HzN L N^NuNV/ / &n n EB4%hB4/al@Hk/+$aO Jg /+ar`B00+g@7@/ a$n&nN^NuNVH08$nJmB*ZAZtJ0o&jB $ VI - +$//+0/+`fp `BB+f +@// / aOJf4k7|B/ Hz>xĄx/a7J`vHm0 m/aJf*JgJl 'm0`Nx'D`F$`@(+0gp`4B*AZtJ0fp`Hx / HkV` Hx Hkv/ a}BL<N^NuNVH< (.$ z &zFƅ y$p Bl*Jg&*gJ@fBHx`Hx/aOJgp`2r jzƅ$((z L0(9 JgBHx`Hx/a L".$. *.&.JfR|# | 쨀"xȀl y pJg(fp`"h")(LA0Jgp`r| LA( (1 "q Jm Ѓlp`JI/HzN/ /,j/,f l$/(a"BNOJ\fr#\HxN NBLr)ATL<N^NuCan only write QIC-24 EXB-8200 density support only Only one density supported Unsupported drive SCSI bus timeout st_scsiwaitno cartridge cartridge not loaded new cart/power interrupt cartridge unloading %s: not ready st:%d write protected NVH?< .-@~F΀-G ~n y$p Jg *Tfp`gp` j$,(**f(*jK/.aC%@*I\/</C-I/ Hy\///aܤ*I\O.//.Hy\///avO0*n_@0@~ e@0;NZ88888ZZZ2.g %|X`:%y\\X`0BX`*B.HABAB.ሂ.Jg%AX`%|XB.B..pC|B.B.B.B.B.jY *X@j[0*n_@0@~ e0;N<~~~.g|`~.gHz`d|`h.g HzaATXy\c.y\gy\ky\o`&.gHzaAX`HzaAp`*I\BIB// Hy\///a&O~fPB\/ ///G aNB// Hy\///aڎ&O,f/ ///N/ aOJft~g~fBR oHzga@Rp`4BHzgHxHy-,abOJgD`///I -LN&O ~f/ ///G aNO0*n_@0@~ e0;Nvv-g-gHz`@-gHz`2-gHza?BX`-gn-gfHza?nX`z-g///N&O ~g$B\`\-g///N&O ~f8/ ///NOg"/ a&X`HjHza>/ aO Jf*I\/<//.Hy\///aش&O~f/ ///a @OJftĮ gJ.l~ή/Hza>~p ``B.HABAB.ሂ.%A`G a-g *WfB\ *T~%GTJg~%GT~ϪT/ ///NBL9{0B@(@2A@oF`$ +$ f$ +$'@$Hx/ aڔP +$f'|$ gB@F`aĴ'F8B0B4BHB(/ N/ N +$Pg / aX +$'@$~eլ\SJnDp@T~΀)GTLp`BBHx/a$Ofl/a``*@ M D H L`L2+B 0+F "@C 2+J Ё2+N$ԁBHx/ar(@// Hx/a6$Of$,P -l$/// aF`2+B 0+F "@C 2+J Ё2+N$ԁBHx/(<"DN(@// Hx/a$Of^4kB0kF0kJ0kN$ BHx/"DN&@/ / / aj -Ol$/// aE\$Hx/ a,OHx/ a`Hx/ Hx/a8$ L<<$.(. *n(n Ё"AC AG I FC 爐 3 g*g* @ hgc @ hge @h3b @h0ep` qlf/./ //a`E0'J\BB4B8Bf @#` h?f@#`/ / aP`C 爐A Jg| `j|͐`d/ / / a2*`V/ // a.*`H/ /// a(*`8/ /// a*`(C 爐r |́' ` / aH`zB+ L<|N^NuNVH<<$.(. *n Ё"AC AG E0'J\BB4B8BnR hOn h@l h=m&` Hgn Hg` Hg Hg` @HgVn2 f~gn f}g` @Hn @Hm`T @ hg$n @H1g` @h3n @h0mI/zʁ// a$pЫ\// / aN^`f+!g^@I/+!I// a+#@# h>f @#`& h?f@#`BHx/ Hx/E NBBBHx/N`BBBHx1/E (JNBOBEHnBB//NSORzl`BE B(MHnBB//NORzl`fHnBBBD/a\`LBHx/ BD/aB`6/ / a *`,I"AC 爐A Jgz `zː`B+p`B+BL<P gB@F`Jg ||g `t|-F`-@B@*@20 n ЈA AE *!gFB@HzG4NAdP g B*"f/(Hz~NP`A fHzpNX/ a$Xgtz0ڊ%E\BHx3I// axت\%E\B*/Hz8G4NBOo B$E/Hz/NPRn`Hz#NX R|lHzNL |N^Nuhilconfig: unknown keyboard type 0x%x, using default NVH80$nB@&@2@j!I/*!I// aB*O B.HnBBHx/NOJ*"g6Ad gB.gBA fJfB./Hza@P gB@F`aNL N^NuNV/ / n$P|BHxHnHx/ G N/<B@a2*OgjHnBBHx/ NO.gBBBHx\/ N$n&nN^NuNV//"n n Bv҃$L<,fffgҁF@hBHxHnHx/a$.&.N^NuNVH88$ntG0J* g\I LB%K\BHxI// NpЪ\O rl"@ @0f%K\BHx3// N` R* l%K\B*B* \ILN^NuNV/".t‚鉀$N^NuNVH< n$n"n..:9SxB@(@2A@oF(fC`(fZS fJg(g( f gB@F`aL `B$.&.N^NuNV//$.&. //aon\p BHh/Hy a$.&.N^Nubus_space_map: bad space tagNVH8 .(. &.$nJf 9T؀$B`Zrg HzaC r /Hy aPJg$$Sr Թ\Hx@///an:$B`p LN^NuNVpN^Nubus_space_free: shouldn't be hereNVHza Nqbus_space_unmap: unalignedbus_space_unmap: bad bus space handleNV// .$. &.Jgrg HzaC g Hza 9\b b Hzaz//am\ r @Hh /Hy a$.&.N^NuNV n". Ү BN^Nubus_space_probe: unupported data size %d NVpЎ# P/afXJg B PB`^rg$m rg `4rg`*". n0`*". n00`". n 0`/.HzbavB PpN^NuNVH 8$yT#K&J# ,I%$< ||||@/<'Nj.Xg `,j.g  9 ,"S# ,Srm|| 9 ,f r(# ,p("<L@#tLN^Nucannot get %d Hz clock; using 100 Hz cannot get %d Hz statclock; using 100 Hz cannot get %d Hz profclock; using %d Hz NVH?0$yT#K&J(<А$9"LBJg/HzPa.~d#P&9Rf#R&9` LCHJg/Hz>a~d#RPvd$9T@f CA< #T@&9R$`2n"<АLBJg //Hza#RT@$9R&*<АLyX(<АLCH,<АLBh jRrdҀ 9el #em #&SS$S#"9e #씁###||B ||@B*|@L N^NuNV .Rf #` #N^NuNVH 0&yKE$9eSNg"9ҀB S y  #/.aL N^NuNVH <*n(yKG-dE-h"S RB  "ff 9萂A B?oR*+HL<N^NuWARNING: no battery clock WARNING: bad date in battery clock WARNING: preposterous time in file system -- CHECK AND RESET THE DATE! NV/ $n-JJefB"9T/aXJgHzFa4X`"9T#er#eHnaXJgcHz%a-JX fnHz1E4N-| =HzGNA-d $nN^NuCannot set battery backed clock NVH88A-d/a @E $"L<fffg"ҁ(@I Ѐ"$L<,fffgҁ $("L<fffg"ҁ(@I Ѐ "($L<,fffgҁ $("L<fffg"ҁ(@I Ѐ C "($L<,fffgҁ$( "L<fffg"ҁ(@I Ѐ "( $L<,fffgҁ $("L<fffg"ҁ(@I Ѐ "($L<,fffgҁ $("L<fffg"ҁ(@I Ѐ "($L<,fffgҁ "($L<,fffgҁHx HxG NBO B//NPg Hza` RRx lLN^NuNVH8$."L<.E&ւHCH Ѐ"CC: "鉒 鈐A L< ҂x Ѐ 爐Ё鈔 L< ҂ Ѐ# 鈐刔!BrFp lo$Jf`R xf mn#Jfx#erAemRlx#eA R#pЈLN^NuNVH8Hz`#%.fJolBoaRValB@F'.gaat.gHzFaab3#Sx3#-83#_L3#{0BBC4 YJgB4BJB (|g6m|g`b|m\09-8`<9{0@8l\<F 3{0`N9_L@:l><F 3_L`06l&<F 3-8`/(HzaHzaѐ PJflR|lN29_L09{0Ac3_L209-8@c3-80ySxc3SxL|N^Nuinterrupt levels: bio = %d, net = %d, tty = %d NV9-8r/9_L/9{0/Hza.N^Nuintr_establish: bad ipl %dintr_establish: can't allocate space for isrNV/ /$.rd /HzatHxHxHxa*$@O Jf HzaN%n%n %B%nA4C, f"B`."*o%i$ i #J`"@ f$g Q!J"%Ia $.$nN^NuNV"n QJg!i i Hx/ a-aTN^Nuisrdispatch: bad vec 0x%x intr_dispatch: ipl %d unexpected intr_dispatch: too many unexpected interruptsintr_dispatch: too many stray interruptsintr_dispatch: stray level %d interrupt NVH0  vրrd /Hz&a ARRP @4 f0/Hza 9@"R#@RPr l\Hza΀B$@/* jNX$RJfJgB<`. 9<"R#8".&n B( | zFʁfF`(R#HBHzHxHyHas&OfN 9Hn|#H`$S$*"f P& +,S'FSjHznâ | 쨀|gmJg`|g| g(`&+ |e dv`pAPC VI%dE Jfp/Hx/ Fƀ//9#HyN$+ "+O <d / /Թ#/N& y#Hh/HyNO` &+ $|A d$BJWI// /NO Jg$TeXe 9\bcp`/ / /a_`p|fBB`|gbI%dJLf0BHxTHxa$#LHxB/a8O O "* <d / //9LN&O `&p`TJf*Ւ"[Iӫ ,+݀'FJgJg| 쬈f|Hl HyHavfBH L|N^NuNV/". n t 䨀Jf etdp` t $N^Nuvm_map_lock: failed to get lockNV n"n  0"#N^NuNV/././. /<a( N^Nupmap_init: bogons in the VM system! pmap_init: can't allocate data structurespmap_init: kernel PT too smallpmap_init: uvm_unmap failedpmap_init: cannot allocate KPT free listpmapplNVH?< 9x~ yG #G 9A #DP-yT/< HxB/<Hn/9H,< &FNOJf.-yR/< HxB/<@Hn/9HNOJg HzatB B$yHܵo& <"@Y @ A$"C$ѹ Rn y G A $ 9P"ҀFHx€//9Ha8~$-BO f HzOa#z8/.Hy*< &EN#`"nC-I#N y AA-H#z(*I"BP&9HܶoF <I(<$@Y"@ QC$ E$&D&~$؇(I$G K҈RnEP"pH@vֹܰd& &CG:( "9P$ԁFāԀB/< HxB/Hn/9H&FNOJf..ނ-GRe HzYa/././9HaD^O Jg HzRaƬHx//9Ha7$-BO f HzFaƄ. Ѓ-@؀#CxB-@ yCxG#Cx K #!@/Hy&EN yCx!@P .f 9~ Hy0BHx/HnHn/9HE *N#z$-| 9O o$2|BBKԻg yB h f|`"9(  l~f &@~f&Jgd&~f" ~"0 g A Ё` ~0 f$`Z ~ TE cJ*g6G JgJgaQJf *fx// // NOXbb(Jf6Jg yBJg g h gBJgfaQ`aQL *v PA (fHx//*/*a O`$RJg * @Jf gB@F`aQL N^NuNVH?8&n&. ,. .JgRf/// a<`>f6A *0 ̷g yB h f8|2|c"9(  k~f (@~f(Jgd(~f" ~"0 g A Ё` ~0 f&` ~ SE cp$g` ~gVJgJgaO*$Jg(~(fB/aO/aOZP$~`~΂$Jg /aMXXb`LN^Nupmap_enter: used for CADDR1 or CADDR2pmap_enter: access_type exceeds protNVH?<&n,. *.(.v-C~-GJgfxgf HzpaFJf/<@/9,a-v&Pv(f. ~ k"0 g0A Ё0 f"` v k(f // aPE ~ SI " @f: JgJg`JgJgR`S"BgJB`BJgHx/ // a Og*B 9PK" F€/& ƀ//9,aQJOJog".9P$9pb TIvgAbd B`p~A"nC pE>9SxB@&@2A@oF-CJf%F%KBB BB`ta @!F!K B BB$$9gN"j& g BB`8Jf& *gg f"*‚ gB~& %G".F .g HzVa.gB .9PA"9ಀbd B`pvA p`J..Cg@ &9PA"9ಀbd B`p~A p .g &.B@F`aL`BBRJgRJgaKA "..|"T v$~ y(Jg$BJf Jfv@~f vDf~ & "CWID~fJf/aK/aJP(Jf g yB h f /aI:XJgJfHxHx@/a `aJ(L9SxB@,@2A@oFǹfHfB(k *k$SJg %k"K J""""""/ a^X`jB`dfg&J$SJf(j *j&/ a0X "D.A"9ಀbd B`p~ nA"C$qGJg,Jg&Jf" +g~΀'GHxB/aO Jg~(fp@Ќc Bb`Bgp0-2@SI;I @f^Hx/-/9z$a+yz8+y` O ~(f+yd yBJg h f - ~ /aAX~ϫS "D(A"9ಀbd B`p~A p. gB@F`aB&L8*.(. JogpIP",&9pb TI|gFAbd B`p|A"nC pE<9SxB@$@2A@oF ,Abd B`p|G sIg gB@F`Jg |ga?JgpJgl j *| P 0 gP ,A"9ಀbd B`p| s gB@F`a@p` $RJf gB@F`a@BL|N^NuNVH?<,. (nxJogGP".*$9pb TI~gjAbd B`pzA"nC pE:9SxB@.@2A@oF*G ..Abd B`pzA p> JgJg&*zfChe Cle j ~ PG JgJgBa= $* ąg`Jg6~(f,zg ~`f fB/.a>/.a=P& * g yB h f /a<4X$RJfL g * B@F`a>L %d pmap_enter: uvm_fault failedNVH?<&n(. *+z8fzHxHx/9z$a'@/Hya'@ O~(fHxB/ad'ydO yBJg"g h f + z /a= X k"9(,<~f &zE<` ~E zf&~JfX*k/ aX$Szf Hzap. ΀'Gz HxB.+ނ/aO ԫ z $ k 0<@ ЁE . z΅$G~ SAL( 9PFȀf:9SxB@&@2A@oF yJf/ a yXJf Hza&# _#_$(HxB/(a@PO.HxHx/// aVO g B@F`a<@`RkHxB//9,a^OJg//HzaHza//a$P.9PA"9ಀbd B`rzg$~‡C nI A  qA `h$z(fHxB/aO .9PA"9ಀbd B`pzA"nC pA>9SxB@&@2A@oFJgz` PJg ff!J !K~(fp@Њcz $b` B~$R gB@F`a:L 0x%x type %x, code [mmu,,ssw]: %x UVM: pid %d (%s), uid %d killed: out of swap NVH?<(... BBEPR&yBBJfG΀J"f Hz6a.Xf|F-k-kC'I& b.0;JN$$$$$$D$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$DbZ6$$jj/.//HzE4N/.Z < ev֎Jl < `/HzNOB@F'//a P gB@F`a/J#,gHzNXHx/a|FȆPodAo/0LaHza k"J*PJgJf J* l2*0@` @`g~`~ g\mJg`~@g`$9,~f 0@ @g~mA Af j `/*/*a`$9,~f 0@ @g~mA Af j`V/*/*a`B$9,~f 0@ @g~mA Af j0`2j/ /*a,*PJgJfJ*l2*p`~ g\mJg`~@g`$9,~f 0@ @g~mA Af j `/*/*a`$9,~f 0@ @g~mA Af j`T/*/*a`B$9,~f 0@ @g~mA Af j0`2j/ /*a(* l"!F6mJg/ Hn/ a(@O ` * rfHn/ //*aȤOJfPB-nHnHn/ mN(@O rg"mrg<` Jf-n -nnP`"U-GR` j hJg(p-L nP(*` /aXJ*g / ajX`BJfjJLg\B@F&/ a jRDa;X gB@F`a#\` /a~XJ*g / aX`BJf*+g *L9s//.R/ aO r,fB.V pf4Jf0BHn aPJg 6|(***B// aO `  * rf/./ //*aǒL+J pf0Jf,B/ aPJgz&*(*B// anO ` * rfBBHx/*a*//B0*/Hn@/HxGE"NO,Jf>/B/Hx HxB0*B4*"Ҁ[I//Hx//HxNJfRBL N^NuNVH< &.*. (.gTEP/Hyaӆ$"Ғ//HyaʀHxHxHx//Hya րڀO,fL MAXPHYSdmago: no can do 32-bit DMANVH?< n,. (.A C+pGB o HzaJ9,f.g HzaB-n~ϮC-IKJo-M$M(I/a$(X~(f /aX "<o"+(܁Jg` .g⁺f(J9,f 5>Ё n"nڱ(QQSӒ`*ڒ$PPRJnnBS'CB+ 09,W@H@7@".~‡f@7@Jgk`.gk.gk~(f Jg+ 90~f Jg+ ~f Jg+ J.l"kfk`+ J9,f& k +"n  +05S@1@1k`$ k +"n  + 5S!@1kLcn_dev == NODEV NV/ y%JfB`R$(rf Hza|J6lfHy6l/aێP "@C Ag/././. / pN$.N^NuNV/ y%JgD$( 96lg/aB6lXHnHx/a`O Jg/.a4XJgB`& "@C Ag/././. / pN$.N^NuNV/Jpg y%JgtgB`4 y%Jg("( "@C Ag/./. / pN`p$.N^NuNV/ /"ypJg y%Jgtg")j` y%Jfp`&"( $@E Ag/./. / pN$.$nN^NuNVN^NuNVH00$. $n tbf$Jpg>B j/ajJfdBpB`Z"ypJg y%Jgvg")j` y%Jfp`*"( &@G Ag/ /./.// pNL N^NuNV/ /"ypJg y%Jgtg")j` y%Jfp`&"( $@E Ag/./. / pN$.$nN^NuNV y%Jg /( hN`BN^NuNV/$. y%Jg,Jg(//( h NPp f y%Hx /( h N$.N^NuNV/$. y%Jg(JfSpJpf //( hNJgRp$.N^NuNVN^NuNVH 0B%Em RJg$/ N *Xo Jgo&JE  @JfJg$9%/ kN%f#%L N^NuNV/./. /.ar#fpRN^NuNV/./. /.ar#fpRN^NuNV n Jf/.//.a`pN^NuNVH88&n(n $nBB f&/+a}-@HxHna}-@O `-@x-D/ Hn/ aN&O fvJfHxHn/.a &O fl$. xFxfD/a0x%D`(Jg&xȂ/a0".xFĄ%AX gHx/HjaN` LN^NuNVH8 $n B /./ /.a(O rfxJf\ *gV/a&rXf/a0H&r`Jg$/a0.ኄpF&X//*aP LN^NuNVH 8&n(n $n/ / / axt#f$ k hgt$pR` gBBLN^NuNVH 8&n(n $n/ / / a0t#f$ k hgt$pR` gBBLN^NuNVH 8&n(n $n/ / / at#f$ k hgt$pR` gBBLN^NuNVH 8&n(n $n/ / / at#f$ k hgt$pR` gBBLN^NuNVH<"n*n (i d T&p Jfp `JHnB/ aJf8$n T!"l U0Rk .o)@ n BL<N^NuNVH08&n +vmvoJg`vg`tԎHxn6rg: 'g:`B$`J$`B$`:r$`4$`,r$`&B`"$`aK$`/HzJavp`B$nN^NuNVH?8 n&n (nB"hE tgm vgX`tg~` +v '@"[I$*&* oHh0 h/aZ,f\"+[I%@%A $%A(*** Jj Bك$v B.t " (` h (v Щ,(`| LN^NuNVH00$.&n $n g/aF @XJfp`X BB(rҀj vր$`$ + g f JmB`B`rҀ///a$v fpL N^NuNVB/./. /.aN^NuNVHx/./. /.aN^NuNVH0<*n(n $. m&P/a$@XpJgT ,vg:m vg`.vm& kJgB0*g B2pfB`JgHx/ / a4"O fB0*-@B0*-@B0-@B0*-@=j=j -j -j-j*-j-j=j=j-j-j"-j&Hx8/,HnaX"`ZJgZ"+gB0*g B0gp`LHx8Hn/,a"f$5n5n0.@A-d%P& `/./ / aŽL< N^NuNV// n -P-h-h ( "t‚-Agv-C(gnp.f (-@&([I-B-C/.Hn/.a($.&.N^NuNV . Tgxb( @Tgfb @Tg|` @Tg@ @tkgp`| Tg6b TgD TgD`` Tg tjgJ`N <tu`F <@tt`> <tv`6 <@tw`. <t`& <t~` <t}` <@t|` <@th` <tgN^NuNV|H?<*.*n "E()BG$- @tg t f/-///aDz`X "Dd Q(p Jg fp `60 cp`$ cBHx/aF,&FO Jl Jg>// /-aR$@O Jg*`gJg/B/ aO ` g& $Tnj $TlN f~gn" TmH To Tg`0 tjgn Tg` Tn Tm` @Tgn& @Tgn thgt` @Tg` @Tgn @tkgn` @$Tg`"D iJg@`0f~@΁-G| l/Hn|/<f~`r~& l// /<tb`^p&g~@&$l// /a2./ jN$@OJf` @Tf6p@&g.~&`(// //a:V` l// // hN$@OJfgJg//-/ a$@O Jg Hx/a L<$.*n (nv@"B$i b R&p Jg$j"- -x e0; NRPg`g `pgz`|†`8vP k f@$k HxHn/-an @O Jf".[I-@-A*.[I-D-E-n=n=n nf*+ҫх-@-A0. @gn @g` @g:`+ g|"B(-|-J-Bx-DC-I-C`X+ gpx"B(-|-J-Bx-DC-I-C`$-|-J-Bx-DC-Ix@-D 9 jLHn p N`p k gp `b$k Hxv֎//-a( @O Jf>".[I-@-A*.[I-D-E-n=n=n nf*+ҫх-@-A-|-J-B|-FC-Ix@-D 9 jLHn p N @XJf-n-n-n=n=nHx/-/a~`~p`z-U-m-A/ Hn/aoN @JfVzfN$ @(gg(f|͔ gl gl gl L<|N^NuNV,H00$n&n $./*ae-@,Hx`Hn,ae&-S-C/Hn/ asOJf6Hx`E0/ /a}tO JftԎ// aRHxh/+/a}L N^NuNVB/./. /.aN^NuNVHx/./. /.aN^NuNV,H80$n&n &.$./*ad<-@,B/ /Hy98Hn,/ aa>Hx`Hn,ad4(-D-SO$Jg/Hn/ aT`/Hn/ aO Jf:Hx`&0//a|zO JftԎ//aXHxh/+/a|L N^NuNVtH00$n&n $./*acx-@vHx`Hnvac&-S-C/Hn/ aqOJf6Hx`Ez/ /a{O JftԎ// aHx/+/a|dL dN^NuNVtH00$n&n $./*ab-@vB/ /Hy98Hnv/ a_Hx`Hnvab&-C-SO .Hn/ aO Jf6Hx`Ez/ /a{>O JftԎ// aHx/+/a{L dN^NuNVH80&n$n HxhB/ aR$%k5k   c5| `5k %kT%kX"+# v x 言%B5k 5k +4"+8Bxn%k8`x%D%k%k$ %k,(%kD0%k@4L N^NuNVH0 $n"n IBBBBBBBBP23j3j   c3|`3j3j3j 3j *4"*8Bvn#j8`v#C#j#j$#j,L N^NuNVH 0$n&n $./*a`-@B/ /Hy98Hn/ a]// / aL N^NuNVH 0$n&n $./*a`-@B/ /Hy98Hn/ a]// / aL N^NuNVH 0$n&n $./*a`B-@B/ /Hy98Hn/ a]D// / aL N^NuNVH 0&n$n $./+a_-@Hx/ /Hy98Hn/ a\ *O f// / a(`-R-@// / a>L N^NuNVH 0$n&n $./*a_|-@B/ /Hy98Hn/ a\~// / aL N^NuNVH 0$n&n $./*a_,-@B/ /Hy98Hn/ a\.// / atL N^NuNVH08&n$. &./+a^-@B/$B/Hy98Hn/ I,NHx/ /Hy98Hn/ NO0.// aL N^NuNVH 0$n&n $./*a^n-@Hx/ /Hy98Hn/ a[n// / aL N^NuNVH 0$n&n $./*a^-@B/ /Hy98Hn/ a[// / aL N^NuNVH08&n$. &./+a]-@B/$B/Hy98Hn/ I,NHx/ /Hy98Hn/ NO0.// aL N^NuNVH 0$n&n $./*a]^-@B/ /Hy98Hn/ aZ`// / aL N^NuNVH 0$n&n $./*a]-@B/ /Hy98Hn/ aZ// / aBL N^Nu/emul/hpuxNV/ /".$n jt0( P gp`P @gn @g `& @ g`/ /a`/ /a4`/ /a$PJf %|qlT` HjaNl $.$nN^NuNVH08&n (kB('l ,", j @'@0&,֬'C4'l,D keHkaMzX kA  kER$ %l %k( + %@ g /+ aXv@%Cv%C keHkaMX kA  kER$ %l%k0 + %@ g /+ aXv@֬ %Cv%C"+0 Ь$B$A4JoF keHkaLX kA"kAR !J!BB Bv!C/ /.aH@L N^NuNVH88(n &lJ fJg l J8gp` l x0 +$ԫ"+ A'A @'@'BlBB()k ,"+ j @)@0(+ث)D4)k,D leHlaKX lA  lER$|%k %l( , %@ g /, aX%|x%D leHlaK0X lA  lER$|%k%l0 , %@ g /, aX + @%@x%D",0 Ы&C$Ԭ4JoF leHlaJX lA"lAR !B!CB Bx!D/ /.aFHLN^NuNVH08&n (kB('l ,", j @'@0&,֬'C4'l,D keHkaIX kA  kER$ &, ֬%C%k( + %@ g /+ a|Xv@%Cv%C"+0 Ь$B +4$AJoJ keHkaIlX kA"kAR !J!BB Bv!C +4", $ԁ j @ lB'@4/ /.aDL N^NuNVH 0$n&n $./*aWN-@B/ /HzhHn/ aTR-S-kB/Hn/ arL N^NuNVH 0$n&n $./*aV-@B/ /Hz Hn/ aS-S-k-k/Hn/ arL N^NuNVH><*n&n "+($DE|e$ *<q"EJ(fp`Iq 4(g:// /ao&O g& - |f/ /4(//-a `8 - |f/ /4(Hj/-aO/./ / "E q(NL<|N^NuNV ."n re4rgmrf iI` i0H` i  r#A `#@ N^NuNVH 0 n&n Hn//(aLh$O frldp`J gdHxBaL$@/+/*/+ am$Og / a `v f j r j!@r%A `:/ /+a`, f$'|HxBa$@ jBr%A P/ /+/+ n/( a$PL N^NuNVH 0 n$n Hn//(aKt$O fjrldp`^J g@HxBa\&@/*/+/* am$Og / a `$/ /*aFP/ /*/* n/( a#L N^NuNVH00 n$n BHn//(aJ$O fJ gHxHn/*alz$O g`BHn/*/* n/( a%Z$OfxJ gr".gl nJgr f hJg  nv!C ". ( l-@ n/./* /(G bN$O fHx/*HnN$O .g/a L N^NuNVH< $n /ax&SXze z gzfp`"*g,Hx tԎ//aklO JfnHn/aG P"*JVIx؎/JVIrҎ///.aʬOJf*Jg"tԎ//aFHx /*/akJfBL8$n(n BJgHBBBBBBBBtԎ/HjaHx /,/ai*Of8 ,g.Hx Hn/ah*O fG/ /.aPB@F' |gmJg`|g`"*҂%A$*ք%B&*چ%C(*ވ%D 9F€%A 9FĀ%B 9Fƀ%C 9FȀ%D`j .F .F .F .` *.$n BBBB vxg/aXJg S"|†$ꈅ R| lL|N^NuNVH<0&n$n Bvx$S z" 3,g/aRXJg 稁Rz lL g:` j&BJ4VID!@B rê*$nN^NuNVH 0&n$n $./+a(X-@X rg`mJg`rgrrg`-j-j-j HxHna(0-@Hx/HjaAN/Hn/ aer`\-j-j-j /Hn/ ai`:-j-j-j /Hn/ ak`-j/Hn/ ab`pL N^NuNV/"n n ". tg:mJg`tgLtg\`|-h-h-h /Hn/ ar`\-h-h-h /Hn/ at `:-h/Hn/ ar`$-h-h-h /Hn/ awh`p$.N^NuNV/"n n ". tg"k$ԉ DcBB(0(g2b초b// /a&O HxT/aoP-|-JB 9 jLHn p NXJg `j.+f@*3g8 jH(9g,$ $h / au n!J BB/at@P`Hx/+ Hna0T n&k L<`N^NuNV/ /$n /./ /.aO Jf@ *g8HxtԎ//a/`O Jf B@.=@Hx/*/a/JfB$.$nN^NuNV/ /$n /./ /.a O Jf n"n ((v"&)*) $)gA`Ag|`|ʆg A|`A|Ɔ  g|`|ƆgEB`^A"EgE`E |?F|@g0mJg`0 g f B|†`B|B`|B0  g&B  f| `|† g|Ɔ`BB| |"#C#E #BL|N^NuNVH> n"n &(v(*)") $)g| `|†g|`|†g`gB`B@g|`|†g|@`|†fD`D_?   g&B  f| `|Ȇ g|ʆ`BB| |"#E#A #BL|N^NuNV"n n BBB N^NuNV"n n N^NuNV/ / &n$n $HjHka + @%@$n&nN^NuNV/ / &n$n $HjHka + @%@$n&nN^NuNV n"n "#|BJgp#@N^NuNV n"n "( gp#@`BN^NuNVH8$. n -Pv֎/Hnax؎//Hx/aOJfHn/a n BLN^NuNVH8$. n -Pv֎/Hnax؎//Hx/aBr@-Ar-At-Cp-MHnpN$Xf m$n -|-JC -I-@-M 9 jLHn p N$Xf m$n -|-JC-I-@-M 9 jLHn p N$Xf|". f"n$ft`d/.E6NXJf/.NXJf"E"`<$KHj/a"E"/ // a$Og"E"`6HxT/ aXB`&/.a]X/.a]XHxT/ aX LJf4 -f$ [g ]ge TIDRR` WIDRfJfp`g`f(R`LN^NuNVH?< . *.ȺcHBB(@V&@T$@R"@*nBXX "X H@B@BX|*XbL<|N^NuNV nBB gE#!|ͫ!|!|2Tv N^NuNVH<<$n*n (."*5 Ҁ%AcR zѪt@b@// Hr8IǘNO Hj/ G .". &BCHC$BBHB*,LhJf Jf"B`b"B`"x c  D*LX"L B@H@ AHABAJg$ H@B@ B@H@dS`$ H@B@Ҁ B@H@cA`$ H@B@Ҁ B@H@cA`҆cR"H$A " L|N^NuNVH8B$.&. .".JjD@xJjD@Hn////a JgD@ .".LN^NuNVH< .". (.g.$&zd pЄ&B` r *"& "L b `c zb ` b @c Zb fJfB$$_N^Nu / g8 o"og.f,Sg$g"f SggfSg g fSfNuUINu o FJfЈNu o /"@fNu o"og$f"gfgfg gUINuUINu o/ gJfpNu Nu o /"@JfSfNu/ o"// mjB$ሄሄሄ gSg0U g"S QB@Sd gS QgSQ /$Nu"o o"/ mj mX gSg2U g"S""""""""QB@Sd gS"QgSQ /Nu mX g Sg3 U g"S# # # # # # # # QB@Sd gS# QgS Q /Nu"o o"/ mj mX gSg2U g"S""""""""QB@Sd gS"QgSQ /Nu mX g Sg3 U g"S# # # # # # # # QB@Sd gS# QgS Q /Nu o"o / gJ"gf4Sg:" f"gfSfgfSfNuYYp`BB !NuNV ..Jg nf S`SfBN^Nu /"D€p Nu/ o"/ t mX gSg0U g"S QB@Sd gS QgSQ$Nu o"o"/ mp gflSgHf`U g2SfLfHfDf@f0&n,. (.ȼo$Bz"KEB6"4 ꠂ@2RnB037L |N^Nu o NXNC/@pN@spurhillev2lev3lev4lev5clockstatclocknmid'( $  <<d b@@((XÈËÓÙÝãèîóùþ  %,2:6ANG RX@eThJ xLTLlL8MdMx@MM@N0@OxO@OO@PlPP(@P(@Q8@RH @RH@RX@RhRhSxSlUPYY@Z P\pP\Pp@N0d*֮iAd:0!$FYٸt:ۘDxHPPH2\unfb[V Ldd r  LLdvPP 8H2(xxP, OD V H V ?\ V 6T V 0X V ( V  V -PXTUNTFY$ZHPNZbRR[ CE[XST[NMW:X<CLX0PLX0REY @RR[ CE[XST[SLURR[ CE[XST[ER\$CE[XST[Haxbi iijjjkTjp&MHpLak͈Dk^Dk^pkJkJpXp }Lrxk^lkrj`k(sTkJjk^zk^Dk^tk^{ uZy$jPN|O<{V{|Dx8{,|X||kTLk^`kJk^kJ`&D͈k:Dk:pTpXp }LxkJp(k(k:TkJk:k:k:Dk:tk:k:k:k:$k:PN|O<{V{| 8,|X|k:k:`k:kJkJ` P͈cDk:Dk:pc^hpXp }LexfkJg|gk(k:TkJk:k:k:k:Dk:tk:k:k:k:$k:PN|O<{V{|h8k:,|X|jkTk:k:`k:kJkJ`@~ ~x@9D  Copyright (c) 1996, 1997, 1998, 1999, 2000 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. ΀netbsd D*h %2 T ` t|6#\%2j |.P 0   { :  &b {8 P |),-by$yT4` qx r^8rtp v8@ | +j ?4zws%2%2 ; ;w \ @$ @ ;%2%2 ;P> S|rRlD02%2 %28*  y }b ,t P zz%2 0r  "%2P dt%2  P 0.z9z{{z~~<>3%2Q@ XT$*|f %2%2%2%2|p%2%2 vpvv P%2%2%2moFn%2%'4>%2%2%2%2>(%2%2%2%2tput*X%2 ds <&%2$57@d A BH"3W$ ||||||||||Ӕ 4 H  @f v  MTMN(%2%2%2%2%2Nv8%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%29  ? AP. 1x4. ?)*pV 0~ 1, 1X%2&(T    }voicZSNIA=7/' sjaXLA5)! wj]YK?4*??B@YMY<Y. X,2tbd"td8tbd"td8v8  \jjtd8@ ``56@65MDj (2lockf@`  ((PKFA<71+& t p l f b \ U P K D = 9 2 , %   GHK LLMM<MD MO MZ< Mdh Mm Mw M M MDMpMM MM MLMxM M M N< Nh N N& N2 N?NKHNXtNdNmNx N$NPN|NNN N,NXNNN OO4O\8`Dp Lx(TDt$P|,X4`͈O,k:Dk:pO@kJkhkh khLOZxOOPkJ(k:TkJkJk:k:k:Dk:tk:k:khkh$k:PkJ|kJPkJP8P,QTXkJkhkhk:k:`k:kJkJ`kJRd<HQQRRRS:SDT$T.T8TLT`TVTB͈Vk^Dk^pXkJkJZ \LL`x`a"a\k(k^TkJjk^bk^Dk^tk^b\`r$jPa|alhlrk:8k:,bXlbkTk^k^`kJk^kJ`k^RU U U V U͈cDk:Dk:pc^hkhkh khLexfkJg|gk(k:TkJk:k:k:k:Dk:tk:k:k:k:$k:Phx|kJlhlrh8k:,iXljkTk:k:`k:kJkJ`kJU4#mmnno$o`ojpp pp*lp4p  pmpmp$ pl$p/p~$pv5$poY$pfP$p^n$pVTG$pM G$pH$p@$͈r~k^Dk^pkJkJtBt uLuxv,krj`k(k^TkJkJk^yk^Dk^tk^z vk^$jPx|ylhlrk:8k:,yXly8kTk^k^`kJk^kJ`k^U0"0zzzzuzqzl{{{{{ {{zzz z z z z zzzzzzzzzzzzzzzzzz'5<pV z*4>R\jH$,~  | t ͈Rk^Dk^pH Lxkrj`k(k^TkJkJk^k^Dk^tk^NF $jP|lhlr8k:,Xl4kTk^k^`kJk^kJp%͈k:Dk:pTkhkh khLxkJp(k(k:TkJk:k:k:Dk:tk:k:k:k:$k:P|kJlhlr 8,Xlk:k:`k:kJkJ`R' 20123456789abcdef^^0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef +5J$6@Hp5XZ<90+d+,2-P-X]*_8Xa- vH.U Q >FLMFX-4Z\-Z\N-Z\-ypZ\x~-4Z\`, -2L %(i}E#(D@X2(@AAA==(A*E@ 8@8@ @@@@@@@@@/x///p---///|////h/l/////$ X IP Filter: v3.3.6    D@R @=Zf @xftp0\rcmdtraudio@ /x<' @4=,ANt7X_mԶƎ r8N0%(*/DZ$P55@      ?BEFF'' EF''' ?F''F'' F''' F''' EF''' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''77777788$8>8Z8v88889 9.9B9X9d9n9x@;=T>Đ۪۠ĢۂۖLی: ͈  @\D @"p@& L x.kJkrj`k( T j [ r  cD t 8 }H  $jP @|tlhlr 8 6, Xl  Rk^k^4k^`kJ  ` Rh:|͈k:Dk:p ,  L |x kJp(k(k:T kJk:k:k:Dk:tk:k:k:k:$k:P @|tlhlr 8, Xlk:k:4k:`k:kJ ``;͈cDk:Dk:pc^   L x ZkJg|gk(k:T k:k:k:k:Dk:tk:k:k:k:$k:P @|tlhlrh8k:, XljkTk:k:4k:`k:kJ `d=\0123456789abcdef?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@?0?0?0@0C DF 7 9N F  Hd In J L M$ MT M 7 RAT͈ i|  D Rp     6L Px Slkrj`k( Tjrj   dD t R n L $jP gR| W p  `8 , X   & 3 4 ``  ( &`A͈k:Dk:p    6L rx kJp(k(k:TjrkJk:k:k:Dk:tk:k:k:k:$k:P gR| W p  8, X k:k:4k:` kJ &`C(͈cDk:Dk:pc^ p   6L x BkJg|gk(k:Tjrk:k:k:k:Dk:tk:k:k:k:$k:P gR| W p h8k:, X jkTk:k:4k:` kJ &`DG W Z0 \ F  ]$ In J L M$ W M RF ͈k:k:Dk:p ]| _Dk:k: k:Lk:xk:krk:k(k:Tk:k:k:k:Dk:tk:k:k:k:$k:P `| `plhlr ^8 ], `Xlk:k:k:k:`k:k:k:`NFh ~$ ~ ~ ... Z v " @ a J 0  ܚ  \GH0H d  R _ a  L L L L L L L L L$ L( L, L0 L4 L8 L< L@ LJ LH Jm68k,  0B'Gg999999999 99 9 9    14 E EB E E 3 3 (    ' G g 9 9 9 9 p9 X9 99 9 9 9 9 9 9    } m I C < 5 )       1 4 ش , T  0 ) $ $@ $`H %8 %%2'K n  ,XA `h%4K 4 6b 64 6 7 6\ 7 9 : = > =T = ?r  6) #0 004 B. B|4 B B B$ CX D E Gr I\ G HB I  64 M M M N6 O P Q T S$ S U@  6????4 [ [4 \2 \j [ \ ^ _\ a c b b d&  64 f gZ4 g g f i j f i j f i j f i j m o r pp q r  68 u u@4 L : $%2 Kntz,XU `@ %K2Kn,X  `  %K%    j D  b@ #%&)*,/12478;=>@CEFIJLOQRTWX[]^abdghkmnpsuvyz| : 4 ( ʺ T4 J " * V  ^ Ө Ԅ8 $ xd \ ֌'   ܾ  ܸ  ܲ` ܭh ܨx y  t N  * ! /q" M < + $,*  o8 . ) " 0 { + {   " M, p- z* . t* $ (/ nq d0 hq z> N0Cp>@3q> WH@H$^@> HHj2@"@j? ? ƾy>0N 0}ptX>`@io8ni(|x |?~A,A^p'00>pq?~v,,t4&?~, (,(,<D?8% d%@YH??^p^ (?V +?bubY>vV 25}dL5#UdUUV$VdWdW$VVXY$VdUdUWWX$XdX` | ^  X''P 8 8 ( * %@D DTD  L$ Lr f gPhilin`\  0.,+123-456*789/E()^1234567890-=[];',./ opklqwertyuiasdfghjmzxcvbn~|  0.,+123-456*789/`|\~!@#$%^&*()_+{}:"<>? OPKLQWERTYUIASDFGHJMZXCVBN`  0.,+123-456*789/E()1234567890-=;',./    ~|  0.,+123-456*789/`|~!#$%&*()+{}:"<>?     i f c ` ] Z W T Q N K H E B ? < 9 6 3 0`<  0.,+123-456*789/E()^1234567890+'[]*\,.- opklqwertyuiasdfghjmzxcvbn~>  0.,+123-456*789/`|\~!"#$%&^()=?/{}@|;:_ OPKLQWERTYUIASDFGHJMZXCVBN`<  0.,+123-456*789/E()1234567890+'*,./    ~>  0.,+123-456*789/`|~!"#$%&()=?/{}|;:    <'  0.,+123-456*789/E()^1234567890+`}~|{,.- opklqwertyuiasdfghjmzxcvbn>*  0.,+123-456*789-`*\>!"#$%&/()=?@]^\[;:_ OPKLQWERTYUIASDFGHJMZXCVBN`  0.,+123-456*789/E()1234567890-=;',./    ~|  0.,+123-456*789/`|~!#$%&*()+{}:"<>?     \]d]^d^ t`adabd^ lbcdcdd^, #    H T  0 r  \ f X ( R (   = > AV G Jt I H&,+6012R9AA2 P U V Y Yٖٖٖٖٖٖ""""""""""<"4-hJ../PJ/ ø  ~JJ x$!L!:pr!LJ!{||.~0}B  0 T = > G Gt G f X  . R v\ vJJ w2 x x     J ` L j ,: ^ . 6 : o q\ sJJ th z z ` ( : 0 %.%&tttlPJ01899 P U Yl Y Yb"""""" <Ԇٖٖٖٖٖٖ & ( ) * -H 1f *R:"""""""""""""""""""$ A" A J L M< J Z [\ J e f J t^ uD J * T J 4 5B 5p 5J n <Jhp300   y m y i y e b ^ [ W [ S M I b E [ A b = [ 9 6 $   n \4: T -  !"EFG.$#hpuxpj ;wrhmXyzz,}bt@vB  ^`^[^V^Q^K^F^@^;^5^0^)^#^^^^ ^]]]]]]]]]]]w]n]e]\]T]L]E]=]4]/]*]%]]]] ]\\\\\\\|\c\O\;\5\\\ \[[[[[[[[[[[[~[y[e[^[U[A[-[[ZZZZZZZZZZZnZiZUZOZHZ4Z.ZZYYYYYYYYkYVYAY:Y1Y&YYXXXXXXXX{XtXgXXXQX<X2X(X!XXWWWWWWWWW|WgWRW=W(WWVVVVVVVVlVcV]VVVMVGV@V9V2V+V$VVVV UUUUUUjU_UJU5U UTTTTTTkTVT:TTSSSSS~S^S@S"SRRRRRRRmRXRCR.RRQQQQQQQqQ\QGQ2QQPPPPPPPPjPKP=P/POOOOOOOxOmObOGO2OONNNNNNNoNZNEN0NNMMMMMMMsM^MIM;M6M!M MLLLLLLLLLLLLLLzLsLgL^LWLLL7L"L KKKKKKKzKeKPK;K&KJJJJJJJJ%2   ,&,D5b>5( 66x 6 3  {%2%2(F%2)82|,,+HfDfb5*(E1'1T*h%2> H%2%2%2%2%2 !%28(  8 ??4 -f%2%2  %2%2 %2 @$ @%2%2%2%2P$n$ S| %2R%2%2%22%20%28*%2%2%2%2%2%2%2k%2%2%2%2 CCDpD%2%2%2P%2%2%2 h P 1,.%2 % % 78{z%2%2%2%277%2%2%2%2%2%2%:%v%2%2%2%2%2%2>%2?d % 4Ӕ H @f   viF%2%2%2%2%2%2i%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%%2%2%2%2%2%2%2%2%2&%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2*X%2%2%2%2|pvp%2%2%2v%2%2 Gr ERFG.%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%20 %2%2j%2%2 , z }b  tzt  "Aj y~~%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2%2Ӕ  2Kn,X `%KKgghhK%  `   X,nK22Kn,X `%KNetBSD1.4.2@(#)NetBSD 1.4.2 (GENERIC) #0: Wed Mar 15 09:20:57 PST 2000 oster@zoot:/u1/NetBSD-1.4.2/usr/src/sys/arch/hp300/compile/GENERIC NetBSD 1.4.2 (GENERIC) #0: Wed Mar 15 09:20:57 PST 2000 oster@zoot:/u1/NetBSD-1.4.2/usr/src/sys/arch/hp300/compile/GENERIC   :+p8H= E GN :Zdbs xz  En6px  8n  .ʐ85 > J W g u24.(bH    2DTy< | *,8CO ^ g0o ~s  ,T pv t-   cH1 A@M _o}4 NA24 4 lr\LRP 1 ! %2 `C pS1\Ds {h _D tJX $-2$ jp L' >4t@AR)f(' Z.ySD t * G\l! Q/ x=K \<eq>}? | < lPeP T-7zFVP^gas ~|f `  BH{|( *  P, @YPРYk x T HP  B =  $ /  :O< J ZJ f( sy  < 3 3 2 m  p     H  ht ( a 7 %8 E Q` `  j$ r  |%( d  - 6 > p  .  l /x   ( %d i ., 7% ?+ JTV X hT a D h w<    p  l  T    #P     & 1X J Y1 aNv p ," z G H0 6 S   0f  ݊ Z 3 0  "n *2 6- Bh R c n\ y  "    .   D 2  b 1 z u Q   "& 1F;8C Sy8dluj 4p6 R  1e "^ V 2PFVj:rv,H  ; g ڈwr  $ x w.$ ,N0: =HwPQ`bnk@u  8 ETL= TN  p 1 <:%. -LBS Q Falx V 01,  &#2 D JL1TZbl Rw    \ ,O` C V(-b6D@HM\ oyM pՠ]d <  wbfnY+ x7 C~R  `vk}: .  t   2L,5B M-aokTw e>8 ."<n r r.4  *:\B tKPV ^6j w b 3t ~ d l p t d &j6$>N [ nhr{¦m PG.r46%D- x5 t?N W |bq   0  '! +mX  * 6HMxV {at b:  T F `$ &J dkT) 1f3 AMtX a Ħoz2ȼ-U  h l6cn7 c0% n2 =Kd>n`H  |@-X W4 j0à#00K84QtiL  J P%l09K[egpM}  p t̎r(Fn&4\?IVg?0s & x۪O@v .  09 x'p= AVIiUen\X~ > fVt | (   8   - <x J V d  x   ?    T   ]! 0!?!* !31x!?!MB!b~!uS:!H!GF!t!!/!%! !j!0d!" @" "%4"5"?J"L "Wo"c H"r ." ^" " "P"e" "  t"  8""  \"  `#  d#?R#2#)#BP#[D#p##<# ##0~##C$$ H$=$'/ $>$Q Kh$b $s *$>$  h$8$DŽ$d$$*h$ H$@% Z%7b%%02%:%C  t%R Yl%Z %h.%w*d%)"%(% % F %i%D%  x&l&P&%&4$n&G&So&^&lk:&ykJ& &  &&H& & \&&&$P&  &~''  'O,','69'@%.'I+'L 'Z )'d D'n 'x 'c'a'' r':'  '0'fb'  'NX'*(Gh( Z0( 9<('  (4/(;nd(E8(T ,(cVd(r \j( B( 9( 7( O(S (  (*(((h) i))+b)9 )E  )T)cY)k3 )}  )+6))O) )Z)) h$) 4) ي) * 2*)* t** *8A*AŸ*I*QG*ZY*i*w *&*p*d*kh*\**+++1+Fp+\+s+ B+^+D+dh++3+D+,  ,,<,%$,7:n,@  ,O  ,[ ,h,x J,B,4,: ,$,?,,,,  - d- 1-^z-) -4 f-H [-Z B.-l 6b-2-3b-A--e-  - H-z- -H-^.  ...Ř.'.6.@X.SŨ.[h.s %. .F. &D.. X. G.L. &H. s. eh/ Z:/ L/) /7 @/K ,/WAD/^ h/j۴/t D/Ȓ// &L//Ѱ/ &P///2|/ &T0  7000#@0-aJ05 }0D 0Q 0[ &X0hHp0vj000 h0 0 Z0[`0f0 0 &\1t11v1)i19 6\1B1P Y1YQ1h 1p31 6`1 R1KF1 6d1F1/121 1o1 >1 :1 N2 22"F2.28eH2G 2Rkh2c72r N2~$2 N2 2 2 N22h2<23 3#4v32(3FA3M N3[P3j 3tv3vp3 J33J3Q33 O44X4 O4& nX41  4E~4UMP4_4r4|444 P4J>4*4 64 Q4@4 4 5 5?5  n5+ d595C `p5P25a5w,5 05@05 5/5z5@.5@55J5 .5 Gr6 6 Q6#060L6>6S6]J6f 6y @66Z666 z6F6 Rd6 Rh7 7 }V7 Rl7*tB7917F7S z7\ x7e%:7y 7.7 7T77A07:7 7|7r7 th7 z8 w28 O8 Rp81 ~89n8M8_ [8gJ88u 8}8j8;888 8 a88"88ۂ9$9 Rt9 >9)'9> t9ND9b9yt9 R9jr9 R999 R9 R9 R9*9/::::(F,:.:::l:P:fX:|::x:AH:::Bn:T:RV:; ;  =;/;,:;4kr;D R;S;]lh;k R;| AP;% ; ;@;;;e;.;[; -<U<<'Y<7  >>,&>6{ >FG>R>\z4>d y>sq~>>>H> Sx> ">3>ER> @? S|?"?r?: 0?E /?T?]2?kKT?x,?44? T@?,?L?T?z^? ? f?+? TD? U? @~x@$3`@+@=_@Pab@^N@o WL@x6@B@ @@ o@ U @@@ a@Fh@C(A AA =\A:;AT:|Ak' A%A"0AAA<A AB PB B8MBEBWjbBffBw U0B U4B3BVB U8B`BB|BC C$ C9CPDC_7"Ch FCq uC|dCFC U<CjC.CoCChC U@CI,CC C UDD UlDD$VD0 UD: DF V@DO VD^ xDgԶDtD VD VD rD *D DW DzDpDSD HE $EE *E! E/ YE7 MTEA ET.E_/EkcEqE/E>FEpE EbEXEEDEE:F ~FpF VF& VF5 FG >FQ VFZ VFfFv<FAFFFF WFFNFRF^hF WF G G WGIG+ wG9 yBGG xGR WG]HGpZG>GG WGCGČG@ZGHG gG |G&H :H@vH&fH1 HB8HNH^ Hs rH LHyHK H 4HH H r H HH4II`I ~I( LI5 IBIVIc WIn Iy WI I0TINXI uI I ISItI I ^ICJ WJXJ,J8JOHJhJxJJ%vJ JdJJ3JtKRKKnK.\K7m8K@ KOjK^Ki Kr WK}XK gZK [K B|K 6KװK rK Lo`LL~L4oL= (LF 4$LTL_ XLjmtLzLAL L<LLL$L_<L LFL 6jL fMOMM( ,M7 MG MUlM`Mi .MxM MtM tM MTM<M7M{zNNlN"XN-%NA0NP _ NZNm*Nx.N2N Nj`NN NN N _DNLO 0O6O% _HO2 O<~ON _LO\:NOe ROr _PO} WO qOOOmO^OO|ONP mPPFP&pP1 ;P>RPMXP[?Pi$lPtPP PBbP{8PĤPdtP _TP _XP WP 3P _\P _Q$Q&hQ; QI)QUelQ` jQqQQ<QtQ _Q QQQ Q FQ _QHRXR!.R'zR-?dR@ oRI ƺRS v\R\ |RfgNRq*R:,R _RHR @"R-hR ZR \R5RGRR nS -S S% hS26jS=SE/ST/Sc^Su\S JS8S _SGS$S4S PS:SoSS _SFdTVzT 6JTT, CT6 T? =TTK aTW aTaTkT{TJT 5T aTLT TT|TMTpHUxU. BU9 aUDUH ΢UR TnUe4Un@Uw bU MU rU rUU U jU ~U :U2V V TVnV#V+M$V3d,VD VN VVO~V^VfTVq#JVx <V V8V -VjVPVV6@VGV sV#W7WWvW(^W7W@\`WJWYWh sWx 0zW W W=W lW sW:WLW4xW4W 0W 6W sWXXX sX- hX; XXI[nXX sXg tXsGXX tX<XuXX+X tXE"XX QX Y=Y4Y'(Y3BY;RYINYSY\[Yib\YwYHY q\Y vY0YYؖYPLY Z !Z ypZ4Z$mZ, Z6f,ZEHZW zZbaZn 4Z|2Z z$Z Z ZZ Z Z PZLZZxZ[ IB[.[$ [0LL[9T[DZ[N |[f2[t8[H[I[ z([ d[ [ [ >[ [ ]$[ߴ\G\ \*P\>>\E \OJ\ZV\n H\~ 6|\1\ z,\(T\ \\ P\\\5\Sh]9x]  ] 5*]& {]0 ]>r]G/]T}2]b]kٖ]v`] ]Y] ]D]m]X]b8]Y]Q] @\]H^ -n^^&4^7 H^@ ^^Ij(^X ^d^o 3^y z0^ ό^^.^^^/T^/P^`r^~_z_>_ w_(P_1d_:f_FI_O Ѷ_]_e -"_w@(_ sJ_ r_Z_ __{`_ z4_ HB__"`` Aj`#ޖ`6 D`@`N:`W7`]`e`p`y ` z8` ` j`?d` 4`V$`:`v`` Ga@a%>afa7aV z<an z@av zDa>a xaN$aF6a,aaPa adaa,bj b {b {b' Inb1 { b9 {$bDTbPb` {(br IbzObb$jb {,b [\bBb \bzb? b {0bxc c k&c.fc$ 5Bc0( c9Tc?ncG8cZTcc+jcqcw cSc.c dc {4cc cMcd d\dZd+ {8d5EDdM*dW {Tdg ds.d}dd d d {\dd nd dee FefDe%Gre9 6eMNeUser|peqxe 9Nep(e3e`eaeBf {`fT$f$bf2f?fE fP,fX$fn9Df\f zf xfP$fPf f 4f |$fgjg |(gg pBg0(g; DgI gQ U@g_hgh gyeTg^g |<gtpggLg g |@g |Dg gưgehhhph h% |Hh6 |LhD dhS6ha/htjh<h |Ph Lh }h$h hhHhxiXiili& bi33iF? iTig(ip ivigiEi @$igi i i/iHii }ij j ֌j }j(j2 t^jA jMWzjXje(jp ʺj{ j]jjjj0j8jEj k Vk Fk k)0k5kMbka kjlks } k kkFk k }$k0kFk]k Eklrtl l1 6 l; LlENlRql]bll.lu3lll Gpl Uvl l!Ll{8lldFmvmm }(m5 >mA`mM (m\mi ,mq N6mz m ^mpXm3mZm\m xm mXm+8n +4nPn%{n6 0nD0nSi naVnm ny n n{n nm@nngnPn nn*o ooo o& bo0 XoCoR/o\ |oi rozVoo o o Yo ho <&oo Fo 7oLp pp%p3 2p=/DpMmpZ0pj?(psppp p ptp p p &q  qT.q! Өq,54q; qL >qW :qd0qs0q Jq*qFhqk~qqq sNq qpr drr- r9 rD rO/pr\rh :rvChr $r (r r\rprNrV~r0rrs ts s s-֮s9sHsQ,sV se sp Tsy @siFs s s(s|s|ss-s.ttbt \2t( 6t9 (tA ttRte/ts tt tt ?rt t^tNt tj t \t0u Lu Ou M<u&<u3Ru? 3uNQRuX\uj 5puv 8ua\u `uvu tu uu u.u duu ^u vv v(v:6v@,vODvZo|ve @vpv rv$Jv S$vzv dvPvLv(v Dvyw Fw XwN,w( w2w?/wM hwUw`$wjwy hwPwwGwDwC w>x=Tx;x5'xN#xgHx(x xx ,xxHy2y |Ty, iy54y> yG ySFy` yy 0y 4y4y8yWy yZDy 8yD4y Ty=,z z#zrz) 0z4zGzOzW /zczm <zx$Rz~ @zJ0z 8zDze>z z'xzr~z \z z^z m|{{ {R{% {4o{F |{Y`{e Jt{m {w {{&{{H{ Ͼ{ {;{H{{h|*|2f|-|+,|A[|P2|Z#|`8|s .|/|  |5|$B||(| ||#| ݦ|| $} } v@}}% T}. (}7Ծ}G }Rv }Z }e@d}s}~j} }<}9}}}} }. }|} ~/l~ ~#=4~,>~:&~I~Y0~` (~r~H~b~ V~ &~~~+~2~b~|3j w ">/(6T`BJ jS 0bgl ;v$6 Ԅ T-  {V \34 : O*66GzT$.Z Te r0P8 p g Ԟ4 & !,& T3sB4.O `] f 5r   dL4 f2j hH5 $ 7BK>Xk8~ !P*p +P l `3I p"*+< K *U rdpzu  Y $>M` 0S2 n ~* } [+ 9 (B PN F`Vm$vZL$& xSL t P:Ll/t (# a- 9J CbOZ ^d۠o Z - olsΦelWd T) 5 uBN16Zbgn y  xیQ  ,` |H \ ]| f)F 9cDFW ^^k_Un MHLP ĎQh V! 3r<OYY#_ =g "riz 750 ̀6$ ΀8(  $oF:OdUPkdvRf ϸ DI0  D *,: ЈCJ ЌU ն` Аjxd p7 ДL5FDpl   6"" -61E xR|e Мu d Kb @2  G4  uD^/P !LR$)2c9 `M dalsD} h 2#2N+oH 6-B}B l  AQ@$@-3=`Hu] piq<8* t b p4\xf B "r {/x9C3Kw^ xh єwX U&X |d@( zF ј ^r T' ;1 8 AKMT^ [j$uX|   * ќR6 P CX 87\d+H9 CJQ [@lu J Ѡz8i ڄ  l Ѥ  -,#&2 <2NV\ fWs 8V ( x+@*  %<0H>L0K.\fm   R,44   *)R |:  cv|.#z1$9>@ LNtZ |kuzzB   $,P W   ,&'2LBrS R^/|k$t 4{ 8 < @"\X$RRb9 ~R#6/J<̎J.U6Z De Dq> L |~|0 o P @.Dp3 *D^|iDxv/ D{ *  pƼTj( 1 |,9 D NY kTu(d X.   _"    %/>>N Z,fs {B \ @(B I  $74^IHSri w1*z, :<|,/r  b-<4H[kǘs r|d,D }1TP l% 52+5 ?-F SQ[ ?jou DX Q \P8S\pL $R%65F  P  b lm  $z4 _   ( 0rV yb2(5ٮ@SlMd|& S -H5p QL3TBI" 30;G] |gt'<~` O   ,$ tp'B2;9G \P`  0o-=> H.  4O IJv +`F   <#9p, B:0N8V ~.`:bkYz L  P4, T.;V  T0   >  q&(8 LCPR_wzt! p&u I\ eT Mu ,\p%  -N9EMSjC} d& *Rt ( Gt  Dd@!0xR@  G U =a,s{H  D0`<6     X ,+X: 0G>TX^m }u T Ȁ985o ]/ha W$Ud% ,kAaM V_(r  { ,{  %2   R  z  s!k/j<9ALO ]-j  t$L BHR B U  66P+X63BXO 3] ppj h|."j jNDa2) ,H"; -,,@1L[bpx? ]*6 8 $   V&!5 />  Q_8]hfyo  >m< x:&lr# '4\A@R \ h  sW0P|6fNx H kV \$$( 9 vC `Q gR_m!vI f z.>     %8m` _\  Ad!( 26J^p  x \ 7PƎ<rG*    &Z5 0> \M.ap r T_ K\dp6     ø  {$ L* D32R@|I7 P\m xN  ~t #Zr bhk^H! #(Y$7 .@ # OZvf u,ClS$ \hY  kT%" j0 H=JBQӔ_ztr #$ #(`f| #,7  ABf!1 BrPW_&q\-# #0N fz  3  #4 ) W/ g=_I7J\xg %Pot9z)n@` ^3Jh I$9 8CR0^ %Tf}vN|ϰ Zr*,$ 79  h* 3 %;I@.V %e :oi|   `b.81}b %  i %!( ^; F S Z>i %q~l4 &ddbd^d  tHg(8&J  & 1 |; FZ@QXRgOxv H , &  `H Z>+(1(    &(m6 'GHO 'X }bjjr^ ' ^( (  ( f ͈$'3 ^: ~BULRS_ h^u6 | Z +d4  +h @$ +l.7\5 ێ?2PM\dڤk +pv ,~p -,j0>(%\t!\B' (2 : E;TjaԆk0 ~UrrZPl x4 - D/.P* -03 -49 G\p~ \F -8Ow -< $ q ZZ% -T2 -d8XdG f`U/tb ^tJ~ -l2_bLlQI  xhx\) ȸ8 RJ -pP 2[>jq%~l00  A vsW$H 7N 7 X* -t:0D.VTi 8t L~ 4 -x#B -| V -%$ Ep -x$ 489.GZe n zOr mp, 06 T"Z, 4:RKZo `z+  <j i 2Ip ` 4F' 4.\76xG Qql\gRn w PM5 & дM_,XJSl 4 /\$.-> 4I%Sp\%ghw z€Œ“ ¡,>´ 4½ 4 47 4 4 e@ T G(Ģ4=EyZ4bnlFÀATÔ 6â: ö$ 5 > MbWydm6}#\ĉ|ěħ 4IJ vľ 4 5Pcd1Yd$2/S|>J HcTMd t`ŅŖ 4ŦLŰ 4ź 46h x 5lm >3" 5p+3+HFtS 5tj(whƇƓ 9Ɯ/Ʃ 5xƲfƽD9P  } $T  Y+h57<kP \^ 5kT8y PǒLǙǠǧA ǭǷ 5 57' R~0fad 5 5"n( b3 I,Z وd ٺn }ȘxȨȱ\Ⱦ6|J,:%/: HhSĈc jP| 5ɂXɑJɜɬ 5E4R  z+ 6l  ]. <cKpZ 6pj$s ʇʙ 6tʠۘʷ0L 6x' 6|/Xp  6%Z$ ..O7g|C 3T ,\ uj*w |$ˆ 6˝ ˭ ˷ |+m. 6 6 BP++7XG BTNX `ʨf Nt BXz̄w̧̘Hp̯ 4̸ ̾b}W C` Cd*oj*Q5B TZ q z{ ̈́ !~͓ͤxͯ C ʹ?ͺ Cx @{ C|BT  fۖ' C5,*=@ITn^ j ~q ΁nΑ΢٤ή5dε ν DDJ$$ DHo$qp DLh! "*7 DPC@I (R]юi޼u~ς DTϐ2Ϝa"ϩ DXϵn,0 |h f!k1 E=I BS E8g A"u+Ѐ HdЌpКVЧ E<дPм Ff5b F FQT ( a7HARn\ o4| DHь3њlPѤѵ8 .|  |8 F f'/ F7 F\Gp4V G bN(t } ґ*ҟ Ҩ(Ұ i|Ҽ6,5I$"Pd )8 &2Z9 dB bI R,Y c l G$qŮz G(Ӈ Ӎ*ӚөӵD<  zu &/ =E2PL^Bh }HuȸԑԠ\\ԭ ԺP ߔ M Ɍ 4.̸6?O/` G,uDՃ G0Տ՟ իպS Ɏ.$ \X*ND7RDNW ixpxSPրN֍X֙LT֡ N֪~ּp*v8 K4 dYN 4-F4\B Q^ K8h KHsk׃:r׎(ימצG׮ K׼90i ~ K r, `  1* K; 3@H KS֢` Ӓn ktP؃OZ؎>؛ ئش~~ ,ξ% \ @$+d8,h7MD` *k˰yه ٘6٤ KٲXyEg% L '7uZG$N *Y *c M$o{Qڈ6Dڒ LPڙ ڢ0ڵc^GQ LTn !x ' 1 :BI[nlxpۃۋ"\ے#ۙ#۠#ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?w,,,Z,n,,,-".N.F.v.nۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?.... ./T/&#/4-/F5/z=/D/L/S/Y/`/g/m0t0{000L0^0X0`0j0000011"1B1h11|111 2*112%2h,2`32p92?2F2Q2Z2a2j2s2~2303@3Fۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?3h333ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?3333 44424F4N4b4n 444%4-454=5E5M5"U5<]5Le5V5m5t5{5555555ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?5666 6,686D6P6\668888|8 88 8)82889JB9pK9BU9N^9Fh9dq9z99::(: :::<:Bۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?:<&<*<<4<;;=; ;*<3< =<E<=2== ="====>>R>>F>>>d>>l >v>>ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?!C4*B 8BDCHNBpXBXB0dBFoCnwCFBBBBBBD BChCbCCCCCC CCC#C,C4C<DDCLDXDVaD@iEpDyDE<DE(EEtEEEEEEEEEEۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?E FFF F(F\.F~5Fl;FtDFKFWF`FiFrG${GGlGVGzGGGGHH:H8HVH~HHHIHHII.I`'IP.I|:JCJLITI_Jۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?gJ oJ(wJJBJp!Y MnMJKbK<KPJJKKK:XKKKMD L>KL6(L&1LZ;LBLILQLZLdM,nMvL}LM LM4MRMZMMMP0MNtNfNnNNNHN8NdNN&N.N7N?OFO$NODUOp]NeOlOtO{P"(# 8QjSVVP`PPrPVPPPQ&QJ2QF=QPHWOQXQ|bQkRtRRWDS:RSSS~SSTUTUU&U`U~U$U/V\8V0BVKVTV^W iW&uW"W,W\WXWfWWWWWWX0X&XbX XXY &X.X6X>^GYXNY8UYX\ \[_YhiZTl\<oZrY~zYYY[PZZ4[[[ZZ[[6[r[[[ \\l]$\(]0]R9\B]J\O\T\Y^(a]j^Ho^Pw^^_^d___ _$_(_,_0_6^^^ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?__J`_^ ___%_n.`7_B`N_V_^`f` mv`T`&``<`F`t`~``````a(aa@a~aab6b.%a.a7b@bIb RbNYbr_bzfbmc.tb|bccc$c@c8c^cnc~ccccd"dRd`dۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?dee eee e('e0.e85e@<eHCePJeXQe`Xeh_epexfemeseyemnmo"noooooo p8pLpTp\#p+qۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?4q$:q,@q4EqDJqTPq\Vqd\qtbq|hqnqtqzqqqqquvv w vNvvw~wywzxx$x*x0yh8y@y6ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?IzNzzTzۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?]{.ezmzu{|{ {{{J{{p{h{{{{ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?|| |$|(|,|0| "(0P8@GOۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?X_el\sy 8J&lۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l? :v#`)/"8=$FN6U4\ve>lPun~X(2Vpۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l? <F'sQj!X*t3;ENW`ir${4jhXy0Vfrۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?# )(/05@;PA`GhMpSxY_ekqz$|0Vft :P#+2l8=xDJOVXۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?^djpv|qz$4tJ .D# ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l? *<ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l? T\4d:l!t@E'/5=FLT]dnltnvyۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?$8FNlN~%.7 @I.Rd[Td:mvr "4v2.H%Z-d5h>xGPYbkrz*8Z x$L>0p` !+5?IS]*gDow &,28>'Dۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?/H8BI ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?Q[fNq|<D.|n t+3;Fۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?PJ3X`Fjr0yX\ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?3LF\B`bdJV> x j|ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?%,3:AIQYahXlrul} ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?J3X|Fjr0|\taۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?dۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?ۧ@ۯ@۷DۿHLP\ht %0<IT\dny܂܊ܔܝܥܭܵܽ "* 3<CQ^es݀ݍݛݨݶ ".:ALU _gu  ބގޛ!ޣް$޷޺޽%((,0* 448$<-67>E M T\bjr{߄ߍߗߠߩ߰ߺ @) 4>HP[fp@{   ( H@  & 0 ;(IHW^@elt| 0 @`@@Ad ,4%/<: $D,N ,Xa<l?Ä#F*:.v5liÄ>@ELT\dlu6*t~FXjÈÈÈÈ``׈ٸٸdddd,, >HH4!d)    5 VNWf.w!$"#, -00@0@CDJDxDxDDM<M<STTTUNU%W::X<OXcY wY$ZHZb[ [X[\$\<(<ST__axaxfdpXpX~x~xTTTTXX$$s~*~8888PPlhpdHHt ƼƼppӨ#x+9C4M4ttX44ddh  %H%Hr35D2344666@d@dL<L<L<W$W$WWWZabbcididil)1yPlTlx{`{`~~.Pd<TTŒŒ N߄߄ ߄ '0 ? S$ dDD }R  $   6ddpp$$ h-h-h0T0T33MMMMiiyy44\\\\ƸƸ Ƽ 4 :͈͈88 @@ p l 4  , >   Q ]/F j26 x4 9AHAHM<M<O,O,QQT`T` t Yh cDcD cXj`j`ll  p@p@ ",zlzl # #}}~~  tt % ^    *h 7 Bx JZ S _ j4 y (( ( HH (˘˘ ( ֨֨HH  h & B   .   (   *  5 E v T z   f6 u   0  (  * # #x +## +$ %J  +.  -* <+ O44445588 Y+<HpHp gP rQ {PZDZDbb + + +  b b c  pp + f"qTj%-3u|@v$Nv_wVxxs}xy``lllll  v..'.$/=.DK*avkDŽDŽu/4~/6ϬѶԸ.^ɜL۰ ,/:1HADQx]ܤer/J}ߊd&<xx22>,>,LL(/PP;/XXH\b b Tb hhTh[Pekrq>}u|T|TT|TPl((T(l`\\T\RTT#-?øƨƨTƨO,_NoԢ|̀Nװװp3||r . x x||7t7t6l6l484"4khkh05qq?6H7`X7g7y777788$8>8Z8v8"838C8T9 c9.u9B9X9d9n9x99  :: : !)ĐĐ:۴۴N[>  e r      J  " N H H & & 0 3 3 7 7 7 7 O O W W  ]h ]h ` ` e e g4 g4 i\ i\ ~ ~G   G  * 5 @G   ̰ ̰  P Z "e @n J}  ѸH,0,4   0    " ܚ- ; D8N<  XHdc L  v  T T    H @        9< 9<H 9  : ; ; D( D(+d;\P`cHs M8 \ \ e e e n i* q  q  u u {l {lpl }D ~ ~ ~ X! T*H5 @F 0U c Bp          d      R t x  | 8 8,8EM  U @  c q {  b v D D      J  6 D D P P    J4  Lh $ $L %8 %8 6\ 6\ B$ B$ M M [ [ f f u u ~ ~ L LPP,P X X  8P@ D DMQUQ\ l l  iR(uRHRh $ $ \ \ ܨ ܨ   h h   | |   f ! #\ # $ %  & &  (l* +x6Y>YFZ 7\ 7\NZ4[ZTiZtu 7\[t ? Cn DJ Kh Kh L$ L$\\8 L$ L\\\ Y a0 f f f# g n n 0 0  -ehAeT Pe     veee L LmD   n x x  8oo  <+@ @ @:D ø øGHTL Ƽ Ƽ   0 0 \ \((  apTTo+,D,D{314|98989898=H9;P?d?dCCJJ^h^h^h^hgggh hO/(ϰϰϰϰ>_nfs_readlinkrpc_nfs_boot_setrecvtimo_kernfs_sync_log_copyin_sdioctl_nhpibreset_addlog_proc_trampoline_isbad_dmmax_ffs_oldfscompat_ipintr_nv3tov_type_nfsm_srvpostopattr_nfs_iodwant_doforce_namecache_pool_vndread_cdevvp_cd9660_vfsops_nswbuf_remrunqueue_max_exec_aout_prep_oldomagic_rderror_hpibustart_kmem_object_print_freglist_ffs_fifoop_p_ipf_rdrrules_sz_unp_output_ttychars_doshutdownhooks_cold_astpending_rdmatch_mtgo_apciinit_rt_timer_init_cd9660_readlink_htonl_nfsspec_read_nfs_getnickauth_fix_outcksum_sys_shmget_spec_read_db_lastsym_kpt_free_list_devctty_ectype_hpibbus_alloc_devopn_iso_uiodir_isohash_nfsspec_close_spec_close_buf_native_sigaction_to_sigaction13_findbootdev_iplopen_tcp_syn_cache_limit_bgetvp_hil_softc_uvm_pager_dropcluster_nfsd_head_flag_sys_revoke_db_cmd_loop_done_hpux_sys_write_in_pcbdetach_in_pcbconnect_zeroin_addr_procfs_symlink_vndsize_htons_nhpibppoll_arp_allocated_genfs_nounlock_fdesc_setattr_ccpu_le_ca_ttydebug_fr_running_cpu_model_uvm_map_protect_ffs_reallocblks_nfsnodehashtbl_fr_pass_rt_timer_queue_create_nprocs_pagezero_mfs_close_nfs_readdirplusrpc_send_reset_unp_detach_ttyclose_finit_le_cd_uvm_map_submap_catq_dofileread_ffree_fork1_MD5Update_accommand_gboxcnprobe_dvbox_clear_iso_shipdir_vfs_setpublicfs_exechook_establish_mountroothook_establish_vmapbuf_shutdownhook_establish_iteoff_in_pcblookup_connect_kernfs_print_fdesc_statfs_needbuffer_spec_strategy_uvm_map_clean_cnputcdst_nan_st_exgapthr_hyper_deinit_mfs_rootsize_fr_findgroup_vnode_free_list_m_copym_vattr_null_sys_setgid_sys_umask_db_last_symtab_hpibgo_ite_ichar_fr_check_procfs_hashrem_dead_poll_getsock_bdevsw_acct_process_sys_readv_vop_symlink_desc_vop_fsync_desc_hpux_sys_shmctl_unp_scan_encode_comp_t_vop_ioctl_desc_dca_careg_dest_isofntrans_ccd_softc_soo_write_compat_43_sys_quota_vop_lock_desc_cnstop_dio_scodesize_pmap_procwr_sys_munlock_cd9660_unlock_dca_cdfault_ffs_realloccg_writedisklabel_sys_settimeofday_cd9660_ihash_slock_scsi_init_wait_semlock_db_listwatch_cmd_copypage040_vndxfer_pool_fdesc_allocvp_kinfo_vgetfailed_sysctl_file_sys_getgroups_bdevvp___adddi3_exec_aout_prep_oldnmagic_hpux_sys_nshmctl_ufsfifo_write_rtrequest_slstart_tablefull_tickdelta_cd9660_reclaim_vfs_unmountall_fill_eproc_sys_seteuid_compat_43_sys_stat_sdgetinfo_fr_tcptimeout_ips_num_net_sysctl_compat_10_sys_semsys_sys_wait4_db_put_value_devin_groupmember_dmago_devio_sys_semop_topcat_common_attach_uvm_shareprot_nfs_mknodrpc_ip_natsync_am7990_config_calltodo_getsfc_dioprint_nfsrv_statfs_sorflush_db_show_regsfline_enosys_sys_ntp_adjtime_cd9660_getattr_hpibid_ite_iline_tcp_do_rfc1323_mrtstat_copystr_vop_mmap_desc_uiomove_cd9660_unmount_ccddump_doboot_arpt_down_fdesc_sysctl_acioctl_iteon_spec_pathconf_nfsrv_slpderef_devioc_addrmask_db_mult_expr_ptyattach_acintr_badaddr_ip_natexpire_ipfr_nat_newfrag_frodo_intr_disestablish_intr_disestablish_dio_intr_disestablish_ttymalloc_compat_43_sys_gethostid_sys_getfsstat_ipauth_sys_nanosleep_apcieint_uvm_page_lookup_freelist_uvm_deviceops_procfs_hashins_hpibidtimeout_iteinit_apcistart_pmap_pageable_nqnfsrv_getlease_nfs_boot_bootparam_fae_list_reassignbuf_mb_map_pfctlinput_inetdomain_hpux_sys_readv_ipflow_slowtimo_kthread_q_db_strcpy_acctp_cnwrite_bcopy_amap_cow_now_ipaddr_lf_findoverlap_sendsig_db_unary_copyout_ipopts_kernfs_symlink_sbflush_dcm_ca_in_pcblookup_bind_sys_obreak_fhpibreset_ufs_mkdir_ttyflush_dcm_cd_syn_cache_pool_kernfs_pathconf_donice_semexit_fifo_pathconf_msqids_cnpoll_native_sigset_to_sigset13_rdioctl_itetty_pager_map_wanted_lock_spec_advlock_vndclose_bbcaddr_frodo_intr_establish_intr_establish_dio_intr_establish_ipfr_nat_knownfrag_ipfr_knownfrag_compat_43_sys_waitld_minf_kernfs_write_sysctl_struct_sys_mincore_acopen_pmap_collect_mbufchainlen_acctresume_seminfo_hp300_init_busaddrerr2030_ffs_clusteracct___divdi3_ttylclose_extent_free_calcru_hyper_dio_ca_dvbox_deinit_iplinit_procfs_dostatus_safepri_vndclear_stackgap_init_write_bbc_reg_sdmatch_gbox_init_fdesc_vptofh_mi_switch_seminit_dcacngetc_endtab_ufsfifo_read_rdrestart_ufs_hashlock_fr_flags_ostype_db_aout_lookup_dmaintr_scsi_test_unit_rdy_hpibdmathresh_uvm_deallocate_finishdup_sys_nfssvc_sys_vfork_db_examine_coperr_fhpibppoll_unp_gcingslognp1d_hpux_sys_wait3_nfs_invaldircache_procfs_hashget_enodev_sys___posix_fchown_pmap_enter_ptpage_apciopen_doreallocblks_in_ifaddrentries_addstr_ipacct_unp_shutdown_hyper_cd_ufs_mknod_process_read_fpregs_iftovt_tab_nfs_update_sys_setlogin_cpu_rootconf_sys_ovadvise_hpibbusprint_link_rtrequest_dead_ioctl_config_deactivate_hpux_sys_sigvec_ststrategy_sys_fchflags_db_radix_readbuffers_nat_outlookup_kernel_pmap_store___muldi3_dvbox_itesw_ipintrq_kthread_create_lance_watchdog_us_shiftmap_dmainit_vfs_detach_dmafree_amap_wiperange_ipfr_fastroute_evcnt_attach_compat_10_sys_shmsys_scsi_nosync_iteputchar_ufs_remove_igmp_fasttimo_rttimer_pool_sys_shmat_db_value_of_nameld_mone_cnread_timeout_ippr_ftp_portmsg_ip_forwsrcrt_getdevvp_unp_defer_logsoftc_compat_43_sys_recv_compat_43_sys_send_sys_execve_spec_bmap_ite_major_rn_inithead_ipcperm_db_map_addr_convasize_tcp_syn_cache_size_sbappend_trapsignal_rboxcnprobe_countbits_sys_shmdt_sys_rmdir_rtable_init_apciparam_ttyinput_vsprintf_bufcache_topcat_scroll_ufsspec_read_icmpmask_filedesc0_spec_open_vop_getattr_desc_bpfilterattach_dmareq_hpibreq_ip_sysctl_getblk_roundrobin_cpu_startup_db_page_print_cmd_unp_mark_sys_swapctl_sys_fstatfs_cfdatacalc_e_privinst_grfdev_attach_ufs_rename_syn_cache_count_procfs_vnodeop_p_rootvnode_setbootdev_ppistart_syn_cache_init_getdfc_hpux_sys_vfork_print_mcond_ufs_symlink_pdevinit_postsig_ifa_ifwithdstaddr_socantrcvmore_sys_sysarch_hpux_sys_sigsuspend_uipc_ctloutput_ptcwrite_compat_13_sys_sigsuspend_ccdopen_sys___sigpending14calc_m_ipfr_newfrag_ttclos_CADDR1_cpu_dump_dmacomputeipl_regdump_ipfgroups_sys_setgroups_bounds_check_with_label_CADDR2_print_addr_db_printf_process_sstep_pppattach_uvm_map_pageable_ptytty_uvm_map_checkprot_execsigs_hpux_setregs_oc_cksum_fpcc_table_vfs_getvfs_pidhashtbl_db_map_print_cmd_dvbox_dio_ca_grfunlock_pool_sethardlimit_proc_pool_sys_recvfromld_mpi2_intr_dispatch_hyper_clear_nfs_sillyrename_tk_nin_procfs_vfsops_get_modregstr_tcp_established_nfssvc_sockhead_flag_sys_mkfifo_genfs_einval_apcistop_uao_dropswap_in_pcbinit_intrnames_mtwrite_amap_wipeout_vflushbuf_selscan_fr_addstatereal_unsupp_lev6intr_tcp_ctloutput_ip_ctloutput_pfs_hash_slock_spechash_slocksnzrinx_fr_newauth_physmem_hpux_sys_rmdir_rbox_clear_vndopen_pmap_prefer_ite_dline_in_setmaxmtu_compat_43_sys_sethostid_pagemove_config_activate_vop_valloc_desc_dcacnputc_print_disp_soo_statoperr_uvm_pagerealloc_ttymodem_rip_input_ufs_islocked_nfsrv_dorec_shortcorename_vop_readdir_desc___anddi3_udbhashsize_ttopen_vop_strategy_vp_offsets_vop_reclaim_vp_offsets_vop_readlink_vp_offsets_vop_symlink_vp_offsets_vop_rename_vp_offsets_vop_link_vp_offsets_vop_fsync_vp_offsets_db_read_bytes_hpibpptest_tcp_mss_from_peer_ifa_ifwithaddr_dead_bmap_soqinsque_vfsinit_nfs_initdircache_ip_setmoptions_unp_drop_fifo_poll_dvbox_grfsw_exec_m68k4k_prep_omagic_nfs_cltpsock_pfs_hashtbl_proc_isunder_sys___sigaction14_compat_43_sys_sigstack_hpux_syscallnames_hpux_sys_stime_6x_vfs_opv_init_default_db_show_cmds_extiobase_lev7intr_ip_mforward_sys_getpriority_fragtbl124_ffs_update_nfsrvw_coalesce_hostname_db_check_interrupt_nfs_quotactl_dead_open_compat_09_sys_uname_scsi_tt_read_bus_space_map_nfs_cookieheuristic_rtalloc1_exec_maxhdrsz_native_to_hpux_errno_sdstrategy_ipl_enable_ether_ifattach_rbox_cd_st_dmaoddretry_sdclose_ufs_ihashlookup_getnewvnode_iplread_numvnodes_lkmdispatch_ffs_specop_p_cluster_collectbufs_schedhzslog10d_mtustart_hpibdevprint_itestart_db_continue_cmd_pfil_hook_get_sbdroprecord_eintrnames_nfsrv_fhtovp_rttimer_queue_head_contsigmask_shm_committed_hpux_sys_execve_nfssvc_addsock_krpc_call_sigcantmask___ashldi3_nfs_getattrcache_nfs_loadattrcache_nfs_getreq_nfsm_loadattrcache_tcp_respond_selwait_sys_lchown_db_kill_proc_hpux_sys_getsockopt_in_pcblookup_port_fdesc_quotactl_getnewbuf_sysctl_string_sys_getsockopt_db_inputchar_tcp_keepintvl__delay_ixstart_wait_genfs_abortop_vndattach_kernel_text_xdr_string_encode_udpstat_semundo_adjust_cpu_exit_emul_netbsd_hilqalloc_trap_types_uvm_page_init_scsi_tt_write_iteread_ffs_vnodeop_p_nfsfifo_read_dead_lock_fifo_read_tcp_debug_inpcb_pool_pfs_hashlock_geteblk_domains_kbd_cn_ctrlmap_kbd_ctrlmap_nfs_receive_nat_rules_vop_whiteout_vp_offsets_vop_islocked_vp_offsets_vop_read_vp_offsets_vop_setattr_vp_offsets_vop_getattr_vp_offsets_vop_mknod_vp_offsets_socketops_ktrsetchildren_sys___posix_chown_vop_create_desc_tcp_close_ip_rtaddr_kernel_map_tcp_setpersist_multicast_encap_iphdr_vop_pathconf_desc_sdmakedisklabel_rdmakedisklabel_opcode_bitmanip_tcp_template_rtstat_tsleep_ip_mrouter_set_vn_isunder_seltrue_hpux_sys_times_6x_exec_m68k4k_prep_nmagic_cluster_callback_uvm_km_alloc1_vndiodone_procfs_hashinit_soo_poll_badtrap_dev_data_list_stread_ufs_quotactl_ip_allowsrcrt_exechook_disestablish_mountroothook_disestablish_shutdownhook_disestablish_ppiwrite_uvm_pagedeactivate_fifo_print_vn_writechk_allevents_vunmapbuf_vop_inactive_desc_vop_seek_desc_hpux_sys_getpgrp2_in_pcbbind_soreserve_sigprocmask1_genfs_badop_genfs_nullop_nfs_readdir_nfsrvhashtbl_db_get_valuet_extdnrm_scsireset_nfs_removeit_ureadc_nqnfsrv_vacated_ip_protox_igmp_leavegroup_physaccess_nat_stats_dead_lookup_sltioctl_vndioctl_ccdreaddz_fhpibdmadone_apciread_in_cksum_chrtoblk_strcat_dkcksumdenorm_MD5Final_mtstart_cpu_fork_hostnamelen___subdi3_hpux_sys_gtty_6x_bbc_registers_hyper_itesw_netaddr_match_rt_timer_timer_mfs_mount_uvm_meter_averunnablebindec_sowakeup_sys_fdatasync_pmap_collect1_rd7914P_sizes_rbox_dio_attach_gbox_dio_attach_dv_mode_dvbox_dio_attach_uvm_page_physget_rt_missmsg_tk_cancc_sys_quotactl_cache_enter_db_command_trapvinst_hpux_sys_getcontext_rip_connect_cd9660_mount_ufs_unlock_rpc_msgdenied_db_cmd_search_ppi_ca_hpux_sys_stat_6x_kmemlimit_ccdsize_intrhand_rbox_itesw_nfs_ispublicfh_in_rtchange_realloc_acclose_uvm_object_print_pmap_change_wiring_ufsspec_close_ap_proxies_clrbits_ttylopen_kthread_exit_vnddump_strcmp_ppi_cdt_frcinx_scsi_cmd_wait_nfsrv_commit_uvm_map_lookup_entry_nfs_access_sbinsertoobovf_r_k_genfs_ebadf_vop_bwrite_vp_offsets_vop_update_vp_offsets_vop_truncate_vp_offsets_vop_advlock_vp_offsets_vop_unlock_vp_offsets_vop_lock_vp_offsets_vop_write_vp_offsets_vop_access_vp_offsets_vop_create_vp_offsets_X_db_symbol_values_db_symbol_values_db_aout_symbol_values_fr_auth_ioctl_ptsclose_sys_futimes_vn_close_ip_getmoptions_MPFail_soo_read_pool_drain_vop_abortop_desc_m_freem_kbd_cn_keymap_kbd_keymap_print_fcode_ipfr_fragstats_cpu_sysctl_exec_aout_prep_omagic_dmastop_nfsd_waiting_in_pcbrtentry_resetpriority_sys___fstat13_sys_setpriority_strchr_callfree_prtkey_ipfilter_cd9660_rrip_analyze_ite_dchar_topcat_intio_match_rbox_intio_match_gbox_intio_match_dvbox_intio_match_ipf_natrules_sz_tcp_output_rt_maskedcopy_devwait_sosetopt_ixin_wait_ctstrategy_sys_listen_bbc_to_gmt_uvm_vnodeops_ipf_ftp_atoi_ctaddeof_sys_lchmod_strlen_db_flush_line_unp_bind_config_rootsearch_strcpy_pool_page_alloc_nointr_apciattach_viftable_in_pcballoc_cd9660_vnodeop_p_tickadj_rdclose_gbox_putc_tcp_optlen_unp_ino_topcat_console_scan_rbox_console_scan_hyper_console_scan_gbox_console_scan_console_scan_dvbox_console_scan_amap_allocPTENRP_intioprint_nfs_null_nfs_readdirrpc_mrt_ioctl_dosetrlimit_filehead_db_flush_lex_ether_sprintf_callout_ktrcanset_vop_lookup_desc_hpux_sys_fstat_6x_ufs_ihash_slock_dv_init_fr_authstart_ddb_initnrm_set_ufs_checkpath_print_fcond_nfs_bmap_nfs_udpsock_route_usrreq_ppptioctl_pool_head_compat_43_sys_getkerninfo_itecheckwrap_itewrite_nfsfifo_write_sl_compress_tcp_fifo_write_pmap_collect_pv_mxin_wait_nfs_reclaim_enterpgrp_inferior_ipfilterattach_whichqs_physunaccess_stwrite_dcmconbrdbusy_swread_fr_icmptimeout_tickfix_ppihztoms_dio_devdescs_fr_auth_procfs_readdir_mrtdebug_pfslowtimo_suword_waittime_mxin2_wait_dvbox_init_mfs_vnodeop_p_nfs_open_filedescopen_mfs_vfsopsb1238_fix_bsdtohpuxbaud_amap_copy_nfsrv_initcache_nfsrv3_access_ipfr_stats_dupfdopen_savacctp_sys_semconfig_sb_max_pv_table_vop_readdir_vp_offsets_vop_rmdir_vp_offsets_vop_mkdir_vp_offsets_vop_poll_vp_offsets_vop_ioctl_vp_offsets_mclpool_alloc_etherbroadcastaddrget_op_fr_authstats_tprintf_close_pgsignal_compat_09_sys_setdomainname_compat_09_sys_getdomainname_pmap_is_modified_nfs_getattr_nfs_searchdircache_dcmistype_nfs_unmount_socket_pool_cnpollc_dumpspec_plimit_pool_acconvert_uvm_map_clip_start_igmp_joingroup_socreate_db_watchpoint_cmd_eintrcnt_fdunshare_fdshare_exec_aout_prep_nmagic_uvmexp_bsdtohpuxmask_hpux_sys_nice_6x_itestop_nqtimerheadPTENRM_intr_computeipl_rdustart_procfs_quotactlPTENRN_dcmcninit_nfs_renameit_ppppktin_mfs_reclaim_ipf_nattable_sz_compat_43_sys_sigvecreal_dz_ctwrite_fragtbl8_nfs_readrpc_cttypoll_ktrwrite_schedclock_db_look_token_lev1intr_nullcnpollc_nhpibreadtimo_gbox_deinit_get_modregstr_mit_uvm_amap_pool_fr_authused_db_print_cmd_db_object_print_cmd_esigcode_funcsym_pmap_clear_modify_uvm_map_clip_end_nfssvc_iod_proc_reparent_compat_43_sys_recvfrom_vop_rename_desc_ppimstohz_doclusterread_dead_vnodeop_p_nfsv2_vnodeop_pstentoxd_hilevent_vndbuf_pool_kernfs_access_pffindproto_addrerr4060_hilmmap_grfmmap_hpux_sys_getrlimit_dcmclose_rn_delete_sys_getrlimit_compat_43_sys_getrlimit_sprintf_fragtbl_ttpoll_ttyrub_sys_lkmnosys_fpfault_hilioctl_grflock_grfioctl_rbox_grfsw_igmp_timers_are_running_subyte_db_find_breakpoint_hpux_sys_sysconf_stintr_dio_devdatas_prints_ip_forward_pppread_rtredirect_db_putnchars___xordi3_printu_ufs_bmaparray_db_last_command_suline_nfs_decode_args_nfs_fhtovp_ip_mrouter_get_bufqueues_itefilter_hpux_sys_setpgrp_6x_uvm_pglistfree_ffs_fifoop_entries_cd9660_fifoop_entries_frflush_tcp_debx_genfs_fsync_stathz_strncasecmp_nfs_getauth_ipq_locked_fdesc_vnodeop_p_spec_vnodeop_p_pool_init_tcp_maxpersistidle_sysent_vop_poll_desc_pool_gett_dz2_nfs_defect_nqsrv_waitfor_expiry_vop_lease_vp_offsets_vop_vfree_vp_offsets_vop_revoke_vp_offsets_vop_close_vp_offsets_ptsopen_vn_open_fpfline_rtinit_unp_connect2_cd9660_tstamp_conv7_ttcompatsetflags_itecnputc_dvbox_cursor_tcp_do_win_scale_rtfree_genfs_enoioctl_in_ifaddrhash_dvbox_cd_genfs_nolock_consinit_active_sys_minherit_hpux_sys_setresgid_uvm_unmap_detach_nfs_close_nfsrv_readdirplus_nfs_doio_char_type_cttyread_config_attach_scsi_immed_command_rd9134D_sizes_vprint_scsi_data_wait_proclistssslognp1_hp300_models_scsi_print_procfs_reclaim_printf_Sysmap_nfs_boot_enbroadcast_tcp_syn_cache_interval_MD5Init_native_sigset13_to_sigset_fr_tcp_age_kernfs_readdir_vfs_list_pcred_pool_pool_put_initcpu_dcawrite_nqnfsstarttime_db_symbol_is_ambiguous_db_disasm_hpux_shmctl1_ipl_frouteok_ttread_db_watchpoints_inserted_db_breakpoints_inserted_cpu_switch_opcode_pmove_b_to_q_sys___posix_lchownld_ppi2_nqsrv_writeslack_anonportmin_tprintf_open_nfs_boot_flushrt_vfs_busy_cd9660_symlink_aobj_pager_vfinddevsgetexp_ufs_dirremove_nfsrv_cleancache_nat_icmpinlookup_procfs_unmount_db_next_free_breakpoint_hp300_impipl_amap_add_nqsrv_clockskew_hpux_sys_sigprocmask_uvm_io_tty_pool_sys_undelete_compat_13_sys_sigprocmask_cachectl1_uvmspace_fork_nfs_adv_fr_defnatage_tcp_rmx_rtt_anonportmax_raw_attach_profhz_vop_print_desc_vn_lock_mclbytessgetman_hilinfo_nfs_nget_routedomain_pgrp_pool_tk_nout_cpu_exec_aout_makecmds_exec_aout_makecmdsbinstr_ippr_raudio_init_sl_uncompress_tcp_config_defer_cd9660_inactive_ststart_nfs_connect_curproc_ledinit_hilinit_swap_syscall_lock_db_qualify_ambiguous_namesuni_2_rbox_deinit_mfs_vnodeop_entries_ffs_specop_entries_ffs_vnodeop_entries_fifo_nfsv2nodeop_entries_spec_nfsv2nodeop_entries_nfsv2_vnodeop_entries_spec_vnodeop_entries_procfs_vnodeop_entries_kernfs_vnodeop_entries_fifo_vnodeop_entries_fdesc_vnodeop_entries_dead_vnodeop_entries_ttyretype_nfs_init_cd9660_specop_entries_cd9660_vnodeop_entries_gbox_dio_ca_procfs_docmdline_extent_create_nfsrv_getstream_kernfs_vnodeop_p_fifo_vnodeop_pdecbin_rd7933H_sizes_nextvnodeid_CLKbase_vop_blkatoff_vp_offsets_vop_pathconf_vp_offsets_vop_bmap_vp_offsets_vop_abortop_vp_offsets_vop_mmap_vp_offsets_vop_lookup_vp_offsets_cd9660_lookupsopr_inf_dumpsys_grfattach_nfs_msg_tcp_drain_swapdev_vp_cd9660_fhtovpreal_trace_dumpsize_bpf_filterslog2_avail_start_db_active_kmem_map_writeback_nfs_pub_nchstats_bitmask_snprintf_itimerdecr_vmspace0_nfs_commit_frcache_pfil_out_list_grfaddr_nfsrv_mkdir_ipfr_forget_ledaddr_Sysseg_rdstatus_uvm_km_valloc_wait_ctstart_tcp_disconnect_procfs_statfs_kernfs_fhtovp_cd9660_tstamp_conv17_ccdstrategyovf_resscosd_susword_ufs_whiteout_stdump_ffs_init_process_read_regs_ip_defttl_ip_mroutersacos_nfsrv_setcred_tcp_mss_ifmtu_tcp_initscosh_ite_clrtoeos_in_setsockaddr_sysctl_rtable_unp_setsockaddr_vop_mkdir_desc___ashrdi3ld_pinf_hpuxhilevent_procfs_start_nqfhhash_exechook_list_uvm_fault_unwire_nfs_hash_rttrash_domainname_vmcmd_map_zero_db_delete_nfsrv_setattr_nfs_request_procfs_getattr_vm_object_cached_bpfattach_slattach_nhpib_ca_hpux_termio_booted_device_hiliddev_nfs_flush_root_devicet_avoid_unsupp_hpuxhilioctl_hpuxgrfioctl_ffs_alloc_nfs_false_xdr_string_decode_rip_ctloutput_rqinit_compat_offseterr_deferred_config_queue_osrelease_strrchr_vndshutdown_nhpib_cd_topcat_dio_attach_ffs_balloc_fr_checkstateld_pone_hpux_sys_setsockopt_getsettty_uvm_map_replace_lf_advlock_sys_setsockopt_pmap_remove_mapping_mtstrategy_ffs_fhtovp_kernfs_reclaim_vn_ioctl_db_write_variable_ncallout_get_modregstr_moto_nfs_link_nfsrv_mknod_vttoif_tab_sys_chroot_sys_getpid_uk_keymap_grflckmmap_ufs_readdir_nfssvc_nfsd_pool_inactive_time_fdcloseexec_avail_end_uvm_fault_numdquot_nfs_fsync_domaininit_cd9660_ihashrem_grfmatch_opcode_pflush_amap_init_rt_ifmsg_pppstart_dcmcngetc_amap_free_tcp_drop_tcp_delacks_sys_getsid_vop_reallocblks_vp_offsets_vop_valloc_vp_offsets_vop_inactive_vp_offsets_vop_remove_vp_offsets_vop_seek_vp_offsets_tty_init_hpux_sys_setrlimit_swwrite_sys_setrlimit_compat_43_sys_setrlimit_fr_tcpclosewait_kernfs_getattr_fhpib_ca_fr_stateunload_kernfs_unmount_dumpdev_nchrdev_pmap_alloc_pv_procfs_sysctl_procfs_rw_hilbeep_file_pool_fhpib_cd_topcat_intio_attach_rbox_intio_attach_gbox_intio_attach_dvbox_intio_attach_krpc_portmap_topcat_clear_uvm_map_setup_kernfs_quotactl_sys_getuid_exec_script_makecmds_dumpmag_nhpibgo_apcicheckdca_ip_output_ppp_softc_socantsendmore_ttcompatuns_getop_subail_nfs_disconnect_procfs_print_m_copybackround_uvm_map_reserve_nfs_savenickauth_scsi_probe_device_dcastart_rbox_dio_ca_sys___sigprocmask14_uvmspace_init_bus_space_free_ite_clrtoeol_icmp_send_ip_init_uvmspace_free_ip_optlen_uvn_attach_vop_rmdir_desc_dcm_console_scan_dca_console_scan_in_ifscrubbpendsleep_sys_ftruncate_compat_43_sys_ftruncate_db_end_line_genfs_lease_check_lance_put_hpux_sys_setresuid_ippr_ftp_init_session0_db_show_all_procs_ccdattachfpsp_fmt_errorssincosd_nfs_mkdir_genfs_poll_db_delete_breakpoint_uvm_swapout_threads_ttspeedtab_process_set_pc_uihashtbl_cd9660_blkatoff_fr_authsize_nfsv3_procid_arp_intimer_nfs_mmap_nfs_boot_cleanup_hp300_netiplssincosi_nfs_advlock_vnd_softc_ffs_reclaim_uvm_pglistalloc_unpdg_recvspace_unpdg_sendspace_sb_lock_ttyout_compat_43_sys_getsockname_sys_getsockname_cd9660_ihashinssatan_nfs_vget_tcp_freeq_checkdirs_sys_madvise_procfs_vptofh_kinfo_vdebug_sys_getdents_ccdiodone_ttcompatsetlflags_cpu_init_kcore_hdr_m_copydata_sys_accept_strncpysasin_ledbase_booted_partition_stustart_scsidone_fr_authpkts_arcbroadcastaddr_vop_print_vp_offsets_vop_open_vp_offsets_uvm_vnp_sync_sys_access_disk_init_X_db_line_at_pc_db_line_at_pc_db_map_equalg_dfmtou_revarpwhoarewe_nfs_reqq_intiosearch_icmp_error_ip_drain_amap_share_protect_ffs_unmount_mfchash_ip_freemoptions_sysctl_clockrateslognsintd_hpux_sys_netioctl_hilopen_nhpibifc_grfopen_amap_ref_disk_busy_db_print_loc_and_instssincosz_kpt_used_list_uvmpagerops_nfs_mknod_cttyopen_hypercnprobe_nfs_removerpc_nfsrv_accesst_inx2_bswap64_pmap_map_scsi_request_sense_dcmioctl_ufs_reclaim_m_reclaim_trap12_tcp_recvspace_tcp_sendspace_ifaof_ifpforaddr_us_keymap_ffs_vget_nfsrv_rmdir_max_hdr_vn_read_ptsreadap_st_n_stopen_nuidhash_max_sbrelease_sys___getcwd_cpu_kcore_hdr_mfs_pri_tcp_attach_raw_setsockaddr_fdesc_vfsops_sdustart_lematch_dvbox_putc_tcpcb_pool_initproc_nfs_root_ippr_raudio_in_ttycheckoutq_trap15_ffs_isblock_zombproc_db_delete_cmd_fpcregs_tcp_dooptions_ip_dooptions_cd9660_ihashget_native_sigaction13_to_sigaction_compat_43_sigvec_to_sigaction_hpibawait_speclisthrei_fhpibifc_uvm_page_physdump_bswap32_bswap16_fxfr_wait_hyper_dio_attach_nfsrvhash_cd9660_node_pool_masterpaddr_pmap_changebit_le_copytobuf_grflckunmmap_kdb_kintr_fr_defnaticmpage_pppopen_suswintr_machine_rminit_soinit_termiototermios_dcaparam_setuse_sofree_rmfree_ktrsysret_TBIAU_dcmcnputc_nfs_readlink_nullmodem_uvmspace_exec_genfs_seek_kbd_ite_nfs_bioread_raw_ctlinput_sysctl_rdstring_db_run_mode_TBIAS_nqsrv_locklease_icmp_input_tcp_input_config_detach_sys_dup_st_exvup_nfs_boot_init_vfs_mountedon_db_store_count_scsigo_mtcommand_ctustart_nfs_send_itecninit_psratiold_mzero_vwakeupap_st_z_mountnfs_scsistart_ite_writeglyph_ihashtbl_appr_ok_ip_freef_db_symformats_map_forwmerge_pmap_release_ite_fontinfo_nfs_sndunlock_nfs_node_pool_unp_rights_tcp_notify_pppwrite_fdexpand_db_look_charsetox_nat_new_arpinit_done_pt_softc_vn_rdwr_db_fromconsole_hyper_ite_fontinit_ite_fontinit_nfs_safedisconnect_raw_disconnect_rn_addmask_vgonel_sodisconnect_solisten_gsignal_nfs_rcvlock_fr_checkauth_vfs_op_descs_compat_43_sigmask_to_sigset_hilclose_grfclose_fr_authnext_ttywflush_lance_copytobuf_contig_topcat_itesw_mmcc_table_frodoprint_igmp_input_raw_detach_sbwait_nfs_read_hpuxtobsdbaud_hpux_sys_ssig_6x_nfsd_head_uk_ctrlmap_opcode_movem_rdr_rules_st_map_ufs_getattr_uvm_vsunlock_child_return_parityenable_opcode_movec_uvm_page_physload_strncmp_nfs_sigintr_nat_inlookup_tcp_mtudisc_ip_mtudisc_sys_getgid_vn_poll_intiobase_SHA1Init_dioattach_fr_makefrip_vfs_findname_db_fncall_ether_input_hpuxtobsdmask_pmap_attributes_ufs_getlbns_uvm_useracc_hp300_cninit_scsi_delay_uao_set_swslot_mfs_statfs_db_find_breakpoint_heret_ovfl_ufs_readlink_db_breakpoint_listSMALRN_setquota_untimeout_db_breakpoint_free_pmap_zero_page_ffs_clrblock_rn_walktree_nselcoll_sys_pwritev_read_bbc_reg_procfs_domem_ffs_read_nfs_nameistart_hpux_sys_access_nmtinfobpendtsleep_hildevno_scsi_tt_oddio_grfdevno_uvm_coredumpovf_r_x2_tcp_iss_seq_procfs_doctl_nchinit_lkmenodevnrm_zeroovf_r_x3_scsi_debug_inittodr_nfs_boot_setaddress_soqremque_db_max_linednrm_lp_scsi_pridma_dcmdefaultrate_nfs_create_sysctl_rdstructreal_operr_vfs_shutdown_mclpool_release_ctreset_rb_mode_soisconnected_intiomatch_fr_tcpsum_scsiintr_dcmmajor_uvm_anon_lockloanpg_rip_disconnect_cttywrite_vcount_vrecycle_rip_recvspace_rip_sendspace_fdesc_readlink_unpst_recvspace_unpst_sendspace_lance_getsetoxm1_zerodiv_kbd_map_sys_msgrcv_vn_stat_nfs_lookitup_vectab_uvmspace_unshare_socksetsize_hilread_pmap_copy_lf_setlock_ite_readbyte_tcp_pulloutofband_initmsgbuf_msgbufaddr_gbox_cursor_nfs_sync_procfs_domap_ttyprintf_hpux_sys_setsockopt2_db_set_breakpoint_dcmmatch_ifmedia_initld_pzerospi_2unf_sub_nfs_mount_ptsstop_db_write_bytes_Segtabzero_intr_init_uvm_fault_wireSMALRP_scsifree_rd7912P_sizes_nqsrv_cmpnam_db_deletewatch_cmd_lance_read_sdread_sys_msgsnd_ploadw_compat_43_sigset_to_sigmask_compat_43_sigaction_to_sigvec_uvm_pglistalloc_npages_rootvp_ap_sess_tabPIRZRM_cc_table_tcp_canceltimers_vn_readdirstanh_appr_check_pool_setlowat_uvm_vnp_terminate_nullioctl_ttioctl_cputype_hpux_sendsig_nfs_prog_max_keylen_ffs_sync_MCFail_nfs_ticks_ip_optcopy_cluster_rbuild_hilkbd_cn_device_sdsize_topcat_grfsw_ip_natin_rn_refines_deadproc_hypercninit_SHA1Final_rb_init_extent_print_vndsetcred_hp300_bioipl_lance_shutdown_pollon_soisdisconnectedmem_read_apcicninit_ndflushstand_setjmp_hpux_sys_readlink_pppintr_sys_readlinkstore_kdb_trap_hpibtimeout_ip_mtudisc_timeout_q_sys_getrusage_db_load_count_lance_zerobuf_contig_uvm_map_create_tcp_slowtimo_ip_slowtimo_acctsuspend_default_bell_nfs_sndlock_tcbtable_rt_timer_queue_destroy_vdevgone_vm_object_list_dcmcnprobe_ip_nhops_vn_bwrite_vop_default_desc_scsi_attach_children_hpibbus_attach_children_numcache_doingcache_hilsoftinit_uvm_unloananon_vflushssind_illinst_hpux_sys_stty_6x_hpux_sys_sigaction_pmap_is_referenced_sobind_compat_12_sys_getdirentries_compat_43_sys_getdirentries_compat_13_sys_sigaction_ffs_mount_nfsrv_updatecache_fr_tcplastack_vop_vfree_desc_cd9660_mountroot_vndgetdisklabel_ffs_inode_pool_fdesc_sync_evcnt_detach_kill_vmcmdsssinh_itecngetc_unputc_compat_43_sys_killpg_exec_hpux_makecmds_db_show_all_cmds_hilpoll_grfpoll_hrcatseye_grfsw_lrcatseye_grfsw_pmap_virtual_space_ffs_checkoverlap_nfs_true_arpresolve_map_backmerge_nfs_dirhash_sbappendrecord_mountlist_pmap_testbit_rdread_hyper_scroll_arpintr_procfs_readlink_mainbus_cap_move_syn_hash1_compat_12_sys_stat_sys_kill_vop_read_desc_uvm_kernacc_syn_hash2_bufhashtbl_nfs_nhinit_memmove_disk_find_mainbus_cd_pmatch_hilqmap_kbd_cn_shiftmap_kbd_shiftmap_nfs_renamerpc_nfsv2_procid_tcp_do_timestamps_sys_fchdir_wakeup_mclpool_amap_pp_adjref_rootfs_vfs_export_lookup_X_db_sym_numargs_db_sym_numargs_db_aout_sym_numargs_db_aout_line_at_pc_intiolimit_vclean_copyright_rbox_cursor_nqsrv_maxnumlease_m_copypacket_db_set_watchpoint_mmutype_uvm_anon_init_bpf_validate_disk_unbusy_hw_sysctl_sys_munmap_nblkdev_rdsize_quotaon_tcp_backoff_procfs_close_vsnprintf_timedelta_hz_mainbusattach_hpibbusattach_rpc_vers_sys_link_topcatcnprobe_amap_unref_nfs_timer_fr_delgroup_ifqmaxlen_nhpibdone_ufs_root_udp_output_unp_disconnect_sys_msgget_pool_reclaim_db_watchpoint_list_db_print_format_hpux_sys_kill_findbootdev_slave_dqflush_ffs_fifoop_opv_desc_bpf_tap_sys_fchown_cd9660_fifoop_opv_desc_db_watchpoint_free_memname_ttywait_mask_rnhead_ppiopen_getphysbuft_unfl_ffs_blkfree_numnfsrvcache_pool_destroy_hpux_sys_sigpending_us_ctrlmap_uvm_pageunwire_killpg1_compat_13_sys_sigpending_hp300_calibrate_delay_scsi_str_dcaioctl_nfs_rephead_nfsm_reqh_fdesc_symlink_lockmgr_fr_statesize_procfs_findtextvp_uvm_pagezero_uvm_pagealloc_strat_amap_extend_kern_targets_procfs_control_vfs_opv_init_explicit_soshutdown_slopen_sys_shutdown_ite_console_attributes_vfs_attach_sys_ktrace_db_call_depth_db_add_expr_pt_map_hy_init_iounmap_uvm_pagermapin_cd9660_access_nqnfs_piggy_in_pcbdisconnect_mountcompatnames_nmountcompatnames_ffs_vfree_udp_init_raw_recvspace_raw_sendspace_initclocks_cd9660_strategy_st_map_store_nfsrv_readdir_cd9660_start_pppdealloc_ixout_wait_mtreaddsj_invalhash_logopen_qs_swapdev_ipf_rcmd_atoi_fr_authunload_db_trace_until_matching_cmd_kernel_object_lance_stop_cpu_coredump_sys_msgctlsatanhd_mmclose_dcmparam_uvm_anon_dropswap_nfs_vinvalbuf_tbfdebug_sys_symlink_uvm_init_limits_db_delete_watchpoint_nfs_setattr_free_msghdrs_Debugger_stioctl_ufs_makeinode_sys_mmap_sys_exit_sdintr_ffs_mountroot_nfs_mountroot_in_interfaces_vfs_mountroot_am7990_start_chkdqchg_nfsrv_pathconf_nfsrv_write_fr_state_ioctlSMALRZRM_compat_43_sigstack_to_sigaltstack_native_sigaltstack13_to_sigaltstack_fusword_uvm_anfree_ippr_rcmd_init_pfil_add_hook_curpriority_ufs_advlock_nfs_lookup_fdesc_vget_fhpibdone_nonidempotent_rpc_msgaccepted_copyinstr_diosubmatch_udp_recvspace_udp_sendspace_nhpibattach_nfsrv_fsinfo_rt_timer_add_sonewconn1_checkalias_lance_copyfrombuf_contig_topcat_windowmove_fdhashtbl_in_pcbnotifyall_pollscan_pool_page_free_nointr_cpu_reboot_dcmattach_pmap_init_tcp_mssdflt_SHA1Update_pmap_destroy_nfs_reply_frodo_imask_ffs_truncate_nfs_truncate_rip_usrreq_ptcopen_db_eqname_ratecheck_nqnfs_clientd_nfs_boot_sobind_ipport_pool_sethiwat_sys_open_uvm_map_db_tok_number_loopattach_desiredvnodesdest_extovfl_hpux_sys_mmap_hilconfig_ctioctl_sys_mprotect_hpux_sys_advise_dcmsetischeme_setdisklabel_if_index_cd9660_pathconf_cd9660_print_nqsrv_addhostreal_fline_igmp_sendpkt_pgfind_disksort_rbox_dio_match_dvbox_dio_match_rddump_ufs_dirbadentry_nfs_boot_ifupdown_tcp_init_win_cpu_initclocks_sys_fork_semmap__insque_dvbox_scroll_limfree_statclock_vfs_export_pt_map_store_soisconnecting_free_msgmaps_reaper_send_hildev_cmd_hy_mode_gboxcninit_in_socktrim_fdesc_root_uvm_map_print_soaccept_sdnumdefaultpart_apcicngetc_nfs_rmdir_fdesc_poll_tty_count_bpf_mtap_prints_bf_uvm_unmap_icmp_reflect_lkmopen_sys_fchmod_utsname_nmbclusters_hpibbus_free_bus_space_subregion_ttypend_microtime_vop_advlock_descszero_hpux_sys_open_tcp_reass_sbreserve_configure_db_examine_format_db_set_cmd_DCFP_hyper_putc_sys_bind_protostfree_dcadefaultrate_apcidefaultrate_ip_mrouter_done_uvm_pagewire_sbcreatecontrol_sysctl_int_rdintr_badhyaddr_zeropage_nfsm_srvwcc_tcp_keepidle_slpque_ipf_cksum_ecacheon_hpux_sys_fork_uvm_vmspace_pool_dead_strategy_sys_statfs_mfs_vnodeop_opv_desc_ffs_specop_opv_desc_ffs_vnodeop_opv_desc_fifo_nfsv2nodeop_opv_desc_spec_nfsv2nodeop_opv_desc_nfsv2_vnodeop_opv_desc_procfs_vnodeop_opv_desc_kernfs_vnodeop_opv_desc_fdesc_vnodeop_opv_desc_spec_vnodeop_opv_desc_fifo_vnodeop_opv_desc_dead_vnodeop_opv_desc_pfslowtimo_now_cd9660_specop_opv_desc_cd9660_vnodeop_opv_desc_db_clear_breakpoints_hil_process_int_tc_initdest_dbl_lerdcsr_opcode_fpu_pool_create_exec_m68k4k_prep_zmagic_arp_inuse_max_datalen_lockmgr_printinfo_sys_acct_rd7958B_sizes_amap_unadd_sl_compress_init_dcamajor_m_pullup_nhpibintr_nfsrv_getattr_procfs_setattr_DCIA_spurintr_printu_wb_nfs_enterdircache_recvit_sendit_scsiustart_ktrnamei_profprocs_DCFAnullpcbres_func_opcode_map_unixsw_nfsrv_rcv_nfs_iodmount_rn_insert_kernfs_lookup_pppclose_uihash_sys___getlogin_acgeteinfo_topcat_cd_tk_rawcc_hpibbus_ca_pmap_activate_pmap_initialized_uvm_map_findspace_fdesc_read_sddump_dcamatch_opcode_mmu_nqnfs_serverd_nqnfs_getlease_pool_prime_maxdmap_pmap_create_in_ifaddrhashtbl_ifafree_if_slowtimo_sys_getpgid_hpibbus_cd_nqnfs_vacated_secopt_syn_cache_add_compat_43_sys_accept_sddefaultpart_sys_dup2_DCIU_hpux_sys_truncate_grfdevprint_ip_mrtproto_ncvhash_sys_truncate_DCFL_random_db_next_free_watchpoint_db_write_cmdslognp1_DCIS_ctident_tcp_trace_db_recover_nmihand_grfprint_insmntque_limcopy_db_line_ether_delmulti_prints_wb_sbdrop_shm_nused_sys___sysctl_db_extend_nfsrv_wakenfsd_nfs_writerpc_count_lock_queue_m_free_vprintf_vop_close_desc_psignal_ppiattach_nqnfs_callback_pppalloc_db_next_tcp_cwm_burstsize_bpf_dtab_rtioctl_nfs_numasync_syn_cache_get_procfs_allocvpslog10_pv_page_freelist_lf_wakelock_sigaction1_se_keymap_hyper_windowmove_chkdquot_nfsrv_create_igmp_slowtimo_useloopback_nat_list_nat_init_mrt_ipip_input_rn_init_hpux_sysent_gmt_to_bbc_doasyncfree_suser_fdesc_init_unp_gc_tc_mode_uvn_sync_lock_sogetopt_sys_sstk_vop_unlock_desc_DCPP_fhpibintr_pfil_in_listreal_unfl_printu_bf_opcode_0101_cd9660_lock_pager_map_wanted_ips_table_procfs_vget_uvm_sysctl_cd9660_defattr_readdisklabel_lance_init_vop_revoke_desc_cd9660_link_DCPL_kbdenable_opcode_1000_compat_43_sys_getdtablesize_hrmcatseye_grfsw_nfs_bwrite_vop_open_desc_topcat_dio_match_opcode_1010_vop_reallocblks_desc_uvm_swapin_sys_sendmsg_sys_recvmsg_buserr40inex_opcode_1011_revarprequest_sys_lutimes_Segtabzeropa_ppinoop_apcicnputc_opcode_1100_pmap_extract_ip_stripoptions_vfs_opv_numops_apci_ca_trace_rdopen_fr_ipfrttl_in_localaddr_soisdisconnecting_nfree_msgmaps_miicf_locnamesnorm_opcode_1110_xdr_inaddr_decode_ip_natout_nlinesw_sys_getpgrp_vop_readlink_desc_vop_strategy_desc_ctmatch_killproc_sys___lstat13_sys_sync_apci_cd_kbdgetc_route_src_disk_count_ufs_bmap_fr_state_doflush_dofilewritev_tcp_mss_to_advertise_tcp_syn_cache_syscall_m68k_fault_addr_mainbussearch_mtattach_hpibbussearch_nat_icmpin_ip_reass_kernfs_setattr_semtot_uvm_pagefree_ffs_blkpref_DCPA_apci_cn_frodomatch_appr_match_sosend_sys_profil_nhpibwait_getinoquota_ufs_open_procfs_dofpregs_uvm_pageremove_uvm_swap_get_kbdbell_tcp_saveti_uvm_pageactivate_procfs_root_mbtypes_nfs_clearcommit_db_free_breakpoints_ICPP_format_parms_nctinfo_conforced_get_immed_rootspec_cluster_wbuild_frodo_ca_tcp_totbackoff_ttstart_exec_aout_prep_zmagic_stxsense_dcmreadbuf_trampsym_fdesc_link_softclock_mfs_bmap_nfs_start_nqsrv_send_eviction_ifmedia_match_sd_ca_frodo_cdbsun_hilqfree_exframesize_ktrgetheader_vinvalbuf_cd9660_mmap_am7990_intr_lance_reset_hp300_nam2blk_rd7958A_sizes_hpibreset_iprintu_wb_uvmcnt_dump_nfs_fsinfo_pffindtype_addupc_intr_sd_cd_scsimatch_opcode_branch_uvm_swap_put_dqhashtbl_nfs_checkexp_cd9660_deftstamp_bus_space_alloc_uvmspace_alloc_bpf_iflist_bpfopen_vn_write_ptswritefpsp_operr_mfs_open_ttyopen_doclusterwrite_fifo_lookup_db_unread_token_qsync_nfsrvw_sort_sl_uncompress_tcp_core_ppp_restart_sysctl_dumpentry_loioctlstentox_uvm_map_extract_cd9660_init_physioslog2d_proc0paddr_le_copyfrombuf_chkvnlock_pmap_enter_nfs_vfs_init_pfil_remove_hook_ptcread_lance_mediastatus_oscsi_ca_ICPA_sdopen_hpibstart_fifo_printinfo_sigpending1_uvm_page_printit_desirednfsrvcache_nexpire_vrele_procfs_access_oscsi_cd_ICPL_proc0_hpux_sys_symlink_nhpibrecv_nhpibsend_procfs_validregs_compat_10_sys_msgsys_db_del_symbol_table_db_add_symbol_table_rd_ca___qdivrem_spec_print_soconnect2_db_maxoff_reassign_parms_gb_mode_ip_pcbopts_in_delmulti_db_regs_m68k_compat_13_sigreturn13_stub_netintr_iprints_wb_uvm_aobj_pool_ippr_rcmd_portmsg_fr_stateinit_bufhash_rd_cd_semu_list_fhpibwait_rpc_call_nfsrv_errmap_vop_lease_desc_db_examine_cmd_ruadd_compat_13_sys_sigaltstacksslog10d_curpcb_mono_time_db_term_m_retryhdrt_dzdest_sglscoshd_dqinit_dcaclose_uvm_page_print_nfs_print_uprintf_hpux_sys_stat_fhpibattach_vmcmd_map_pagedvn_pmap_pmap_pool_rbox_windowmove_gbox_windowmove_dvbox_windowmove_uvm_unloanpage_uvm_pagecopy_pppinput_fputype_ppitimo_topcatcninit_cluster_write_cttyioctl_ptyioctl_ttybg_sys_getppid_db_varssacosd_spec_nfsv2nodeop_p_fifo_nfsv2nodeop_p_genfs_noislocked_ktradref_swapbuf_pool_amap_lookup_rdr_masks_maxproc_ICIA_memstr_bufinit_arpintrq_dumplo_vm_nphysseg_ufs_setattrreal_snan_logpoll_kmembase_sys_mlock_sys_adjtime_prototc_nqsrv_maxlease_mountroot_compat_12_sys_fstat_isohashtbl_fscale_procfs_mount_sys_fsync_db_read_char_send_hil_cmd_cpuspeed_leattach_ufsfifo_close_nfsrv3_procs_nfs_rcvunlock_startprofclock_gbox_dio_match_opcode_move16_ktrgenio_ufs_dirrewrite_rip_bind_issignal_mbinit_nfsrv_writegather_udbtable_rn_mkfreelist_fdesc_open_stclose_sys_preadv_vop_islocked_desc_ddb_sysctl_atacf_locnames_diocf_locnames_atapicf_locnames_uvm_km_init_minphyssgetexpd_dqhash_mfs_doio_uvm_km_free_sys_sbrk_ppirw_ppiread_bpf_setf_sys_clock_gettime_nfs_remove_rn_lookup_ttyin_indent_allocsys_fhpibrecv_fhpibsend_mountroothook_list_db_find_watchpoint_mallocsinf_hyper_init_gb_init_process_write_regs_sys___sigsuspend14sslognd_st_exmotthr_uvm_cnt_head_ufs_init_machine_arch_dcmwrite_ippr_raudio_out_ptcpoll_uao_create_pool_head_slock_nfilessgetmand_protorp_hpux_cpu_sysconf_arch_hpibswait_iteattach_get_areg_val_holdrele_iso_nchstats_hilreset_if_qflush_sys_pollsnan_hpux_sys_wait_sgo_wait_ippr_ftp_pasvmsg_fdesc_lookup_pgrphash_config_init_cd9660_fifoop_p_incorepmod_rdstrategy_grfoff_route_dst_procfs_sync_procfs_donote_maxlockdepth_db_list_breakpoints_db_set_breakpoints_ctclose_uvm_map_call_ips_stats_sys_mkdir_db_read_line_tcp_new_iss_ipsendredirects_sloutput_trap0_opcode_fmove_ext_fubyte_uvm_page_rehash_nfsrvw_procrastinate_va_null_device_register_domountroothook_ifmedia_ioctl_ledcontrol_trap1_zdmap_nfs_rename_unp_attach_logread_sys_setreuid_memset_trap2_ufs_access_nfsrv_lookup_uvm_vnp_setsize_pppioctlsint_trap3_mainbusmatch_ttyinfo_ttyoutput_exec_aout_prep_oldzmagic_nfsspec_write_nclruhead_spec_writesmod_vfs_unbusy_dcaspeedtab_mfs_init_ptsstart_ttylist_v_putc_sys_pwrite_db_output_line_hpuxtobsdsigmap_kbdcninit_tcp_do_sack_ttyfree_swbuf_pv_nfree_parityerror_conscode_addupc_task_msgbufmapped_TBIA_rd7959B_sizes_fhpib_controller_nhpib_controller_ttwrite_sys___posix_rename_longjmp_fdesc_start_raw_usrreq_am7990_tint_lance_config_nfs_writesone_cxin_wait_dqfreelist_procfs_fhtovp_log_open_db_single_step_cmd_grfmap_ifunit_wskbddevcf_locnames_wsemuldisplaydevcf_locnamestblpre_topcat_deinit_db_break_table_ipfr_nattab_ipprintfs_hpux_sys_sigsetmask_uvm_km_suballoc_compat_43_sys_sigsetmask_sys_mknod_cd9660_bmap_tcbhashsize_ipqent_pool_bpfread_compat_43_sys_truncate_X_db_lookup_ifmedia_set_uvm_swap_alloc_chkiqchg_ufs_lock_ippr_ftp_out_thread_sleep_msg_sys_pipe_cd9660_statfs_db_prev_hilint_iszerodev_ufs_link_dounmount_vfs_getopsbyname_sys_read_ether_ipmulticast_min_termiostotermio_mfs_mountroot_procfs_doregs_disklist_acctwatch_uvm_pagermapout_TBIS_pmap_aliasmask_apciconsinit_dio_devinfo_tcp_template_pool_rip_init_ifa_ifwithnet_hpux_sys_execv_vm_physmem_tty_attach_setrunqueue_ctread_tcp_newtcpcb_ufs_vinit_nfs_inactive_ktrsyscall_vop_remove_desc_ether_ipmulticast_max_am7990_rintssincos_gbox_scroll_ippr_raudio_new_ktrderef_db_get_variable_hpux_sys_mkdir_cd9660_rrip_getnamet_resdnrm_compat_12_sys_swapon_uvm_mlk_call_frstats_ipip_input_sockargs_tprintfunfl_sdgetcapacity_cd9660_islocked_db_shift_expr_db_print_position_tcp_do_newreno_arpioctl_lf_getlock_bwrite_sys_writev_fdesc_print_hpux_sys_read_nfsrv_null_xdr_inaddr_encode_vfs_getuserstr_memcpy_iaddstr_db_force_whitespace_db_breakpoint_cmd_hpux_sys_creat_grfunmap_ipl_unreach_kmeminit_sys_ioctl_isodirino_lewrcsrscos_hpux_sys_lockf_nqnfs_clientlease_nat_instances_procinit_uvm_initunsupp_ffs_write_consintr_sys___msync13_Sysptsize_gb_microcode_boottime_dcminterval_uvm_grow_scsicf_locnames_oscsicf_locnames_frodocf_locnamesstwotoxd_rderrthresh_fdesc_readdir_cd9660_sysctl_db_restart_at_pc_PCIA_hpux_sys_mknod_hpux_sys_utssys_extiomap_kbd_ctrlshiftmap_make_cond_ifnet_addrs_sys_getegid_db_search_cmd_uvm_mk_pcluster_ufs_mmap_rpc_reply_syn_cache_insert_ifioctl_extent_alloc_subregion1_sys___sigaltstack14_db_lookup_uvm_dump_ap_sess_list_procfs_bmap_lkmexists_vop_truncate_desc_db_trace_until_call_cmd_dvbox_intio_casmovcrg_opcls_hyper_cursor_apciioctl_raw_input_ptcclose_native_sigaltstack_to_sigaltstack13_dcmstart_dcmspeedtab_fr_tcpidletimeout_fdesc_checkexp_m_devget_ffs_blkatoff_pppoutput_sys_ptrace_procfs_revoke_vnodes_consinit_procfs_open_hashinit_db_symtabsfpsp_fline_ffs_cgupdate_bpfpoll_db_stack_trace_cmd_ifmedia_add_delay_divisor_reset_vif_sun_noname_ttrstrt_hpux_sys_setpgrp2_ufs_fhtovp_sbcompress_selwakeup_sleep_sys_setregid_db_trap_db_delete_line_virtual_avail_tcp_syn_bucket_limit_ifa_ifwithroute_identifycpu_tcp_ctlinput_allocbuf_runtime_topcat_dio_ca_le_zerobuf_send_icmp_err_route_protot_operr_uvmfault_anonget_ipforward_rt_rtalloc_process_write_fpregs_nfs_vfsopssslog2d_grfrmpidssincosnan_nrdcompatinfo_uvm_pageboot_alloc_cpu_set_kpc_nofault_nfsrtton_inetsw_rt_newaddrmsg_m_prepend_total_hpux_sys_fstat_uvm_mlk_hint_uvm_loan_nfsm_uiotombuf_buffers_hpuxtobsdipc_hpux_sys_time_6x_iskmemdev_fdesc_targets_dofilereadv_compat_43_sys_getpagesize_db_aout_sym_init_intrcnt_hpux_sys_ioctl_rdstart_cd9660_vptofhsetoxd_gbox_clear_ufs_ihashinit_realitexpire_hyper_dio_match_nfsm_rpchead_procfs_validfile_st_ca_lowram_nfsrv_link_rip_output_vn_closefile_exec_aout_setup_stack_hpux_sys_sigblock_rbox_scroll_apcitty_compat_12_sys_lstat_db_find_variable_sdwrite_tcp_now_vop_whiteout_desc_vop_mknod_desc_vaccess_st_cd_MMUbase_in_pcbstate_rt_setgate_in_canforward_db_show_arptab_rawcb_uvm_map_init_ffs_reload_in_pcbnotifymiss_memchr_maxsmap_uvm_vslock_db_lbuf_endPITBL_stackgap_alloc_fdesc_write_lkmcloseserror_leintr_fubail_cache_revlookup_nchash_parityerrorfind_db_map_currentstan_soo_ioctl_sys_fpathconf_intioattach_fix_incksum___moddi3_db_read_token_iommap_diomatch_acctchkfreq_spec_lookup_memcmp_hpux_emul_path_nfsrv_noopssin_trap_type_uvm_pager_init_tcp_cwm_fdesc_reclaim_db_read_variable_rd7957A_sizes_rd7945A_sizes_vgone_cd9660_check_export_udp_sysctl_setregs_sigcode_hpux_sys_ftime_6x_cp_time_sys_mountreal_ovflsintrz_uvm_map_entry_pool_vhold_ptcwakeup_sys_nosys_pgrp0_ufs_rmdir_ticks_ether_addmulti_hpux_sys_writev_page_cnt_compat_12_sys_msync_genfs_revoke_cd9660_syncprem_want_resched_pmap_free_pv_ip_maxflows_igmpstat_ecacheoff_apcispeedtab_uvm_mmap_slioctl_bpfioctl_procfs_checkexp_fdesc_unmount_uvm_exit_ctintr_ipflow_create_cache_purgevfs_itimerfix_shmsegs_nfsrv_zapsock_nv2tov_type_udp_input_sys_utimes_db_ed_style_ffs_fragacct_topcat_putc_uvm_unmap_remove_ipqmaxlen_compat_43_sys_sendmsg_compat_43_sys_recvmsg_cd9660_quotactl_dcastop_tcp_timers_fdesc_inactive_unp_connectsrem_sys___stat13_setroot_autonicetimegen_except_hpux_sys_pause_6x_ipl_inited_semundo_clear_pfind_pcmciabuscf_locnames_hpibbuscf_locnames_pcibuscf_locnames_inside_udp_ctlinput_unixdomain_ktrpsig_dv_reset_fdavail_hpux_sys_dup_dcaattach_dqsync_nfsrv_init_cd9660_specop_p_if_attach_kernfs_vfsops_scsireq_uvm_map_reference_udp_usrreq_fdinit1_lance_mediachangesatanh_apcimajor_hpux_sys_rtprio_mem_no_nfs_setattrrpc_get_fpustdGEN_sys_unmount_vop_bmap_desc_ccdioctl_db_stop_at_pc_db_putstringfpsp_unsupp_bsdtohpuxsigmap_uvm_map_inherit_procfs_init_db_command_loop_ppiclose_fr_ifpaddr_fr_checkp_sysctl_iflist_compat_43_sys_getpeername_sys_getpeername_compat_43_sys_creat_db_lex_starttab_stopprofclock_sys_getfh_ulmin_acstart_rd9134L_sizes_opcode_move_rn_search_m_bus_space_unmap_hpibdone_mfs_inactive_ufs_inactive_doclusterraz_savectx_hpuxtobsdsig_ifconf_kthread_create_deferred_uvm_forkmem_write_protection_codes_sys_geteuid_vm_object_count_apcimatchsatand_ulmax_rbox_init_db_dot_ffs_vfsops_vnops_fuswintr_nqnfs_lease_updatetime_vfs_rootmountalloc_vfs_list_initial_maxmem_hpibbusmatch_dcmopen_fr_tcpstate_m_gethdr_brelvp_db_last_non_space_db_putchar_nfsrv_symlink_breada_linesw_cd9660_readt_ovfl2_panic_mem_size_dev_data_list_hpib_fdesc_getattr_mtclose_uvm_pageratop_ip_mtudisc_timeout_kernfs_checkexp_unp_dispose_opcode_misc_cd9660_rrip_getsymname_uvm_setpagesize_ttysleepsasind_breadn_ssir_kbdnmi_pmap_remove_mmopen_nfsrtt_prtactive_db_watchpoint_allocsintdo___iordi3_sdstart_vndstrategy_fixskip_m_get_db_onpanic_nullcf_locnames_rdgetinfo_gbox_itesw_in_losing_uvm_km_alloc_poolpage1_siginit_lockinit_virtual_end_aps_free_tty_detach_uvm_scheduler_nexecs_genfs_eopnotsupp_db_output_positionslognd_vmmap_rd7937H_sizes_rdwrite_rpc_auth_kerb___umoddi3_putphysbuf_uvm_km_valloc_db_free_watchpoints_m_adj_ctinfo_dcmselftest_db_printsym_st_exreconthr_config_rootfound_ttcompatgetflags_nhpibmatch_opcode_mmu040_cd9660_vget_hpux_sys_getaccess_cpu_dumpsize_nfs_writebp_procfs_link_m_cat_sys___semctl_compat_43_sys_fstat_nfs_boot_deladdress_mfchashtbl_max_linkhdr_scanc_snprintf_logclose_panicstrsslog10_intr_printlevels_fpregs_getvnode_vndgetdefaultlabel_disk_attach_db_cmd_list_am7990_meminit_uvm_km_pgremove_nfsrv_remove_tcp_usrclosed_syn_cache_lookup_cache_lookup_brelsereal_bsun_rn_search_msgbufenabled_stop_uvm_pageout_db_set_variable_in_pcbnotify_crcopy_sys_sendto_ctdump_fr_udptimeout_tcp_xmit_timer_mbstat__remque_stgo_ufs_ihashrem_nfsrv_read_nqsrv_unlocklease_igmp_init_netisr_vfs_getnewfsid_sys_flock_db_listbreak_cmd_in_addmulti_bdwrite_sys_rename_mountroothook_destroyBIGRZRM_stcommand_biowait_pffasttimo___one_cmpldi2_bsdtohpuxsig_pgdelete_m68k_sigreturn_stub_sdattach_nfsm_srvfattr_fr_authend_limit0_cd9660_setattr_vput_etext_ctdone_sl_compress_setup_ifa_ifwithaf_kernfs_xwrite_logpri_cache_purgereal_inex_loadustp_ffs_setblockpscale_iteclose_nfsfifo_close_fifo_close_spec_fsync_dcmmctl_cn_tab_nfsrv_rename_vndthrottle_kbd_stringmap_quotaoff_cd9660_rootssinhd_fhpibppwatch_nhpibppwatch_dcaread_vreffpsp_done_hpux_sys_lstat_nat_ioctl_sys_connect_db_symformat_scsisubmatch_dcmmint_netcon_boothowto_hpuxtobsdioctl_pmap_phys_address_machineid_hpibppclear_dqget_nfsm_strtmbuf_hostid_sys_setpgid_cd9660_vget_internal_m_retry_mbpool_se_ctrlshiftmap_uk_ctrlshiftmap_us_ctrlshiftmap_hpibfree_ufs_dirbad_fr_authexpire_ppp_compressors_m_getclr_q_to_b_trap_hilqunmap_ppimatch_ufs_start_soreceive_exit1_sys_getitimer_rbox_intio_ca_dcmintr_iomap_kmemusage_exit2_bzero_ctattach___negdi2_fuword_maxslp_pmap_page_protect_around_rn_addroute_ttydefchars_fr_active_putc_execsw_statintr_ipflow_pool_kernfs_mount_mountlist_slock_ifinit_msgpool_iounmmap_netcls_crfree_db_single_step_cnioctl_us_stringmap_nfsstats_relookup_fhpibgo_procfs_inactivestanhd_conaddr_opcode_coproc_sigaltstack1_bucket_ufs_ihashins_vn_default_error_sys_lseek_sys_select_dregs_mmmmap_numrdidentinfo_rdidentinfo_dcminit_ipflow_reap_sys_close_vndstart_frodoattach_procfs_checkioperm_uao_reference_shutdownhook_list_sys_semget_spl_mtintr_ufsspec_write_nfs_xdrneg1_uvm_km_kmemalloc_vop_access_desc_db_endlpsslogn_hpibintr_db_show_callout_gbox_grfsw_frsync_namei_dma_softc_grf_cn_kernfs_xread_lbolt_nfs_boot_sendrecvfpsp_ovflPIRN_db_reboot_cmd_spl0_iplclose_slinput_sigexit_unsleep_compat_43_sys_gethostnamePIRP_hilin_nfs_getcacheblk_apciclose_dqrele_ufs_print_nfs_reconnect_ipl_disable_lkmioctl_compat_43_sys_sigblock_swstrategy_procfs_validfpregs_rd9122S_sizes_in_revarpinput_revarpinput_grf_ca_grfon_uvmspace_share_ippr_rcmd_new_db_help_cmd_skpc_tcp_compat_42_sys_chmod_allproc_sema_uvm_anon_add_db_list_watchpoints_db_set_watchpoints_dev_name2blk_grf_cd_mfs_start_m_split_hp300_ttyipl_sys_chdir_topcat_intio_casetoxm1d_selrecord_cred0_fhpibmatch_topcat_cursor_in_setpeeraddr_unp_setpeeraddr_ttwakeup_stopsigmask_time_rd2200A_sizes_ufs_ihashget_tcp_rttdflt_setstatclockrate_db_eregs_nchashtbl_vfs_sysctl_sys_fcntl_cd9660_rrip_offset_autoniceval_vfs_op_init_soabort_sccs_rdgo_copypage_looutput_kernfs_inactive_fifo_inactive_ac_ca_db_search_opcode_addsub_ufs_check_export_semu_straytrap_nat_maplookup_ac_cd_m68881_save_kernfs_init_sys_chown_msginfo_ctopen_dvboxcninit_ufs_direnter2_sbappendcontrol_shmfork_sys_reboot_check_exec_db_evarssetoxm1iIdle_hpux_sys_rename_scsiattach_nfsdirhashmask_udpcksum_ip_directedbcast_db_tab_stop_width_ctcommand_itematch_apcicnprobe_ihash_syn_cache_timer_ip_id_ipflow_init_lookup_msginit_db_tok_string_m68881_restore_mmuid_sdgo_sysctl_vnode_db_watch_table_tick_makefstype_tcp_syn_cache_timeq_icmpmaskrepl_vop_blkatoff_desc___udivdi3_iprints_ufs_create_dead_write_vntblinit_arp_ifinit_topcat_init_unp_discard_spec_ioctl_emul_find_iprintu_syn_cache_respond_ttsetwater_sigsuspend1_exec_m68k4k_makecmds_rootdev_fpunsupp_rpc_mismatch_fr_timeoutstate_spec_inactive_db_breakpoint_alloc_mfs_print_nextc_dcamctl_nfs_asyncio_in_broadcast___assert_vget_pmap_pinit_ippr_rcmd_out_netio_uvm_km_free_poolpage1_sysctl_doproc_dcmread_fdhash_sysctl_rdint_trace_req_ifnet_chkinst_hpux_sys_chmod_ppiioctl_emul_hpux_soo_close_lestd_dcamint_udv_attach_sys_clock_settime_hardclock_hpux_sys_chdir_aregs_pmap_reference_gbox_intio_ca_bigadj_isofncmp_crdup_config_search_mt_ca_msghdrs_dqref_tcp_outflags_bremfree_hpux_sys_fcntl_in_maxmtu_rn_match_constty_sys_pread_hpux_cpu_vmcmd_dcaintr_in_control_mt_cd_nfs_pathconf_syn_cache_unreach_pidhash_tcp_maxidle_llinfo_arp_updatepri_bootdev_Sysptmap_uvm_wait_vmcmd_map_readvn_cninit_ffs_flushfiles_nfs_statfs_iprintf_fdinit_compat_43_sys_lstat_numccd_bufpages_mfs_vnodeopv_descs_ffs_vnodeopv_descs_nfs_strategy_nfs_vnodeopv_descs_procfs_vnodeopv_descs_kernfs_vnodeopv_descs_fdesc_vnodeopv_descs_vfs_special_vnodeopv_descs_fdfree_cd9660_vnodeopv_descs_mtioctl_amap_splitref_bpfclose_kernfs_link_slclose_hpux_sys_chown_sys_unlink_vop_reclaim_desc_rtc_offset_in_ifaddr_uao_detach_db_sstep_print_uvm_object_printit_se_shiftmap_ipfilter_version_sys_fchrootsto_res_rdcompatinfo_nat_masks_sys_setitimer_intio_ca_se_ctrlmap_crtc_init_data_pmap_copy_page_vop_bwrite_desc_vop_update_desc_mntvnode_slockfpsp_bsun_isr_list_dcainit_ipstat_sys___vfork14do_func_uvm_vnp_uncache_intio_cd_dmtext_constab_cteof_fr_statemax_msgbufpstwotox_hpux_sys_utime_6x_fr_scanlist_vnode_free_list_slock_bpf_bufsize_disk_resetstatfaultstkadj_sdreset_tcp_keepcnt_alldevs_leavepgrp_compat_43_sys_sethostname_vndwriteget_fline_dcmrint_grffindpid_frodointr_mfs_initminiroot_ip_srcroute_copyargssslog2_hpux_sys_sigreturn_amap_lookups_rpc_autherr_fdesc_fhtovp_compat_13_sys_sigreturn_crget_breadsscaleBIGRP_ccdclose_msgmaps_db_lpszr_inf_rn_newpair_ipflow_fastforward_logioctl_disk_detach_uk_shiftmap_route_cb_sem_nbuf_rbox_putc_pmap_clear_reference_subnetsarelocal_hpibsend_hpibrecv_print_reglist_shm_find_segment_by_shmid_vop_write_desc_shminfo_ippr_ftp_in_raw_setpeeraddr_db_error_nullop_sys_chflags_nfs_sysctl_fr_addgroup_proc_targets_shminit_vmcmdset_extendfpsp_unimp_ufs_pathconf_appr_init_ip_savecontrol_kcopy_sys_gettimeofday_esym_rd7936H_sizes_appr_free_db_skip_to_eol_uao_swhash_elt_pool_rt_timer_queue_change_procfs_lookup_tputchar_resettodr_dcmpint_syn_cache_reset_cn_devvp_mfs_strategy_ufs_strategy_arp_rtrequest_procfs_freevp_pffasttimo_now_clalloc_X_db_search_symbol_db_search_symbol_db_le_db_aout_search_symbolfpsp_unfl_frodo_subdevs_pfs_ihash_ndqb_tickfixinterval_tcprexmtthresh_kernfs_vget_nqfhhashtbl_clfree_iteioctl_soclose_fifo_ioctl_uvm_map_printit_dcatty_ufs_direnter_doexechooks_uvm_swap_init_vm_object_cached_list_pmap_bootstrap_badbaddr_uvm_swap_free_nfsm_mbuftouio_in_fmtaddr_arp_maxtries_kernfs_get_rrootdev_shm_last_free_kmemstats_nqnfs_prog_arpt_prune_sysctl_ntptime_db_lc___cmpdi2_mtopen_lmin_ffs_sbupdate_loif_lf_split_compat_43_sys_mmap_X_db_sym_initsrc_nan_polloff_ctgo_fdesc_pathconf_logwakeup_rd7957B_sizes_rpc_auth_unix_uipc_usrreq_max_protohdr_diskerr_kernfs_statfs_soconnect_dofilewrite_db_command_table_lmax_hp300_bus_space_probe_rdattach_mtident_frodosubmatch_ifa_ifwithladdr_ifpromisc_uvmBIGRN_kpt_pages_getquota_compat_43_sys_lseek_db_inst_count_rmalloc_kern_sysctl_main_rboxcninit_nfs_vptofh_rtentry_pool_firstc_eopnotsupp_fdrelease_phys_map_ffs_valloc_chkdq_nfsspec_access_nqsrv_instimeq_unp_externalize_lkm_nofuncpwrten_mtintr_mfs_rootbase_route_output_cinit_maxfiles_nfsnodehash_kernfs_root_sbappendaddr_cfreesto_cos_dcaeint_sys_fktrace_caddr2_pte_free_dcmstop_in_ifinit_semu_alloc_lockstatus_db_readline_db_last_addr_ipfr_inuse_fdesc_ioctl_vnode_pool_extent_alloc_region_db_unread_char_db_symformat_aoutsc_mul_switch_exit_hpux_cpu_makecmds_uvm_analloc_nfsrv_getcache_rawcbtable_sys_setsid_read_bbc_dev_data_list_scsi_dvboxcnprobe_arpt_keep_ffs_statfs_fr_forgetifp_lortrequest_rusage_pool_ite_ca_db_loop_countg_rndpr_hpux_sys_unlink_nfs_bootparam_ncvhashtbl_db_lbuf_start_imin_dead_print_ite_cd_uvm_pager_put_nfsm_adj_unp_addsockcred_exec_map_sys___sigreturn14_lance_ioctl_uvm_pagelookup_fr_tcpclosed_iplioctl_unp_internalize_sys_setuid_numvnd_dcmtty_ipforwarding_kbddisable_ufs_dirempty_iptime_domainnamelen_imax_hpux_sys_ulimit_cnopen_ite_cn_nfs_vattr_pool_kernfs_sysctl_caddr1_pte_sys_clock_getres_mtmatch_uvm_km_free_wakeup_sys_pathconf_sigprop_ktrops_ufs_lookup_nfsv3_type_raw_init_nat_lookupredir_tcp_quench_bawrite_enxio_msize_edata_hpux_sys_alarm_6x_hpux_sys_waitpid_kvtop_rdreset_chkiq_fixjobc_ntohl_rdfinish_dcaopen_ipq_if_down_pgrphashtbl_mmrw_ppp_dequeue_vop_link_desc_sys_shmctl_sys_setegid_chgproccnt_db_clear_watchpoints_gbox_cd_cnclose_dcacnprobe_pmap_update_kernfs_read_rrootdev_shmexit_cpu_dumpconf_cngetc_nat_table_tcp_fasttimouni_getop_nfs_symlink_kthread_run_deferred_queue_SHA1Transform_st_exblklen_spl_mtstart_iteburst_if_up_pmap_mapmulti_ffs_sysctl_end_bcmp_compat_43_sigaltstack_to_sigstack_fdclear_procfs_pathconf_ktrcsw_biodone_lance_setladrf_tcp_ack_on_push_vm_object_list_lock_internalhpib_ipfr_heads_ipfr_slowtimer_copyoutstr_db_expression_ct_ca_amap_pp_establish_inetctlerrmap_semlock_holder___ucmpdi2___lshldi3___mainfpsp_snan_rd2203A_sizes_hyper_grfsw_ipfr_unload_bpfwrite_ktremul_vop_setattr_desc_ct_cd_fmterr_mtinfo_icmp_sysctl_tcp_sysctl_dio_ca_dcmxint_ifmedia_list_add_kernfs_vptofh_compat_12_sys_reboot_vm_cache_lock_rdident_config_found_sm_version_fdalloc_sys_ntp_gettime_cmask_db_max_width_dio_scodetopa_tcp_newreno_wildcard_rt_tables_extent_destroy_endtsleep_spec_poll_ffs_dio_cd_dirchk_nfs_hashlock_route_init_sohasoutofband_npty_cfroots_clkstd_uvm_map_deallocate_enoioctl_closef_sys_write_apcimctl_nfssvc_sockhead_apcitimeout_pager_map_lf_getblock_pmap_protect_acgo_rt_setmetrics_dead_read_setrunnable_ufs_close_lf_clearlock_sys_socketpair_apcimint_vfs_opv_init_getc_fdcopy_falloc_mtdump_ffs_mountfs_ip_natunload_routesw_vfs_opv_free_fifo_bmap_emul_flags_translate_hpux_sys_sigpause_dcacninit_ether_output_cluster_read_pmap_deactivate_nfsv2_type_nfsrvlruhead_nfsrv_readlink_sys_socket_rt_timer_remove_all___lshrdi3_cdevsw_securelevel_ccdwrite_ddb_regs_mtread_devout_nqsrv_getlease_cd9660_readdir_ntohs_apciwrite_apciintr_ffs_vptofh_nfsm_disct_fdesc_mount_schedcpu_dmmin_iteopen_fr_defaultauthage_fifo_open_desireddquot_procfs_validmap_hzto_tcp_usrreq_sl_softc_kernfs_start_coredump_min_opcode_divmul_icmpstat_tcpstat_devclstmpstkfaultstkadjnotrapfaultstkadjnotrap2heartbeatbeatstatusmdpflag__TBIA__DCIA__DCIS__DCIUUSER_DAUSER_D0USER_D1USER_A0USER_A1USER_FP0USER_FP1USER_FP2USER_FP3USER_FPCRFPCR_ENABLEFPCR_MODEUSER_FPSRFPSR_CCFPSR_QBYTEFPSR_EXCEPTFPSR_AEXCEPTUSER_FPIARFP_SCR1FP_SCR2STORE_FLGBINDEC_FLGDNRM_FLGRES_FLGDY_MO_FLGUFLG_TMPCU_ONLYVER_TMPFP_SCR3FP_SCR4FP_SCR5FP_SCR6CU_SAVEPCFPR_DIRTY_BITSWBTEMPWBTEMP_EXWBTEMP_HIWBTEMP_LOWBTEMP_SGNFPSR_SHADOWFPIARCUCMDREG2BCMDREG3BNMNEXCnmn_unsup_bitnmn_snan_bitNMCEXCnmn_operr_bitnmn_ovfl_bitnmn_unfl_bitnmc_unsup_bitnmc_snan_bitnmc_operr_bitnmc_ovfl_bitnmc_unfl_bitSTAGWBTEMP_GRSguard_bitround_bitstag_maskdenorm_bitetemp15_bitwbtemp66_bitwbtemp1_bitwbtemp0_bitSTICKYsticky_bitCMDREG1Bkfact_bitCMDWORDdirection_bitsize_bit2DTAGdtag_maskfptemp15_bitWB_BYTEwbtemp15_bitE_BYTEE1E3SFLAGT_BYTEXFLAGUFLAGTFLAGFPTEMPFPTEMP_EXFPTEMP_HIFPTEMP_LOFPTEMP_SGNETEMPETEMP_EXETEMP_HIETEMP_LOETEMP_SGNEXC_SREXC_PCEXC_VECEXC_EAneg_bitz_bitinf_bitnan_bitq_sn_bitbsun_bitsnan_bitoperr_bitovfl_bitunfl_bitdz_bitinex2_bitinex1_bitaiop_bitaovfl_bitaunfl_bitadz_bitainex_bitneg_maskz_maskinf_masknan_maskbsun_masksnan_maskoperr_maskovfl_maskunfl_maskdz_maskinex2_maskinex1_maskaiop_maskaovfl_maskaunfl_maskadz_maskainex_maskdzinf_maskopnan_masknzi_maskunfinx_maskunf2inx_maskovfinx_maskinx1a_maskinx2a_masksnaniop_masknaniop_maskneginf_maskinfaiop_masknegz_maskopaop_maskunfl_inx_maskovfl_inx_maskx_modes_moded_modern_moderz_moderm_moderp_modesignan_bitsign_bitrnd_stky_bitsx_masknorm_tagzero_taginf_tagnan_tagdnrm_tagVER_4VER_40VER_41BUSY_SIZEBUSY_FRAMEUNIMP_40_SIZEUNIMP_41_SIZEIDLE_SIZEIDLE_FRAMETRACE_VECFLINE_VECUNIMP_VECINEX_VECdbl_threshsgl_threshnot_fmt40not_b1232inex_ckoflinex_ckuflinex_cke1inex_doneovfl_doneunfl_doneuser_writesuper_writeuser_readsuper_readFONEFTWOFTENF4933RBDTBLA2_strun_de_normnorm_looppos_expA3_contA4_strpos_resA6_strk_neglen_ckA7_strk_posiscaleno_infx_posnot_rnrmodenot_rpe_loope_nextA9_strA10_stA9_normA9_loopA9_conA11_stA12_stdo_fintA13_stnot_zrl_loopl_nextA13_contest_2A14_stfix_exz_loopz_nextno_sftm_loopno_zrzer_mA15_stnot_denormden_zeroconvrtuse_ilognot_zerox_loop_finx_loopA16_stmant_pwr_sgnloopfirst_dsec_dend_bstrRTABLEFNIBSFSTRTESTRTEDIGITSFZEROTENe_gde_pose_saveloadlwmd2bnextlwm_signap_p_fxap_p_clap_p_gdap_p_fmap_p_elap_p_enap_n_clap_n_gdap_n_fxap_n_fmap_n_elap_n_encalc_pnot_rmno_negmuldivend_decno_excPONEMONEPZEROMZEROPINFMINFQNANPPIBY2MPIBY2not_fmovecrld_mzinxpmodtsmod_opersmod_fpnsmod_snansmod_zrosmod_dnansmod_zsnsmod_fsnsmod_nrmpremtsrem_opersrem_fpnsrem_snansrem_zrosrem_dnansrem_zsnsrem_fsnsrem_nrmpscaletscl_oprscl_snanscl_zroscl_infscl_dnansincospsincoscomexc_tblbsun_exccommonE1ovfl_unflcommonE3no_matchdo_checkunimp_xdo_cleantest_revunimp_concheck_frframe_comcommonEunsE3uniE3unsE3_0unsE3_1uni_no_excuns_no_excfinish_upofuf_conbusy_frtry_41ofuf_finloop1do_condo_builddo_restoreloop2contbug1384g_traceg_easyframe_41nofixframe_40notidleidle40loop40idle41loop41opclass3uns_notpackedpack_sourcechk_dy_mosrc_op_ckdst_ex_dnrmdest_op_ckmk_normend_getopsrc_sd_dnrmsrc_ex_dnrmis_doubleis_singlecommonposunpackpack_dyaset_monset_dyauns_datauni_instreloadbit_setuns_opxuns_op3end_mkend_mk_posno_unflset_unfluns_denuns_nrmuni_denuni_nrmmove_unpacktry_zerofix_nanfinishnot_specpos_zeromtry_zeromfix_nanmn_snanmnot_specmpos_zerofix_stagz_or_nrmis_nanis_infis_nrmis_zroset_bit15end_is_nrmend_fixend_getmns_infpls_infnanhugedz_ena_endm_infdz_enap_infset_fpsrop_enaunfl_signokunfl_conunfl_disunfl_enaunfl_fint_workt_dblt_sglt_setinx2ovf_disovf_enaovf_posno_uacc1dst_posdst_snanno_snandst_dissrc_possrc_snansrc_disxdnrm_conxdnrm_disxdnrm_enaxdnrm_dnxdepnot_extis_extxdnrm_storeidle_endend_avunsrc_denck_src_denden_comsp_bndsdp_bndsmonadicdyadicdposmon_dnrmnormalcu_normcu_nmovecu_nabscu_nnegcu_ntstcu_ntpocu_ntczcu_ntncu_ntsxwr_etempcu_nmrdcu_nmrscu_nmnrcu_wrexncu_nunflcu_nmrdccu_novflcu_nmrsccu_nucontinst_dinst_sinst_sdcu_nuflpcu_nuninxcu_nunzrocu_nzrocu_nrpcu_nrmcu_nincscu_nincdcu_numvcu_wrzerocu_wreonnrm_srccu_dnrmsposck_wrapfix_stkcu_dmovecu_dabscu_dnegcu_dtstcu_dtpocu_dtczcu_dtncu_dtsxcu_dmrdcu_dmrscu_dmnrcu_wrexdcu_dmdncu_dpdcu_dpdrcu_dndcu_dndrcu_dmsncu_spdcu_spdrcu_sndcu_sndraddcodesubcodemulcodedivcodecmpcodewrap_addwrap_subwrap_mulwrap_cmpwrap_divdiv_srcddiv_destdckinf_nsforce_unfck_in_comckinf_ndnan_or_infforce_ovffrcovf_fpcrfrcovf_dblfrcovf_rndfrcfpnadd_srcdadd_destdadd_wrapadd_sameadd_u_srcdfrcfpnradd_s_srcdadd_s_destdadd_s_dclradd_ckovfadd_s_sclrsub_srcdsub_destdsub_wrapsub_diffsub_u_srcdsub_s_srcdsub_s_destdsub_s_dwrsub_s_dclrsub_ckovfsub_s_sclrcmp_srcdcmp_destdcmp_setnmul_srcdmul_destdfrcunfcontfrcunf_fpcrfrcunf_dblfrcunf_rndfrcfpn_fpcrfrcfpn_dblfrcfpn_rndfrcfpn_clrfrc0123frc0_dstfrc1_dstfrc2_dstfrc3_dstfmoveincsnan_negfminc_cnanfminc_confminc_czerofp0123fp0_dstfp1_dstfp2_dstfp3_dstpack_outmv_outmv_tbllisgpxpmvout_endwidpbino_auflmvout_conmvouti_endmvouti_conint_dnrmlo_plrglo_nlrgint_wrtint_operrint_inxwo_plrgwo_nlrgby_plrgby_nlrgint_rpwrt_dnsz_longsz_conxdnrmdo_fpsp_catassp_undersp_overdp_catasdp_underdp_overddbldsgldextset_xopdpspdnrmsxopp_movetp_movezp_moveip_movenp_regdp_dyd0p_dyd1p_dyd2p_dyd3p_dyd4p_dyd5p_dyd6p_dyd7p_writestatickdynamickext_grsrnd_conttruncatemode_tabrnd_nearrnd_zerornd_mnusrnd_plusadd_to_lsgl_or_dblend_ext_grsgrs_dblgrs_sglst_stkyend_sdad_1_sglad_1_dbladd_extadd_sgladd_dblscc_clrsgl_donexcc_clradd_ext_donedcc_clrdbl_doneerrortrunctend_rndd0_lessms_clrgreaterall_clrlowerno_sgn_extno_inexdnrm_inexload_sglload_dblchk_stkyset_stkyclr_mantnot_E3no_lpcase_1case_2case_3c1nstkygrs_clearc2_sstkyend_c2clear_grsc3conc3negsixty_foursixty_fivec3comc3sstickyc3endPIPIBY2ACOSBIGACOSP1asinbigBOUNDS1ONEATANA3ATANA2ATANA1ATANB6ATANB5ATANB4ATANB3ATANB2ATANB1ATANC5ATANC4ATANC3ATANC2ATANC1NPIBY2PTINYNTINYATANTBLXXDCAREXFRACXFRACLOATANFATANFHIATANFLOATANOK1ATANSMATANMAINATANBIGATANBORSATANTINYATANHUGEpos_bigneg_bigpos_hugeneg_hugeATANHBIGT1T2TWO16380COSHBIGCOSHHUGEEXPA3EXPA2HUGETINYEM1A4EM1A3EM1A2EM1B8EM1B7EM1B6EM1B5EM1B4EM1B3EM1B2TWO140TWON140EXPTBLADJFLAGSCALEADJSCALESCONEBYSCEXPC1EXPSMEXPMAINEXPBIGEXPCONT1NORMALADJUSTEXP2BIGEM1CON1EM1SMEM1MAINEM1BIGMLE63EM1SCALEMGEN3MLTN3EM1POLYEM1TINYEM12TINYshftuppershft_endsintexcrnd_mnsrnd_plssintmzsintpzout_rngein_rngeun_rngeun_rnrzun_rmrp_negun_ldponeun_ldmoneun_rnrz_negintpsnrmrndpBOUNDS2onezeroinftynegoneTWOADJKFFFRACKLOG2SAVEUHiX_not0HiX_0KISZEROKISNEG1INV_L10INV_L2invalidcontinuePI_TBLZ_VALSM_TBLBG_TBLPI_RNPI_RPPI_RZRMset_finxSM_RNSM_RPSM_RZRMno_finxBG_RNBG_RPBG_RZRMfin_fcrMod_FlagSignYSignXSignQSc_FlagYY_HiY_LoRR_HiR_LoScaleMod_RemY_NormalHiY_not0HiY_0Chk_XX_NormalInitMod_LoopGet_ModR_GT_YR_NE_YRem_is_0R_LT_YPostLoopHiR_not0HiR_0No_ScaleDo_ScaleModOrRemFix_SignNot_EQTie_CaseGet_QRestoreFinishQ_BigSet_R_0SRC_BNDSsrc_insrc_outsrc_smallno_denormden_donesrc_negdst_dnrmspos_possovl_posden_posnden_exitfix_dnrmsneg_posfix_unflfix_loopno_carrytst_zerotst_conno_dirzer_rmzer_rpsm_dnrmfix_exitno_dir2zer_rm2zer_rp2neg_zerodst_loopdst_normdst_findnrm_posdst_exitscro_posres_negres_posTWOBYPISINA7SINA6SINA5SINA4SINA3SINA2SINA1COSB8COSB7COSB6COSB5COSB4COSB3COSB2COSB1INVTWOPITWOPI1TWOPI2INARGRPRIMESPRIMEPOSNEG1TWOTO63ENDFLAGNADJNSINBGNSOK1SINSMSINMAINREDUCEXSINCONTCOSPOLYSINPOLYSINBORSCOSTINYSINTINYred_negCONTLOOPWORKRESTORESCCONTSCOK1SCSMSCMAINNEVENNODDSCBORSSINHBIGTANQ4TANP3TANQ3TANP2TANQ2TANP1TANQ1TANOK1TANSMTANMAINTANCONTTANBORSSGNVTANHBORSTANHSMTANHHUGEc_fp0123c_is_fp0c_is_fp1c_is_fp2c_is_fp3is_fp0is_fp1is_fp2is_fp3EXPA5EXPA4EXPA1ADJFACTFACT1FACT1HIFACT1LOWFACT2FACT2HIFACT2LOWTWOOK1EXPBORSTWOMAINexprEXPNEGTENOK1TENMAINEXT_PINFEXT_PLRGSGL_PLRGDBL_PLRGtblovflEXT_RNEXT_RZEXT_RMEXT_RPSGL_RNSGL_RZSGL_RMSGL_RPDBL_RNDBL_RZDBL_RMDBL_RPovf_e1_excovf_e3_excovff_sglovff_dblovf_fsglovf_fpcrset_signe_rm_pose_rm_negend_ovfre_rp_pose_rp_negd_rm_posd_rm_negd_rp_posd_rp_negs_rm_poss_rm_negs_rp_poss_rp_negneg_signop_0x0unf_e1_excunf_e3_excunff_sglunff_dblunf_fsglunf_fpcropc_1bopc_3bop011not_sglnot_dblEXT_PZROSGL_PZRODBL_PZROEXT_PSMLSGL_PSMLDBL_PSMLtblunfuEXT_RNuEXT_RZuEXT_RMuEXT_RPuSGL_RNuSGL_RZuSGL_RMuSGL_RPuDBL_RNuDBL_RZuDBL_RMuDBL_RPuset_signue_rm_posue_rm_negend_unfrue_rp_posue_rp_negud_rm_posud_rm_negud_rp_posud_rp_negus_rm_posus_rm_negus_rp_posus_rp_neguneg_signpregdstbyte_d0byte_d1byte_d2byte_d3byte_d4byte_d5byte_d6byte_d7word_d0word_d1word_d2word_d3word_d4word_d5word_d6word_d7long_d0long_d1long_d2long_d3long_d4long_d5long_d6long_d7not_mvcrfix_stackck_revfix_conoperr_endoperr_longoperr_wordoperr_byteoperr_nanchklerrcheck_upperoperr_storenot_enabledchklerr2fixlongstore_maxchkleposchkwerrchkberrend_operrload_negdest_memop_longop_contrue_operrnot_true_operrenabledck_inexoperr_exittake_inexovf_adjno_e3_1ovfl_exitno_e3_2e1_setovf_e1ovf_comnot_opc011enamove_outend_snannot_outreport_snanrep_conck_rev2rep_con2sto_longsto_wordsto_bytewrt_longwrt_bytewrt_wordissrcclr_negfpreg_maskE1_stoE3_stosto_fpis_posnot_fp0not_fp1not_fp2not_fp3opc011infget_mantdbl_infdbl_wrtget_smansgl_wrtsgl_Dndstx_contunf_resunf_E1unf_E3unf_sglunf_contunf_storeext_opc011unf_doneck_sgnno_aunflno_storeunsupp_confmove_confix_doneop2sglop0op0_xusetete15op0_xbop0_xiop0_fp3op0_fp0op0_fp1op0_fp2op0_loopop0_sete15op2_comop2_xuop2_xbop2_xiop2_fp3op2_fp0op2_fp1op2_fp2op2_loopcase2case3case4gcc2_compiled.___gnu_compiled_c_loc_pv_crctab.46_cnmaygetc_db_more_tmp.26_db_qualify_db_rw_internal_variable_ccdinit_ccdinterleave_ccdgetdisklabel_ccdstart_ccdbuffer_ccdintr_ccdlookup_ccdgetdefaultlabel_ccdmakedisklabel_vndlock_vndunlock_cd9660_chars2ui_cd9660_rrip_attr_cd9660_rrip_defattr_cd9660_rrip_slink_cd9660_rrip_altname_cd9660_rrip_defname_cd9660_rrip_pclink_cd9660_rrip_reldir_cd9660_rrip_tstamp_cd9660_rrip_deftstamp_cd9660_rrip_device_cd9660_rrip_idflag_cd9660_rrip_cont_cd9660_rrip_stop_cd9660_rrip_extref_cd9660_rrip_loop_rrip_table_analyze_rrip_table_getname_rrip_table_getsymname_rrip_table_extref_iso_mountfs_start_init_start_pagedaemon_start_reaper_check_console_initpaths_pscnt_psdiv_tickfixcnt_schedclk.46_nextpid.124_pidchecked.125_lkm_v_lkm_state_lkmunreserve_curp_lkmods__lkm_syscall__lkm_vfs__lkm_dev__lkm_exec_kmem_map_store_orphanpg_last_nam2blk.46_getdisk_getstr_findblkmajor_findblkname_parsedisk_memlock_settime_nanowait.122_mapply_msgs_number_config_process_deferred_children_fmt.24_expool_create_expool_extent_free_region_descriptor_extent_insert_and_optimize_extent_alloc_region_descriptor_pool_page_alloc_pool_page_free_phpool_drainpp_pool_prime_page_pool_catchup_klogpri_kprintf_putchar_flag.40_msg_freehdr_shm_find_segment_by_key_shm_deallocate_segment_shm_delete_mapping_shmget_existing_shmget_allocate_segment_ttyblock_ttyecho_ttnread_ttyrubo_proc_compare_cc_getcwd_scandir_getcwd_getcache_getcwd_common_lockstr.110_mntid_slock_xxxfs_mntid.124_typename_vfs_hang_addrlist_vfs_free_netcred_vfs_free_addrlist_change_dir_change_mode_change_owner_change_utimes_rename_files_fdcache_lock_fdesc_attr_nfdesc_targets_openstr.110_tried.110_nkern_targets_ctlnames_signames_nproc_targets_atopid_bpf_movein_bpf_attachd_bpf_detachd_bpf_freed_dst.36_reset_d_bpf_ifname_bpf_setif_bpf_allocbufs_catchpacket_bpf_mcpy_m_xword_m_xhalf_if_indexlim.22_digits_etherbuf.24_slinit_sl_btom_pppsioctl_ppp_ccp_closed_ppp_requeue_pppdumpm_ppp_ccp_ppp_inproc_digits.48_pfil_init_done_pfil_init_pfil_list_add_pfil_list_remove_pppasyncstart_pppasyncctlp_pppasyncrelinq_pppgetm_ppp_timeout_fcstab_pppfcs_paritytab_ppplogchar_pppdumpb_digits.136_normal_chars_rn_satsifies_leaf_rn_ones_last_zeroed.36_addmask_key_rn_lexobetter_rn_new_radix_mask_rn_zeros_rt_init_done_rt_xaddrs_rt_msg2_rt_msg1_myip_initialized_revarp_in_progress_myip_ifp_buf.20_hexdigits.21_lla_snprintf_arptimer_arptfree_null_sdl.26_arprequest_arplookup_in_arpinput_sin.39_srv_ip_myip_db_print_sa_db_print_ifa_db_print_llinfo_db_show_radix_node_rti_head_rti_fill_rti_find_buf.26_inpcb_pool_initialized.20_ipflow_hash_ipflow_lookup_ipflowtable_ipflowlist_ipflow_inuse_ipflow_addstats_ipflow_free_icmpsrc_icmpdst_icmpgw_icmp_mtudisc_mtu_table.38_icmp_mtudisc_timeout_save_rte_ip_srcrt_numvifs_have_encap_tunnel_ip_mrouter_init_add_vif_del_vif_add_mfc_del_mfc_set_assert_get_version_get_assert_get_vif_cnt_get_sg_cnt_pim_assert_expire_upcalls_expire_mfc_sin_last_encap_vif_last_encap_src_update_mfc_ip_mdq_socket_send_srctun.56_encap_send_phyint_send_tbf_send_packet_tbf_control_tbf_update_tokens_tbf_queue_tbf_reprocess_q_tbf_dq_sel_tbf_process_q_priority_ip_insertoptions_ip_mloopback_syn_cache_last.26_tcp_ctlvars_udp_notify_rcsid_fr_savep_frzerostats_frrequest_send_ip_fr_tcpudpchk_frflushlist_frsynclist_nat_delrdr_nat_delnat_nat_flushtable_nat_clearlist_nat_delete_ipfr_new_ipfr_lookup_ipfr_delete_natfr_rcmdfr_raudiofr_appr_new_session_appr_fixseqack_fr_statetstats_fr_state_flush_fr_delstate_fr_matchsrcdst_fr_checkicmpmatchingstate_krpccheck_xid.24_nfs_boot_defrt_nfs_boot_getfh_nfs_boot_delroute_md_mount_bp_whoami_bp_getfile_proct_nfs_backoff_lasttime.126_nfsv2_repstat_nfs_xid_nfsrv_v2errmap_nfsv3err_null_nfsv3err_getattr_nfsv3err_setattr_nfsv3err_lookup_nfsv3err_access_nfsv3err_readlink_nfsv3err_read_nfsv3err_write_nfsv3err_create_nfsv3err_mkdir_nfsv3err_symlink_nfsv3err_mknod_nfsv3err_remove_nfsv3err_rmdir_nfsv3err_rename_nfsv3err_link_nfsv3err_readdir_nfsv3err_readdirplus_nfsv3err_fsstat_nfsv3err_fsinfo_nfsv3err_pathconf_nfsv3err_commit_nfsrv_v3errmap_base.116_dzero_nfs_numnfsd_notstarted_modify_flag_nfsd_rt_nfsdrt_nfs_asyncdaemon_nfs_mount_diskless_create_verf_hextoasc_ffs_alloccg_ffs_hashalloc_ffs_fserr_ffs_fragextend_ffs_checkblk_ffs_clusteralloc_ffs_dirpref_ffs_nodealloccg_ffs_alloccgblk_ffs_mapsearch_ffs_indirtrunc_mfs_minor_quotatypes_done.100_ufs_chown_ufs_chmod_mastertemplate_uao_init_uao_flush_uao_get_uao_releasepg_uao_find_swhash_elt_uao_free_kernel_object_store.42_kobj_alloced.43_uao_list_uao_initialized.46_uao_list_lock_udv_init_udv_reference_udv_detach_udv_fault_udv_flush_udv_asyncget_udv_put_udv_list_udv_lock_uvmadvice_uvmfault_amapcopy_uvm_swapout_km_pager_uvm_km_get_kmem_object_store_mb_object_store_kernel_map_store_uvm_loananon_uvm_loanuobj_uvm_loanzero_kernel_map_entry.52_cexp_uvm_loadav_uvm_total_uvm_bootbucket_virtual_space_start_virtual_space_end_initialized.58_uvm_page_physget_freelist_uvmpd_tune_uvmpd_scan_uvmpd_scan_inactive_swap_priority_swapmap_swaplist_insert_swaplist_find_swaplist_trim_swapdrum_add_swapdrum_getsdp_swap_on_count.136_sw_reg_strategy_sw_reg_iodone_sw_reg_start_uvm_swap_io_uvm_swap_aiodone_uvm_swap_bufdone_uvn_init_uvn_reference_uvn_detach_uvn_flush_uvn_get_uvn_asyncget_uvn_put_uvn_cluster_uvn_releasepg_uvn_wlist_uvn_wl_lock_uvn_io_uvn_sync_q_asm_buffer_info_buffer_buf.88_buf.93_kdbprinttrap_db_var_short_stacktop_findentry_nextframe_findregs_doingdump.20_hexstr_dumpmem_nbuf.25_intio_matched.26_dio_matched.26_frodo_matched.26_capsmode.46_metamode.47_itemaj.66_initialized.67_paniced.74_dca_cn_dcaconsinit_dcm_cn_iconv_dcmconsinit_listnr_par_talker_par_sec_par_rddoingadump_scsiabort_saved_cmd_wait.28_saved_data_wait.29_scsierror_issue_select_wait_for_select_ixfer_start_ixfer_out_ixfer_in_mxfer_in_scsiicmd_finishxfer_cdb.62_cdb.65_inq.92_sd_read_cmd_sd_write_cmd_legal_cmds_sdgetgeom_cap.28_sdlblkstrat_sderror_sdfinish_sddoingadump_st_read_cmd_st_write_cmd_stmatch_stattach_havest.22_modsel.25_modsense.26_stfinish_sterror_acmatch_acattach_mainbus_matched.26_seen_netdevice.37_dev_data_insert_dev_data_lookup_statvar_month_days_clkint_statmin_profmin_timer3min_statprev_bbcinited.30_rt.35_chrtoblktbl_db_write_text_innmihand_gotparmem_parcatch.154_looking.155_straycount.36_unexpected.37_currentleds_physlock.30_devzeropage_refcount.126_hpux_scale_bsd_to_hpux_stat_hpux_stat1_bsd_to_hpux_ostat_exec_hpux_prep_omagic_exec_hpux_prep_nmagic_exec_hpux_prep_zmagic_hpuxtobsdbaudtab.28_context_040_context_fpu_context_nofpu_context_table# $NetBSD: disktab,v 1.3 1995/09/30 21:57:48 thorpej Exp $ # # @(#)disktab 5.5 (Berkeley) 2/27/91 # # Disk geometry and partition layout tables. # Key: # ty type of disk # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # rm rpm, 3600 default # se sector size, 512 default # sf supports bad144-style bad sector forwarding # so partition offsets in sectors # p[a-h] partition sizes in sectors # b[a-h] partition block sizes in bytes # f[a-h] partition fragment sizes in bytes # # All partition sizes contain space # for bad sector tables unless the # device drivers fail to support this. # # Entries may also be used for other compatible drives # with the same geometry. # # HP CS80 Drives on rd (new style partitioning). These mapping support # three basic layouts: # # A/B/G: This is the "traditional" setup for a bootable disk. # A is the root partition, B the swap, and G is for /usr # and users. # A/D/E/F (large drives): # A/D/H (small drives): # This is a setup for bootable systems requiring more swap # (e.g. those who need CL). It has A as the root, D as a # larger swap, E and F (or H) as smaller user partitions. # E could be used for /usr and F for users (or H for both). # C: This gives a single, non-bootable, large user filesystem. # Good for second drives on a machine as either /usr/src # or a large /usr or user partition. # pseudo-geometry taken from rd7945 miniroot:\ :ty=winchester:ns#16:nt#7:nc#968:\ :pa#10240:ba#8192:fa#1024: rd7945|rd7946|rd7945A|rd7946A|HP7945A|HP7946A:\ :ty=winchester:ns#16:nt#7:nc#968:\ :pa#15904:ba#8192:fa#1024:\ :pb#20160:\ :pc#108416:bc#4096:fc#1024:\ :pd#40320:\ :pg#72240:bg#4096:fg#512:\ :ph#52080:bh#4096:fh#512: rd7957|rd7957A|HP7957A:\ :ty=winchester:ns#22:nt#7:nc#1036:\ :pa#16016:ba#8192:fa#1024:\ :pb#24640:\ :pc#159544:bc#4096:fc#1024:\ :pd#42350:\ :pe#54824:be#4096:fe#512:\ :pf#46200:bf#4096:ff#1024:\ :pg#118734:bg#4096:fg#1024:\ :ph#101024:bh#4096:fh#1024: rd7958|rd7958A|HP7958A:\ :ty=winchester:ns#36:nt#7:nc#1013:\ :pa#16128:ba#8192:fa#1024:\ :pb#32256:\ :pc#255276:bc#4096:fc#1024:\ :pd#48384:\ :pe#100800:be#4096:fe#512:\ :pf#89712:bf#4096:ff#1024:\ :pg#206640:bg#4096:fg#1024:\ :ph#190512:bh#4096:fh#1024: rd7933|rd7933H|HP7933H:\ :ty=winchester:ns#46:nt#13:nc#1321:\ :pa#16146:ba#8192:fa#1024:\ :pb#66976:\ :pc#789958:bc#4096:fc#1024:\ :pd#16146:bd#8192:fd#1024:\ :pe#165646:be#4096:fe#1024:\ :pf#165646:bf#4096:ff#1024:\ :pg#706238:bg#4096:fg#1024:\ :ph#358800:bh#4096:fh#1024: rd7937|rd7937H|HP7937H:\ :ty=winchester:ns#123:nt#13:nc#698:\ :pa#15990:ba#8192:fa#1024:\ :pb#67158:\ :pc#1116102:bc#4096:fc#1024:\ :pd#15990:bd#8192:fd#1024:\ :pe#246246:be#4096:fe#1024:\ :pf#246246:bf#4096:ff#1024:\ :pg#1031355:bg#4096:fg#512:\ :ph#522873:bh#4096:fh#1024: rd9134|rd9134L|HP9134L:\ :ty=winchester:ns#16:nt#5:nc#973:\ :pa#15920:ba#8192:fa#1024:\ :pb#20000:\ :pc#77840:bc#4096:fc#1024\ :pd#32000:\ :pg#41840:bg#4096:fg#512:\ :ph#29840:bh#4096:fh#512: rd7936|rd7937H|HP7936H:\ :ty=winchester:ns#123:nt#7:nc#698:\ :pa#16359:ba#8192:fa#1024:\ :pb#67158:\ :pc#600978:bc#4096:fc#1024:\ :pd#16359:bd#8192:fd#1024:\ :pe#120540:be#4096:fe#1024:\ :pf#120540:bf#4096:ff#1024:\ :pg#516600:bg#4096:fg#512:\ :ph#259161:bh#4096:fh#1024 rd7957B|HP7957B:\ :ty=winchester:ns#18:nt#7:nc#1269:\ :pa#16002:ba#8192:fa#1024:\ :pb#32760:\ :pc#159894:bc#4096:fc#1024:\ :pd#49140:\ :pe#50400:be#4096:fe#512:\ :pf#44226:bf#4096:ff#1024:\ :pg#111006:bg#4096:fg#1024:\ :ph#94626:bh#4096:fh#1024: rd7958B|rd7962|rd7962B|HP7958B|HP7962B:\ :ty=winchester:ns#42:nt#9:nc#786:\ :pa#16254:ba#8192:fa#1024:\ :pb#32886:\ :pc#297108:bc#4096:fc#1024:\ :pd#49140:\ :pe#121716:be#4096:fe#512:\ :pf#109620:bf#4096:ff#1024:\ :pg#247590:bg#4096:fg#1024:\ :ph#231336:bh#4096:fh#1024: rd7959B|rd7963|rd7963B|HP7959B|HP7963B:\ :ty=winchester:ns#42:nt#9:nc#1572:\ :pa#16254:ba#8192:fa#1024:\ :pb#49140:\ :pc#594216:bc#4096:fc#1024:\ :pd#65772:\ :pe#303912:be#4096:fe#512:\ :pf#207900:bf#4096:ff#1024:\ :pg#528444:bg#4096:fg#1024:\ :ph#511812:bh#4096:fh#1024: rd335H|rd335|HP2200A|2200A|HP335H|HP6000/335H:\ :ty=winchester:ns#113:nt#4:nc#1449:\ :pa#16272:ba#8192:fa#1024:\ :pb#49720:\ :pc#654948:bc#4096:fc#1024:\ :pd#65992:\ :pe#304648:be#4096:fe#512:\ :pf#267584:bf#4096:ff#1024:\ :pg#588504:bg#4096:fg#1024:\ :ph#572232:bh#4096:fh#1024: rd670H|rd670|HP2203A|2203A|HP670H|HP6000/670H:\ :ty=winchester:ns#113:nt#8:nc#1449:\ :pa#16272:ba#8192:fa#1024:\ :pb#67800:\ :pc#1309896:bc#4096:fc#1024:\ :pd#16272:\ :pe#305552:be#4096:fe#512:\ :pf#305552:bf#4096:ff#1024:\ :pg#1224920:bg#4096:fg#1024:\ :ph#597544:bh#4096:fh#1024: # # Utah derivatives # rd7937-utah|HP7937H with Utah partitions:\ :ty=winchester:ns#123:nt#13:nc#698:\ :pa#15990:ba#8192:fa#1024:\ :pb#67158:\ :pc#1116102:bc#4096:fc#1024:\ :pd#124722:bd#8192:fd#1024:\ :pe#163098:be#4096:fe#1024:\ :pf#287820:bf#4096:ff#1024:\ :pg#1031355:bg#4096:fg#512:\ :ph#455715:bh#4096:fh#1024: # # Antiques # rd9134D|HP9134D:\ :ty=winchester:ns#16:nt#6:nc#303:\ :pa#15936:ba#8192:fa#1024:\ :pb#13056:\ :pc#29088:bc#8192:fc#1024: rd9122|rd9122S|rd9122D|HP9122S|HP9122D:\ :ty=winchester:ns#8:nt#2:nc#77:\ :pc#1232:bc#8192:fc#1024: rd7912|rd7912P|HP7912P:\ :ty=winchester:ns#32:nt#7:nc#572:\ :pa#15904:ba#8192:fa#1024:\ :pb#22400:\ :pc#128128:bc#4096:fc#1024:\ :pd#42560:\ :pg#89600:bg#4096:fg#1024:\ :ph#69440:bh#4096:fh#1024: rd7914|rd7914P|rd7914CT|HP7914P|HP7914CT:\ :ty=winchester:ns#32:nt#7:nc#1152:\ :pa#15904:ba#8192:fa#1024:\ :pb#40320:\ :pc#258048:bc#4096:fc#1024:\ :pd#64960:\ :pe#98560:be#4096:fe#512:\ :pf#78400:bf#4096:ff#1024:\ :pg#201600:bg#4096:fg#1024:\ :ph#176960:bh#4096:fh#1024: # # SCSI disks # Again, these mapping support three basic layouts: # Again, these mapping support three basic layouts: # # A/B/G: This is the "traditional" setup for a bootable disk. # A is the root partition, B the swap, and G is for /usr # and users. # A/D/E/F (large drives): # A/D/H (small drives): # This is a setup for bootable systems requiring more swap # (e.g. those who need CL). It has A as the root, D as a # larger swap, E and F (or H) as smaller user partitions. # E could be used for /usr and F for users (or H for both). # Or, E could be used for /var and F for /usr and users. # C: This gives a single, non-bootable, large user filesystem. # Good for second drives on a machine as either /usr/src # or a large /usr or user partition. # # A/B/G: This is the "traditional" setup for a bootable disk. # A is the root partition, B the swap, and G is for /usr # and users. # A/D/E/F (large drives): # A/D/H (small drives): # This is a setup for bootable systems requiring more swap # (e.g. those who need CL). It has A as the root, D as a # larger swap, E and F (or H) as smaller user partitions. # E could be used for /usr and F for users (or H for both). # Or, E could be used for /var and F for /usr and users. # C: This gives a single, non-bootable, large user filesystem. # Good for second drives on a machine as either /usr/src # or a large /usr or user partition. # sd7958|sd7958-utah|HP7958S:\ :ty=winchester:ns#32:nt#6:nc#1643:\ :pa#16384:oa#1024:ba#8192:fa#1024:\ :pb#65536:ob#17408:\ :pc#315455:oc#0:bc#8192:fc#1024:\ :pd#98304:od#17408:\ :pe#102400:oe#115712:be#4096:fe#512:\ :pf#97343:of#218112:bf#4096:ff#1024:\ :pg#232511:og#82944:bg#8192:fg#1024:\ :ph#199743:oh#115712:bh#8192:fh#1024: sd7959|sd330|sd7959-utah|HP7959S:\ :ty=winchester:ns#32:nt#12:nc#1643:\ :pa#16384:oa#1024:ba#8192:fa#1024:\ :pb#65536:ob#17408:\ :pc#630911:oc#0:bc#8192:fc#1024:\ :pd#98304:od#17408:\ :pe#102400:oe#115712:be#4096:fe#512:\ :pf#412799:of#218112:bf#4096:ff#1024:\ :pg#547967:og#82944:bg#8192:fg#1024:\ :ph#515199:oh#115712:bh#8192:fh#1024: sd7548-utah|sd660|HP97548S with Utah partitions:\ :ty=winchester:ns#56:nt#16:nc#1447:\ :pa#16384:oa#1024:ba#8192:fa#1024:\ :pb#65536:ob#17408:\ :pc#1296511:oc#0:bc#8192:fc#1024:\ :pd#98304:od#17408:\ :pe#102400:oe#115712:be#4096:f#!/bin/sh # # $NetBSD: install.md,v 1.6 1997/10/09 07:25:48 jtc Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # # machine dependent section of installation/upgrade script # # Machine-dependent install sets MDSETS="" md_set_term() { if [ ! -z "$TERM" ]; then return fi echo -n "Specify terminal type [hp300h]: " getresp "hp300h" TERM="$resp" export TERM # XXX call tset? } md_makerootwritable() { # Was: do_mfs_mount "/tmp" "2048" # /tmp is the mount point # 2048 is the size in DEV_BIZE blocks umount /tmp > /dev/null 2>&1 if ! mount_mfs -s 2048 swap /tmp ; then cat << \__mfs_failed_1 FATAL ERROR: Can't mount the memory filesystem. __mfs_failed_1 exit fi # Bleh. Give mount_mfs a chance to DTRT. sleep 2 } md_get_diskdevs() { # return available disk devices dmesg | grep "^rd[0-9]*:." | cut -d":" -f1 | sort -u dmesg | grep "^sd[0-9]*:.*cylinders" | cut -d":" -f1 | sort -u } md_get_cddevs() { # return available CD-ROM devices dmesg | grep "sd[0-9]*:.*CD-ROM" | cut -d":" -f1 | sort -u } md_get_ifdevs() { # return available network interfaces dmesg | grep "^le[0-9]*:" | cut -d":" -f1 | sort -u } md_installboot() { # $1 is the root disk echo -n "Installing boot block..." disklabel -W ${1} disklabel -B ${1} echo "done." } md_checkfordisklabel() { # $1 is the disk to check disklabel -r $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval="1" elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval="2" else rval="0" fi rm -f /tmp/checkfordisklabel } hp300_init_label_scsi_disk() { # $1 is the disk to label # Name the disks we install in the temporary fstab. if [ "X${_disk_instance}" = "X" ]; then _disk_instance="0" else _disk_instance=`expr $_disk_instance + 1` fi _cur_disk_name="install-disk-${_disk_instance}" # Get geometry information from the user. more << \__scsi_label_1 You will need to provide some information about your disk's geometry. Geometry info for SCSI disks was printed at boot time. If that information is not available, use the information provided in your disk's manual. Please note that the geometry printed at boot time is preferred. IMPORTANT NOTE: due to a limitation in the disklabel(8) program, the number of cylinders on the disk will be increased by 1 so that the initial label can be placed on disk for editing. When the disklabel editor appears, make absolutely certain you subtract 1 from the total number of cylinders, and adjust the size of partition 'c' such that: size = (sectors per track) * (tracks per cyl) * (total cylinders) Note that the disklabel editor will be run twice; once to set the size of partition 'c' and correct the geometry, and again so that you may correctly edit the partition map. This is to work around the afore mentioned limitation in disklabel(8). Apologies offered in advance. __scsi_label_1 # Give the opportunity to review the boot messages. echo -n "Review boot messages now? [y] " getresp "y" case "$resp" in y*|Y*) (echo ""; dmesg; echo "") | more ;; *) ;; esac echo "" echo -n "Number of bytes per disk sector? [512] " getresp "512" _secsize="$resp" resp="" # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Number of cylinders? " getresp "" done _cylinders="$resp" _fudge_cyl=`expr $_cylinders + 1` resp="" # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Number of tracks (heads)? " getresp "" done _tracks_per_cyl="$resp" resp="" # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Number of disk sectors (blocks)? " getresp "" done _nsectors="$resp" # Calculate some values we need. _sec_per_cyl=`expr $_nsectors / $_cylinders` _sec_per_track=`expr $_sec_per_cyl / $_tracks_per_cyl` _new_c_size=`expr $_sec_per_track \* $_tracks_per_cyl \* $_cylinders` # Emit a disktab entry, suitable for getting started. # What we have is a `c' partition with the total number of # blocks, and an `a' partition with 1 sector; just large enough # to open. Don't ask. echo "" >> /etc/disktab echo "# Created by install" >> /etc/disktab echo "${_cur_disk_name}:\\" >> /etc/disktab echo -n " :ty=winchester:ns#${_sec_per_track}:" >> /etc/disktab echo "nt#${_tracks_per_cyl}:nc#${_fudge_cyl}:\\" >> /etc/disktab echo " :pa#1:\\" >> /etc/disktab echo " :pc#${_nsectors}:" >> /etc/disktab # Ok, here's what we need to do. First of all, we install # this initial label by opening the `c' partition of the disk # and using the `-r' flag for disklabel(8). However, because # of limitations in disklabel(8), we've had to fudge the number # of cylinders up 1 so that disklabel(8) doesn't complain about # `c' running past the end of the disk, which can be quite # common even with OEM HP drives! So, we've given ourselves # an `a' partition, which is the minimum needed to open the disk # so that we can perform the DIOCWDLABEL ioctl. So, once the # initial label is installed, we open the `a' partition so that # we can fix up the number of cylinders and make the size of # `c' come out to (ncyl * ntracks_per_cyl * nsec_per_track). # After that's done, we re-open `c' and let the user actually # edit the partition table. It's horrible, I know. Bleh. disklabel -W ${1} if ! disklabel -w -r ${1} ${_cur_disk_name}; then echo "" echo "ERROR: can't bootstrap disklabel!" rval="1" return fi echo "" echo "The disklabel editor will now start. During this phase, you" echo "must reset the 'cylinders' value to ${_cylinders}, and adjust" echo "the size of partition 'c' to ${_new_c_size}. Do not modify" echo "the partition map at this time. You will have the opportunity" echo "to do so in a moment." echo "" echo -n "Press to continue. " getresp "" disklabel -W ${1} if ! disklabel -e /dev/r${1}a; then echo "" echo "ERROR: can't fixup geometry!" rval="1" return fi cat << \__explain_motives_2 Now that you have corrected the geometry of your disk, you may edit the partition map. Don't forget to fill in the fsize (frag size), bsize (filesystem block size), and cpg (cylinders per group) values. If you are unsure what these should be, use: fsize: 1024 bsize: 4096 cpg: 16 __explain_motives_2 echo -n "Press to continue. " getresp "" rval="0" return } hp300_init_label_hpib_disk() { # $1 is the disk to label # We look though the boot messages attempting to find # the model number for the provided disk. _hpib_disktype="" if dmesg | grep "${1}: " > /dev/null 2>&1; then _hpib_disktype=HP`dmesg | grep "${1}: " | sort -u | \ awk '{print $2}'` fi if [ "X${_hpib_disktype}" = "X" ]; then echo "" echo "ERROR: $1 doesn't appear to exist?!" rval="1" return fi # Peer through /etc/disktab to see if the disk has a "default" # layout. If it doesn't, we have to treat it like a SCSI disk; # i.e. prompt for geometry, and create a default to place # on the disk. if ! grep "${_hpib_disktype}[:|]" /etc/disktab > /dev/null \ 2>&1; then echo "" echo "WARNING: can't find defaults for $1 ($_hpib_disktype)" echo "" hp300_init_label_scsi_disk $1 return fi # We've found the defaults. Now use them to place an initial # disklabel on the disk. # XXX What kind of ugliness to we have to deal with to get around # XXX stupidity on the part of disklabel semantics? disklabel -W ${1} if ! disklabel -r -w ${1} $_hpib_disktype; then # Error message displayed by disklabel(8) echo "" echo "ERROR: can't install default label!" echo "" echo -n "Try a different method? [y] " getresp "y" case "$resp" in y*|Y*) hp300_init_label_scsi_disk $1 return ;; *) rval="1" return ;; esac fi rval="0" return } md_labeldisk() { # $1 is the disk to label # Check to see if there is a disklabel present on the device. # If so, we can just edit it. If not, we must first install # a default label. md_checkfordisklabel $1 case "$rval" in 0) # Go ahead and just edit the disklabel. disklabel -W $1 disklabel -e $1 ;; *) echo -n "No disklabel present, installing a default for type: " case "$1" in rd*) echo "HP-IB" hp300_init_label_hpib_disk $1 ;; sd*) echo "SCSI" hp300_init_label_scsi_disk $1 ;; *) # Shouldn't happen, but... echo "unknown?! Giving up." return; ;; esac # Check to see if installing the default was # successful. If so, go ahead and pop into the # disklabel editor. if [ "X${rval}" != X"0" ]; then echo "Sorry, can't label this disk." echo "" return; fi # We have some defaults installed. Pop into # the disklabel editor. disklabel -W $1 if ! disklabel -e $1; then echo "" echo "ERROR: couldn't set partition map for $1" echo "" fi esac } md_prep_disklabel() { # $1 is the root disk # Make sure there's a disklabel there. If there isn't, puke after # disklabel prints the error message. md_checkfordisklabel $1 case "$resp" in 1) cat << \__md_prep_disklabel_1 FATAL ERROR: There is no disklabel present on the root disk! You must label the disk with SYS_INST before continuing. __md_prep_disklabel_1 exit ;; 2) cat << \__md_prep_disklabel_2 FATAL ERROR: The disklabel on the root disk is corrupted! You must re-label the disk with SYS_INST before continuing. __md_prep_disklabel_2 exit ;; *) ;; esac # Give the user the opportinuty to edit the root disklabel. cat << \__md_prep_disklabel_3 You have already placed a disklabel onto the target root disk. However, due to the limitations of the standalone program used you may want to edit that label to change partition type information. You will be given the opporunity to do that now. Note that you may not change the size or location of any presently open partition. __md_prep_disklabel_3 echo -n "Do you wish to edit the root disklabel? [y] " getresp "y" case "$resp" in y*|Y*) disklabel -W $1 disklabel -e $1 ;; *) ;; esac cat << \__md_prep_disklabel_4 You will now be given the opportunity to place disklabels on any additional disks on your system. __md_prep_disklabel_4 _DKDEVS=`rmel ${ROOTDISK} ${_DKDEVS}` resp="X" # force at least one iteration while [ "X$resp" != X"done" ]; do labelmoredisks done } md_copy_kernel() { echo -n "Copying kernel..." cp -p /netbsd /mnt/netbsd echo "done." } # Note, while they might not seem machine-dependent, the # welcome banner and the punt message may contain information # and/or instructions specific to the type of machine. md_welcome_banner() { ( echo "" echo "Welcome to the NetBSD/hp300 ${VERSION} installation program." cat << \__welcome_banner_1 This program is designed to help you install NetBSD on your system in a simple and rational way. You'll be asked several questions, and it would probably be useful to have your disk's hardware manual, the installation notes, and a calculator handy. In particular, you will need to know some reasonably detailed information about your disk's geometry. This program can determine some limited information about certain specific types of HP-IB disks. If you have SCSI disks, however, prior knowledge of disk geometry is absolutely essential. The kernel will attempt to display geometry information for SCSI disks during boot, if possible. If you did not make it note of it before, you may wish to reboot and jot down your disk's geometry before proceeding. As with anything which modifies your hard disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your hard drive is backed up before beginning the installation process. Default answers are displyed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __welcome_banner_1 ) | more } md_not_going_to_install() { cat << \__not_going_to_install_1 OK, then. Enter 'halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __not_going_to_install_1 } md_congrats() { cat << \__congratulations_1 CONGRATULATIONS! You have successfully installed NetBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, power-cycle the machine in order to load new boot code. Make sure you boot from the root disk. __congratulations_1 } md_native_fstype() { # Nothing to do. } md_native_fsopts() { # Nothing to do. }