ELFa( 4C4 ( Dj!Dj!"AA T/"\\@0 6QQ O @@( @0 <  B00 RР -L GbTcObmain() returnedz萛A -L0L@ P0S T 0P00>10CB>A#>A0BT0(0#d<  h  L0+c p-X0L@S` d0PXPhL00P !P0 !!gphp4AOb 0-X0L@S PXPg`0 \ 0?S5dD0g20 3/P 0h0ԨA @ObP/P/P/P!"P//P P|/ Pp/ P P\/PT/`PD/@/</8/4/N@ @ @ @+@@m@@@ @@@@ @ --LM@, h yK@M@ -Lp@g``Py1W9 1W 0WW|1W t1WP*h10S-PM T1HF D1  PAP R#P= T0(00b>10CB>A#>A0B^.dP00CP02 0 3/PP P00S 0 P000 00P Px萛AA @A A(@A hA+c+c @+c -04L0M0@S 2 03/, 0B S񟗛 p  $ d  < L  T 0  30S# 30SI P3@B30Sx30S 00T30S @30S0mP,3')20 3/203/i20S 20S20S 0020SEP 2  l2  2 012 0X K3/ J+i%1  0S2 08 K3/2 0X K3/ "4S1||=tQtt,pK0`K4K20 3/P0SE Q 0 10S 0  ))00S00S! 0PPX0S `X`f0  0?0ᆵ0e20 3/P 4 004 0$ 0 0( 0(K+chA+c+c+c+c!@*@+c4=+cA@ԨAK@Ob p-H`L@`P{ww_ 0 EԨAV@ Q-L \@0  p3/Ob 0-L8M@ =28#8 S "S1  1  10S "2R0S  10S "2R0S!0|!0l1 d1 X1X L1 ( 27$! 0 10S2K0 K3/203/2 0< K3/P 20S 3/ P`vXPL(J@۩\00t0 0 `0@fP 20S 3/4K0蕰@@hA+c+cf@+c@W3A| @ 0-LP@ة@ " " " "0hR -(24ML@ 00`P 0 0p @@@ @$`(P1 'Π00 010 0, ( @@ @$`,Pp1 0d100 0 0 @@ @$`(,P$1 0100 0 0 @@ @$`(,P0 0000 00 00(0 0 @@$`,P0 ,0t000 0\0 00 @ @$`(,P(K?@GJ@A@ @4 @'@D /c -L|M`P@` Kp!V0 0K #T0 0d 0pR0 p00 0pwp30 000 00K00PpW ( $0S S0 K/cPT ^0<0Kg090KT1㸃K40 0p , 0HK03/PPP@3[ =3[@:  R0 3 SS PSPPSP8PKUPPPU60  "$ P(U0 !0S0.@ "$ 0SPߺ K'NEFXPiTD -L(M0H@KPp( ,`Q0<0K03K?40 0sKᰄK03/P3[  K p-L@I0P`00000 0ʯ 0Sph&@ -L 0 0-1L, @T9 P1 Q4Q .     0h?T0S 3/P  0R"@   S# D0 1 @$ (0R!(00(0$ ,03/0 0-L@P,@T 8 OQ0Ob 0- LP ,0 0@000hX0S 3/@ E0hOb 0-0@$01$ L0P(0101 00S0 00T 0'0 000@ 0h1 R0S0hX@ -L@P}1`0$pS0 R W(0!(00(0$ 40 3/Q R 0S 00 <00 1 0Sh;@ 0-1L, @P00  1  B 000X8P<00E0h_0 03/0< 20S 00!<0000C00h00! !0! 00 0-LP1@ R  B 0 -` ::L#(@ !p0T  T !T 4 T3  T 0T @$ % @t T``@P@PP P 㘒P @PT -A2A3A p-L,@ 0P S ` <0S` 3/`P 00C 0xp -LM`@WP`@P00S ` g0pp PEo   |0  0h0`M_ P T7LL 0tP<Kh+K蕰@LA' AObW3A 6 @+ |0 @ : :-LL#1@P 0 P000A 0-L,P 0@ CS <0S 3/0h -LMP`Lq,@00<00P03/00<00o0S 8o< 0 0S 0pp兢0  0000`^ P | KiT@Avo LR00 8,o8f Ki臒 KOb PbPbPbB@; H@A -@LP00Eo<00045p0 10S1 R 0S 00<00 0 00<0000%00  k00;0000,1   B 8 Q Q 1 ,03/0S(P>0Q|^r@x@ : :-#L B@000A -LMP,p@`4 LP աҡ@0 0D0,0(0v t`@<0V K@@ -LM0K @,` P00S0B^KPE00 , UP 000 420( K0020"S` ^ r P1[S5 Ut\0S  OPZ  q\0S 0 RPPPPPEuHZP 0@001[ S R*$q1( K0 x1[PS%PU* U U U Ut0;0  @;0Y0S0S00ą P [0PP@00F(K@j &@@ LA@@@@@'@@ -LMQ@< A,pmQ=n< 0   L0<3/`+0S4!  8KM008 K80 (040 000 0 <0@ 1, @ ?P@ 404`<0Z\0S 3/0<L 0R$F SP`Am HR00 60m,e뭐G]Ob @h' Pb PbA% -`LP@,pP 0 00000000 @0,00(0000,0,000(0400tG ? H> - PL`@p0V00 V 00000400G$H0L3/ 4@^@ -pL@ P`0 (01 0C#@0    0 , ≫0000F&LH03/h 000#40R000/ 0/  00054/00@00/ -LM` )@D0,pS P ϟ0( 00!0 0S000` X00 '<0wPX S 察0( 00<00l0S 3/0j*PP7 0  40呟( 00'0 t $0,Q@$D0SQ= 0CD0 Q@P@@Sl0 R @P R @P D0S@0CD0@ U 00 03/T 00 03/dl@@@@@&@f@@}@@:@ -LM@PpP0` A`>@0 0 L0`@@@000  00T0/$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -0@L00@ L0@ h -L+M` P0L0  MP0  p` L0 A $$30Q MꔐK( 2 }H (K@" K ̢ jP2 塛( 0([- x20& 呛0[l0F \,$03/8A -KPz 20 s0[0( 0[0㓅%@P000c d1(K09401`@P D<8 #4,0 8 S90㕃#@0 , #L(K(0K }K,B$00h Kd0 06 l@ LKGX0 /KBX4`K0.  ,$0 3/4 $0 3/5A 40@  T0d05 l  0d0L(K耫A@@@@C@@@@@@!@2@V@ -L M(0`\  P0,@,0 80` 4 0000 48 p0 !, 0C#8 @0\ ( p,0C#F0Sp80 00 1E   (Ko胣408 T 0p  P p 00 BRx1@ p1a B  ׉@T@KVT=PP9 @`KAq-P&P"+P0&P+!P&P! P$00   |7ᗉX@K@0PP єDam(KP`c`c A@o@o(@@@(@// -LM0 0X= -L@Д 0T #2 0(000$p00 00(0080$04p 7/0H0,0ᙺ,0 ,S!i蛺t= @ @ԧ= &@ @@ p-@L 0SF$04P 5/$0`8P08 #85/$04P 5/$0`8Pݎ 08 #85/$04Pӎ 5/$0`8Pˎ08 #85/$04P 5/$0`8P幎0 05/p -$@` 0,`00$0PL4p夎 8/$04圎 8/ ,00,0$04`后 6/  000000,0 00300 000 00000$04`s 6/0000000066000` 0 p-@ BLP0R-꼆 P < ܆  0"S*$ 0"S $04@B 4/$0`8@: ;4/03 D  0"S pp -L@`pT0 S S SO W!S 0P SS=S S =SW, `P'0=SPW/   ( 8 0U=S( 8P P    80 S S S0S $0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A -L 0-HPL@P0S0P00 R  0h@-H0/$( 6\ 0/$( ( ?@$ 0S@ p-`L@VP (0HP@0P00P@pp= -LdMQ@p0 P|n P (PcQ`000 PPPWXp0p`w3<W01<0#t0 H,l Z$1 @d0K,0x0 5V00Y03S) 0L D d0 40`0K50_0K60^0K80\0 <0X0 0T0 (0P0 ,0< H0 00@0 0S8K x  dKlt P l0 g0l0 0F@s`TPZp0P(K Pb,c -L|MpK@`P` 9,0K\0 0,0 0 0 0py300 00᚜PY,0 CQ0 (KܫA -@LD0S ǑP h3 -L M@4   0 ```b0 ,  0 8! p 4p S0 0S0PP\ P ,00,0@0@0 @) P0P P60S5pWppp0  A4 f/ a ,003/PWP (Ko(K ,c -LM`P@p㌀4K(00(0 0 $ 0}P W ᙩp0  0r@T(K ,ct= 0-L@^50PS0500S L0h+ -LP@` T8幵pUp1 8@`PgU@ -<0L(0\ 0S  嗵,c!@ 0-40L@SP 4KPP  ``債 0QD<y 0S000S  00001@=J@ -0L@P` 0S 0S4`pPU@P80  R $ O0P,c,cA -L`P@H pOP4-0 00p` P0@Ae@,c -L M K$K`j+PP6 O0p@P0O\W0PS  0 WtPŽ*Op踩AA Pb -| @PL`X7v pp6 #::0 $000(00,00000400800<0L P 0@D T0H0:0(= -Lp@0PAp\1` 1x00 0S60S50S0S PH0P\ Q 50S0t }050踩A܏ -LMp0S GZP < @Zt2 Z Z Z Z sZ`` `` `Q0f,0 Sh0 Sg00 4,  ( 00@S%07# Z 0 000j ៅPV  60,``(0@/P: < R*/*,*80S0  @`V 0 媐`P P0:0pT 0K ! 1 c K0S/#ܫAx -0LDM@P,0 (0  T-,0K0,( K$2/P P@F 1  |0`P 0 @@@ @$`(P$!$0K @#   p @@@ @$`(,P0PJ '>00041 0(1 @ @00 0$`0 (00,0P0 00 00 000 @@$`0 (00,0Pٞ0 p00 @00 000@ @$`08(0 0,0P$K}@(=ܫA,cs@Pbo@ A ,cz@ -0L@S$P`V00$`S 0` V' Kp &PP 0$pS 0```(`,`0`\U  KP KPA -\7@L\1`P 1x00g50pStE587V 37V 0CV 6V 6Vb 6Vs6V 0V 0CV~6Vs 6VD 6V 6V6V x6VY p6VHd6V X6Vl 0CVa 0V 0CVvQ$6Vf 0D0r6VlZ6V 5V* 5V 5V^Q5V 5VF 5VT0`S0``L050SE%0 S 0S 000;i0S 000(,00S% 40PS0ZFP0400S 000S  p4@`0S Q 0T*  B@`V@0S Q (4`0S 0S `V|P4pW`000@`0S 0000W00(0,000 F P040 x530S  2  000A Q QR 00 ABa BR\CS2`>pW: F1P50(pS1PU JP , p JPPP LJ 0PV S `000@`0S 000(,0;`VS7Q1:1 0#S 0F0S0 0@a : :\1004(0,0 0000+(00,00&060#0008000S080<00<00@0@0H iA'H ir' 踩AkB@|B@iB fB@hB tB@oB@f@wt@{f@kB @oB@{B @~fyB|f}BlB gBzB vtfBwBlBܫA,c@AبAԨA -LMK 20c# c K0@-0P4 c0Q*@S:0 0@P# @@@aT@a@Q  Q0 000    8 -LMK 10[#4  K 0-0LP c0Q*S:00 0S 00 -PLHM@pc `P@,K `05S 8S S, S 5:S SGS: S S?\ S S:%S S S2 S/ SL $S* -S (SG ,S"0SK 4S\S ES =S <S@SJ DS MS HSV LSPSh TS|S dS `S aSlS tSS S SS S`QQ0aS:W1 0SM:W P 0b S*=0S0cV0aSW,  U0S0cV0aS W,  ,0SB > R0* bV:W P 0b S* (& R`7 :Wz00Sr  aR*0``a`0( K1D 0( K1D`0( K1D0( K1D`0Q0P 0P 0P 0 P P:P 001PfV- 000c0800000``(K -PQL@  U10S0S`㮘2 p@0AQ 4 ` ` @@Ta T^ T'TZ TX `T\QYSP UQR1J@QG QD Q Q? 0QC `Q: PQpQ5 Q920@T-3@ T T T0T @T% X!*X:000@@T*X*@ᴀᴀ@@000\ :@@.// 0-L0KPM@P#0 kO0P0 RS+ K0 RQ  0 P  0S`O  0R00  0 P}O 0003/K0PbPbA,c -LP@p`ǗP `O댠 |: 0SR \TO㲗P00 0  ┬`(0000 0?>#2 0 0$p000(00801 0$04 8/00 ,0 $04Pހ 5/0 PP0l0 8P0m0l0Sm0S t P Pp P4,0 0  (  09,000 ( 900m0S t0  50nD8mh= @ @8=@@@@@@ &@ @@@ -LP<@$08`o 0T6/p@W(h%H= -@L僀P 0S S SkS .S0ve`0SS`]Z$08`= 56/$04`5 6/$0p8`-;8 #86/$08`# 06/$04` 6/$0p8`;8 #86/$08`  06/$04` 6/$0p8`<8 #86/ $08` 0W6/pXl0S (0 t0 xt $08` 0W6/pXt0 8t $08` 0W6/pXt0 431 $08` ;6/$08` 0 6/t0$0 8` |36/$08` 08`H3 6/$08` ;6/t0 s $08`{ 0W6/pXt0   0S$08`g 06/t0m0S 0?Sj$08`U <6/$08M$0p4H` 8/00 :/t0 $08P7 15/$08P/$0p4*` 8/0 5/$08P 15/$08P$0p4` 8/0 5/$08P 15/$08P~ :5/$08P~ 05/p "88S*R R$08P~ 05/$04P~ 5/$0`8P~ <5/(0 ASm訪===  = Pp W p-$0L@8P~ 95/4P$04`~ 6/ 6$PUp: -$@` 0,`00$0PL4p~ 8/$04~ 8/ ,00,0$04`u~ 6/  000000,0 00300 000 00000 0?S$098`U~ 16/$04`M~ 6/$0p8`E~1 6/?< S S00 0  S  S 00000 00 0000000000,0006600=4`~ 6/  P#  P&  P!  P($ P  P  P!00600000$04`} 6/ 00<006000000006000000000,00` &0 -0BL@pPS@ t ` `  0"S 0"S $04P} 5/$0`8P} ;5/03 003/00SL S SH S@E 003/ `$0Vll8P} 05/$04P} 5/#(0 < S``n,`SlFc`k$08Pj} 05/"$08P`} <5/$08PX} 0>0@-0@R:P@S \0 -,`pPV0†! ,Ń1L@jP  P4  C  Q0 0 00bS0!RVX F4$P Q " 4V !40`pWP,` -Lp∁@l `?PP  8(0p 0<0PpD0$`(0 0,P HAA0$00(0,0000?HA -L;!@0(0,0000/ -L@0P 8~0|0$0Sz 0S vU U Uj11 01D0 @01H03/Y`圁圡$pR g *pbWp!U U U0A3AS0 D0 @00A3AS H03/@g `TV,0p蠟`R f *`bV`!U U U 0 D0 @0H03/@f Td`\T婤80X03/0S| 0 t "@G?0 0c*C6"* b0 0 Z 0HP`j V0Q 8  80 00c 01 t D00,00 0@0p03T0SP(0p(0000D00(KA -LMp ( , `@V0SD0 DP0P80000P0(`p0PKA -LM0,0K000000# 0 0@P,P2  `pP + zP1 P1*  `pV 0PP$K -LM@`TpP 0S   0> . 0 0  0, P, P @0U @ 0@(KfcfcA-P@`p)+PUPR*0b@ S00 R*U*^PP0 0cS0!>0>00` V!!!$!,1!01!-!5!=000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p$O+- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A <0 80 40/0/ 0< 8/// -0, M@L 0DK -@ ML 0 0 DK -$L@!::L#!=h`0 T0 (0 R 0d00003/A p-L$M$@KP` "  4 50$0K 0l 0 0`1Kp0u -LM4Pp0@0 j X  X 0 0 0X:=$-%800804$P'U>A -Lp#q@rrPpb 0 AP  0AUxCPtpkt}kd$P\=vv(bL=h= -Lp@p`P\@ =0000SH0S`00`0 tjxڛ0d`0000P 0X00080 080p`p vDv`$X偛p 0a 0uBPh赛!@=hA@ @ -@0`Lpph@PT p`0W 0 0 00&cav08  chN -l0@@P0p0CSLRn00Sx0SypWx`4P"1 0xn00Sx0Sy0Sx`P"0 0[n00Sx0Sy0Sx@P"$0 0@ԨA1 -L M0K0 0`, K褫= -L$M,pK@`P G0,0K0  &0K0@ %0K 0 $0K 0)`K(PK'K0 00+ K0u p-L$M$@KP` {  4 K0$0K 0 `K0 00+Kp0u p-L$M$@KP` ^S0$0K]  , 0 *  0 0+Kp0u -SL M 000000L0 00$ 00000 00$ K N -L$Mp@P`,K B0,0K@0*0K'4%0K00D0T00 000,K 00+@K)`K&K$pKpA+ K0u  -L$Mp@P`,K C0,0K'4%0K0T#0K0080,K 00 0:00+@K&`K$pKp+ K0u p-LM 0d`@0400P0 P40  0c(#("$c4"00#$400 S0S000Kp -LM@P`e/h0dp,p(0000lA$48pd0000S0 S 00  l0 K<0K?404!0X0P0 0 <0  00000840   00sK"@"@WEV -LMTP@ -XoKM ~n pvnpsnx0" x 00'zX z D 0w P 0嗙 -X$ u K f@ p-LM0@` CRP/0000 d0 P$0S0 00b! d4 a!,Ġa,0C BSd040 0#$40Kp -LM@4@ I @0@00000D0 0 07# 0@0000@ 0 0#K N -L,ML0 Pd`D@Kp,KP 0P U ,PUA0[@@ @@ L0  00DK 00=(K -L(MPd`@@Kp(KP 0P U (0S=0[@@ s@@ 00R0  @K (0 $K - :`:L#f4M&_@P dP00P0 0SP#P\0L0 t:80`V Ypp 00 ꇢ!P  K"P P P X W80080-"P W80v,Kd0 K|P@,0 S4 d0T0 DK40K0T 0P(4ZA[ P0 0 48 0 S j0 00 TDK 0P(K;0!d0 KDP, 00h l0$+p ;h01l01p000S# hr80080SM K 0pDl `<h 0 + l $ PW V T0(V 2S  Y  Y 0 f`0 f` 0L009Q-p!80080L90SP"(KA"@"#@jb#@s#@A#@ -@ ::MM#LM * P^dp` 80E/U< /U  BU5* BUt// BUh/5+:,`/U) T/UP/"#H/U'8/U  BU*$/U //U/  /U /U..U .UZ   0 tsp} >U V>Ut '0CU^ 0CUB  >U X>UY 2L>U? 0UR C4>UU 0CU 0UG  >UE 0U@ =Un =Uu 0CUF 0U1 b=Up 0U* AL=U _?CU5 0U x=Uc p=UY <U X=U 'L=U+ @=Ud <Uq (=U w<U <U =U <U< 0U'<U <U/<U <U0CU.*L<U<U( <U<UY <UQ h<UV\<U ;U H<UTe/T0 ᔠ0T0   \P\8`0T0`0 X0zu`00`08MK ad 0p03PP0wPp@T WË0d`M^K0 0P4[$[00b100 0Ps o(Kpq@J~GpGPcc 0(pKJ@@SQ1PM 0d@ P<8@K E080K'410K009 00pK0d & p0G,S 0PKdVP R !0P 0 @d@>00d M>K^Pd040 8(K "$ MK M^K (Pt8(K 0 BR !M^K P(8(pK 0 BR !0SMK H 0\pd`lPK,Kp 0%P W ,0Si0[PP PP 00 00 0000dpPK`,Kp@  0@P W nN0`K0  0@Pa,pW PP``0[P`P0[` 0 K0 0 00 0 00 0 00 0000 0 0S30 0+0 0# 00 00 0 dd   0S0Q  R@ OP k > 8 Q0d0<  < d0<  < 0030;0 d 0M%TPK Y0T0K0 P0K0 `#L0K0 0 00d 4% SKK 0 S񟗉4!!!!4!,!!,!!!,!! ! ![0T0Kd0K0K0002TK 00 0:0d0K%P0 [0"30W[0T0Kl0K0K 000d2 #00 0 :J K0PKdTK 0$P= 8 [0T0KK K0PK 030J0K001TK00 0:0d0$P (pK[0,0g K K0PK 030J0K00L100 0:0d0$P 0[ # "  #1 0 0 0 A}d(@c c Q d@pd c@Q @qdQc cmddvd~d(Q`drdAc c c c c c c ct@edAcpd cccchdc gdccc cc(c  e R$#&-- ##? ?0,<,<0 0  R##?0-<"-<0 0R 00`@PU?00PVP(K蜬A// -PL4M P@KD0@PF$1P`p0 0P @@@ @$`(p*q00 0P @@@ @$`(,pq'>000x0 0l0\ @00@ @$`(,P0pq@Ps(K蠬A$@Pb$@$@A -LM0`p S 00 @(PK@ +(0$0 T0 BK 0 |K -LMK q K 0-LM@ P RP$Kb0 $/0Kq;q8 q5,q2hq/lq,pq)`q&dq# q q0q4q<q@qq$q(0s P P P-/-/// - L~%@ p-LM0P0CS~0 40Q R00000X`P `00s, [`00s`KphXKp%@ -@L TX? -@L IX? -LMp0PT0So`(  F00,0K0 0`P,, 0( ,/ 0 /pǏRQB0 10R0 X#30p 0 xp & K0PX 0 y,,X[  O\0` x 00a00 0"[ b `$KG? c -LDM@P`Y 0 S\PʠQ00 000Sp! p``pP0pQ  P R H0 0 000PyYuT P P  0H D0 TK R0SP`R^ T L l\ 1Q@ < P TK2 @ < 0@K 8 4 D0SH^8K0K ,K0@ K00P k ,0K@ K0,Y0 L,PcX O,Y0XS (K -L8Mp@`P 0  0(0  07:#:0800 000X000\040`080d0<0h0@0l0D0p0H0t0L0x0P00 h l0P0$00(0PX&0S#  `, KX D  XK;, T  P L (0 H0 N0<K4 80 000 nPH0(D;c$0 ]0d`0000,0P0tp000$KA -LM0 Q@& K ! 0K p-`0@P  p0L00HP:X6S \PT&p`X6\60C\6H&ZNPLVPfp -01B.L0@ S-=P0CP P R   BRڇRP `0S !8&<6P"0S c> PX0\ U0B}0 @0  8fGAKoP0 0000  00ph4갗A :: #->L+A谗A p-P ::L#>P@A0`S NP 04 P@@0`S NP 0  P@@0`S NP 0 @0@SD wNP@  0p7``4KP0 xKoP뀀儠0 00 00800T0<000L0T< 0T0< < h@=PP 0S KP p 0$ 0A<PP& IP" P KoT 0000 00000O0 000p谗A -PL`!::#><0@S IP (p4 P$0S S\0X0@ 0990l1SL!0R Q똠K@ 똠0B 0000( 000000?006 000 0 0000 00000 000000HS㜀v0 X00 (0KS0ږ S~0A0Ú0(0h1(0l10L100  R 00 008d0h00 00000lN0 000|0 0d h0e0003/PX  P谗ApA p-K_@L`000!L1  20 0$TX0@0 000S00008 <S0@000T Lx`:@P0@ 003/0S HP 0@0Sp谗A - ::L#4M`>\ :@P X0  x0S HP P0 0Pp0p@0S`0S 3/P DspKS00KL00L18 < 0000S0P00T0 000T0< &@&@M@&@!pAp!A!&@(=A! -LM0pK`P@ /0$0 00 00` (P K -`PL@x`pV AJP 0TW0 0Qb -L`DX 0 8 <0T  `S0T3/00D $$4 3/0# 3/01@1@`=1@1@ -LM@` 0l 3/N03/TyP0 P pQ@2S0 3/ )%Π !3/ p0A0CS, 03/,  0r3%Ġ 0 ,Š\0 %8D 0%D`0 8P n T  ?h ?l d 8  p @x P4   ` h0%:00 :00 %208 0 :#:?!X c/c/c/c -P0ML000 0D CO0 0 K$7@/cuRb -0Lp@P`T  P@P D V U L lPP` P@ 0@P4 0puRb/cA - 0L@ @l0 hPA/c -@0ML040 00$0 H0 K*7@a/cvRb p-l0@L0`S@ P JPP @ G@P (K0@0 @PpvRb/c - 0L@S Uu hkK07@/c p-L@P`  0RP PE @U@p -LyP = -$@` 0,`00$0PL4pb+ 8/$04Z+ 8/ ,00,0$04`N+ 6/  000000,0 00300 0 00 $04`5+ 6/ 006  000  006 00 0000 -LP`<+@pDyU  V`(000$p00 00(0080w$04p* 7/0H0,0rV,0 ,,VwitV= @ @D= &@ @@ p-@ BLP0R-"T"@"" 0"S*$ 0"S $04@* 4/$0`8@* ;4/03 v  0"S wp}wwwp$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -L3S 3/ -L0,#R" 3S 3/ - @`T3<3 -3 ML Bb 0 p0 #pP  0 0S; $0"3/$0 "3/ Xx0  0x |0 "3/p0  0p t03;30 0 000C8#8S0 )  h0  0h l0U  h0  0h l0|33/,  0PodpWPKH 00 0(0 00 00 00 00 00 :0 0|0 0p x0 0t0 0l0 0h0 }>d0 0  0`0 }` 1\0 v 1X T0 0 0P0 tP 0L0 m 0D0 1xpPK1WH @0 0`p<0 hP`P000$0KPcPWP x ~@ P@@ @ K PP@@@$K 0- LP`@SP0S 1(S 1S3 SP000(@ -LM`0Ps000 pS0C00:#:c@@@ c0,  S: N@N@T   S 01 p0 0p T * 0  d|0 p0,>0 . 0>0R  cp  p,00(KTG"I"D" -LM` 0 0p,0 DD0S  0@000 pPUᭅ@PpP0pp0Q!~$@PK!$@Pd040(0 + @P&hK400 0@P@P[0I8S@ 7L 0u@P 0s,0 $[0  ^pR \1 0QRs h0 Ό 0. L0 4 b3/, `p OQHW4 ,0ps0,0 0, S0 0c0c B 0,0 , 00 0 >0>.0 S  c 0l# 00c,0 00K4 K ,0KP0 S:0 S 550b005, 000,0  0 `00 3[Q  7,0 0 @e%@X  6 (KAD" -L4M0,0 0< @3S P%Yp3@ SP @ R 20C8S$pP22D0 6D0$0< 0pP000,08040" ` 0 Q0 Sp#*3 E000$0< 0pPpWh0 , \ (0K #0< 00>040080X 80K0,0K0< 0P `pPP* 0 <,008 0H00 6E0H0V @0Z2 02000|0d`|0 D5h0<$03/pX <0 E D5p(K c2" -0LMt030  C `p[( , 5,0$00 0pPH 5 4 t0@ P80 < 20S-0 S*S(00$ 0eP 0S S R0S4BPp0S  R4`6P8< (P3Z:X5Wpp ,R5(KP=Y= -L@PT0@0T0P :P/ Y; S S  S S  S P R P Ppp0&R (" R &R "r Rppp`0  0[Pg1T1S0S 000H0_h0 ?Dh0 0\ 0m0` d0 00 [d0P0X  FAs@Xd0S` 0h D \ 0EhXK0 h zh0X0 \ Ax`PM@0 0 C 0L0  0 \L0  00H0 \0< @0 XK X s(KA>A0B30@/8 4 8K  DK 01DK 0 S    p" 0H0C 0;  0$4L3 0  B : S000?> 0#3L3" "<00S ,0i,0DKƯ ,P 0P <4 (KTU 4AT4=@S=@?@r=@ -LMP,`@a  ?a/`? p 00an 1匑R`p0pB80Aȁf!>0 FP080 ,  ,!:9P,` 0 2@` d.@ +@/`,@"80Q `cYf ! BB.A.A BPbh`t! Q(K  PQ, ?$@U ==@=@=@=@===@=@ -L,M@ <0  @D L 8 ?8"P`0 (0\PQ0  2R\ ?ᵯ H 1>, 0 0pS9H  ?00@ K?=Sl<@, 0 9,0DZ L0 P 80 %X00S00 0L0P 0 ,;  0$4L32   8 : S 00C0?> R0#3L3" B"00T3S V  a`FBnA!nA`Bf` (KoD4ATU >@?>@ -L4MH D0 0 0 ,0 @`?0KR&P4 0 0\PQ0 0KP`?P6 R`p8` p00Yt``Zf $P Xx,0@0H K00@> $ 0$000? 0#34L3 2   \%X5R<=S9T0嬀 0C (5 Pu`RP5X0200W L P0 먐T T 0 0 L P0|4R X0Ԑ W 804@ c X  !< 0c R3a<`FBnAnA`BQ0 T #T0TYZ0 0!10CB>A>A0BR 00K ?0|0@H K@a>h>30 \$0 0$0$ 4 ?$ 44 L3 0 <0 800cR3 Q 0@ {#``Xf #P $ 800c$08  L3P  0  b  0*$000? 0#3L3 000\%2Rj=SgT0嬠 0C -1 Pu`RP5X0200W L P0 먐T T 0 0 L P041R X0Ԑ W T 먀0 P0  P00 T0 000ST T  ST0TP!P100T#00R 4P10CB>A>A0B308(Ko4ATU Y>@~>@>@ -LM D3P<@R`pp  0/0 , 00K ᇿ 0PQ (800cß 00K Q` `V""P 0 0S 800 0`P(``V " 0B#00C0? 0#3L3 2  B \%1Rj=SgT嬠 I  D1 PpRP5X0200X  8 @0 < < 4 &4  8 @0 1RX00020X  @0 < 먠   8 8  @0<0t p0C00ST T  ST0T0!010C000  20O0@(KU T -L$M<@< 80 L3`00pS 4 00W P3\%$PR0    0T  BT0000,0K0 0\P,0,Pp3 R Q0S0W @@ß\ ^\0W  ,0 ,<0K RT `υWr 8!PDZ@S @ 0 0,0,<0K ?@ < P<10CB>A>A0B3 0 80Rpg$040$0$ 4 ?$ 4L30  00 p101><0K @ n0@  R! BB.A.A B" Q@0 }$ 4 g$  $Q/ $L# W g   pg pA!@0 ! 喒ïT3S V  a`FBnA!nA`Bf`,,C (KTU 4AT P/  P/ 8= M-LM 04 0 <@ 00PX#30c ` =$ 4 00 ,0 DĔ<0@$ ,c 0p00K 0S R 0  P;<4S84S0 4`?"p ?G0 001QP 0Ȅ0S0h h 0p``p(00(0 4 P$ S=(K4r">@>@ -L0P`p<@ |@d` 工t@0@[\ P 0H1S8 0@Nt0 0/R S 4?᯼80 O2;X HP  ?̼ `4?ᙼ,` ?P踼2 L0Q  R L320S80O2 R0@ -L0P`p<@ |@k` ?t@0@b\ qP 1 St0 0/R S 4?:80 O2EX 0  ?W `4?$ P`?,`; ?P?2 L0Q  R L320S80O2  R0@8Po@0 -L0M@@ < PD0 ȟ 0 \%4` pR /8 4 5%   45% 0T  B⥤0000,0K0 0P ,,4,PX #R #@KP0 00 ?᛻3p X`@ G00DQ&`0Ws P@, 5 C 000C0? 0#3L32  B DT08 \3D0 0QABAAB\@L N,L崾0DS`0 bpW3 L0 PL0' $8   $ 8 $/ $L#   0L 300C0? 0#3LL3 00C0W00180 804 H 80 q0cR3pGB~A~ApBQH 0L <L Z 10CB>A!>A0B30D \$00l$0$ 4 R?$ 4L32 l 80 800cR3 QH 0 00T3S V  a`FBnA!nA`Bf`@,姾 (KTU 4A -LM0pP,0 0@` 0008< 0 P  0KhKD= -L@M@pP/8 4 L  80K 蛺0 0H D 0\%4 0P0 1R ?@ <0 '<`!p  <`!p T0 8 @  0P>HK 0    P/8 @0T  C0000,0K 00TP, ,h ,0\ Ó\  L0P0\00H0K  ,(KTT=U M-L`M<@P` p` 0Ң$ 4 0@ <0 DĔ<0@$ ,c 0@0K 0SR  0  嬡P P\%T<R01p@ < 0 1 @ < @ <0 , `P`00 007 Ppdp pW 00p,0K0p 0኿`P , @K?ᱹd><` iL#T0 t X QRX38@ D0 A h ?8 40 00L H @K 04? QjhpWfP\ [:\%$pR0    0T  B&000000K0 0.P<00,p:\ #R3*0 0\PQ0 @Kx ?P T9xY\`08 T 0`0 80` T K/p l |0 7p K8 4 00@ @4 p0 l@ ?O 0@8 K0@!`0.A8 K0 R8 4 0@Q 0@0 @ 8 4 8@^4 DP| h08 @8 cL0K TKD0L H 80d@ p h0 |P 6 LPK0/08@ 4P @?P L H 8K0 0`Ό 08PK0P@U8@ 4P  @PQ @P@ P 8 4 8PS5 p^hd@|P8 a !0 B!D ^0b 0! !\T0K TL Y ?8 40 T  94@?O0 @8K0 @`8@K @T000030$00C$04 D0 @4 DtL3 0 @ 8@K0 @80 4@ D Q00T3@LST Z JBA!窮AB\0 0X0S4 @0c\<4SFB84 SA= h0h0 (00(00S# T @K,P Bⵠ00S40S o6 n,0X , ;,0u,0 , ,0@0PU @pK0S! S?<0SDDĔ@$ ,0 㾷 4S64S230S  {800'<0DĔ@$0C ,0d 㟷 40`S4S:30S   [800, @@i5`002 0 `lQ8 4 ʇP 00yW 00S T @K B  0 40 @0K $X( 00yW 00S T80K X ? L0h uT `h`X"48pK`$ 0{ 0Xp0S4 h0h0 (00P(0 T 8K,P Bɟ 04ሹ,0 i, U,0,0 , ,00 R 8@KP`d`V ,*ś` TR7``(KT>@?@U 4AT8?@AD?@q?@?@?@4r">@>@ -L4M⼀P`8 40 @D  0ᵶ0$00 d0@ < 0\%H0 D1hR ?(p ( 0`  @ K0  080K `P. ᾏ0000,0K 00FP, ,t ,0\ Ó\ D080K 0H 00Q00@0K ,)(KT`=U -L0M pD0 @P`Ḡ ? 0 <1@ < \%R0     /,08 4 ZT @0@ K@`48K B Ԟ0000,0K0 0ܻP, ,h ,0Q Q D D000@0K `,ù(KT?@U d -LXMT0 pT0P l 0娠d <` @3P< P@X@ b$40 P Q\ <@, ȟL 0 ῵ 0<  蹵0@ ?L04 ps,0H0 壿븀  0L L P ^<YP@ U0 HQLLÔœ\P< U@P^ 0 Q 0 zP<`U00C2S0!Ud0 00C1H?h0 0@t SQAI` 4tĔ品4^H D 圃 00@ p H0K R ?K QpP!D9#S HR HK 0p 3p\ 8X! ?X42 @ H0 Ld0 Y h0Y` ^H^@@ @0LC ^H0LdŽ ^h ^ `\HÔ\ȟQL< 0 QLB XL3<20SXȟ4 ,0 QS? ሴ\H3 P R  R  B 0P 02 0 00P dd 0$T0@T@@@$[@(KTU -LMP<@|/\Ŕ p8\ 0 P   Y̐ W00-Q  -`P  喛   P0 S 0P Q00[  0K   QP0`85`@5`L0`0 V00V0S; 0P; K0p000 `000<0K0 K0 pm`PP KI0 衮< K0W1pt (00(0  儶!Q  R0` !001 0K P Qሐ P@%L08E @@@ YP K0p000 <0K0 0 Kp ?0K P V:0S*0@ L0 0P K0p000v <0K0 0 Kd`PCW T <K Bⴚ0 K  p`P00< K1pt ,0K0 K0Ka`P,00C,0 0!0L`P^ K 0@/00  0<0K 00 K``P\K -<K\ X T  Bg00 K00040K 00 `PT K 4婵\0K`P00   0 !  K( ` 0  (  0 0 \K `  0P⬐K0    04K  002`P40, !,0 Qk 0 0  㖴P,0\ 0  K0   0 K   00 0<0K 00 K`PW <K  K T B˙00 0000K 0 0 `P>0`P:0 \1K Q 4|4彴y UP40Pm K,0(K2|0900 <0K 0 K0'`P 4Z W<K   T K Bn00 K0000 pP 0400 `8,0(K2|0 K144  ҳW 0K 0  K00MP 0㿳`T  B.00 K0000 WP` 0S,0K 2 0 pP 0004 K0 0 9Ps4`0l \5pT PS  0 Bq0K 301#  /  0 B]0K 0       ,     ,0K  0 0 T0K ? L⫘P 04K000 0$!P40  A B 0 SpP `Pp0 (00(00( K 000040K0 H00|P40| ,01 4岳嬀K 00 040K 0 0P4Ѳ,0Y\K 00040 $00Z:X 0Ȅ Q/   Y̐ -W00Q   `P  0  S P 0\ P00b  0K 0 0   QP0`@@T@@85`@5`L0`0 V00V0S; 0P K0(000`000<0K0 K0 p`P;P K谗0 0  0< W(00(0 P  ꈮQ  R0` 1SM 0K P ~Qሐ  P W 000 K00@%L08E @@@ YW 000 0 Kj`P ܱP# K0(000y <0K0 0 KpW?0K P 0V:0S*0@ L0 0P K0(000K <0K0 0 K`PW T <K B0 K  p,`P}0< (0`0(0s40K0 K0K`Pj40 0C40 0 YE`P K 0@00  0<0K 00 K`g`P\0KV<8\ T Bⷖ00 K000,0K 00 `PXK ,\0K`P09 0  ( ` 0  (  0 0 \K `  0P 嬐K0    0,K  00儳`P^,0 , 40Rh 0\0  PJ.40\ 0  K0~   0 K r  00 0<0K 00 K`P00K PK  Q2 00S0  0 1  009S T   B01 }01 00 00040  $ 00K FK 0 0 H0SpGwA  0 a 0 ]  R ppG R  0 01 0KP 20删Q P085 @5L0 009S R T  B01 01  040 $ 0ʤK pʏp K0  p܀0WSP 0S0 101p   r 0Sp W AKP ȍ댠p QP08@5 L0 0S00   0Sp W AKP 堍대pQP0 8%@5  L0 RO# pbW)T0KR#  X R Cx0 p40 0K $t K/ a0 0 0 0S00Pp p P 00S0h  jh K0  R0 06(00(0d0)R 00 0A@A -L0M@< $` 01H0 4 K0WP  04 00 4x ᙷX 8 48<0B?H 哞P LI. @ 001H,0 0)P ` 0 p 0S 0S4 pWr,0 S 0 0D 0p00F0004(K0000`,``L00L0긩AcA@A@A@AA@A@p" - 0Lp@` ǿ LR000  0p Rp;8S000ᪿ PU000V  mAp" -LPMP`dX p 0 ㌀<@ \ 兿 ㈐8<T 娆0,0 X  T P X RH D {Qy PpTK w @ < @K085 8 4 `0 0 ~Y0P!X @Kt  QP@uL0pbppp0, K0@ K0n80K0K 00, K 0 @ K00P $pZ)`T 0LD PcUP!RHQ, p`WcQ,X P ,㭠, X00SL0 y,P 㟠\4d (K M-L0 0@0x ,PS?`  0 ( (  d l p t0?`,О0 ( (  X P  00 K M-LM`0000 0P@pߡP P vu 0`4PW 0 ,C0  40SPPP &KG-8@偐P@@``Tfp`  Zu`刀p`8 VP 8`U=== -0`LQ """"PQ BP'B@ -0`LQ""x"h"p30 !B1   P LB@ -0`LQD"(" ""BBuB@ -0`LQ""""BBB@$ŐG-\}lh@S @`Q R`UPE^ap^PU R`UPE^ap^PUP$epP``X!Uppa`Ǒ`a`FBnApnA`Bv `  \pp`ppVpBW  Pe`h¡! BB.A.A B"oH  X  L\pl  R W! c!U!0c1$5A R0CS P#1 -PL4M P@@@P42 P00`p 0 0P @@@ @$`(pp1 00 0 0P @@@ @$`(P,p\1唑 00' 0 0\ @@ @$`(P,P0pD<1 00 0 0 @@ @$`(P,0p/0 00 0 0 @@ @$`(P,`0p0 00 00 `00,00 @@ @$`(P0p喫@P (KA$@xRbB@B@*+B@B@B@A -LMp@``Pn0 H`P1000S  P '0S EP`W P,OuT0S咼`P   0PK0%堀 0Kvd -D Lh00CSh0 m(0j 0g0hcA1c0c0c\ - LMh0Sh+ʴ0@0 0@@ @@@0 x00@ @@@ X0 L0 0@ @@@,0KhKAB@0cC@0cC@1c -LM0p S 00` @(PK@ ᆛ40$0 0 BK 0 כK p-LM` P R$@KǛ 0 0S , S* FKp -L0M < pS8 4 ` 8K0P@L30 K <0P 1@o8K 0P 屻0 U00L L 8 K0@ P,0 0 %< 1S 40ğ4 040`P$T40X4S 0 P$T40X4PD]4`p@xL,800PT 0 S4P 0fHL B0 ,K00 0P , 1 博 1,0  ,,゚80` V\4PS $$5SP#0$0,S屸` ሳd0SH0 !P 圸噸P x!1P Dr\5 P Sp ?4轖 ?1# !  ! )?4诖0       ,$   $  ,B?K 0! 1 4?yx ?ၖ` g0TB?K  L]0 ,K 00fP ,יe 8 40,  2,șVh `V\LT t(K&C@TT9C@C@BC@ &@ccC@ -LCM0@RP 0! 1 0! 1 S000!0jpW4,p @pP uP ` 㛷pP48 0`,P h , 1,@t T! 0, K0 /:ۛP,0/  ! ,0\%R-hp0R tRhp0 ! #RT1S  ! 3!S'V>GSQV.`,0@ ,}@ 5! % )R* (  !P 4 ` p[1S p -PS TD, , `u ` pC?K xS> 0 %< 1S 40ş5 04) P$T40X4S 0 P$T40X41K0h0 S,,0 ,0 'P4僕P0000YT8$<4 L~1 0,0K0400,4 QS}, 5Ґ  0Y000004@3$5  S,0,001 Uq $ pL P180 0`0S4`T 0eHL B}1 000,0K00Ś0P L(1 .(1P `po,0  ,唖,)80, P !U$5 `PS$qP0$%0 , S, H 4S9Ӭ4հ4S@0Ӱ40T31 `0徶0,000(5 |0S80 !@0@080P0<0 0@040:4080<80Pt0@0t 0b0?oR0c0D0T0Y 0CH080L00004000PW\4SW rTL&0!0040h1 40>L `p @ ` pp ` ppp P  0 97T h0 0 ,P ဗV xP q徵l0 0(KDpP 5 ==TTvC@C@C@ &@C@BC@9C@B@C@ p-L1LM\Q@1P@G,, KC@P 1 =4 '4  @P  G-04 '4 t0 0 Q0   0 尵0u/ 0P`Y 0eD C;Kp踩AcB@$@x3cc c -0L M0PSP ` pL@P#] D@Px  0 @0 3 )PX@ P U@@ K b -LM@P@? o``pph0000(0K 0$0 0IpP4 5h 1 5(0,(0,`0\%R=S04, 030304040 50xx <"  00 5Z (6p(Ғ$KT -L M@8 44 P@Lp*800`T 0S4`0eHL B{00,0K 00 HP,0  ,噔80S,,呒80PU40XSP0(K -L M `p4 =S =S 0(= , s8 DP@jd0x S0 H0 a60S H  R ( 20S W 0S0t"SP0S80S_;, Y0P <0 ,<0S'Wd!;PP 00d<0 ,<0 W0 04  0SP!Tڳ,@0@T0W" T0Sʄ0S 8@W0   40PP UW9S寳PjP=S 000 044DPP PP P ~PPD,(K?@C@c (?0=4A -0QL@P\q Q`h`P 10 `P \`P P J`P PhL踩A -1 PL\!@`pPYtt!P=SRPM0J #D P > P0 91Q X pP0 0 R00p  QZ L$%0,R, L1hxP PJ0 040:40F"긩A<= b -4%LM`,` \ @R34P R ` +'XP$ 4, K߬`P U, 0S`0 ]P ` 0P 0 \  0R  U 0 , 80``V``,!,#`,V40 8 440U!40,PP ,`,|V, s`P pP ,X, ,i, pP=S"40  `P"`PP0 40S 50ó 5'4 `P=S4   040  ^`Pz=S* 80' 5, 0 " 00401 d    I ,`PU 00\4S J `PH0SE 0 0 09`Pu/L 50 5=S 00 1 0$44 OE> X /P40S O 40140,``(K``a40``긩A\?H=C@C@ &@C@4AD@ID@hD@-/-/-/-/-/-/ P/ P/ -L\M0p  0<` Q. 0R)Y' 0 6S  d 0R 0R0S+ ` @ `"@Q  0 PQ0 P R H0 3000dHPY0,0 X Lp L0 d `0 刀 W0ST P0 ʝR PdK h < @ @K0<0H D S8 4 @ PHK xQP085@0 0L 80 l h HK wX W ,K00@ K 0-D RH0 S HK0 wQPl0p@5pL00h08K0K 00 0,K 0@ K 0ᒔPp-l d0h \cP Q!WTQT,  `YY , ?pP,,p Q\ WXLpXLpXLp,P d040(00(0 0 = Sd` P d0  000 0PU410S  PP+XP( `,BuTPU_ȰPP  0PP  $`K00&0$@dp4 0P$K =vd -LhM@Pd` e 00 00 0S  mbP0 | 0K :0K 舀 儐   ㈀K0pp 儀 嵫x 0tp00 p 00  IpP9S) 0 }0S0( 10S !P =pl 0 00d@Tp] Z _pVꄀX* P',0KpK0 K 0RpPE8\}P 0   300嗫hGp,0W匫 0 p,:`tT0S} 00S00 pP  0  P0( K\p"$40(K =cAvd -LM⨀P<@P0 ,0 b,0p` rQ0P0W  V 0 = 0LH8%<5 0 ? - PL`p@ T  Bqb 0 @ T -L M Pp@`T  BXb 0 d` V 0 0$44(Ko4A -LMp`3 SP aQ QOp30x30Op30x3 0| 84H0s;$K0  0K R0 0 " : 0 aUzx  x 博0 ! ^P Qš -K0( '00 U00S㌐  Dy0  c 0x K ~a WQL0K  00 404 wp eZPPx p x D|P Q P R fxP,cU%0S" \ 0 ,0 @6 Kv00,  cR1! [w0 (K1H@b 0# pK!    q, 0000,0 L  0,0 0p@ 00 L1 ! h!  `o t0KT1 8 l ATZT  0Y@( $0\1P-Q) R&l1S 3S a^\\  2 `0Q2 b c^  4! ^1SPß10188 ,08Qh!R hL1S) Z 0KSPP0 0 0 V0pK, 0 100>00j@0 1X1 t1h *&@p 8H , Kp`H ,0d @0Y:h8  H !T: #:P KP7@Hh$ 0H@ 07X 4Z0`K0000e00 0 00PeP0S lQ d 9 03/(KG?xF@lA b`c0|#  0-P  S  RL@ +WP 'W P000 0-@LPƓ0S ,p0h  -SSSL@Pp` X ݱW ױi -LMp0`80 4 $0P3/@PyZ@s,0K0 0,P :```0P U.@@4@,P J#(K -LM@0 Pp,0 `0X0XX00  ,+00S &0  006/`(K -L@M<  @0 pD  P0< d@( QX$0 3/@P0S@K00K0 < @0 0 0 8 U PP 1  D'P  '03/ 0p 0@0K0000 p03/XU  XQ @K 1( KpAI p-L@`P4 fP ` P$00S$0$@pA0S    mA p-L@`P4 EP ` P(00S(0(@pA0S    LA -L`P@pP P&p W,0S 0,0&4w$0S X$Q(0S ,(QፌH@H@ 0-LP$@0 3/@T000000 -Lp@ 0fP P0UT `V P(0   0S("" /ဃ -@LPp`0` VW P@0@ T -(L@M" `T0 0R0&"@P p4 Y1 T 0,0K0W+0K :W,K pPK0,Kp *pKOpKPKp PK g,K pLK P0K ` T09/ \ 0 p0 ` T0W? paGApGXW8QaAApAXW0A Q.0ApCpaCXW0pC W-S W 0 R0A0P* .RS*Q1p1 3: V  IY 0b0Z @ =@Ĝc`c -7I0H 9I00(Ks@I@I@A#I@tAI@xAI@aI@aI@HaI@DaI@aJ@A J@|AJ@a'J@A5J@CJ@8aH#MJ@XJ@cJ@ahAd1c -p0L@0 R 0S D xP4$0@ R000AAoJ@ -L(M0p @$( 2PP7PX tRtb HX00SPD`K a0C0K0D0K  0 ($8T0 #S003 XR`p>0  0 0oP R`p.0  0 0/u(MQMa0 3S8 <0SD00c08  0b/S000C000000 u@T 0( 0 (  /R 3S80<0S 0㸶@P00S4  w/p  P^ L^ ](](P`4pp` 40 8 00 0PQ  0 (Cᇵ(Kd1c1@8aK@ -L`@PV 0'S(g@P p q] P l]P 0m -LM `@ 0<K ]1 S)X 60Sz50Sv ) ) 0R   ,0KP ,0 QZ EP`E>  0 ($8FOLpK \PK] ]  ] P=  ]P8<0[S;0[0S 40S <Km U0S 40S <K` 0 0w0KpK0x0KxK Kt ` H`P, 0PU 0S (40S \KL K<K P<K cP 30S +\KPL K<K0 gx30S  <Ku Xh\0[S D30S \KL K<Kc< L0[SK[XL`K\pK xcPpP3 20S  <KD K((I '(P t20S  <K/t !R  ∁ 50 00S 20Sj Ḽ1 <K5PH 0X000%0LK0-U=1,P .D10SPQ*`KPK Z\pK U\ Q\00K0K0KLK0 0K0K0K\\K \<K \,0K0 0pI,P 0 C,F00K00KK\0KKK - LP`pC 0  0 $0Ƴ(K AtA1@d1c8a5K@sK@K@L@IL@L@L@M@;M@ATAH# -LM @` 0(pSpf 1  0 W P`>  0 ($8I0 S 0 3S80<0S v@P 0 S  * 00K4PQ 00 Q% :XH : 0P}P& ?0S Pѻ  0~P`s((,8 0((,8t 0Sk 10  0 0bT\ 0Bό 0 X 0Yp Y{ YF YYL Y\YY*Y Y s:Y YYL :0IS\ 0S 10  0 0U3$$$$$ 0S 10  0 0  Q 004 0S 1 0  0 $0U U 0S 1(0  0( ,0U :U Q 88<U,0'pPp@ 0 3S80<0S0 S *+0 PPP@xp0 S0%0 * 00K.P 00 Q %0 *p0~  W  Z|8(<8 08(<8B>  0 $$4wTk Q @@DWY 0 S 1pp0  0p t0 S 1px0  0x |0*0㧴PPh Q Wl90SW W W#E0SO00 0S% * 00K⥷P@ 00 Q% Q:Y7 0P[0K 0TK\0KUKXP mZ\KDP *gpPT0[SS0[0S 04#$48#80 (0`f0`FS񟗼 $ $ $ $ $0VS PU U\V  Vu@PK  0ჰ  YpPi  `P f7pP` 0S]0SZ  0RP%P *  00K0PF 00 QPPUD V  [`P_ XV500SS100SS-HȀ `FF B` 张  @ p`. @R ^?T?RT0P0 R Q+ T R T P0Q `P@`e P gQ@ pἠ0lX p@张P\ :\ $5pp 5pp00  Pi$,$,$8$$P<`k 0,0 0 SPKUP H 4 *P:̠  0 @ 4p  @` %00S  RL _PpLWP P P0S\P 0 R `@TW PU̠@``̠@08` Vk 0P00 <` P8`4pP D įV V9䂟X PD 0<00+8p40 4000@0H00P L00 `(`( X (` X R R) R00000000(K40!0 8X00008 800001P 0S( 00 008  (    #R 8 <QDP0 8 B00c0 0 U$ 01 0  ؠ  @ ` p 0 *: @ 0 00S|0 '0  R \ pS00SkL  VP P Pa0 ^ \d1cM@Ah1cĜc4Aac`c8aM@3c?d1c1@ԅc3cʚ;PB 0 R< 0S `0 @ؠ4<0#4 p0D0  QS0b00 0 00S!0 0*0K0  W0 WW @ @T{U``pVh0p'SppWؠ@ pP 800(0s0(0 'Xp p@张 Wy vU[pPo 0 PPj̠ 3S 80< RDP00 c4J32P0( (`ZW W 0.W 4W 2 $00-8004s0((0$S8(<8 08(<8x$|4 0x$|4(pU Q HHLU#05P z5} v5 Q PPTUW,$0P 6;^ 2; Q XX\UW$0P @2? <2 0S 1`0  0` d0UW,%0ְP a0 ]0 0S 1h0  0h l0Um'Ww%0㵰P@CuUZWdp$60S ℶ0P‶ 0P S2000S V /W V`p>  0 ($800 S0%0 *0 ,0K┳P ,00 Q %0 @:S p0P0 ,K3W +W" ,W` W<W| 0R0%0 * 0jP ,0 Q: 0S~  3W  QQ] 0R`%` * 0MPj ,0 Q:``Va p0pSq 0S 0R00  0.PK ,0 Q 0SB   " B  Pp0`S0%0 * 0 P* ,0 Q: 0S!  l) RPpw0 ` S% *0 ,0KP ,00 Q% :Z IP`@>  0 ($890S0K 0KKK   | U`P& 0w K pKx0KgKt` UpK  `` TP 04 \8 @ <:0t0 x0K0 0 崠 S㰐 P pK  04 8 (0K#0 D;D+00##0S K K3/p[`p(8 0(8 [`p>  00(480p,0  0R * 00KSP 00 Q% *0 Y 0P0K 0 K0K[KP U0KP 0 !T`P,⼠ P ^0SZ^0:SW`0Sd0Sh0Sl0S ` T[PEp0St0Sx0S|0S p B[P30S "1 1) V& x-0î@P P =0S ,K 0 ?(K ,0ZP,P (;0,0 `P$ UV@  P @>0S ,K 0(K ,01P,P(NPP0 ` 0P T0ԫ(K/0`P' -L  0`$d4喿X b 0  W(K AĜcd1c p-L M@0P:T (P P@ R8`K @P R  RQ@  *@*@Kp p-4@PL@P ` 0 ph?d1c -LP = -$@0P,0000$0L4`pu 6/$04`n 6/,0`0,0$04b 8/  000000,0 00300 000 000 00 00 00 00600 -LP`^@pf   ` 0?>#2 0(000$p00 00(0080$04p 7/0H0,0,0 ,Ji= @ @8= &@ @@ p-@L `V V V$08P 0$08P 05/$08Pڤ #<5/p p-@ BLP0R-,$p,$\,$,$ 0"S*$ 0"S $04@庤 4/$0`8@岤 ;4/03   0"S pvz~p -H0L0S @0  "!$0d03/0 !!/c0S:@bDT T , 055N@N@ Ph/ P  P P/P0/N // p-L`<0P@ VP @Tp8A 0-tWL@U! (R  BR(13/4WU PEU4WiD73/4W8S 0CS8,8 3/8P800 "0 p-2LM0@PS!!R 0"0Qpfd21`0 / R U R 0 S~e O/0!0rQ UQVΌV0 S hQ !VfhV`!0!V Q"010h80 ShQ VfhV`hQ VfV`08U} UySdP qF OL0P$S!Tpp1SphN@D=N@N@O@j -LM@3⛇2i 0R> 10Sg/1!0@18&O01!0 S !  R 01 1S | 10CB>A!>A0B3P0D0 @ Y21S,01,ch1O@j8AVbbO@P.$0.R/ /"-" R/  0P/P//jR<9$,9$49$X9$P9$,9$X9$ P l7S40!\ 004/0S/t=D= p-L`@'PPHH!ph30000t7S00p8s ! 0 p7S d8@!00 p7S S S0< 0<0;0000CS:$:$:$:$:$;$08 0808070B;0p0;0pqO@L=j -LMĠP, p@ 0S4" ,0 ` ZP dd0  0XVLP  |`1V4v@Tp@AhO@O@ &@@O@@ -LXM@` !]pPh B 08`K M pd@ \ß0S7 L 0ad7  0d7   0ގd7   0Վd7 0͎W^ 2=0p0 4<+x0 ̆<t |0 Jp l p l P? ` 0ᫎd7  0 0ᢎd7  | 0ᙎd7  x  0ᐎd7 t0 0ᇎl8[0 8KP 0SS(K A0 80KZd 1Yd0pW0d0 kp8K.0 P& ` 0Vd7  0Nd7   0Fd7   0=d7 05p80[Wh`K{DӎZ$0h  0OL0P@(Khd=@BP 0</D= -LP@Pxx"2L8xW W WW Wpppp  W Wpyp1峠Z7r - Pn W0Z# "- p P \ PU0SR2 =0!0PQ PUBP1!0S` l`  ``VW0Zspp0S00S P4 p8Sp7pX4S Vpg 0f`00S\78\78 \7OP4qO@=hjJ0000 000/ -LM Pp` @TX"* U 0 0S0:1@!0CR P0(@10@1!3 `!0 0 0*PP'bTXP!00@QU 0S0   0R0@10C@1! `!0< 0 0P00 0 SP00 0O@O@& \BQl0A1: ///// p-LM80P@S!  (  0   0 Y`0V :3/P 1 t 0G 10 18003/@ 3KH08003/0000<0Kp$P@/P@=bP@,=0 - p 0 0L@p']`&p8/`0 V3E3E#E@P,0:(0:$0: 0:: ,=VbtD$D$D$D$0 S<< t4Q Q  j !/P@0=VbP@0 S@@ [8Q Q $ Q /P@L=VbP@P0P//Vb -QL M@`pP ڐ1 "0 $10$1)l2X'Q1 L"1l0DT 00 ,21l12X1 V121l0!00| (10(1ld7 㲠6p1 !0i pV d71 tT!\ p80S0S p03/P 1 $!0F 베,10,18003/8< 0pR*ʔ* K,0K# bq# D U*1 Pc& ,K A`eV( K0Z  C`PU,KڕD0 w'Pp'PN'PeA$PG$P@$PN$aA$ (K -LMR@P<0 ' p0Ku  91 01(0 0C0b(8`KA 0ᙗ  GP @0 R '㷗D0 ( ,0(K p-L MR`@<0   PK101u (0 0bP T&KpP///= -LJMP<@pK0D `! !@ @P @0-K00 S 0 P `@Kp0L1 I(KL1 P00 RP UqB@ `(P0PE Pii0@ U1Pi PQ (@K`AV(PK00PqUqFAEaVHq@@(`K@aT@@&@@$@A0@ $ R:@PQ TU ` Dp10  }x 0.' $,K+ K ( * K)K( K!P(`K(pK00@aTa@!DP  AR, K  $PPU(K=cU@ -0L@`㪖㧖U@ -LJMp<`@K0H P! !@ @p @0-K00 S 0 p`P@K0P1 ;H(KP1 P00 Rp WB@P(` 0`c c0@V 1D! `b plLq p pq0p(K 'qX00YHqIXLpp(KpqWp*p DqR:@TV Hp10  w 0V' $,K+ K ( * K)K, K(@K(K\ p00a^aLN\ P.R, K$(K=cU@ -@0<` pL PXX9P PUPPR\'P PP #R8 <QD 8   bR0C0000 =@T% 0 (00(0=0, R("( B R<  0#$#8 00  P~S@=<wVA 0-<@L QVPP000 @$0A P-L 0003/,c0S 0 84 0 0P//P0S/ 0($0 0,0Rp3//P0 84 0 < S/$S/$S\ S/$S Q0Q 00/ ///PP0 84 0 < S/$S/$S p S/$S $S  Q0 Q 00// /// -d8LPQ@p`)@P`  0T 49(6 0K0U@U@U@@ -LM0\ 00S" 0  )P .  @@DB@B @@@B @@@B @$B@B @ Q@ U@U@ 0-0-LMPp@uP @T 4߹(ܹ ¹ֹK0U@U@U@@ 0-LP@u Ź(>0h迹U@@ - 0L P88L0 PR~S@= p-@0LP`P  R 4T( TP  phR=pA -0-LM@KP0 0   f"K0W3A 0-,0LPS@P {T,,0S !400S u  ,P0A@@$V@ -LMaP@p < !=W P1 RPc1P t0 H00@00@0 <1PQ m?LV@ -LM`@S@Pp . S/ S S 0S & Sl PS S S S  \7 p7S2S S 40040 0h Sʐ1 ?Gr0?!?L00L0 , TK9<D K KlOKPKx0Sr S S< k S[S# SV%0S> S@ ] *SM!2S4 W SG-8 Rl7SO 0P45K0 0C##P0K0N0KBl7S0P0K=0H 0cJ0K80S0M0K3 ! 0(.(>#H00H0&EP 0 0S+ 0 84 0 <S 0S , ! 000-=P00P000 X:80S1 T=Gr0,=!$=>D00D0 0S! 0%[/,Q 2  Pf?H0S 7!061\7 0TK 0u(0|8\7 `7 $`78`7TK 0](5[  ;AP T Ks&PP?S0 T0K)&D :`p   AP  :d8U\'1*  3/3/p7S t'R 40040 40d  p040  Rd  p1:2R   X:dZ1 707 7D00D0td R 1 6  7H00H0bW1 `706 6D00D0Q X 1 L6  7H00H0@X d R 0 @P0 1 5  `00`0&\' X1 505 5V`00`0d(UpS p $ a@P  >%PUp 1 q8 0 d  1 404 4P 0P1  10(!0h00h00n ! R 6p\ /" 1 !1p0000S 0p7S񟗟ꬕ$$$$$$ԕ$$$! 0$4Ct7SW000d8U y"PP|2 12  0200S} T.pt>= t 5 HX`R[ 00\倐!>0S>X G00Q0K0!L$ \\ 00h "4?0S>  T/`?{6 ` `  ` `  /Z Z @0P\ph  Op[1 !?0S 9)09\PNK0Ӆ!އ44K 000S   d82121 T000P0K 0 9O0P K0Y 4 C204P K2402x %p7St7S 40040 0hSʐ1 x6Gr0l6!86L00L0!0dXh 岀X 1 pkƟ0W 6 0d8U81081h00h0g 0l ̕2P  P P P  ȠČ P0 S:Q1 H5Gr0$5!4wD00D030S! 04Gr!4eH00H0!0 1 kğ0W 4 0d8U81 081|00|013/hl X"  P202H72024Q ?  \7Q76\7\776\7? /630S31\76\76\71 j\`ß \03 ``  Dß00W  0`U1 3/t7S40040 hX ʐ1 2020 P2L00L00q00101 8P40040{1 mjD 0p7S S40040i 1 3/ad8U^ #Zt70CS40040S hX ʐ1 d10\1( ,1L00L0B0q00101 8P4004021 $j$ 0p7S S40040  1 3/d8U #1S  0pH000#P(Kv[@V@W3AV@[@AV@V@[@\@V@TA &@@.\@PW@W@O\@ja@V@V@V@x\@\@\@\@\@ -LXM`PR@\0 d  /O? 0  F0:0p7S0 ( R1S  L?m 0 X 0 0 pT  1S  ?Y0X 00T\  X S$ح$$$$$$  7PE &YXQ= R1S  8>X R.d  l0 7Pl0 d  $7Pl0 1 = 0 @>000U S  7P  PP \ X0  ,00S  R8 081 aPʐ #0!   ,<000101{ 5TX QT  Q QE Wu q0S H`P 1S  0< 00 0[p7SP $$$ $$$$Yd 3  0  +7 P1 ;0<000-Y Y 1 ;0+;000d8U1 ;0P+l;00 002S1 :0*; 0]@*]@F]@;]@\]@f]@]@]@]@]@8]@ ^@<^@-_@U@d^@Lcu^@Ĝc^@^@,c^@]@h3A^@^@_@TA!_@\@A_@W3A@9_@V_@_@_@_@`@\1Y0\1 1 l00x \0000( 1R S 0 P 00 0 T @R R\' p' r 3R 1T ,ve\0  @0@1 T R 1 h10t1"!l140040\7 1 10!1$00$0u 0 P 0 @  `C\  T000 tƟ! `P BPq`V 0y0w0u9s\75Sn S S0ge !b!e R #|7X\7N\7K\7Hv>01d71J\7 ?\7<\700>8SF ,5!0R1ā!d!<R:`pK`P5U[4U `PP )U'dS&]P P)8p$0`0K0\0K00[0K Q<<[0KT4 \10 P`K(0 T P0 00 L H0  g)0S _)\0[0\0K 0T P0 L H0   (V `K< Mlgx  @`v`301P0!6 Q"   `V0 1 !R !c%1S`PK `P ?PP 1VS !ā! B`2QU`pK `P !P{ 2 Z0K`"r1 S`n0` KX0 P1X RX0 X`Va_  @PP `X ` K\P <X `b("(!L` @Fd7B 1/A(R(  00>>00 00Q$$$$$00000㓂(:90㓂(&90s03 B8 ?\7 00t8`001`:S (03/``$Kx(= AA<$$z -LMph P`?@L%?`PG0<%`S: 2@ BS  BS  S ? S  SL$S q: S2m$SN  BS  S  BS$$S  BS$S  Sp$Sc  BS  BS H4 BS4$S + BSw$SY  $Sh  BS 6! BS#S v: S r SO#F$C$t7Sid800d8 'd800 80('80?0t7Sd4  X'2p+R'l7 0s03VP F0S`hl_`8d3/`3 +p7R ~'0ip8s " R01d8@!0100<\7`8|75\7  1/d8?-00G\700%1"1 \1``0 P D &1&p`00@ `6'Vp"01000\7=$`p00 0,0 0`K;i0 (0  '00L 00004 00`n>$K`AF%*xCE`cj Az$ -L$M`t @l,>PX(`Pp0D(WpGppS  -' BS# ? S  S  S'S^  SI  BSE'S  BS  S  BSr'S  S BS"|'S2 . BS  BS  SD'S@ l:+ S&('S  BS*7 BS  Sd / BSS&S r S0W S~p &  (c&W0S!V Q" 010h8p7SpWz3   R< nRl <3`Wk0Sg0$`$$<$$$T$d' l'RZd' d' T p'Sp7KWMQ0p8D p5 R0C \2 0 0ppW 0S  R&"0-  0 \ 0Sp8W4 W 4W0S d7  \78\7p7St7S\7 ( \' ,\'03A0AS|7SW0S W0S|7W0SW0S d7  \7 ; \7  ;\7`WH3 \7  WW0Sd( 0խʟW0S d7 \70 \7 0\7W0S"ղ0ђ4DW0p RRQRpW0&0㙞0 L0 $L0  p>%W@YWd W?B0CS^1 3A0ASS13/Dp7SM cP5p7SD pG HK$l7p 0s03QP VZZ6\- (K P @0S HKS 0R P1 3/4P`03A0AS|gV4``0;< 7<`(K``A-%EOjzx  -?LMQ@pPj !?Q ?Ql ?Q#?QC ?Q:|?Q  F0CQ`?Q X?Q dL?Q @?Q 4?Qd?Q ?Q ?QY 0CQ<>0S!- 0e``> \1 0 `P1dx CFR$H$H$H$8$H$H$H$H$$$$$H$P$l$$$X$$$$H$$,$H$|$$$$4$P$$$$$$0$H$H$|$H$H$H$H$$$$$$$$$$$$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$X$1S S S\740 \740\7040@S`{-$P`w 10CS$$$$$\70\7 \750\750\75\7!d8 y1`,C!R B"g*{1S`Kx7P<0SF]d7 `A 1 C(bR.Rh18SC8|74c1S\700\7\7+1S\744\7\7#!<RKypP:0[ S\[;Y0[Sp7S dX )P b PPq Y & P:3/[ [ 0RPp% 0[㨀KS000ʅ0K ( ,0 00 400 0 "0 [@#U   Pp :[SD::3/U jp!RHKpPH0[Sp7S dHH r)P L1p ;@P eSj&p!*R^KpP0[0CST`$$$L$L$p7SL [i0KR  0 PP= !P 5p'R R01*[3/0PK`$)P   @P  %yp7S K @P  0[S hp7S`& P`" 9pP ` !uP d9x\7QP1S\73\7 3\751S`\75\7!R R R5451S d7\7:\7:1S\733\71S\722\7\71d'SX010@$P` 10@1 C(R0Ǖ:0!R( Xd 0 P0  XZ㎠1!S|010 1 C(R0Ǖ!18d710QY\7|괁 XRHK pP K!l7 0s03(PK QP P6VUP(PKPQA0S hQ0 (KPPhUP (PK!R Q"010h80 S eK !03A0ASg|7SGpbp7S! cpP;1 3/4!ᨊR`HKjpP+X D!P` 03/P` 1HK6S03/`03/`1zS%$$$$$W !pP` 03/P` z03/W 03/W 0:03/W` $03/!R`HKpP R 0P` B [`"Wd'` (R(   .  .  /0CS`$$$$$1P000W 0810Q1P000K 0810E1P000? 081091P0003 0810-10810&ii8iiiiiii:i6i(i5ii o?) $A(== @j* * i8VbAi10s0300$!p7SS`1 C(RB8ĕ8p7SS`1 C("(=R 501*:1S\7 0 0\700S10t8d7!1R`1!C!R`3:P 03A0AS13/p4W03A0AS|gV4````````````lpK! `Pl0[ S`^P l [( 4`l`K! t7Sd( хl Kl K lK! ` 0BS` !R r39S P  00S u@ PQQm0S t R`Pc Xpo0Sà&=000 尀 0 P` 0 0I  P`Xp@:3/Vp20S&L`V<4  BQ  \74pR$$  \'\gS`4`\7|&0004p0000S \1 0`P00 d`PpWP@`,5! 0S d7 ` \7 ;\74` \7k;\74`\7` 000500n` 0 %\7P4`::\7\74`t7Sp7S `\gj  ` d `1|&S08 S`!V Q"` 0108h8t7S4`xp7S 8S`q d(,aV4``kd8,ah8V4``dt7Slp7Sh`Wc`Th7 \1 0`PI `C7HX ʀ0` !j`0 !! @aRa/#8`PWa/:0@ !N@0 !!\8 @P`-4P``  6X````(K```K @ @ p:3/&= p`0 $0H 0!0  0 0/ḩAlcc+c 0-L@P03/T:0iA jA -,14ML0,@K0$0 lPp0`P  (pt P*0  00  00$0 0`P(p_ Pt0  0h0  00$0 0`P(pJ P, $$!(Ks@MA`@A`@K`@t`@= -L4M@P, 4 <0000,pK00 00`0P0 $`(P P'>000`0  0T0 0 (0K$`(P P ٙ$K@@`@$GJ@IJA`@= -QLM 0 |)  e@QQ 0 0  P`lU1l#  0000U0SX 4H1S0 ʀ0@ !@0 !!8K 3h@&hbK8@ V 02S7S8@ =6S i>8@ 040 d8S8@ AT8@ 40Sd8000 0@夠K` 0 ` ` 0 p8`0"R0 p00 Xl W d8Tg d8iTp00Q0  Q0QS:*K/)K 0  ,1S o`K `fFa(KhK08K9K8K0 0K00K31\Kg0KO? 0cKd0 0F `0 /@1$K\ 4K3 4K>03K21K:0K8190K@P0 0 0e 0 xH40[4 S00000 0@80Ri F RdH  P80 1S8@ 4 0@ G-T 80 4 0@ T^0` !`0 !! R0Q)@(K踩A0  0$`(P P0`0\2Έ0  0L $`(P PLv2 1 0  0$`(Pͅ P_1Έ010 0 0  0L $`(P峅 PLDD1 (1 0  0$`(P囅 P-0 v>0  0  0$`(P儅 P00  "  0$`(Pm P <<E(K`@`@H%GJ@IJA%`@`@`@a@ a@a@t`@=c -@L5P% p-LP`@T 0S00`00C0  `:rp --LM00  K!a@080P0aaa0/ -L`p@@0S0PPe\ 3S80< RDPP0P0Pc0PcU 0UP 0p00PePcrP U 1 # 0@pPcU0(0``e(`u3 0-P UL@p1U tP 0PePP zxP 0000 0&a@Ea@ -L M1P@p` d0 Q)R 0,K d8T Wed 0(  Wlg 0$KYa@ &@^a@ -L M1@`P dx0 QppQ 0d8V f0' (@K ~ h 0q KYa@ &@ra@ -1L@  o i0h\a@ M-L8M01`P@p Q80 ( 0IW D`K   80L 0j, ( 80K0S0D K70K(@40 0@ 0$Ka@ -LM1@P`p dQl 00W00 ,@K \  X0 0Kk 0`KKa@ =b@/ -@pLpQQ 봂0 ((XU:fo9먉<8P((RW W U(XH0  U(X,0  B \75\7i<9 Y@48b@: p-LMP@`1 PV000 008)"V  0R 0 0 0 0S  0 83/KpMb@Tb@ = -L MP@+9P  唕`1 P000 0C00b0iS VqW1 P 0L0 !&P 0R 0 0 0 0S  0 00 K Kiskb@8=b@b@ -@LP1  02S :0S 3/08)"p`Vhb@H= -LM@>P 0v 2q"2l5|  #"0d ?d]P,1 0<00QO? (8@1KhIb@ c@/c@Qc@~c@c@c@ 0-L@Pg8PPPД000A  WP%@T0kb@h= -LM`P@1p O00 0 0p0,1 0>020p003/09909: 0O/020P1700 0 0 0@0 00!p R1  AqpP` Ki7Tb@=,=> -LP,`VF,T@8@@$S ,!R@p7S?\7@?  @&8p@S RP @\7   P @81S1@@I @=^T+-9O r3O  ! j,H ! a^ ! W?0 ! tJ?llh0 ! @H0HD7c@d@d@ d@d@7Ac@c@d@A"d@OS@X8@ &@f@ p-8@gSL g^P`0``e 1 ``\P1v&0R3 @ 8PUlphp=*d@@8d@ZYA=d@ -0@L83/0P $ .4P . h.AвA p-@L1  0:`k6 60SP 01S LD 0ᬒP0U(-00J6phG6Md@=Zd@вA} -вA -P`Lp:6dHP 0 |00 Rm00@O0C8#8S0 1 3NT 0` @T 0SW600ԨALcsd@L0 (8@0 (840 8,080880 01/l%D%8%%4%"0 "(0 />202/ -LM 0l QQ`'(`' $! d0h K1 -L@ \700 ,0, 0u\7=\7`78`7d@d@@= 0-@8LP3/0h p-LM@`QtVppXu" 0!0200BF/  0Cs rQ1 0 0pl 0*t7S@1@ F/ 00SKpd@d@jd@= -pLP8`3/@P\00\0  d p-LM8P `3/@P\00\07 1 4M 0 1d ,00d822d8,Ql,GqF L0003/0990920P100Pp e@=,= -@L`8p3/PP\00\0&  d8 0 0d822d822dd8,Ql,qF d8 99 p-@LP`4P4p 0-LP@P dFF 1S 3/"0 "(0 0> -p0@L0P`00    /0?d8,1,1 > 021031 M? (Q 4$Q 0 0 M1S 3/ -LM`P pS@P 00 0"0 "(0 > -p7L@SSp \7m in`P40 R0S P`dhRM4 -LMp7(`SS"H \7] i^Pp30S TAT/0 R0S P@dH0S i V1S1 K0@008 0PA 3 Ke@= -}@L`3p7S 0 dX P3Up7SSPP   1 K  0C000=e@0= -LM@P`@@c3Ap P,1 S `1 eK000, 0@T3$K_e@H= -L@Xp<  R 0S R`P```3pP  P 0R,1 S R 0S R P0 0S`@PUB3 -LMPp@`2 aP 0S  WP* @T!000A HP0S  ?P @T J0<08 0~2$K 1 Vb_e@l= -LMPU* p2P0S0S i VAT1 JTP 0G0 !!i2P i~te@= -LMi 0 p`P, 00 @P'83/@P\00\0  xd8 0 0d822d822l,}qF Od8 9918 \75 4 7J0X400!, 01 1 1e0_X J0 T0S Op0Ip0 W`B00S PZ R p0 0 07 0,  00 0 /0?00a`,a > 021031 0S 7!061 M? (Q4 4]$Q0 0W 0X(Ko(K &@e@e@TA@e@e@e@ p-p7L@SP m`^1088 81ddXP 0 02222000099,H0,1l8p7 S13/pe@j p-L M@PdP; ` P5 P 1  <10<1$ P 1 ?I\'l0h PP L  ( \7<\7Kpe@=V@a@ &@V@%f@ -1L@` !]P0p7S118888 871 PP[ p ( d8 "" 9910?\7?0?l7S.21p7S\7<\7?0?\7 000  Vl,Fqp lhL0!Q Qe iTf@=N_@e@j -LM@p7S9in K `5p0V 83/,p᛿ 0K1PSq@5PU01V&0R3 >K0S q K !RRPUq |7S 6S1+ "p7S \7 8S h Kii^ P068!R B8!0S`0>\70\7 Kic tt!i~ p0Pf>P8U5 ?? .-818c?(?CS#ʐ83/83/0hS0cS10!1 010Rc ,10 ,1 0 0 `XP`VU  0U P { Kgf@=~f@f@ -LM08`7lXc~8@`7poPUPǾv¾X0 Ỿgn`p崾0pp1 l᪾`ᦾxt 08lXdhqF }1 3/l8Uf@= p-LM07@P007p7S\70<\7000001 \7p p l0070`0 \0 1VU in P$/l/\70\7phrd@f@j@@A -@dLP h0d8i 0P (&008<P &0<8A -LM@`}pk/P.⾉$8PS@ ((X A@!Z!/T T X ẋ`1 F0(0C0 0$Kf@g@= -2L@P `00C02021 F 0i2Lap 02DQ 0SD1H1pL10CL1fV 1S 3/,PRP D&,PP`pP epPUhv8 ^@A -锠@L Pa.똀p☀[.`0S . 5/`V. o. % -t2!L@0SP` HF2 D9pQQ Q$$2Su :0S 3/08)"021  B 0C0SX? %qQ1A Fx 0\10Sd7  p7S 1 00!Y2,qQ  1A E 000S1  \76\7d7  1 t \776\7 V @-h-h@Ig@jg@6g@g@g@=h@h@Jh@ih@ -LMp"@PR`{20  Q0`920(0312  0C0SY08#8 S: 00 0O/00  -LMP`, p7, SS0040 ,00000 1 0  0"`p ,O@00S p7S2  P d2d |00 Rc d8T{ 040C02SQR L1S `8 31 8qD 00"DP 0SD1H100L10CL1c`DqW 00SXV 1 PD` 01L`Qa13/0S(Sʐ!1p0S  0h c,K0Sʐ!0p0S  0 P,2S  0 M81081X V80D` 0D0 p20H0 0S `[(H QLU0d@ T0 0T00H0DD 0a X0 ` (0X 0bP0 0\ L0 P` H0pWp!W4W d`P`; D bT OL0 101L` 0pbL 0\ \ 00(00P80d0QP `\ d`  \ 000X0(a\0L8000000C00 P`v]P 1h01o?  ?!1d]@(K>k@,= R@ =Rk@0=mk@ʚ;zk@k@k@k@ -L8M`,0 00 40 8 0 ^@P@៕@@@T@@P@,jdQ8  <  h @0 D  P U< @0Dp PpP pSPU \ 00, 0 0 ́0`` ``V`400, 00p U84 8, 00(Ko(K==k@ -LMP`14 8  p X=`0000("(2W55,K@P000u,$l, fq , , W,   0,0, 0,  c (  Q8<PD 8 aQQ0C 0  _@P8 0(00(0 0S ρ40p `080w80 @01011011 <l`d0 00L7S@P7HG0LGP703/ (KTl@=l@l@ -LM`Q@p 十1 <`000x)x9]0Wi Wf W W W PWW W\7,Kk$PP  ,1,0 , d(/ ,\'0,0 p7S000 l 0 ;0d8,F , K , %l7S!0000.0 "$ l, hP l, _P 210, 0000l, N, p'R ,0  , \7 ,, <70S,, , \7,   H8( HR , R  XYXd Ys3 ,K8 40 PP8 40 ,R㰐,岀,0 ,0H& ,, 0X0(01 ; 5z0:000(0Z101 101pX1 ; 0\,K=PP ,0ᰀ00(01聆018,KS45HH'PP p7\'S000 l(  0/  d' ;,  W0,0 , $ ,, d n,00,0 ,HF, !, .\7,   40S 4 S, Q , K, 00,0 0, 0c0(0j,K3PPG \'00 l 0 , ;X0,0 , 岀,0F , "1 1,0011, , \7,   40S , , 00c0(01 : 0,KPP000,0尀00(01011S :\ 0000@|0 3S8 <0SD00c08  0bS00S 00C0000 \PUT 0 `(0w80(0=00000 0n0  , R :01 :  190@001 PWp'R  t:0lp'q狱 0 ~1 0100L7SPP7HWX0P7LW娈0203/@ @(KYATl@=q3jl@l@=m@.m@Om@=TAkm@ (-L`"xj\PP @00(0K00L0 0p)  % p-PL!hL\@P  00(0;00<00` p -L M!=`p d74 # -50@,KPP 1S DD#0000 ,,0 , / p7\',S000,  , 0 ;0,0  \ ,    , , 00,0 F, mX2, 0S 0000,, 嶰, ,00p'R 0  0,0 !    B  ,00,0 01, \7   \7, 2\7\7 ,W, @10S,, , , 00c10 c( #R8 <QD 8   bR  R0C0 5[PP 0p(00(000岀4 $ ' # 북}(Km@=jm@ -LMf@ `P p7\'S000 , 0  ;0\7 / 8)8 S!  00"808S !  !808098\7 `\72\7p7S_\PF 1峀X0  <0S X0B  X:<x}R BQ0CS*phpp1W  !00 000q0<!\75\71 00x p'0S00C00S 0S 0S00000  (Km@=m@:n@#n@ -LMPP1L!`@RT10T11S =820 0T11 0ShW00q?Wp00H1GuS0 PDQpb0pHQLQPLQ1 84 0PU13/Pn@~n@ - L0LM@0 S R/S0S12HIJK0p7S8d82 \7 T1P10 d7n40m T  Uo)V)p9W9 S00 \0咾p7S>0S80 0 01n9U9 00 \0wp7Sk900k9\72\793/1  p7<0 S 9k9Kh]Kj(=8Ao@=?p@Vp@ 0-d7L@ f_~m0h0 -LMd7Pw N@ pW W W0!1``!a0 `!a0!`!a0|!`p'R   D  D  D  D000D00D00D00D00D1  0T00T!00T00T 00T00 000D00D00D00D00!   T  T  T  T0|0 p 0ԽpW@d8S  { (Koo(Kj=H===(=`==}p@=Ap@ -LM\7@(!00S  妽pQt7S|8(00S|8d000 080800 00l |(13/K@f@q@ -824ML 00 0(@K0$0 |P0`  (Pe Po100   $0 0(Pd PZ10    0$(Pd PE010    0$(Pd P100000Ѐ 0 pp 0p$(Pd P0000x000 0 0p$(Pd P 00vv$Ks@MAA`@or@GJ@4%Axr@0%`@= -LMP`Kp` %0@K@@K0000 0 p@ 00` 0 0\0s3P\<0@ R:408 R :,00 R:0P (K -L|M@pK`P` 00 (0K #\0 0 0 0py300 00\PY,0S0 0(K -LM`Pp QS St 000S 0@0@|@T @TP@Z:@@0SZ@t00YS 1` ㈁00눀1( 00 00u(KAr@ 0-  0L!!  @  HP @00S /P  0㈀ 000  | 00  t0P00 S0b 0S  /P 0Pt0S2 /P, P60P nt`F?P,0 0ft,0  000 k00 L0Rt1X4PLtU`(KAWb>s@7s@as@xs@s@@ -@Leha=$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩AQ0SS/////////p@-`0@p 0-Lp0P@2S 0C8#8S20S 3/@T0 00huh1cԨAx1c@% 0-d A 01100LP0CS0001000CS000h0A -0LP`eVp R 0 B RW, V* @T0@&  P  P @T` 00C \P\ 0 0eS0SX@A -LMD0@PS80`080400 00`y80pD`S0C80W  07sKs@ -0L -LDM,0 2@0 0P`| 0 00  @@@ @$P(`.a0 0 0 0 @@@ @$P(,`a,0 00 0 0 @@@ @$P(,0`a1 00 00 000 @@@ @$P(,4``T1 00 0 000 0000 p @@ @$P(,48``'>00 000 0  000 0004 @@ @$P(,8``|0 000 0 000 p000 @@ @$P(,4P8``(Ks@s@@s@s@ -0ML0l0h0 `0<*00T0) 0HH03@2tt44 ,0 KLcs@ @3cI@s@x1cs@ؔ%Wb Wb T An A -LM0  qt@ -L Mp 4 Y5`0 {  " 8 , DP0"@,0 40pkc8 ,00 q$0P(0,0040P(KA(% p-L`@P,\0"0a00000a0000001 @ 6@TphA -L@P _8<0`(0S p3/_0L`VhHb 0-L(0P@@T0hh1c -<%L0(1 00 000 0  $(`^P80 00 000 0  $(`^P 4fp0$180t1x1p0 0hl!S (KAh1c%Wb t@=%t@s@.t@9t@@s@s@>t@Hb -L@'H00D00@00<00800400000,0000h%% %%%%% % p-L@P 0`0S5/Pp00 R0000   /AWb0S   0  B /Wb0 00000000000/0 P  0 000CS00/8 p-0"L0@QU `$ P000CS000 1phpA -LM1@S Kv0 @0000000000040"0000000000001KA p-@5 L`P1 50 U1 10  0 p -0L`Pp0S @0 RFP 3 P 0S FP @TPU@h1c% -0L`Pxp0S 3 @ 0 0RQ bFP @TPU@h1c% -LMpX0S !pS *xQ P A10@`+0S P#$0 RP 0,0 0 000 0,0, 0QT@ eP@PU`V(KA%h1c -L@TP~PhP0P 0S 0\ 0S R0/h1c% -0 LPR`/ "V @0'* R! R EP Q EP0 p0*R:Y 0@T@@% P-LP@pH0S Q P `P (0S  S  3/(%8 R/8 0-3@L03b PEPUP 0S00P00C0PI0hl -LZM_KS/@  "^ P$0XP D0p` \a \ @\1 00  0ZO0@ ?D H04 /4 *Td < ?P@Q < @0幺4ppppiui iivi ~iip p-LP0 @ 0@R# /P9P\ R t pS@#*x AT P0R@D0<`@0S MP @TpA%h1c 0-L@[PP P 0S 3/000-0 0-LMK@CPP P03/K00p Px05#7/A -@p!LBMQP` T1QO    P@TVJlpEVZ6BP2  0R.JK  B먀K ` 0QB BP `V1\0U 1UAD Bda -(Ki it@(= -LMP1帠KUp@@`0  0[S3 Q  U@ T  P#P@D U@ T  PP@DX`VU0@@d@?(Kh1c -p3LMQ@` 3Q t3PTC:0T\3T=W 00@ 0 P 3T2@0T0 `VV`28pKP 㖩)0[S 㙮PP`F@VUU \2TD P2T@ D2T< 82T4256,2T 0012T. 2T 2'(2T2"#1T 1T 10S#1T11T 1T,01T 1T 1T W 00@ 0P:0尣 Z  0 Z 0 3/P  0S-   0@0S4P4T0  ? 0phTp1c(Wb -@L0S 00(Wb -LM@< A`PY 40S500000 pbpP( P40 S000000 5 000  ?  90 <4p#$4 8S0&070K(PK00e0<0S  0 0  0 0S 0PP= 5  Ƞb @ ( @{p00p5 000 p010 04#$48S   10030K$ K00b0<000H3 0 43@P$ 0>  ?s(b0C  `?`Ꮒ`(厂P S_ 0R  R(3 R,3R030X(3S ,3S 03S0O0pK`  # #Z37]!`V@p0K T_!0`@ D0t1@3h1p0`10\103 ֛D1o2814!201prLb20t21! 000 |x"R "0!"{"FP0K3 0$^03C lv$K蕰@f@{@h&%1x@Rx@Xx@`x@&fx@|=x@x@x@7@%d&&h%d%%(%+ -L3S@3}P -@L=30CS3h谇 -LMP@pc33`03=;3S  K@& KGt& p(K$ K 'K" KpK%pK#0K!0K(K K%  (@(,@T 3`\Kx@ -Lp`$3S@U"303=% (@ (PU2,7\&PX%x@ p-L`23@03= 20S  26S   DSU?0  08 #8ph@pP/3S/ u -SL@\ 3<3 oe _P PYU8R崀U``"p P 0 "0S㩐! U?P QPT )1V P`U3<3 -3L@SP43@1 R RR``* 303P sx|0 ?]cU4i蓂pQ Pp0 ` 0p t0` x0  0x |0x@ -LM@h0 R  ?CRFP 0S  0( > 㭂P  |= P-L 0003/,c -PLp 9@P\ `X nVPD 0<00+8@40 4000@0H00P L004\67;(00'5@z@Ĝc -L M@p`3PSy3@v R RRo 303AP 唣0x0 \딃UM4J00K  00 o0PU 0E,K f*0[0S*0K `0  0` d0* PE P(PX0X\ 0P 4 80 Pa7P4 80``d,H0 3/<00000(0 040}(Kh{@p% -LM3@Sc@`PA 1ppp `V3   0X3T3L3HCStZ~PL *~PPj `3SgD~P` ~Pd][Khg ( ?}P @lw 0 , ?}P @_wx #7>0000X1@ 0d00 ?T~0P0,1,   0`4/d3~`j}@:w [3@0;3!0 0Kh[0\Cl37PH E` >Y 7y43SKz@z@z@{@%p%y@ԨAd% -@L`SUPu1pX o0CX* d:10S`Q1X 1XK 1XVG30300SQ M P1. BRPG 4PPP? PP93 - RD#  @R D#   @@ T3D3 4PP S@P P PjiϖoiD5i6i( -L@/^o2SvpJoH -LM@P3SL@3SI F`VC P3( 02TcP3( ( P3B$ (0/00 00000 0L8P3i}LQ|P `sv Z q3;3303Q 0S000000C0(j3;302K'&/y@ -@LpᐃPX13U`;㲃3 UU$ p0  0p t0pul =ZU8h0  0h l0 y3 P0S li2{@ p-L MPl0 @ 0l p0`Z0K0 0`L(}L 0S CKpy@ p-3LPS!o@x@3Sx2 20S @30@30S  0 0Yph[pԨAd%$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A -LP/ 0-L@{.TPd0`30-0 0-@LP`3S023=3YP |P Pt4 cY{P Pt YY02P |P Pt KY{P Pt AY02P z|P Pt 3Y{P Pt` )Y02P {03P {030|30}w@w@w@w@w@x@ -L-a3@S/ ``cPwpQ3p@ zYo Hw0a3\30CS\3 p -LM0   s~P =\30\3 -LM`\ K0KC4@?0K KAB$0 KKK 0KK k}P K -@L\30CS\3hɁ -LMP`|-@pP-?XXPrtt Xt vP 0 8 ~᷏  6pCl30t3 /{P UXr 5 `?`}{0p< 2 0S;93`q{Px 6XS 0R  R2 R2R2`0VpT=0 00Q?0`k ` 0`F*0K0 0? 0`90 `3(t2[#4S  <0``&wt 0<`Knt` <0  0`_t` 0`Ut 0`Lt H0`Ct t0` :t` JJ 00 `(*t3S& 0` t 0`<t H0` t 0`` (0  0d` s` H0s 0? 00K`  000 =000K# W @1_LR31pb01010|10x100@2l12h12d120t2?@!@1@!@1 0 0tx"_R "0"wP0K+0 _V W0a3% n(K蕰@f@=X &1x@By@  "``07@&&&P&&&&P&&&++& 0-LM+2/ VUPP@ 0A_S\ S P 00 PU 0hV0Vy@ -L Mp~+`S@U$`KⲠfh 0PT 0`@` 0PV mV$K! ky@ -L Mp`P+`3@S01K3W 3W ?0 $ P 0P0K 0l0|`` 0PuV 42V1[0C8ssĕ[K }y@P/`3S/ pm 0-@LPt20200 0-0 L|#|"_RxBtw@T~tP0 -LM`S0@U(0 $0 I$0K0 0"1[#0 1K01K,8RpU`` P $ K = P0V3 0@P`P U3t <3(0K001[P 3 <31[01KK  -LMP@3p@ `3S?0 1$`K 0l 0`0 33CSwP wPw4 wP wPzwSU7i3# 43 `|3 `v3`E p?00 2 0S?0# 00 \z" ?vP @p % />v`P3`1.0000 03wv3@0;340U@pp T&K0 33BSz ?``az@z@z@H&ԨA{@ -L`@P*0pV P'3(A0@S AS S  -2B8# S32  G4P(00Siϖo P-L 0003/,c -L$M@4 P`3< S8 3@ R RR  zP Po( aTZtyq,0K xwp/0,0,0 P X70K 4PH2[ᰃ[,P 0(Sp*U0"0#Pc ,P %, 5P!!R0`P U$X MPD 0<008`40 4000@PHL00 `-`0  0` d0!000X0 0X \08 P (P]P,f083/.,0Sp34 <00000(0 00v<u(Kk{@ĜcH& -LM@?P  |3Sc 3=@S_`V\ ⿯$ 2(pK 2 X2K0@2K3( 0+(``PK0 2K`( 3+(` 000` 00 03cvKuP 3;3,30,3@T 0S000000C0(,3;302$K'& -@LP`3S.U` UU% p0  0p t0pnp BSUx3S;30S ^h0  0h l0hi2{@ p-L MPl0 @ 0l p0`Sc0K0 0`,v 0S -AKpy@ 0-PPL `3SZ@q|3S 2 20S 0|30S  0R0h0ԨA$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A -L 0-L@'TPr020-0 0-0L"R @l P lp E'0hP0y@ p-0@3LP u`P 1'Pm $Pt`P $'Pm vP02P u`P 'Pm ePt`P 'Pm XP02P |+02P t02P p+02P t023=3pyw@w@w@w@ p-LP'@:P L2`S 3@ P 02+p -LM0@!<   wP  0S$P= -LeM`P&p@PQ&R"n lR,n0X 202!0  \wP??㳀22$ zP0, P 1 tP1  R,  ",  0 XP t`tu` 2avPDt뤢ᜢtP{ 0 S00S" 0S"S UQ0X2s 2s`1V2sT 2spO $ nz0P nK wP0K P uQ*0(K0`   %+Kw0`K  bQ030@p00000%  | 020 h 0PPP(K蕰@f@=y@y@y@y@z@0z@Mz@kz@LcXA.&P/&"& @ P-L 0003/,c -PLp,@P%N"`X EJPD 0<00+8@40 4000@0H00P L00g%(N)7;(00@{z@Ĝc -LM@0,0 2P`So3@l R RRg 2S?%p l xNVu2`202@",0K s?0,00C,0 , R2 `=,0 S`0  0` d0"X  pX\ 0(0 p g7P`0  0` d0,P03/ YD0 00000(0 00rq(Kz@'*& p-LMc@@`i`2PBSbbPTrP t$rPF$X2SGBrP ,rP=$M*$@ok  ?q`P0`/0000 02rq3@0;3$@Mk tMKph0B2 7P *>Zq`P Kpz@z@z@*&{@ -PL@ᬢpZB1`X 0X 0X.303i00S)% 0. BR Q4P IP3A0S @S D ~4Z iiDi -LMP@2SIF`VC 2( g'?00 (e K(0! 0b( 00 000 00 02qpP 3;3202Q 0S000000C0(3;302K'0& -L M@`PᬂXG93Up;㲃3 UU; p0  0p t0#`_j LU't$$0K0 0q P ' P$0S p0  0p t0h0  0h l00S X K.{@$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A -L0@-DP0  @#@@Q0$ R; 0 0-L@0#TP0\30-0 -LM\3S@K KKB$A KKK0K 0KK rP K -LM\CT?00K;00KK0AK0K@K@K@KK KrP[0[K p-\3L@S$ix``PoxP|`kPomxP|` ?x|oP `0  0` d0p -LM\#@R@00K 00K K K K K K KK|rP |"K>jKgw@ 0p-`@L3 l)MP p`P ^"P+i Kp`P Q"Pi lK02P p`P @"P i ,Ko`P 3"Pi K02P p`P ""Ph tKo`P "Ph gK02DP &0D3<P o0<30P &003(P o0(33=3pyw@w@w@w@w@x@ p-L"@)EM7dd]3S 3`@ ^P)!0]3y dp -LM`p!P@`|LtEMAi` 0MKi akP4R (2 p ="p2#|Cx303C3$ K8pPP Lo$op$oP L` 0R  R2 R2R2P0U?040K2030K 0. K20K10K00K/0K-0K4K, KPqP P!J#,pKPd L 0@ D00@30`000003! L`JT'! 04)NL0]3 d K蕰@f@{@5&h4&1x@By@G{@7@F&l?&A&P/\3S/ 7c -LM0   qP HA P-L 0003/,c -PLp/(@P ,J"`X EPD 0<00+8@40 4000@0H00P L00 4 J2%7;(00I$@{z@Ĝc -LM@0,0 \3P`Sq3@n R RRppg `30`3bqP `Og 0 `I`sVCq@,0K n 0,  ` 04 S,0 `0  0` d0&X0  0X \0#,0p p0(0 b7P`0  0` d0,K03/ <00000(0 009n!m(Kd{@<& -0LM0K\CT?00K;00Ke00K0@K@K@K0K@KK KpP[K -LMP@\3SLI`VF ,3( 0_#0c(0,#0(,#0A00``00/ 0(,3m(lP pf  "I Rb3;3T30T3Q 0S000000C0(3;302$K'@&{@ -@Lp\PX3s3U`;㲃3 UU& p0  0p t0pUf dHUph0  0h l0 # P0S ji.{@ -L MP@\sW!l0  0l p0T\H 0K00 `(m( 0S <Ky@ - LM@0K0KK0zKK0K0KK 0K!oP K -sL@</  |/s 00@S(0@S8RU`` P1"V P`U|s (1"i= -LM\3@Sc@`P9" 1pppgf `V3`   04303(3$CSe@lP( lP,[(Fl<3SZ,lP< kP@P<2lGKh; ->wk`P @Me D ?hk`P<0001`/ 0<@3zl<bk b@/e G3@0;30 )0KhI08CH3c7P$ ?# ;" 7 32SKz@z@z@<&{@ԨAX;& -@LP\cV`c1pX0CXQ*!0CXQ d1X \1XJ303#00SF B 1. BR`< 4P``4 `P.3 - R#  @R #   `@@ N33 `g2iiiD00@ S/A0@Sa@P//$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -LMS@APAU`pK2P+SH 40㛵0P! 8  B8 D R  %0K %0[0C S50 `10  0:00U%0U  U0U 0U  0  0I 0 Q      R@ @@  $KGdWb{@= ݆5LcA3c p-L@Po 0L:`&b`B`B0```BS :00@p? Wb 0- 400600,10< @00L L0t0@0P00d 0L P00 0004240$1(0 0(0`P4B @T  P  P`0TS 4` 0 820C82$K 00CS 0 ꈴAL/82 p-QL@P`+ N0CQV 0QW "0CQp21QT 1QhW1Q 1QaH3A AR 0303/PP`00SWS<2tp10-SO SM4PPJSPG PPC3A0@S AS S 03/6L2S 3/P4P.03/P)phphNH"R 0ph" 0S 0   \ P  phPPPpi6i(iiD5i(#Wb$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A -L 0-L@nTPW030-0 p-0@3LP f`P -P^ lAe`P P^ <rA02P f`P P^ aAe`P P^ TA02P lf`P P^ CAe`P P^ \6A02P we02P qe023=3pyw@w@w@w@w@x@ p-L@VPP \C023S 3@ r` 03,p b -LMK [ K -LM0   hhP h= P-L 0003/,c -LM@`P3S3@ R RRpp 303?0K#4K K0KK0,ĠK 0K0K Kf K -L MPp`@PHA@GBC^, 2BM^ c`Pb 3<K p?phPd00[/ [$3R??s3p00 P x@E] \$|->p0 0pP e@2] 3 0000zpP R@] ? ^` _P/dP 8x? ]`JXG(dp(dP( UAu 0R  R2 R2R2`0V2S 2S0o0` 0PN0` VPLA:`p, ^A !0@ D01@31P00000  }tPT 003; X( KTd`P{ w$K蕰@f@{@{@|@=<|@a|@=|@gw@|@1x@By@x@|@ b|@7@8m&o&dq& -LM K"$@0K KK 0K K K K Kte K -LM3@  3<3?   :? 8R U ᪯``p W  P iV00Pp`U3_"<30  008 #8pO $Km -LMs@@p 1$`K 0P6  `00? #   ? v@ r022BSTbP TbPJP ubP EbPA1>2 ?a`P @[  =a`P<0000`/ 02ba @}[ l>3@0;3+ 022BS "2SKz@z@z@a&{@ -@LPcV`b01pX0CXP*!0CXP `1X X1XI303F00SE A 1. BR`; }4P``3 u`P-3 - R" ?   @R "  ?  @ @ 32 `2iiiD -LMP@3SMs{J`VG 2K 0a(2( 0q(0/A0?0000000 02b`P` pZ ;=3;3202PU 0S000000C0(DK3;302Kxp&}@ -@LPsW0c3U`;s3 UU# p0  0p t0pnZ X<U(d h0  0h l00S mh.{@ -L MP@sW!l0  0l p0p\< 0K00 `a 0S ?Ky@$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !!Q@-00<@\0`@t1c 0-PL@Q0   R Q#S # ( 00\04P0S 00C0S L 0  0h00/0/0iϖoiDr&= -p0LP@`<3 (P 2 003/W P 4 20S N40 3Ad0  0d h00 ( ? 0q R R7, R  10S  10S@ 10S #;0,0a , R  l10S X10S -0,00~@$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A -L/ 0-L@TP\y0l30-0 0-LM@P l3S@K0KK0K0K0KK Kp#K p# =^p3P0CSp3bK0 0-LM@P lP?KKKKKK0KKp3K0p3^p3P0CSp3bK0 -0LM@P0K lCT@ K0P@[K 0-lCLPT   O }@T0hx0' -@02LP$09P A\pP `T ,7n[pP `T 700P #\pP `uT 6P[pP `hT 600PP 0P3HP ([0H3<P 0<34P [043023=3yw@w@w@w@ -L h3@S0 $8P Pp3p0CSp3a8\P@ uo VQw0h3"(P9\X 0-LM@P lP@KKKKKK0KKp3K 0p3]p3P0CSp3{aK0 -LM0   ]P ` > -LMP p@Pd7\8|T`H k8T VPT3` |3Cc2 C3c, Ku[P S ,0p0 0  ]?[`` ` [Pd 700S 0R 00S 0R00Z 0s 0s 0s7i4`K 0CP 7 W 7|!0\@ 0e  p~tT1o\8H1 1<1t@x@K{@7@<&(&&$&p& &&ď&&t&0l3S/W -Ll3S2UP -PLMPp`- l3@S(U&p3_0p3  @ r0 `K  KFd`K f   _ p30CSp3 `K p-0PLMP`. @lP(U&p3_0p3  @ 8 4 }  -0  KOp30CSp3_[0[Kp -LMl3@SR  Y  8<8N F 5$PK 00K 0RpU`` P K?01 SVC P`U8<8 $ K0KP/l3S/ M -`LlS@U p 4P@ \ P-L 0003/,c -PLp6@P 34"`X /PD 0<00+8@40 4000@0H00P L00 4497;(00P@{z@Ĝc -L M@p`l3PSR& RR L0P0L0m[P LZQ 0 3LUdp30p3[p30CSp3Z^W,0K X P, 号 0 04,0 0  0  0 06, \ 0  0 0( 0\L( , 4 80 G7P4 80.13/ <00000P0 00#Xp30p3Wp30CSp3p^(Kd{@̔& -LM@PlsW`1(K 0 0  0 x3   m0@3<3430CSRWP4 "WP8} 4RW dH3Sv8WPH WPLlH>W 2FWR0S 0SAl3S;p3 0p3 0xVP pNP  0hVpP<000p1p/ 0HL3zWHbV b /P 02pp30CSp3]W  3$ @0;30p04p K0DCT35L7P    RPp|}z@z@z@̔&{@&ԨA -LM@Pl3Sc2S` s{]`VZ 83( 0g  -LMP`p@Pd%1\1M`H 1M OPR3`|3Cc3 C3c, KTP L ,0p0 0  V?cT`` ` _TPl $100S 0R 00S 0R00Z 0s 0s 0s1kk4`K00.0 P 0 W 61|!0\@ 0 pmT1o\8H1 1<1t@x@K{@7@&&x&|&&|&&&l&d&0l3S/TP -Ll3S2NP P-L`Pp< Nl3@S7V5p3o0p3 UUU U U Q0Uth 0`W.X bOp30CSp3h[Y h7F >@B 0P-Lp`: @lP7W6p3_0p3VVV V V Q0V | 0t .ph-x'xp30CSp3Y,7F >@B -l3L@S`X   \ 8<8  o  R`Upp P P @`W PpU8<8 X     o&*P/l3S/ F -`LlS@UM p 4P@ r P-L 0003/,c -PLpE @PB-"`X (PD 0<00+8@40 4000@0H00P L004 -H7;(00_@{z@Ĝc -L M@p`l3PSR& RR L0P0L0|TP LiJ 0 ,LUTp30p3Tp30CSp3JWG00K Q 00 垰0PUPE,K 㕰+0[0  0 0) 0 \0P P(P 4 80 PW7P4 80>1 3/O<00000P0 00BQp30p3'Pp30CSp3W(Kd{@& -LM@PlsWM`1 pW0$ |z a3 p k R3  a H0@3<3430CSfPP4 6PP8}H 4fP(H3SvLPPH PPLlHRP,FWR0S 0SAl3S;p3 0p3 0OP pbI d 0|OpP<00041p/ 0HL3PHvO vCI +pp30CSp3VW v 3$ @0;30p0-hp K0DCT35Q7PL@ KPp/z@z@z@&{@Ȯ&ԨA. -LM@Pl3S[2SX s{U`VR ( 83 |  | 0L -LAMp`렃W@P #0L+P /*pP h+0=L30S 00#0pP P #0 4-8R(0 ( <3/ P* 4-8=<RX  2 | <00؁@#ED >߁@ -LP`@)P t1t + P `h* 0(0 8- 0<=0S0S(!00SpW 4-8R(0@  <3/AP0ppP+04} =' \0S`+P ) 0P 9H)80  hl+ꕰ@!ܺ&'@!&#)@@ @!$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -LM0000  0 0 000000 03 KWb -18ML@ 00pl 0 0@ @@@ @$p(D1 P00 0 0(P@ @@@ @$p,p0 00 0 0(P,P@ @@@ @$p0\000 00(P00 0000 0,P` @@ @$p4CP0PP00 0 0@@P$Ks@s@X@Ax&]@Wb --LM LyP04 @,0 `H0  0 0G0 4# )Y *2@ 0@0@0 0S 0S*PP@ lHP`0  0 0 0 p0jp0 j %P H`p0  0 000j00 00 0S Sj S 0  0 $0# YuT7p0S X0sP0 07` R0600 000   &Q F`p(0  0( ,0Ix&x @@T0Sp&p@# QQQ < @0 f2;< @0@TQcp@%5WZ00S X(@ 0@(0,@L5婐@ppW0 RBp? Q-P)  P PAQ&&&&& Q < @0 8 e ѱ< ` @08pWPQ pğ P 0X P8 00  00 4083 04 8 < Ry $(,Sp 0S 0   R 0SS L M N  O000@D0H0L g20q0S 0S pWtB00@0  0@ D00S :S0 0S0| 0z8 y00  00 408y3i 04 8 < R $(,S lA`pU80  08 <0V%J 0S 0   R 0SS L M N  O000@D0H0L 00q0S 0S pWp@00@0  0@ D00S 3& 00 4 Zv(KWbܷAWbLc1c -X0LLL0L0 R  R 0S0hcܷA -LhMp{@PL 41`P0( `0`0(000 0PPPP 2 .0 `0C0`P"PP" 0 0C00wPK00 0\@P0 0x0K0K00~PH0 ` 0H L0$KȜcl2cWb -AL0SB 1!00 @@T`0SP%P@"0S 0CS0 0S0 0Sr 0!@0T`SP@$(pU0o1ccLc  BR/ $R/ #/0 0S/A p-L@000P4S1 30 +Q0 Q0SP 000 0x0 R0`00` `oc2㤯<0`00p pܷAWb1c@0 0S0(S   Q/ܷAWb$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A 0- @LP៦0  0S:0,R310 p-,@L`@  0p 0# l0|00P# l|S,R  U,00,0 03  JP,00,0p`PUR  ;,00,0pKc|0M0Sl00HD Q `0S 0PL Q `0S0Ѝ/AKc0SSM PP Ѝ/0  S\ 0`00/S / `8 -8#4`4#M#(L 8@ #$     #<"KXbd@`0 0 Q  P<@QP0` RS 0/Kc1c -L @3h&,0@Ms 30 | 0 QlP |P TP R LP DP 0SЍ/A -LMp`0@D0H0L 10Q0S 0S PUY000P ť00 `DD 01S0  01@0 0A0 0 10070K080K8pK04K3Kᕥ 7 ᦸPP 0hS   4H0P  O(K@PLc1iKcLc -LMP@`F4Kh0pi0Vh`SX0S\ \ \0X  hI2l`凭1SX01X \ l~Alz2 01\0ݷ`PuX 40K08h00l0  R<"$PH H Q H P  H  D P 0L0D0403 P0L 00|0H0D 00T0 xh0 y0S]  l0|00hp l|S, 0ښ `pW_`P,0`0,0 V`3S/0S,0 K0 %X0hS\ \ \0X 40Ki0S\0lXP1HSX01X \ lܬAl ج001\0 KLcKc p-LM@j0`0CS00(PKS   \0  B 0'0K0(0K02K0 $0 (  x3KpLc2iKc 0-L@ PbX0S\ \ \0X 哰` d0RD d00d0` P 000CS00Ȋ0hKc -p,:LMQ`P :Q:9Q 9VWq U - 9V 1CV 1CV0  0S^0S[0SSW0SSS@ TPL9V' 1CV$ 1CVD|`K@ ባ ߣ ۣ0S ԣ0|PKK0K40L0K z,K i|K e09 !18,  R|  P(V 1!8|0 0 @,| \S ( R @T7hV# h 剣 xx 傣 %@ Q R00P 0S1`0``K@   ` h \3 xx UPK P  0 -`W  0女`W @00S @T@`6VF 0CV> <6@6V9 0V(6V 0CV*!1CV 6V5V|Z1ᶑ I50A 0Sl0 S X@T5V  VVTH R Z000S/`DWL45V T5%VV1 X- 00` 01P#T: @P7`! 4` d @`  00000h 0x 0000803 p0x00y0bX0 0X 00` 0PT 3V  0CV4 3Vk 3VS3VJ 0VQ3V 3V 3V`3V 0Vh 3x ₴3  3 x 00D000E00D09 03( P0|00000S0 R@@00000jpp8 0H0S 0S OP 880S L< ,0,0 H[0[S"TK ]P ,0  ㇉P 70S L ,00,0|\Kh0s D'   0 00s '   0 0 0 R  R0SDX PP X! UD040P }0S P,00,0W 6(083SBX, Zd00d %؀ W@W P3Sp$@pK <4K480 $040 040K巛P,  4i1   0 Q\5僤0@pK, KCAP 40S  ,0 00弔0S0 K 0p0K w KpKxK0 K | Kt 唀KxK` 0 lP,  !P  XP $D0S ̂DPȀK4 ጛD00 0 3 K  Đ 0 ҃P, pK, K0@P| 0S00  ^ [3 3xK 0 P, K 0@P 20S ~,0 0000S0   pK70p0K0pK o0Ka0KP, l ᤆP pK ۡP D0Sh ODPcȀK4 D00 0 1 K  Đ 0 UP, BpK, K0]@P $10S6 %,0 0<0d,00S0  ZP" d0 0   W $ R(pp0PU 1[gdrW ,@@(K;288aN@@@A4A3c @b@|,@ԨA?ac`c̆@ -p8LDMQP@` 8Q |8 x8Qt8l8Q `8Q 0T H80SX  ÀP8T 0CT 0T 0CT7T 77T 7T HW  0W 7T0CT*p7T d70ST7T$7  D7T0CT0C2:(7T 7T h7T70CT*6T0 T|6T 1CT 1CT 06T- ]1CT) t6T% l6T6 6T 0CH60S/ 6T 0CT*0CT%:0T06T:0T0TX 0S R {PPB5T  0CT0 4T!L5T( 0T$5T 50S5T !0T X !4R/PX 4T- 11CT <4T4T 0Tx4T$  0CTl4T& 0T-D3 |⻘`☀00` D1 `.:1.叙q 0@d0 `@ 0A0S@T dSd@K  0A0@q 0@d0 `@ 0A0S@T dSd@K  0A0@{d0l0t rPPs@Pn XK0 ޘPXp jP8Ka TK 0L S,0[0,0Kd0@,0[  00,0Kx040 |0X`K00 xP( ( Kb{P4(0Sl+ R(00hh0@ 810S Q{ P y@TP hPU z -P1PPPPP P$KUiikiii Mi WiH>iku$ijuP imiHLi0?Ni0Pi Ji(KiiileiHdiH@%i ni i ߖ>Si i Ii !i Ti >@ag@ -RSLNM@\ pPleh4Q 1CQ 1CQ0  0S0S0SS0SS`V3TH 1CTE 1CT@I P @V@0 R0S@؀K  R NT00  00 0S K BT00  00 @K0P0K0`0 \0 0\9t0  8K  ̗  `XK X 800X0 T 400T0 P 000P0 L ,00 L0 fP (2T ~XK   `HKXK"0SX   ፗH 80 0H0 D 400D0 @ 000@0 < ,00 <0 4P `VKT1TD@ D ŗЖ@PC3p || ṗĖP6 V00+VK J ᠗RKD 圗KK || 啗 8 KK⎗0\P0 0V/K00-@1@@@(K複@ikiii 0@-1 0;Q7 4@Q @PU P  8P0 /P0p T &P pWPU  㹕L00S < S HK 㩕(K??3c8aR@ -0LM}0$PK 0p00c 0b  0 +t0@ 1 P.`ۛP & [@T 0垵Kca1chcaԨAx'h1c -L@ 0P QQ U S SPP !S 0SU` 40`GS SV`##S6 S SGS S %SJVVGpp ᆛP?  ရP9 V #V!P000 00 00 00 00 00000VP0S  㟔0000000 0#0  $ HPTA\A -LMMPNK @`x O0'1K0(1K#D3 1 01 1 41 mpVP 30SJ GT HP20S< 2~K@T 6P 1[ 20S)  0#@TpKX +6hD2@ 0@K@hjhFK v1[000#1K10S  10S ![1[ ![ ![ ![ ![ ![ ![  qNK 㴓P@P00K00K`1Kp 0K p p e@P /T8 00S4  0I.``K0 ǓP`P S\KJK@K 0`S40[`PK040K40[040K0<0 80 sP Vv@@ K8a|@@h1c̈@ac`c@*@`?]@\? -QRLM@P0K `S \ .\ P a?R=t`K ! KN!0[ K0 T C0A FR ``C`VpKX ]hg!K tg4K! [tKogg K0000<000 p☓ P K -LM40@Sy :0CSu@0S <0 S*10Si 940Sc Sa 38J|10SZ t UB \q8K PP9K   FN1hKK`KpKKKo`KVKlP XP `KXKP tP `KZKP 0@0 <0 T0 0T0  0P U0P h R h <\00S P 1P (A(K8a@@ ??#@TAu@ -LMP?D_t! 0 @hahq,0 N00SH0SE 00SA0 S   8Z,0 D }0P 300 |00 8 C800)| 0T000 R R 0S P, 000CS008y@Th8(Ko`_<&3c8a@ -LMP1,K@` .p+ PP U &  w. Y oU ,K ȘP$K -LM 00db -L$M0,00@0 'S4 (P(@P 0;S<@P{ 04(0 ` &bpa(  p7Pg `8ix)#,#4i8x#( < #< h't)8 j@0 PD` H L ,@ <,L 0`P:  P,@a180<(00@  g8'8@#4g4#(@#$0 #(#<00 00( D0\ 40 2/`P H0p PY,@`,@ `,@ P(U $(KP ` -LM0 0   K0 Z Kp*' p-LM0P`( R0@01K 0K1[#ĠČ3 ȠP,Ƞ 0cK  PK  !K0 R0![  0K ,0`#,`Kp$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A 0R0S 4  0 D R0/0S/4{ -<0ML@00 0$ 0@@KŠ@Zb -L@. $020S h'lAL/'0@- R00P 0P@` P0@00@- R00P 0P@p P0@0 -L8MP @Z R R R RpW SRPDK0J@ZS  L T `h(&h <K KZd2``0P2P 0PpX0 ` 0\0 0S{TQ `0Sd0Sh0Sl0S4<P 408P   ҖPU ZP0Sp0St0Sx0S|0S p  㻖P ~5` L0r03Q0S (0S L0:0Q`<K 㡖P$ p  㛖P%(0S" V 4S<0S80S40S00S `<K ざP X 4S R X2/p\PP0Uzp(K?8/'d? -L@`0p R0S Rp (0SU00 5P0S -L@Pp0`S 4P D0SpW -L@M0`S!4P|@P PpK4 ]80L0 004 H0 0D0 0S40 0000 0 yzK -LTM@p0 8T#8l0 $00$0l0P#$$0(p"(0a0S4l S~p0St R x rP  rR|X` R>d R;h r P  ^ R[XX rUS t Rx0s|Xl 0R S+ R2Rl0S0S!0S0sP0 /S 0S 0S0S 0sP0 S 0S` | l|P p 0X0R0S XX p`Vvp0z03W0ST $0S 0S|  p 3/0t hKx0 [2l SW0S 0S0S ``V``0S0S0S0S 0S0S0S 0S 0S0S 0s$0$S 0S`x Pp 0V0R0S V pVp $0S 0t3/PW h0KW p(K 0-L0M0PSK4@8P 0S0 (|0Rp 㮔P xP2zP-p0St0Sx0s |0 # K$PK $ K K 0 ӍS|0S 0?0K0@0K8KpPK< ( @KxyK0 -L M (pX"$ 0` $ P,  0 4  "@ 8 0 ",< D` ,4    ) !#$$("(  `AC0S>4 S;4S8p0St0Sx0S|0S, p P&`0Sd0Sh0Sl0S ` P8P<Q@ r ,0S0\4pP0  @TX0D` $ R   P<0S 4% R 3AH0S 0S,0 T,00V6 `V3 0S0S0S 0S' xPK \0w0K0x0KpK,Q   P xKcPP 0 100p0KT,00U 0S0S0S 0S,Q 0P L`K0 K P3\ K@p |  P \c LK< K ̆P<00 RL0\K,8 K⾆P\K 4 K⸆P408 R00S0s   bRLKL 㘍P Uw RLK⬅ L00 姅| 0`S 0aS{]| 0bS0lSUq0s   bR r aQas aQ0s8  aR6 ,  0QSLS, X<0s D< <0S< S7S 03 0 3* 3 LK0Q0Y| 0L0 40| Z pD0 0pS0 LLK P@T7U 100PLPP(K3c4A8A -LM  KP TP/Q1 00/A p-LM`P ,P(0@  "P PlP `!Ka`P P03P01[01[#$44Kp -$0$@ LH 0<02c$2c -L1LMHpPX ʀ0@ !&@0 !!Y-@W@U00S%U00S `8K  㵅0T0p p,p 4` p8K GPpW80T0  y 3S R 0@ !@0 !! (K踩A2c -1LHM0SP-bd@KH ԅ(0sX $PS0@ S  0@$0 @ 01U,1% d`K@p$P  P, P4 @T PH P⟅0@   PP dPK`@$P  P, P @T R( 0 K蔊muH2cA 0 -0L 0. 00 00(0 0 @@@ @$p,`b00x>, 0 0 0\> 00(00 @@ @$p,`J(>'. 0> 00 00(0 0 @@ @$p,`3='. 0= 00 00(0 0 @@ @$p,`'>0x= 00 0`= 00(00 @@ @$p,`,='00 00(0 0 @@@ @$p,`'.0 ,< 0 0 0< 0< 0 0(00 @$p,`< 0x<0l< @@00 0 0(0 0 @$p,`<0,< $< 00 0 0(D @@$p,`<0; 00 0; 00 0L0(00 @@$p,`00x;, 0l; 00 0 0(0 0 @@ @$p,`w<0 + ; 0 0 00(0 0p @@ @$p,``:+00 00(0 0 @@@ @$p,`K: 00 00(0 0 @@@ @$p,`64: 00 00(0 0 @@@ @$p,`!9 00 0 0( @@@ @$p,` <09 00 0x9 00 00(00 @@$p,`0089, 0 0 09D0S0(0 0 @@$p,`'>08 x8 00 08 0< 00(00 @$p,`8 00 00(0 0 @@@ @$p,`88 00 00(0 0 @@@ @$p,`<07 7 00 00(0 0 @@ @$p,`'>07 0|700 0d7 @00(00 @$p,`j<047 ,7 00 00(0 0 @@ @$p,`S<06Ɵ 00 00(0 0D  @@ @$p,`;6 00 0 0(0 0 @@@ @$p,`&<086 >00 0 0(p @@@ @$p,`5 00 0 0(, @@@ @$p0`5 00 00,0 0( @@@ @$p0`H5 00 00,0 0( @@@ @$p0`4 00 0%0(0 0 @@@ @$p,`4+00 0&0(0 0 @@@ @$p,`T4 00 0(0(0 0 @@@ @$p,`4 00 0)0(0 0 @@@ @$p,`{3 < 00@0 0*0 (0 0 @@@ @$p,`d\3< 0@0 0+0(0 0 @@@ @$p,`O 3 00 0,0(0 0 @@@ @$p,`:'>02 2 0002 0; 0-0(0 0 @$p,`X2'. 0L2 0.0(00 @@ @$p,` <02+00 010(0 0 @@@ @$p,`1, 01 020(00 @@ @$p,`<0d1 \1 030(00 @@ @$p,`02 0(20:0(00 @@ @$p,``2 , h"0080 0<04  (0 0 @@@ @$p,`2, 02 0=0(00 @@ @$p,`<0 3 030Q0(00 @@ @$p,`P3 , 0<0@ 0>0 (0 0 @@@ @$p,` <03 0?0(00 @@@ @$p,`u3 , 0<0@ 00 (0 0 @@@ @$p,`_D4, 0P4 0@0(00p @@ @$p,`J'>04 040A0(00 @@ @$p,`54 , 0408 0B0 (0 0 @@@ @$p,`<085 0D50C0(00 @@ @$p,` |5 , 0408 0D0 (0 0 @@@ @$p,` <054 080 0E0(0 0 @@@ @$p,`$6 , 0408 0F0 (0 0 @@@ @$p,` <064 080 0G0(0 0 @@@ @$p,`6'. 06 0H0(00 @@ @$p,`<0 7 0,70J0(00 @@ @$p,`00l7, 0x7 0K0(00 @@ @$p,`r007, 07 0O0(00 @@ @$p,`\8, 00(0 ,0Kp @@@ @$p,`HP8, 0, K0$00p @@@ @(`58'. 08 $ 08, K00 00 @(`'>08 08  0; 0$ , K0D @(`'>0D9D@)00ˌ $0, K0D  @ @(`9D'.09  000$ , K0 @ @(`'>09D)00 $0, K0 @ @(`>0@:< 0@0  0( 0  @@@ @$p,`<0: ( 0 ,0Kp @@@ @$p,`'>0: $ 0:0, K0 @@ @(`(K -54ML@ 00`p 0 0P(` @@@ @$pi4 00 04 00,` @@ @$p(TX4 00 0@4 00,` @@ @$p(? 4 00 03 00,` @@ @$p(+ <03#00 00(0 0,` @@@ @$pt3@p0 Sf1X3`00`(0 0 @@@@ @$`,p 3 0300 0 0 @@ @$`(`,p2*00 00(0 0 @@@ @$`,pl2 00 0T2 0 0(00, @@ @$`,p2 00 0 0(0 0 @@@ @$`,p1 ,0101 @00 00 0 0(0 0@$`,pl1001 @@ @ @6":0& 0 (0 0$`,pm1 0000 00(0 0 @@ @$`,pW0 00 00 00(00 @@ @$`,pA(K?@B@@AJ@,.cP@0+bU@hc_@g@'o@x@HA@p@'@@@8+b -x0L|M0pK`P@0` $0 q$0KT0 000 p0 000 00 K+b -0LM0@pK00 0`P0,0 |0 x04 0$0 l00S0` (0 q40Kd0 000 p0 000 00\ KبAܨAԨALcLc -@L|M0pK`P` ,0 dq,0K\0 00 0 00py3 003PY,0 0(Kac -@L|M0pK`P` ,0 9q,0K\0 00 0 00py3 00PY,0 S0 (KA/u -LMp`P@K`  q0S S( 0 000cS0#61$0 $0K t0 p000c/&#*( & 0K #\0 000 0 000 00K00 Khc`c -p0LM0@`SP 0 0 ( $0 K` p0S S( K( K"H0 0X 00 0 000 00K00K .c -L|M@pK`P` p,0K\0 00 0,0 0py30 000 00bP  R 0   0VP00,  (K -1LtM` PpK@` [p0+X@ Vp0 00 p0 000 00(0` s 3P R0   0EV`P`0S` 0X+.p0 (K c -0LtM` PpK@` p0+X@ p0 00 p0 000 000`psp3PpW0S` 0X+o`0 (K c -LtMP@`K` po0UP01@0  U@,PU(U&0@0 @@QP @ @ P boUp00 0000000 000 00K00@@P3@ K0+bA -LtM`@PK` po1V0 V@= U(R( (0H0 `H0 ``V-V+(0H0 @HP @# H X oVʀ( 0 X000 0 000 00K001H@X@(K0+bA -@LM`_ wpK, ` 1o,0K\0 0 00  0 0p00 000s3PX,pP0W aw0p03W0S00(KAԨA N 0-LP)@ڎ0S0 - P@L anP0pp0$0,:0(1 00$0 $ $H0(00,0$0S 00p4000p0h?S  Q Rl 0t S080p0900S @ ) 0L0H ` T0P 4!(\0X0`00d0x0h0,Qll ihU?"?@B -LtM℀K`@p` nP`  P` PG.0D0 0 TP 000 000 00I`$K -0L|M(@K`Pp 0ㅾPK` Kn000 X@ 0 000 0 0$Kac -0L|M0pK`P@` (0 (n(0KX0 00 0 00pz3 00PZ(Q$K b -L|M`P@pK( ` m(0KX0 00 0 00pz3 00PZ(@„T$K -DQLM0pK`` @,0 m,0Kh0 0 0 0 0 @p 0r03P0S,00 ,0SP" ,0R 8K)0,< 8`K`0c0PoP08P 4` P  008 40 (0000 0 8K$(KAɚ;6e 0-LM @ P@PuP3 VPPU0 S S0i00i0K0acac -0L|M0pK`P@` (0 Nm(0KX0 00 0 00pz3 00PZ\0K (0<@S( P(P¬PP;|u$KA b -LMRPp BKBp`K`  m0BOK0 0  00X@ 00`y3PYo(K -LtMpK`P@` lX00P0 忿Ji0@ 000 0 p00 00 Kc p-LM`P,,0@0S  0|p`c -L0MP@L0 QUPPMRp01L 020C HK偌0`P0 & 0@0S W$ X T0 /l T0PD  H  RS孌 @tZTX  pG `P0Z@@ 0@ 呌L0@d@(KlAchA -P1L|M0S@p XX1` R <1 @ H0S 5S-@BꌀK` 4l (0K  #\0 0 0 0p00 00@*W@'T 00# 0` p@Z `1= PdUP!U  3@P0p`eV@@W(Kc ca0c -LMQ 0 P @t    0S0ppZU0 2tU妋2`@U010#0 ;2 噋딀*0WS$K؋ ֋K P P_ 0X 1S ‹ P 0`pe0C0 X 崋1e ᵴ@T `0S P 1埋GPw@P喋O0 0 ۴`卋VE =U010#`0 崐$WYKKVw uK sP r& 0X 1S `peIX X\0S `c0Z`~ 0 嬐u (K >B#.b.b -3,M@LP`|0 0pP @@@ @$P(`Gh3 00$00pP @@@ @(`5$3 00$00pP @@@ @(`#2 00$00pP @@@ @(`2 00$00pP @@@ @(`X2 00$00pP @@@ @(`2 00$00pP @@@ @(`1 00$00pP @@@ @(`1 0 0$00pP @@@ @(`H1 0 0$00pP @@@ @(`'>00 0 0$00P @@@ @(`0 0 0$00pP @@@ @(`x00 0$0 0pP @@@ @(`n(Kx@8A$@s@GJ@?@?@^A@@k @c @@ -L P ? -LP`@p   W`(000$p00 00(0080a $04p崼 7/0H0,0/,0 , i1? @ @(? &@ @@ -$@` 0,`00$0PL4p勼 8/$04僼 8/ ,00,0$04`w 6/  000000,0 00300 000% 00000$04`Z 6/000  00000000006000`  0 p-@ BLP0R-<'''\' 0"S*$ 0"S $04@" 4/$0`8@ ;4/03 $  0"S xpp -H0L0 S P ,gp3Pec @ -0LM K0 K00 K 0 0K K p-LP`P0@P0xVtp0 P00 3/    03/0 0p\@@A -`SL@pP   3/ P \h0WPPP  P $V  03/o@@ -LpPĭ@P 0S0W     0U     0`0  W  R 0pwp3SpW 0UV 0UV 0hAA -L@倭0P Rp0T  @ @  0@0  T  R@ 0TS @0hhAA -L@U0P Rx0T     00  T  R 0@t@3S@T 0h;AA -L@(0P Rx0T     0 0  T  R  0@t@3S@T 0hAA -LP 4? -$@` 0,`00$0PL4p嗺 8/$04叺 8/ ,00,0$04`僺 6/  000000,0 00300 000 000 $04`h 6/000  000 000 00 00600 -LP`p@px2  `(000$p00 00(0080$04p+ 7/0H0,0,0 ,`.i4? @ @X? &@ @@ p-@ BLP0R-''p'' 0"S*$ 0"S $04@ 4/$0`8@ ;4/03   0"S Kpp$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A 0R0S 4  0 D R0/ 0  ă0Ȍ0̌04 8 < 04 8 < 04 8 <0 0004 8 <! 04" 8# <% $04& 8' < 0$0(0,0 c1<0$S  0@/A -L@0P <0 H`` 0< @0P0 ?,<@0 Xp 0@ D0`0 Xp 0` d0 Hp 0 80 `p 08 <02= `p 0,<h3cx\b 0-L@>0\PS   0 0S   00C00aP0hx\b -LPD|0p`0A IlP  ClP  04 8  00P@9 D @4 (@ȟ P-:< R): R& B 4 P 0 4 h`HHLD,@ 0 0`p 0 0 @@@ @$`(p<0= 0P 0 0 @@@ @$`(P,p<0h= 0) 0 0 @@@ @$`(P,0p= 00 0='0000 0 @@ @$`(P,4p< 00 0< 00 @@ @$`(P,04pl< 00 0T< 000,  @@ @$`(P,4p< 00 0; 0 0000 @@ @$`(P,4pm; 00 0; 0 0000 @@ @$`(P,4pVl; 00 0T; 0+0000 @@ @$`(P,4p?<0; 00 0: 0,0000 @@ @$`(P,4p&: 00 0: 0 0000 @@ @$`(P,4ph: 00 0P: 00000 @@ @$`(P,4p: 00 09 00000 @@ @$`(P,4p9 00 09 00000 @@ @$`(P,4pl9 00 0T9 00000 @@ @$`(P,4p9 00 09 00000 @@ @$`(P,4p<08 ,00 08 00000 @@ @$`(P,4pd8 00 0L8 00000 @@ @$`(P,4pk8 00 07 00000 @@ @$`(P,4pT7 00 07 00 @@ @$`(P,0P4p>l7 0`700 0H7 00000 @ @$`(P,4p%7 0600 06 00000 @ @$`(P,4p 6 0600 06 00000 @ @$`(P,4p\6 04600 046 00000 @ @$`(P,4p6 00 05 00000 @@ @$`(P,4p5 00 05 00000 @@ @$`(P,4pX5 00 0@5 00000 @@ @$`(P,4p5 00 04 00 @@ @$`(P,04p<0004 04 @00 0000 0@ @$`(P,4peT4 00 0<4 0'0000 @@ @$`(P,4pN4 00 03 00000 @@ @$`(P,4p73 00 03 00000 @@ @$`(P,4p X3 00 0@3 00000 @@ @$`(P,4p 3 00 02 00000 @@ @$`(P,4p2 00 02 00000 @@ @$`(P,4p, TP@I<<2a@02,S"Ÿ 0  R R (R@aDBBH00S:1La @}[y']eQT!0hL1x 00cl! 0b`!0XP1(Ks@I@s@F@ AQ@Aۑ@AZ@ Ai@Av@dA@a@XA@(A@,A@0Ađ@4Aӑ@A@@@8A @@AI@aV@aa@al@$AA'u@a@@A@HA@LA@PA@TA̒@?3cA3c3chcԨAhc,1cax'3c -0LP0@S@, S 2S S.`pG0  0 0H`p90  0 0:00S 0   0D3c -LM80 @ 4 @ 0< )S0(0 ( ,0K⡹P# ,0 Q %0 :S P PQ(0Rp%(p"*( ,0K∹P ,0 Qpp,W BP`0  0 0pE`0S 3:S SlXk Xg R,K2\2[#$4@ 8#80pXVZ +0F 0 $D  Q0  0 0*0 1 0K\0 b8"8#4b4#00 R TQ0  0 0,0 D !SQj0  0 0k,0 0g~!0XP`pQ0  0 0R! *  gp ``Xk(K<08 PP40@1@3c -L,Mp(0P@1`  8K(  2P@00`SP0 LK [%[ 0LKS2. <0 )0uP@P0 0(K0 / )0hP@P0  0(K4 8 <0c(#(c4"4#= #:00 )0NP@P0 0 R(`P1 0 Q)1 )04P@ᑲP0S 0(0T0 3X X +X<XFT `P 3X0 Z o@P`0  0 0&3X X +X<XP0  2  P0 3 )0P@BT0 0T0 ;(K3c -L MpR@(P) @`K oZ0$0 YP , )0`P p 0PP 1M  N K(Q (0/ ,R0 3R  1 1 S/ p-L8M`P@PHR0K (0SH,R )R +R/ R3R <R;(Q8'S6L0K( 㶰UF0[(0/@S+: $0K⫰"[00S#U$0[0 S:0K 㛰U[0[0  S:0K ㌰U[0[0(0SKpՒ@ p-PSLMPK0`@0%0PP @@Kp 0-L P᪸@P  a@P p Y0 㖸 -LP -L @ሸP he -(0L8M00 080 \ \0  Qm W9I 0@9I:L'M 0@9I/Q/ @ MP`:x=02F?  0 ) 0Hm2S )\0@P 02F?  0 #M 0@8H LP` (8 0(8 \0 0S 1 0@lLP`  0 \0 8<( p   V0'S( p嫱P\ 0  0 0W 1 @0@0 @\0k@ `R @0 P 0 0w p+ 00  0 0S  04 8 < $(! $"(#%$ $&('  $ (   $( $(,r S 04 8 ,! 04" 8# <s \K( 08Pk\0@PeXPp`X P \0 X P\0 X`P XIP`.0  0 070S:\ 0S 1P`0  0 0 P 0 R  R 0SS` ^PW `V80S`hh@P0  0 0@0 _0W0K0 PKX0KeKT` YX,0KXK @` C,0gS > 0p,t< x,|< 0x,|<X$ 4 70SD040SH0 \   P`.870S @0 070SP`2f@P@0  0@ D0\0 0S 180  08 <0U \PሹpP \ P   CWL000 0p4W#$48#840 g4K8K\ K00K1Pm\@0 $-40S*e@P=0  0 0>\ 0S 180  08 <0 0S 1P` @0@0 @ 0:90)S(0( <0K⪴P <0 Q %0 *N\ S DP`0  0 0p80s d40S`\4(0( CR:(S R( cӭ0S30S \  P CP`@0  0@ D0VV\\00  $ (   $( $(,r  $(* $("! $"#0(<sb@P0  0 0\0 0S 1 0  0 $04BeP0  0P T0fU 1 @@0 @@0D@P@a0 g0S @Tڜa@P?>  0)9@\0 0SS 10  0 0J\00(P a@P 0  0 0!\0 0S4 100  00 40++RU 0S 1 @0@0 @t@P`0  0 0 P0\K` 圣#0K 03/` R\巭(K3ct1cȜcA3c 8a@ A1@,A?3c -0LM#v萟Pp`HX @0!@0  "!@T 0S0000C00 !,0 ,00 !!T 0100 m$0o4vcA3c p-4@PLP ` 0 ph3c$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A p-@PLP ` 0PP M  Qpp - 1LM}uaP0Sq(*0S# t R  BRt  0,0 ,0lZ@0  0@ D00Vx0C0F00lp@TP UD0DD Q0A0~0ouc8c4c _000@L@@A(KAtU;0 U7 R4S2 p0 R-3{ [_0(S  HU0pSWppH0U\ 0SL00L00L0pp*p7pp xAAAa -LMp0`PS@PT _P7 (0000000 00KA -LM` 0)R@P( pHS" SGx0EGx:S>pV(hb(hb(hb(hb(Y(Y(Y(Y(Y(x](hb(hb(hb(hb(hb(hb(hb(hb(hb(hb(hb(hb(pV(hb(pV(hb(hb(hb(hb(hb(X(pV(pV(pV(XV(XV(XV(X(pV(hb(hb(X(pV(X(X(X(X(hb(hb(hb(hb(hb(pV(PX(hb(hb(X(X(+ ^-P(KᗱP&U@ UC U UK$U %U)U* 'U (U/Uj 9UO +U/(0  RT0(0SP088(0SP088(0SP077(0SP077(0SP066(0SP066(0SP033W (0SP011z4S`0Sd0Sh0Sl0S(0SP099e(0SP055_,PK P,+: (KPu +  ^Pa  + 0\p,p P9U\   ]PPH 9Pp0p0000 0CS|Y(Y(Z(HZ([(4K ưP, 40S ) R) 1S #R600K⽰P, 00  R-s8008K 㟰P, 80S0ŕLK 㓰P, L0SH0S D0S @ RP,P 0L0[S 0<`V`pK E0{0K0tK|0KL0K|KgKx` d` 02`PD``K0V 70S?t70aV: 3SLK EPp 0S rLP pW00S00S0  00JLpK %P , A<\ 60 S60 X0200K`K00KT6KK DP, ! `LpK X 00S &LP `Vl0S   -0,0 0S5 0R 0SPUT ]P,>(K֯P9(0S S SP04 *P044P044P0&*U U!  U UUU#U U 3U0Uy,UZ .Us:Uq 9U=0ESi%U* U3 U U>0U( $U9(U &U 'U1+U 9U' )U*P0#P0 P0T0P0P0P0P0?P0 P0  P000P000(0 (啮!,0 9 , K  4p09P,0@KS2% ,0 %D,00 0 #PE00 080 U񟗉$a(hb(hb(hb(hb(hb(hb(ta(hb(hb(hb(`(hb(Xa(a(4a(a(hb(hb(hb(hb(hb(hb(`b(hb(hb(`(a(R Q B`@K nD :R0 D0SD*+R  +R('R$#R! @Q  !R Q RH R L0$K0$K00!  0K  8K0 ! U U S 0S2 0S0S000,0 ,K ͭ7*-$KLK, K0dPNCP~ 10AAAAxAAa p-PL`DP [@P  P  [@pA -@PL  h[A -@PL0S   >Phw[A -LMPQPp`@4 [U  P+X' S$P R R0)S   B0P0 00000 000c00S(K -0LP@h 㴝`P 00'S( `P pUCSC 0h藃ʚ; -LPIM@`! 0  K1 4P =C3 700@K5CV' Q   !'@P$Q  K !@P(Q  K !@P@Q  K ! @P0S01 0S00 S00 Sp!qpW 0K(@P0000 00 0(P ((IY:XK@P0 000 00P0U 1 Pi 00P M000c< 3S80< R D P00 0b 0bS00S' ?XFޚ@PA ̯X 固PD 0<00+8@40 4000@0H00P L00@"00000000   =0@ Q0@Y(K$! B0p(  ( 0007@: )<)) 00R X2 0   <  R  X!     0Q X < 0Q X I+   00(p#x0p0S/ p\0K  @1 _B\00K01KK K$= K $A@P  GB  B"@@L ˆ@A 04 8 , 04 8 , 04 8 ,  04 8 ,TL 0HLS 哮P0 ` 0 0咮-@兮pX0  0X \0儮Q K! V! (0S,0@D0H0Ll;0S00 0 S  d@$4@0$8$L0@0S0S;00000@ P00K0K0KMK@ A,0K0pK40K0 0@ @@P ,0S5 1P`X0  0X \0*40S ,P ,0S 1pP0  0P T040S Hp<  P<@  P  ,  lpK @KfA  @pP K K K{Kp VAKp `@P0@ R|pK GA  @pP0 K0KK}Kp 7AKp A@P0@ R4pW 0S V P 400p q ! 00S0<0q0,p<<W0 10 0 03Sg@P}0  0 0~,0Sw 1X0  0X \0n 0 R  R 0SS 0P@ < +GP< Y@ P0S ! 60S !R &P<0S9 ,0350S00S. 0 S,0 080K0<0K0, \0K@P80 S V H0S 0SV H0S <80 @@01S (0L0 DKHK0 KL0KP@00P0,0(  ppV!  L0 <0SW7,0@_! R @^<^  R @\<\< @U1S80LK$ L0 ?L0K 0 80PW= ,⺡P 00( @0O 0$@0, ,0t00 #  # R 30S 00, 0 , W ,7@Z/0@ 40, 00 1Wl80 S:0 $ d8 H3 R80 !8( HbX! ,0ST 1 h@0@h0l@I00`S0` 0S 0 , 0S0  ,00! 0,00 , #  @" R ,20S 00, 0 , 0p 84Q #8$1 0C(1 .40,1 .8001 8A 㤙P0 S 0 0 1(@0000 `  4``\?!0PR@ !0EP3 0S0 0@ c, dR@00(00(0 P 00@, "$ ( 08#,#40#40 0Pl@P`圫`0  0` d0坫7@Q0 Ĝc@aAA`bbȜc3c 0S0 ,`( 00P,! 010!<0h@x0  0x |0h,0S 1p0  0p t0 `ZR,08AS 1P``0  0` d00``00 TP`,LP 00( @0O 0$@40, 00 1@0P 0PT Q`pp0  0p t0K((Kݕەٕו@3@@(@0͕Pb@P0  0 0 !R 1X0  0X \0A@<0S+ l40 0 01剬@00 @>0P@ ^DPJ0smd0@ PSil$T3 n0#$48#(#<0 0S1jP/ 0S  $0 !S001 (0@S001P0/$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A0Q0R0@- P@U(@P%@P"RQP P S 0S\ PS 0S \ P0/0 00 0P 0/P 0//tKc -@L80 0S0004h0P@40X0SP @D0P P 00S6 T  U00R0S   0Ppppt0`80S<0SS \0S 0S   3/0`V  d?A 0-0LP@'T$8s00 S44400X0P0Q0S 0D@3/P X0S@@RRD4OR(LR00@T00A A 0-L @oPP PK0 0-0PLMh咷4 Q  0 0$  TP0  \` K0踓@ -0PLM8o4 Q  0 0# K@ -LM0000 ` 0 0 000000 0b' K|Kc -L|MpK@`P` f:,0K\0 0,0 0 0 0py300 003PY,0 C~R0 (KA -L|MpK@`P` 7:,0K\0 0,0 0 0 0py300 00PY,PU`PV U(%P z! U O!(KA -3<03 P00 0 0` @@@ @$p(P,(<0,3 00 0 0` @@@ @$p(P,`02࢟ 00 0 0'0 0P @@ @$p(P,`0`42 0x200 0000 0P @ @$p(P,`4,2 00 02 00P @@ @$p(P,`0p4ʣ1 00 000 00, P @@ @$p(P,`4屣x1 0l100 000000 0P @ @$p(P,`4嘣<01, 0100 0000 0 @@ @$p(P,`4~0 00 000000 0P @@ @$p(P,`4fP P  㿥D0(Ks@s@@@A@(( J@,AI@I@(A(/@|Kc -p0L@0 R 0S D ,PP4孵$0@ R000AA:@ -LM0 `P@PQp ep ` 04#4!eF00e00 `PP0`| K -L0M@P 04  8 P 0S0`  d0h0l8 @40ql0S XpW# 0   R| pV 0Sphp3W `W 0S 0;0K0 @A@&@0@dAAЦ(B@KcJ@?p2cALc4ALcLcKcLcLcLcLcLc -@L/PhwPc -0LM$@K#0K0, $0K 0 2K/ 0KPHKLc -PL,@T( @P# ,`Pp0`1a 000p0 .pPpG 0`FVp* /$A]b -@L00S 000]b0 0 /]b -L(M@0`LP,0  04 8 RPCpQX0  0X \0R0S@  0;0K00`x0 p 0x |0P`K !(0;0K0Y p8K<0KsKo(4K (Z 0S 0 (048<R 0pSW 40 D0S  pP0p0, 00 00ό00 0P @@ @$`(P,@4pΌ(Ks@^bs@ @Z@ p-0ML0x0@P0 @@@ 0XL` !BA?o@S 0 "@KphpR@A^b -(LBP hhB`b -@L!B0 P0R 0 0RP 2Sx`0@ qP@0?T@T00 #  2Q00S0@h.B^bAhA`b -L M,  0P4,#$$p0(48"(##<49#8 C\CR\   `0  R  IP`L0  0 0MK(H""$ "$ #$40#40!A 04 8 < # $)? AAQS  P P @T 0R GP`0  0 0Aꨧ娇00  00 40 `Pލ@ 0@0@ݍ!{A 0  pP 0 T01   0c00005 2S R{  y8@Pu v  00 00 001<00 0 q 0 0410 0! !10S1@6 B? A!010004!#48#8!SZa00X 000 4 ! !)#48#IYo04#48#Y>  @w0 $)"4408#,#40#4 004#$40i8#,#40#40I 0$!"$("(! $"$("(Q4b  ĠČ Ƞ,Ƞ Q  ` Ƞ(," ,Ď"$ ,Ġ"$ v w R0 0  <10C100C0`sZX 00S0 ``0`00S0` `` P0 $"$("Z f@ 0P4#$48#U 0000S`001Slbp塌0  0 0墌8>@q0$rS !   10c0 00C 0-@ P00w  ̗0 p 40 ×w40 Q0 0 *<** 8670 0100 010c000! 0S(,0@P00C0380  08 <04!? xvP,UP H@P`0  0 0(K 0!Lc^b`bPAl+x+N  0O   ! -- -iᆊG0 00      0(+b@+bޖ@AA/0 0S/(+bA 0-LMP@ 4* 0  4004 $ $0R h0p  B  0@孠NU40 80 ( ,00000(+b)A)4A 0-LMtP@3h1U \1UKEP1U; H1UD0000 0PP;10P5*P2 P/P, 0P0U$*P 4000040000(00,000 041$0 PU T000H000PPP 3K0@+bc,c@cc,AA(+b-//0\11@/ḩAP/`0S/@-!2 A!Q!5!r! P apU Q!`Q001Q!AA2P!A0CS P4U 0CS2Q Q 0120S 0! : :#62/ -p0Lp4`]30 P P$p0S:Z3@P.b0@-!2  P AEA|!E0Q#!1Q0 -L{T -@L{ @  p-Q@L`t{PPp - L@@ p-@L/r  2011>1a01?1?1`P @P Up 0-PPL@2@080C@00S  0 2D0hw2,b -L`MR@2P@03?0TPPz 0FuPP@Dl@ pBpZ2X2d2put0Sq N2  0P 2Ua0t0 [PZ 24`-x 12ap 0|` 0 `P6 0S . @T+ 200S p$ 0R_2l ?R0i0@V2 P @ hK!N2hK @0tPl0@p@0Cl0 0$0p  p |p 0R:@P@Px1201t2[Ua@P P `@00S0000,0ph2 2pBz(K,b,b.bac.bA -QLM@ 0 |#P P zPQQ 0 0  (P   x 3xX1x#  CRSU  RS00u0SzZ t1C P n13P p` t0S 0Sx0 S [1pp 0` 1V`  ZP 214@P̈́ <1A` @  w `V q @Tn Y Ÿ$ 0Rg  Q00R03SR 00 1xx K  @ ( 0 4  |p Xx [t lp 0p h d  \p ` ( R Tp X 8P L ,01001넑4-(K -`PL@pk-00p000-4011P -xQLM\1@a50S N\1 g10T*,1 }PA-0 #ᤒ, -P  0qk+-1,  0 1SQPg-01   0  D0  \1 U (0 鸩A+b@ -x0L\1P@ aW pP00 \1 111 e踩A -4`pL]@1,W-T 0 h趄+b -0Lp\1` QT/ n@P0 eP @l0\1QU ]P 0 P, Q,0,0 0 踩A+b -@L%u@P  L, -@Lg,@hu -@PL40 @ 01+b0\1140g긩Ag -L2LM\1 14`020-1@0 4,1P1S,0 儡Ճ0PPcUU@n :  E ! ȂprW?҈1Ճ?Ҍ1 cb/3! ! 1 p118 P11040 094 X2 `V/ ( R!UQ(0<0 +0  0 <0(,Uڜ0 哃8 `00!2!!r!E0310Pp, U01,(K踩A+b -1LM\1A 1`&gPP Xp `!Q P 0S Y ( R ppp, #00, V,U0 qpPU^Z 8 1 Q0202S$P !^l0!#4#0!1 11 0R!  , P 003/P  PY,0@P 0400800,0@0 03/P  T (<  50 0v(00000(0" `i(00000000S04 00@0000000@00@04 4$( (0QU LpY |(Kp`b -L M4`r``W@P '(000000900 0` `g()(W40  40 0<  00 0,0 ,0* (0 8 @ L(@Kp'W 00 0 0` `=(V$K -H@L\#(phhA -8`L@VP:@P9PUV P P*(ip`P`e ߅pp'0H` 00' 0ԨAhAU) 0-@L'$0  0$ (008LPP:0HQ̅0h'l`bԨA -`LM0@\ql'1PP'# b''000 P ' 0

@0@0%>@plpdphpPx0pH1LpJH d $30d 0d0 p0p0<@<R0@Q8104 <12pp0,0K0d0 `00$,0q,0pW,0,0pW ,pd,0q,0q,000P S,00p 100@ 000X11C10 0S l0l00l000S0  0@00\0|0|0S|0|  0|@0,1 R0@1@0Z1u@03/ < Bo,000t0,$0E,0O M0J  % TAD|FGpDG80< 0 8p(K5G,3G @ꔗ@Au@@).b.bLc -L(M0< P)0Kl`P`pWV  mf@ ƼpP```V `f@C`p4 Uf4 ᮼpPq1 ]u`0p0S +40KP46f4 `0Z:D1 suXp 1 ju @`$@ `V 0f` 0 kpP00K<00) K 00P00-pPQ  lp)0[S<0HV 0eT p(K ce)A -|0L@S d3/0|0d0 -LpM@Q` 0  T0 Q H0K|0 0C| S0S   OD1S 4xQ LP *LP P ;$ 9$0D1,0 000 p>0#6040080>0#60D0>0#60<00@00  Pp P00000 3/00p03W0#S Ps1t$>!$Q$:X!01/1411嘹PPp1p#  0pq At 0 /Rx+ixp jtD0  c(0K #h C/0@0S" :S/%jP P,0K'P, Q 00K00=,RP , 0K0/DP Xp81 Y:@<1Sm !0H0 t40 P t00x00t0S3pPT 0"x0  x0Eh0P E 0SB h0 3B;h0@T2@\PU( XK0 jh0B PULP >0  Q  R0 00H0 x00@0 >0< XK80 <0 4 0 00 G1d@<0|H   aH <0 L L <W6<PT6<<PP6X <P x > 0t00S   00C00S  0 xG"o" Qy 0@y@6<>9P `5& "$ @E",0f04000(K0@.bAp3c p-LXM0PK` 0 0 @Sp0K K\ 0S0 Q   0p03Q0S pKP Kp -6L@M A0P`T!$ sd0:d00Sd0 K   TD00pDtp00C0$p U 0pK`1d1h1l1 hD0t0 0S CD1S  L ?rj-8080pHB>`140S 3/ሷp0  `w4pl0 00l00l01`0S> Z p pYX000|Z   FXC 80 p 000W0Z0  S  #L3tX X43! h!+a#$1S Ih0 x3 0 0S `Q`0p h0刐  h03B;h0 ?0Q QؠG pW1S!!!1 0S   |2 R0@d2p0@0t00000S 0S  0 00S0  0@0`0 `V` 10S`h儠*\pW' HK0 VB pW0  Q  R0 0080 x0000 >0, HK(0 <0 $ 0 0 E<0 0N3V 0s ^HS 1`5 1$`0 t`0C000000L><0I7UQ*(p3cė@/b.bc.b@.b p- QL@ `%d0  l 2 -LdM Q`p t0 p_@M'0 P   >P ppp\,P ddQtH7 RT w P @0/tP:p0S *w6 R 0S꺵Pl pwn !@ ~P K?,10100(1` X60`0!80! ! `0 ! y u}=x$uh  0 0 ghP 800C+P 0 $@ (4P0P0 W8@0S4@3@ 00l0 0d0h04hᄀx0H100L0\@H Ed 40d 0d0^ p0p0<,6 <h   `4l Qt0Z000 0 0,0K0d0010 ,0!!100S  3/310 0S l0l00l00p0S0  @匀\h|#0WSd #h0p;h0p0W 0P*lP % h05h0 0P x0L1x0L1|0|0S|0|  0|@02 R0@2@0{P1u@03/p2Z    h RH2   0S@020S sLP121$1S 1$1S xI1 p0  { < d1,pj0Sd , 0t $  000t0,$0$;,0 Ԁ nlppd R \K0 0\0 0P0 (1 00 UCl0x0Sx00#(KAAabA@@@!@u@@p3cC4.b.b`c`c -LM0@  ,  R      ?R @0K -LM0  0000 K -LM0  0000 K -ML0   K 0-LP@0 3/@T0 p-L@`P4 P ` P00S0@pA0S    A0  A -L4@0S 0 3/ R A0 A -L0@0(S   P AA -00L0 R03/0S A0 AA p-8@L`P!; P~;pLcA 0-$@LP;0hm;Lc\A eAz p-00L`P@03/@Tp A0 M Ab -$0L@0 3/@T A -LPp` d H @P  p `<0< Q0@@0@ pA A*@80 S   0 S   : AAP 0-pa`PPLP@  0S  0m0 3/@T@ 0S X 0m0 3/@T 0 0S im0!? Ac@Z@t@$0H 0!0  0 0/ḩAlcc+c 0-LP@[0S0 0!/ -(Q(1L\ALY@8kaH1S PP0 !!P40040`p0p !!` !!0$012199P 40^9Ps9PP1S O긩A,+b 0-LM0K0p0@00 0T03PP Dm0  /0 @0K0讘@D)@ 0-LP@0S0 -(@L 00abИ@ -L M`@Pp 姱Pi 0000   0,0K0  @0pCpP ᜱTZ ,?Y,,,!RQF0 00 XlvY``?`0 ,,Up` 0U ,,0! P!!,0!,!,0!@ !,0! !,0$0-8U ,,0,0  R,00 p(K@AA -0L\A0P ,t tQ(!l1  X-PPR08`S00[jm븩A٘@@ab@ p-L@\T`300S 0 0hN0$00000h| 0-PPL@ 0! !001010 !!x0Hp0l0h000, !  ! 1D0S ቂn0h긩Alcc+c p-!$0L 0@R R& 0CS"$))0)8)))`)8) ` 0 S`PN` 0 㕙 0 ph (1S P/$0SS/ p-@PL` P @P P D0\1 A VP PU p.bA p- Q@La } 0001 1< 1 V ph5p 0-@LP P UU0 0-@PLP0 p-L@`P`ph 0-LP@ P 0S  0 -0L03/ -L0 L!踩A$10$1/$1 !0CS$1/$Z 0- ALP   0h_ p-$1 QL0C@$1$` 0$1Sp$0 CR 0S/\!? -L@PAT -3LM\q, l```PU 00c 00DATzU@ 0P 0P D1SDA    dUDA PU!㙝h`PD 1L0 3/ 0 |2P 0D0``P ПP P0SVPUX.UPP `v003/*T0 00 01 002`P  XU003/V 0*`o`P   0*XTC 0000@ :0<0`00S0 PP0P000S0 R boa!"! 02 B P 1  0, 0\ 1014 0 ` (K 0Rx|긩A# b# p- 1Ll  00p@DQ` 0`c 0a002 `fa  !R000S R0 0 00S0 @@0@0ph -LM@` QD00 0Q 0 P0  0 0(0 0 0 0P 0 00C0$` eI 0 : 0 v 0 0   00 0 $p` 00S -L Mp0`PS,  M @T  ἀ밐/밐 X3 a/@83 a0x00$0$10 Q d0?h0@0l0p0W p00t0!010h"l20S00 04010S `0Ԁ 0< 0H 000 0 0JUMmh ,h$ 200S@, 0Z0 塪 >101 @p5 10 qbτ00|1|11111b?f?110X111100S000(01S0.!0@1000000`00S P P00 001 0p p0y h00S,1!P0@1@0 180S 3/(K,b7bh*r@A.b-b -LM a@0(qP00$0,0 d0  꼀 { = P01(!RQF S(  $U R !Rq!R$ R  !! Y B (!00 k00 G 061S5Z $ (#0d0  0  0 c0R, 0P  00U   (QQ!R $ B !00 00(KP -0 L\1刀 a DQ@ 0*pXaQ@T0S D0(QQ0D1踩A b 0\1|/ḩA圆  P-Z"P2L@@%@3pP`P   EPdP 0@Q @ P -`PPL@ hQ ppGQ @P  s` -00 LR 4e0 00 T4@Mc@ 0P00R   0 R00/Mc/ 0-,L @PT:08Pc@iAiAQP//< 0R  Q  p 0  <R:    0  0   /(APc -@LXPP0@@0T0 0-80LP@0 _P @T0(A --LM0 0 dc d K@@ 0-LM@P K0KPPP 80S000 PK0@-@T@ -1L,Mp`T @P P @TPP VXVU`PQ(,,S0,ZZ a R #KL0[S <0 S2  P,<0, 0<0LpK,K0Sp0T@3/P l m 0R< V00 80  B @ (K(Az@@ab@Pc --<0LM0S 0$0 \cCcWc Kabښ@@ -L`p!PP/@Z0S d@R@0S00S@J 4A00P3/@P  :0  B 0R 000  00@<S:P O@0SW<0T00T00 0\0  P PPL0  XHO$0   @@ab@Pc(A4@Pc -pP`L0@*@0 S% T0" <0 R00D0H  Q R*00 0D H0@03/PP X @T4R, (U@`c4AabԨA(Aabab -LM`P@ 000 \P{ 00P@DS:Tn 1,0 Np 1  !R 00 - ! 00X:4h1 P 0 P5 PU0DZ:   0P R P V 0 0 ? P 00 bP`U:ZPP XhNPU:,bN (K0 P ab(APcI@ 0-LM@  0  PP# PPt0 P0  P PUP 0R0 00 P 0  B K0(APc -428ML ((R$"@ R  @ 42@ R! 001@!07a e1A0  P 0 v@T:1@$PK@% 00` 0p 0h`$` @@@ @(pOD1 `00 0$`0` @@@ @(`,pO(0S' 0 p00 000 0 @@ @$`(phO0 00 00 0 @@ @$`(pUO$KPcabm@ b0iAabPc@Pc@Av@%@,)abhA@x@ab@n@\K!pP10S,  2R' I`P p" 1 \1   !0 , K 0 \#0 pP ,0SD pyIp\7\`* *$ 1  XW  WZ, P' xP$ p0 X0PvIX0 X(KPpp/I R  cW3A@Pc@(A &@@@?@@AF@l@w@ 0 /P)LA$0H 0!0  0 0/ḩAlcc+c 0-D0LHAP ڀ0P !P0 !!0踩A/ 0  0)]ꘞ@0 0 0)I`Ad!?TAÞ@ p-PL` @0ESVPPU :U 00p00000`0p\ڞ@000/ -0L@Q 1 C!S8\Q101`pW oP 0S i?0Sa oP a @0ap(0\1! BR!1S c?踩A(clA 0-0LP  0! R! 0@ !:@0 !!0T0@P00@ 0`0P00h`@$ 00hva0踩A(c0AP/0 0\1S//ḩA -LH@ 1 C!S\!Uop3踩A00/]ȣZ -H0ML0<0  000    0YU0 K@,)A@-b p-80L`P V @00p@-br -L@xP0 W@-b0@- 0 ( T St S :T }S t }s: \ X }/L 40SO0 0abPc@Bx 0 /ab 0 jPc -D0 ML0 40000000 0i K#?@Pc) -`0 p@LHPpcz3@0, DKW 404;$  0qp PQ 0 0000000C0] T mh -L4MP L0 4H \1p ` 1@80 0S `IY0(6@0 FPP  0  0  p 4 !W@D<@  : 0Np }0<0 @ D ', X @ P,0&Q0 T 0S00<@S@4 :0S WY @ @P0K $ (080@0ŸX0 H 00 4;$4 00$+Q\ 0SY0 S8# 00,02/ p8,0pDT00 \00 nPEe20P 8 ,D \0 o\0 pP700 >00S0 00 0 00H 2/00g0000@0@0 @0pgp0Sx,00,0 0,\h pPD@ pP pP  pPD@4 0S 0S 0 R0  TT XY Z4?(FW PU0T50007000 (K踩AAp) @cX) 0S8 0/$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A 0-\0LP@  0R0P 0S 03/@T 0hOAab 0S/0A00[abԨA 0-Li#P0@3/0 0-LY#@ PR< 041 0SA[ 0h_Eab#) p-LMP`@0V 0Sh00S / `0 D`R<    X00QKpPc@@ -tPLM`p@@0S 0S g/ 00 R$    XTPcK@@ p-LM@P0 `Q* T10SA B/ 0 R   .T Q00S -/0 0S0000yX@0S`Q`0@0S / P0 R8    `X0SKpPcu@@@ן@ 0-L"@3P @0303/P ^Z03/0@ p-LM0@K#`P4!P VT"X.DX`|#PU0K#V XKp@V3A@ 0-PLLK/0@P 0 0P  00h0=@k A @ -LMp4`KX~#P@ P .P.P y.TX!@P<XP'#@T4K#XKC@V3AU@@ 0-LPX|b#S.hX PX  P !P0,X8#P@0^@(cbu@@@A p-@`LP0@S0P  ph˺pA -,0LMP  KѺP KA 0-L@ P  PP 00 -@L!}!h @0 p-`0L@P- 0 V00Ppx!?@ p-`LPK/0@~P3  0wP,  0pP% %-WS!P 00S-t W P T00S-@Vph p00S=@k A @@Pc@ʠ@ p-0L@0`S -hVPP g PP P $00S p-VpPc۠@@ -LM ( $0 0 pKP@0'`0SP `@V K p-LM0`KP7"0T& P!P@0Ks"T 0S :S K P  P  C BKp p-LM`1P6 eP100S 00SVVoRPOV0PKUW!-P ,hHWQPPAW!P@0K"08WKp$c(c@@A^Aa@@V3AU@-,A 0-@LPK/DP2 >P, 8P'',V P 00S,|UP \00S,HU0h8 0000S=@k A @+@Pc;@N@ p-0L@0`S p,hUPP PPP P$00S Y,UpPc`@r@ -LMpnPP1 4`KV7!P@T,PV,P 8,P I,P /,dV@PLVP @T4K\!(}VU dK胡@V3AU@-,A -L M@`K P@( $0 $ (pK +UP  X``@K+!V T K@-00 0-LMP@+P  0  +P KP IK0 -LM4PKp`  +W@P d P@@4K K -LM4PKp` +W P @P @ P@@@4K K 0-LMP@0 @ K00 K0 0-LM@PP ~P  0 K00 K0 -0ML 00** -pL@PIP` P T| 0+l TP@H gc0S T0 +$ rTabPc@@ǡ@ -$0L0S `ThPc@ -@PL`p@00(0pP `@  A@-0h@T@T@T  @T  R$ 0 @@\A -LM0@P 00 0)* p-LMP ^@@`t0Sh0A0UL0 R0A@,0@0m$0 00TpabԨAT* p-0ML@00 00 @@\GCLeL`0Pxxx `P@pb0Pd ``` `P0fb@P HLT@U88 Kph%V@abDcb@p) @Hcb/@@ *:@cb0*0@-` P0  @P 0@ @@@@ @@00C@00D-b-b0P P $$\\1S/"? 0-LPZ@ 0S0 9 -L@ t0Sl02l0q'n'|@T 0-LM1 @T0 ?0   0  R@@ 00 P  |0 t1`0 Wh00 0n@@ @@@L8 0ȻK04"?-bD-bau0uLcbc@+*@ -l1l0ML@ 00Plp 0 0`P @@@ @$P(p@ 1 00 00(0 0`P @@ @$P,p@0 00 0/0(0 0`P @@ @$P,p@l0 0`0`00 000(0 0P @@ @$P,p@$Kx@Xcb@3*j@p@d/*000/ p-0L@0CS0(ph>phh-b -0L 0##@T `VpW |0hQPl0S RpLF0$ R@ @T h>D-b-bc4  000 R0/D-b -LP t0SS00@0 0##0S  R0 R0/D-b 0-p0PL@UeP P 1@0@T@@ 00-b -HRHBLM @ @ 0R *  0ep` >, r 0V , N, 00 8 <   8 P    "4 D 4 A D8<     W  pG 0C00CS0000 0 0,00  0h0= @@@P@T@40@x0s 0x@@  @ N(K-bD-b0u0@-x @(   \ @ P@PPPP@00C@0 0@膻D-b-bA 0 LLcb 0-@LX|0QHS  0| 01 0S0h 00hc-b -0L@1PpS` 0SR 0 0 0l02l00CS 0@1S  Rt RR R W l "l    BR t@T -LMP@` (=`XsdP3 0 ##0S=R3  0 2 p, W 0 Sx0Y iPP0x R 0S!1 0RW 0S`0  p U 10 S SPP0 RVpPpjw3 ZYw V W qX@@TpV\ \e WN Q% R x0P$0000 001 00001l00l0 ` ,0```p `  |0S  0| 1 R@q0@|0S0|  Ppt ppP0V (J<X E<V]pp-bD-bc -1LnMt1 0@P`puOK`0S0pS1 0@@ 5/pP1010P0W0S0K-b 0-X0L@\1P 1P d0 D0S^D00000踩A p-\0\L\Q A@00S  # /a0V y001php踩A(A -0PPL\@ a0P0 S !, !1SqW XQpZ`0 <`0LT ¸W m轸踩A 0 TLcb09TLcb0TVTLcb -80L J0t0@0x0>Lcb 0-hBL  (坻$ 嚻0"S1.!1A !!!0!R0 1!1 n/ !AR| |00n?01@03/n10up| bp1! 0SH1 81 4!Q#/x| 1P pt 00@_#QP@ 0X\hl0 `d000 00P@{xt0t*1㠣H  0hIAu@@@AD-b-b]c\[cZcAA`c(Ad[cG?Xc0TSLcb 0 TSLcb0 T SLcb p-LM`PY@VTR@STQ@RT0@K0$G UPp3Kp Qp-L@P& Q*Q Q%00CS,*,*\,*,*`0V@0T L0@@Tp0PppppA 0  -L\MP@ x 0 D:h  @:Dp l 妡@KPvT Tq@  10$01l0 00S T! R  X!0\10T1^ 00S0t1!  R0t1 0[/0 0 Bh10p -LMQ@ 0 `Pu P` P 8x؀`X  `  VT Th0Se0S0  5PpP Ѐ Ā TX?  p 0 P5Ѐ P Ā p485T8@nP8 1`0`Q   PU R<@QU ̀ `0pSt0S 000 0ⷵPIQA6*5*5*5*6*6*6*6*6*x-1*10$&yl0 . 10 R) 0S 100Sy / P0S0咲0卲0咲 PP 0刲 { w RP̠00S0``P0ĀSf:\ppQ00S\ W n/"n 6/\p Xp Tp Pp lp hp dp `p pP40$p 080,p, (0<04p00@0100p.b p-p0`L@P-V 1@10$00KP1@@0$00 0dp.b p-h0`L@P V 1@100+P1@@00 0Ep.b -L@@ 0-L@P650 -L@, -L@' 0-L@P0 -L@ p-L@P`'0P P 0phBp 0- APLx0 !x000 R0QxR / -LMPp Y`;u0@  ĮU  U @+ ἮU'z  ᰮZ  ᬮZ  ᨮZw   ᜮW   ᘮW   ᔮW   0tP  7u {Uz wZ w sW ᬰu bU ^MMbw az  Z (K -LM`pP ưv0@  7V  3V @+ /V'w  #W  W  Wu   U    U   U   0P   z,v Vw W u U   v u ߭w ح  M(K -LM0 00" - ML0  0 -LM`Pqv@ᘭ`tᕭ@ᐭ 0V0 007 -LM0 006" - ML0  0) -LM`Pqv@g`td@_ 0V0 00 7 1`0 000/ p-LM`P˯00 0@d`P ᪯pph1 -LMTp P@1T@#0`K  K.b -L$M a000P @P04pK0 @P ?T@%01P0 x $0R  SP 0-p@ x0H04K00 㜄0 K.bz@ p-`0L\1 10SH00S <00> > 00 0; 0 0, @@$`(0>1<0X> P00 0 0 @@@ @$`(,P0'1<0> 00 0 00 @@@ @$`(,P41/> 0 =-0 0  0 004 @@ @$`(,P80/> 0 @=8-0 0  0 00 @@ @$`(,P4P80<0< 00 0 0 @@@ @$`(,P0P40/> 0 t 0 < ,0 0  0 0 @@ @$`(,P0P4P80<0; 00 0000 0 @@@ @$`(,P4y0/.0 H+H; 0 0 0000 04 @@ @$`(,P8_0/.0 *: 0 0 0000 0 @@ @$`(,P4P8E0:, 0 0 0000 0 @@@ @$`(,P4-0/.0 *: 0 0 0000 04 @@ @$`(,P80/.0 )9 0 0 0000 0 @@ @$`(,P4P8/l9, 0 0 0000 0 @@@ @$`(,P4//.0 (8 0 0 0000 04 @@ @$`(,P8//.0 (8 0 0 0000 0 @@ @$`(,P4P8/@8, 0 0 0 00, @@@ @$`(,P4//> 0 7',0 0  0 004 @@ @$`(,P8y//> 0 L7D',0 0  0 00 @@ @$`(,P4P8^/<07 00 0 00, @@@ @$`(,P4E//> 0 t6t&,0 0  0 004 @@ @$`(,P8*//> 0 6&,0 0  0 00 @@ @$`(,P4P8/<05 00 0 00, @@@ @$`(,P4./> 0 858%,0 0  0 004 @@ @$`(,P8./> 0 4$,0 0  0 00 @@ @$`(,P4P8.<04 00 0 00, @@@ @$`(,P4./> 0 3#,0 0  0 004 @@ @$`(,P8./> 0 3#,0 0  0 00 @@ @$`(,P4P8q.<0X3 00 0 0 @@@ @$`(,P0`4Z./> 0 2"0 0  0 04 @@ @$`(,P0`8@./> 0 h2`"0 0  0 0 @@ @$`(,P0`4P8&.<002 00 0 00, @@@ @$`(,P4 ./> 0 1!,0 0  0 004 @@ @$`(,P8-/> 0 01(!,0 0  0 00 @@ @$`(,P4P8-/>00 00 00,0 0P @@ @$`(0-0/. 0 0 00,0 0P @ꬢ@/b@U*@\cb@@@s*Ƣ@͢@բ@y*ڢ@ߢ@@@@)@@@@!@(@3@$T*<@E@@ @$`(0-(0/. 0 0 00,0 0P @@ @$`(0s-(K -HqP L@`0S S S.V  PA+)V P" 0)@!|0T@SV`0)@P1T@ PU `0S )@80)T@D@ 0P.b.b -騁` ALpP0S S- SDU @TA  S P:U㔁 P0 @P t > XP$|@TU崥0P@  (P X@T `0SP80U <0匥0P.b.b -LMp AP W '@,`K > k <K -LLM@`d0 \ ` @ < P L 8pKMP00 X T `eh l0 h l090S 0 ZR 0@P(0 @P19 100K @RQt p 0 ,  P 8 K0 08 40 8 K0 8 R0tK YH D0 8 40 X 0@PH0K @Pa 0V@KPpK`pXK` pH` Dp aH Xp aD0u'X` f@ < <0@ 7#H0K 諿L0P 7#h H0K 螿h@ < `0S !0 h 咿` 0h `0\P 0@K耿\ 0@K n\0dP  7#H0K kL 0 dd 0 $ Rd0`VXp0p(K@Bp@-`0@   RPP``=)B` -B @ ``0@ 0@  h RPP``=)B P` -B 0 R00   04Sp?B 0-LP@ | H00 0bH00L 0L0AT0 -LTMp` Aw WlPK <P  0p <lKP P lKP 㳀K -1L` F8@ [P0p0PPz 먠0 S00 XP  Y  ))VPY (/b(A► -LpT`TPp☺P P (@/ %8T(A/b 0-@@L0SP @0 R d0h000 @P0hZ0 -L@P@@p`崀P崠H0V m((A -LMQ`P@T}, KpPxpp, 0pP ,% k1 7X@ pp, 0pPP,0@0p0 0+奦pK` ̿00 0 0 0p\@ P"y3PYp*, 0ӥpP"PP@PU 00S/S .SP'(`P p  ᓿ, dp, 0 ^7p(K cgA - RLMP`@ p\W@2X p W0S0Sp P  0wpP 0F@S񟗝v*8w*@y*@y*@y*x*xx*2 QQ d2  QQ f82 0QQ 2  0QQ 0D006ɯZlSi Rf: Rb:!0 0 0 RSH SRD0 `0a0D0 b0` DՓ1 1R0 R000 0R0 R00 00 ?PP t0  ?PP 0@b@p(K AAA p-LM(@KP` }}P  0 Kp -LMQP0 @R`0FSNppG WJ XG, KU0PB000, 冤0P2Z<0KH 0 , {0P'` KT,0 ::x l);_h1 d@`1@0X1@0 H#@@(<1 000!0@ @@@S2 1 030S @K. 0.  0l`l@P0PS x,\0 S;#uDZPPP@UL0/ǻKp$A`c`c^c *`c(^c]cP`c`c`c|@@dcb`c -LM@`pP  Ԣ 0pU0p p$pl U$4p8080040|0 (P,`3P00 0@0LH0H K R0 @$0@00 Kdcb`c`c(^c 0-@L0S   h0Pd0 R0PU<P 0P 0P8P 0h2$0`c]c,A -L0( KM0", ( K0"4 ( K0"< $"Q ,4,0@@4@ ,@ @T[0KN S00 ,0,  (0S0 P 40s$ '}c8p W`1l# U40W0408` ) 8ovP y7v70408.,0~, 0y$ 00$00040P4P 0PU@xPT T0@K0S00 ,@ 0P0S80 4@ 8@K8P(Ko]c`c`c@@@(^c -LM@,P(0K#\,0 k"4 p 1` 0 R 80 2 P80 P `0 D@Q0P0 Q, 0`p WR4 0S00 ,@ 0@K0P2 0U 0 0$0 $* 0, 0Q0 K\Pt00 , 0S (KoT0 R@@08(Ko8(Ko(Kdcb`c]c0A]c^c -@LY0  h`c]c 0-LM,P@ \M,0 0 0 P 1 0 ` R b0bS0cRS 0 0 0Q0K GK0 -LM@p`P$ 06 p-T0LM0`PS@K! $0k 0 Kp$A(^c -8@LPp` P8`c -@L\00P0H   @@%400 R 8 h`cP`c`c]c^c -L@PL 00R00 0S S h`cP`c -QLpMP 7/@`K0pK> M,Hp `P d7\00S PH,0 S;# 6K@`c@$A`c(^c -2pV``V p0>Sʴ0?03/$00CS(8**d***8*D*W pw  0 S 0$0000p S pp pp{ 0-0ML* 0@0 0@@ @@@2*P0 00000@ @@@#*XPT+2@ 288 00K0A6@ /b>@@/b4**@ *xcb p-H@ QLk 1X0`+P  08+@p /b 0-[L@P0 0h+0 /b p-HPL`8S P0 g+@  {+㻳08H@php /bG-QH` @ D H L Pq0 @  @@ ဠ@ @@X@@T BX@ "! ?X$0(0,0004 d p1 d K/,!0! t1x1|14181<1@1l11|1f111108@/b#? 0-@QL 0 Q `0 *PP T 0 5000 ղ00000@0 /b0 0S/0 * /b p-PLP`@ 0S@0 S   S  0U00 0 0 00pTU 0 㔲0 `0pp 0-L@@P 0 S   S   *Q0 /b0S/ p-LM@P`P% RS(K 0$ 0(0 00$0 00 0  000 0(KPP  E20 "! |KpQp@-  0 00 0 0 00 00 0 000`Q @@DPBAE @\@@@PTPP @@@T@000 0Sp p-@LK`P@f ATp -LM@qH`8 < 8 4 0 0Pp \  X $K  P ?R$P(P,P0P4p 0,pK ,p (p <K `0pQtQ 8xQ|Q`02 SR0fl!!|!!!!! &,K%$K#? 0-LM@KP @ @  K0 -LM` AP:,K>8( d1<$ h1 @q 0lU00`q,4AA, (  $ !0 0  P0E 2K102PK -0 a01L0b?P@0010 !! !D & |10101 0p0$0  6 hU00 0 0000010  D|10101 00$0 -0LP@ a  0`pP o$ p W 010 01001A 0"@-  X@b 1 $ -LMt0pSS $1S IQ4 a 0040 h0,  Y= @P K P40 H@K@0J"03\X 01H00J"03XA@\ !P  1 0S P 1S01DžP@$ 0 K 0 ,  K K0 K0K@>(\; t0S8d0S5, 0Q 80 P80+ l!R( 0C 2T012 0C"03Tt\l  0l1t1Sx!x!x1t! *fT @P^ Y  zpPU fw볖 0Kt0Sd0S h0 2 00U00S:&h0 00 Z00S0 00 ZZ  t d !d R Ah   U00SK4pp  0YP 40S qW(K#?/b/b 0-d0L@ 00R00SP 400 P P P0 0 S:  0h -LP@p` W l0  |`V -L0ML@K`pP0 Q0L0  0@p K p-L0MHPK@0 `<0 H0 <` tz Kp -L0M>`LPK@0 p#V0@0 00<0 x0040 娒<00 ,` ` ( 0$0 Jd0M @K -d0L@1d00t0000d0 Q h_ -pԀL`@ c0SP`d0 PP QU@T `0S PEUV ,iB- d0S.b.b@/b -P1LM ܡp@ `U d1P@  0PVP  @T, `Y4TQ PP! @Px0S`  0ݔPVP t0SS S  |@T<0U(Kx0TSک.b.b - 1L103/ -(1L,01 AP pf d`h0HV(`bo !0G"03\ !0L2 0L2 d00S  0m(1X1 0P10T1: { 0mw.b`c - A0`HpPX1Ub_T1P1L(P2         0  F2 "\V (X0 !02i7#? 0-@PLx 0 -x , 0hSN@G@ -L M APpd0  08 0   }x*t!& :d0$`V 08 0 07 0aV0S 000ϖ 廖00C00ZPq ` # 0$03/0P`(0`S P Đ=X0 Px ,<x , ad0:d0se@o@#?A$?`$? -t0 L\1 1H02 R |*|***<00S 3/hP) 0\h\긩A`cy@ -1L0M\APTKL! aRH0 L!L2p~b0PL2 f PK  0[|0S P L0S   T0K ZTK o$K踩A`c 0-Pd Q@1d0 "2d0d L[0S@  0h 0;AT0h+@/b -1L`\Qp At0Sd0Sd0S:P 0Sd0S Zh0t0S d0S00C0f0$0 ^j i~긩A.b -LM As`P 0  0 0St0S d0S PPe8K>l00@0  080 40040 00000 ,00,0 刡80匑 080 40 040 00 8K 000 1D 0<0 <,00,0 .PPDf0M?@ R 80080 40040 00000 ,00,0 80<8K 408 004 ,00 0,0 PPK 04 0EX0E"03X h P h # l UQ X 011.P0S 3/Ph0 @PPR H "1R R x R h  l   X0%(> Pp(K 0!@/b#? -0t0d0LP1d0>`0pS0  B @X$0S0S V 0  `$p000AT$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !!00S/`c -@L`P p@00T0 P00/ p- 0@R000 L 0 0 0 0 0 0$Qab $ ph蠽p0 X00c\ 0\0Ne PᎽԤ0$0`ph0ALcp@-) p0h@?S  T Rl t@0S@@0p h`?RPPVPUlP tPR R 0 p0S 0 R 00p000p -LH\A  0 $  00X0h긩ALc -D1pLP\A:W 00g 04 0P= PP5U (N U (P#PPW U 0 aP PP `01 P 1H00PP 긩A#? -L@P`p 0帠S`V pWe 0-0P@LU 0hU0 0-L@MP0S0S0hA0h贼 -t0L@HQ`U ʀ0p !p0 !!,0VT 踩A`c0 p / R R/ Q    0 t / R R/ Q    $0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A 0-LP@`0S0 p-L@`0S@00:#003/0:#0PU<0 0 00 0 0TPp踩A -T0Lp\AQ 0`  $p긩A -`L@Pp0`0  P `V:VTITN%p 2"01QqA8q|cbA@ p-@L 0X5"5PP00`j  00(00@`ph*Aҥ@|cb@-!4@0@408@ p-P@LaC 0Q=0TP$0wph -pPML@`,0 00 0 0`00 00p0 0÷P h%0\ 0 0 0 [$0 00d 0 0\ 0 I$08 80 0, ԑ  (Koڥ@*@ޥ@G@@ -AL` R1v@⠰d1 T10k@PD%@1P@pP0 g0`|  0u0 p0m0 h0S 0 `q_ qqo`p0 R    PU:Dh4\ XT| DD 0l|cbA b @#?s@@C@_A%4((0 \ 0Q0L1/S긩A -t0L`P@0 0 p  0*  @T @R T h 踩A01 |cb -P L0   \  |j$븩A4@ -0LM\A Pl q0, l !@ tU0`!00 00000 00  00 0S,0ql0(Ko긩A//// 0-(@LP5  |N0.b///N/-/// -LMK  K 㓭p3 K -LM   KKⅭp3 K Q-L@$ ~PD@ -L@sP hh/ -L M`Q@Ppg ViPVlaP18F0P `P Ma JQ0ėP`PA P8 P#P0PH0  D D " &"* * H0PVP1 %Z0 0ZPP00iP 0 V:@@K"Z&YP PZp "IPO"0S=PCd"P`@Kx0S 4"0"(Kt@y@K@ AU@a@V3Ak@q@ -0LbM 8 40 :@ 0S   0P 4: \10:P S@P " PP :厤Px:0ST P T:0# 0S|(*00|:p0`KTS:   90 0KaPpP "U  "PP  " " "K0p03U0S@  ᑌ&@T( K00S*S @D0਀C 0P! 0P @PrP Pp!W m!t!PW" 0(4 !:: #@0 6#::080 XP  80KcP 70 K8 K7'p <0S £P `pWxx y!㿷P P屣PP<ᩣPPᠣP p6P嘣P60 0P < RJ!6p<0S A!`pWTP(K踩A@0bA -@0LM`Pp\>P oT 0(h0 0 \ , ,@ 00TP 鸩A@0bA -P0LP0S t 0p,`@u 0h=0A@0b -<0L\1!R$ R 0踩A0\1! !/ḩA 0A-40``@0@V004@ Up(``P`(P,`(`` @``PS`V(, 0P4`U00@@(0,@(@8 0S@(0,@ -LM8PK@61 `S q@p B1 p0WQ1 PU ^0$01P218Kp$ 0T0R0S 00$0 0$0v0S@U-PW80K8P`"01R X\"d2`2T[ 0S00|0 0| 01211儁0C10 0 00S  W50S` hZV`0S00S 003/ wP5U t0! !000S L 0   !M(KA`cA -錡L\A們qM$0S 0 011S C<P`@0  0@ D09!@15)0`S0S2 )P`0  0 00  0 0[10110C1QU~㒆P긩A@6b -,0L\1@P1S 踩A -@0L\A%0h00 0 0h긩A - 0L\A0h0h긩A -LM P@K`Z娿0S 0$01@21@80K121@ۿ0  0 00S  0SP `X`VUP0S,00S 003/ gA`c p-$ L@R Q R Rh0  >0S U000 08 00$00-0S 0$0phQR $ 0 `+ϱ 0$0P3phg@ -0Lp0`@\1U ] 0$ 38R 0 HQU C@T `0S H0L@8Jh0 `0tpP .b.bA -2LM`pRV2`2! !2  R  22@ 05 (0 H00H0!0S 0 $00CS * **$*$*$* *0Sp0"Q50 ,0 d ,050X0!Z50@ S, 0S0l0 嶾+ R \P ,x (1- x 1: \ P 厾X @T `0S|0d00S ||0u  b'"% @ T(oZ ࠄ蔀LcAԨA@6b.b.b@!@7@K@$?Xc0@-t0P 0 `@ 4$@T@PTQ<, P00AX* -0P`@0LP  SP  0P 0**똀嘐 ʽp0"S#R qW W` TQ!0 0@SPAX**.b-bP0S/ p-LM80@PS 00 0堄U`  P` U` E0P,@000040 @00` S:8`p p7 n@ &@@@A 0-L0 M P@R 0 020`c Pp-@L`  Q\P 0p ph^ -RSLMp@P0$ KP`T $`dV 0P` K Pp-L@`  0]P 0p phO^ -LM@4 80 `4S D0S00Q0SX   00  pPPYPXY 0000  pP|0pPPUpu   R R Rk0P0P0S@94 R 8 04 Z 01pPU80YVpO 0@00CSGh++h+h+<+ V@0 ) K8pP)0[08 V5  0-p/ V, V@1 @! ޳`P p#   0pP00S0S0 T0S XT  wZ  dֳp(Kڨ@`A -QL@ S_Q `0!PT `00 -LM@P0 p4S sQ0s R 000  9`P0p` a0p 20p W PK,K 0P`PK` 㵛8 p0 R 0[S wP0S ( S ``p4PV:V`u `0pPP m R4 RB`g  0P D0000 XP p:0X0` K˛4 0BV#* f801!` B<  00S0  8 P`08 4R:``4p80pGV:` 7'` EPP4``FV4`8|0`8`@P0S(00(0PPU0,0 K0```(K@A`A -LM@0 P0 `4S8 'QB0s?Q 000  dP60p2 0  p& 80p" 0 R" sV PK,K 0PP@0S   /0[00C SPAC0C QPaCQ-S _S R 0SR R 8`PpTV P)  K PpY  kP   0,00YP``4U: Pph`V (0V (0V R H0S<0S60<; S 0 00   0Q00S  QQ `0BS񟗃| + + + + + +  `0S0 0`0 sWq`0Sn\0SkX0Sh ``r dWW`L _WI RH0SZ`PT ߖ`W`0S L X 㶱pPH ``0K 0* eP ?Xc` j8FR*弱"2`0`c00`ೱ-WW` "W` W0SH0S   {00  d ypP  `Q ͙ 0P &H0S ` p  RH0S 0S `0SWQ 80S ?P W |]y80\#4`ԐԐ 2 Y   R:40 \; 0P, `8 0 ̙0 m00 8P@Q8P `0\:` 0P:8D0 080W (~4 Z&*`:, j0 0  3 P@08 R 8P` 0P:`4 Q` 4 K 4  0 <@`0 $W +040p  0 0S Q Q`0[00 Q`000`0K 0 40`0+ 00H0H0080@P0S( 0 ( P0S ,0  00 (KV )@AP@`A p-PLP@0   ` 0p ph -LM0 000 0 p$R` $ !0SpQ0s  (PP p W8@ z 0K0 0K0spP80Sn V pp0  ~pP4 0` \ 0S:S ` C$h0S ( Sp 3p  0p p 0 V X0S0&   ֯P ,0K08 ;lpP l,d ïpPDۯ, o0$70 8p Я0 XP ȯ80 X00700 00 pS00s  0RJ0 00V00S    0G~P7 +ۗXP0,0  ?.,0KP +̗ , 0W0(00,000C0 0,0  R: P",0  c0 0C0 0p,000s`@40X:00pyp3spW0 p pppPp(K臩@AA`A 0-DL<0+8@ 4P03/T: 0h膷acAhAhAac - L 00 , 譩@acA -L8@ 4|\1! v\1! !踩Aac0\1 g긩Aacac -LM0 `0S10Z00R\ @04S dRp8P, EUPB0P 0    0g}P6,0,0 0   Q  R408  `4 \4  R 0 008S: 0` p@00S8PP W:Z@p(KA@ -LMP0 0`$R Dk0S@jQe0sb040 0K0,K @PYlpW (04P W +(0WJVp 11DpW (0K p# apB!pIP404p 4p8040 @ 圀 @&408 S PpGQ W`0040 0K, 0OPZ00 @00` Y 01 c40T:0@0@@(K臩@ -LMP@Q`p 04S =(0K00 0H\"P P+( Q'!R$ R++++p+h+| VtVh`\( 0 `@ pa 0SPGZL<o ,  P R0 S,0 嫤/#5U  T(   T  , 00,0PhP`0dPx0l0g00@@Dt0,0 T00p嘀PPPPPH L0PX(@K04,0au4 FD (Kbccc -LM0 0to -@L`TP |UP Ppqw0 HŸp PPH   R1#e(6,0S PS S HpPHpL P RHLP R 00@0 \p PPH   R1#e(6,0S PS S HpPHpL P RHLP R 0 0 0S ~\倣PU0S  0S 0S0 彣$o@o趣ccɚ;6ecc 0- 1L@0PS$ Z 1@T U PU h00P*@T 400P0h胣0ccبA0s 0R/0S/ p-LP`@0Vpb -0L @P`  0cX-0   pW0僣P 0000d00`00d0@d@p0000d00`00d0@d@ i긩A -,2LM\Q 0@Ģ``PpPt0   00cSHS SB SB"   S SB SB"   S SB$  ,SB( ",,, ! S S0C400<S0C80#<<< 01! 0  0 $0 0  , 00 妢00:/U PR P0J`Q00(Ko荢긩A -LD0 `` d    Rhl0 0  HdbA -LM@PT @P ۢ0``0d0 0 0 Shl   0P}(` l 0 T04p`x D 0@ $0pm@ @Hh+@b@4@<@D@D0  < 0   S  R00/ḩAHdb00/ -L@P`p ` ph 0-L@P 0h 0-@Lx0 0  0000PP R@ס0 -LM@\0 0  0`p000\Q0S.0S2*곡 `ᰡ! 00 0@0 0@ D0hp,  ឡ O0 S, L L0ꈡV 8Y긩A<@A p-L@P`P `phq -L@0@@g -L@0@@[ -L@0@@O -L@0@@C -L@000h7 0-1L@00 0\ ddl`lldACĠ  ^ dPdPPl`PPlld*CȠ  ^ dPdPPl`PPlld#<< P d1dl`lld`P`ӠU 00h0踩A@b$0H 0!0  0 0/ḩAlcc+c0 R/dAL@ -LM PR 2/@P40<0  ? +0S@' $`K3/@P""0[0C S!0[S S0[S0[;S0[<SD@0< @0`W @@@KA -L MpQ`P2P0 @f<2,K2K 0'0K0*K)K&0K%0K@P@P1P @ PDKPD0K S R 10S<X(&XZP !P QM` PJU TD!0;~ 4$!03~ f5D@ @P @<@ 0  D0K 8 40 <0/00 0HX ʀ0P !$P0 !!8K0P !P0 !!p TL@$Kf q@dA.@­@!@Q@@F@Af@ 0-LM0@S  ( $ K< ( K Q/( $ (K0S `0<0 R?DP 0PK ᔁ03/K0A 0-XPLM0S @K`0 0 P P tK0dA@t -RL 0 03/p0h?S  Q Rl t0S/ 0-LPI@0S0 -4 L@~ p-PLMl@@够PUP0 0D04@ 00@@@$0$ Kph7b@w+7bMc p-<@Q?PL`A൞ 0S Pp7b0~7b -pD2L`\A P? 0,  ` ^0P00 1ሁ011QulP0h0_U_0l00x!101SppP9 003/`P4 T2 W0 ZZ P嘞E4`/XZ 剞0, R,`(x 0 x0( X( Z s 0R llP@P1S 踩A7b@ - ,0L⪡S@P`? ) |1\q0,0 00YY x0 S0Rx 00 0x 0( Q 0SY "Xp, 0S 0   0S   0! B!0S0  0S   0! `F B!V 0o긩A7b -L뵮@ -0L` 0@ qQP 0ST )XT @`c e P̄b -404@L P@ 0hĀb -L@hd M-L0`p`f@PdZ0P0V00SP fd$K$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! -LMK }0[#4  K -LMK1[ K#$40a } -L$ML 2HAT ʀ0` !`0 !!P2 0S  R  R0:K|PQ<K<K<:0[K0:0K4KK14 d,C0 R%#!1@_@P2Pd1 @  [\80P < K UT1009003KDK 0? 0 0 ᷜ3[`p888#,#43K2L #::RD` tK3K  u<P   j| 0`p0d S(KԄbAh1c@ Ԅb0 C R* ?/ ; 0-LM0P@ PPP$TDH$H@.D. , Ď Ƞ,Ƞ"Ġ$("( 0 K0Ǯ@ -L(M8@K &KKW3A p-LM0`KP0& @|0 1K{0 1K{00 0 0 0@  SKp p-L@M`KP {0 0{1[0 {1[000 0 0 0@ S Kp 0-LM0PKc(#("$c4"@0! {00 0 0 0@  SK0 0-@LMP K{0c(#("$c4"0li00 0 0 0@ S K0 0- ML  0@ a0P K0 PK qP - Q@L1KK 0`pNpuP^03/p pP  03/p   - Q@L1KK 0`pNpuP^03/p pP  03/p  `8 8#4`#/ 0-( L0R@ RR0P P0S0S000 -L0M@< @ PD0  `/p0,K 40 `0gpP,wqpPY ,qpP[PEX,%X q U000P0SpP v P z0<  0@Fz140< @D40404p8p0@ 0p000 0 R01(p 000K040K0 1, 00`^qpP+0`0 R YPIp! PPp P OPKp PLp PJpHp R ?00Y0400040 T 4P ,l(K@lA؇+ -LM@Q`oPpP0 (0K # 40   o 40 00 00PP,0SPP, 7P ,000Q(K蠆 -``` VLpP@V@V@` y -0L@S`@P 0Pp0PPP p(00P -L@{P0040`p { -0LPS@PP `0S 00000 `p\ YV@ -@L-/(00 Shhsec -QL@0P0CQPP 0S 0S`U0 pÓ 4q p`V0 0 PUP 0-L@P@000 00 00  00P 0٠P 0ϠPh` 0ŠP@< 0㻠P0h0蕰@$?b+@+\+0+ 0-PQL@~ P00 00hw Q-L@ o0 0 hh -L@h -L@h -LAhJ -LhB -L vp3 @0P/2b0P/b0P/Q"b - 0LP* R R% R% S00  S Qz\ S0000C00 04 S bRW SW $0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -0, M@L 0_K8+X+ -@ ML 0 0 LK8+X+ - ::L#h*p@PM 0H 0SG <1 RET` (PP< 0v bQp`0 ?PS(R%Ɵp@ U`1 `! 0 @pᩖ0T00 X0P V4 24"0 6 X#::"T0 000Җif 0Z000` \ 0S0000.QN ԠZL :/ E Z K]/<9 N ?]᭘  ``E\ .]ሖ$ 0S0,K QP``)\P,,0\0m (K萔AhdrdA}d(@edAvdgdfd~d({dЀ|dydX+ -``PL@U+ \p'\zPP( 00003/P\d &0#X0C0 \W 0 0%wՕp 0Ri -$@L!::L#!븀P$`@0 Tp ( ~P40SZ9 0 05`V0   P$(  R00  $00s 0 }04 1#V b 08 <0`lmo 00mbwꐔA 0-LP0@S 3/P 0<00@ -P ::L#@|!ᙺ@p`G U  U 0 D@0 D@ 00S0{萔A -` :P:L#VMT%n@P@N 0@J @p0PS"T X0*0  T0'P  E0<0U T0(U 2S  V  V 0 UP0 UP 000@@鐔AX+<@ - :p:L#vMP' `P% 0" 0p@G :@P`T0 "R(`r0d`T  :@?P``鐔A -L@0S 3/P |@ -Lh p-L$M@` ?0WPt"m0S80Ũ0S 0S 0SQ B P0 P 0*P@0P000! ?00?rrQ p ? $PK,!0 q0|000000 0 0 ? ,!040ee`ce0 PxS  S*R*R ?gS 6f_ /f`P _Pd 0ܷh d0巘PT\ <墶Kp&@A1@b#@s#@4@4@4@A#@+H+ @+ 0-PL@P0 -PL@P0 x ^PP0pP@00` 0 004 0^P0SPyН+l@ -0L@> 0S 00 ?P ^1p?dP\P\PHb 0cP 0]UPϕ-d⍷`4i0ԨAr@y@ %?(%? 0-LM 0@PS 00T0 007m0  c&08 d⻸`Pt0 0CS0 ʸ0  00uEK0hK0h<#QAo(@@$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -L 0 0-LP@PP)0 -LMp@`AP }`` 00 @00/ 0p0, , 0Pr 0K0H0 0 40P封P  K芯@@`++@ +@ 0-LPUz@0d @T :zPz ,z]볯@˯@ٯ@ p-LPQP0`@0D0QP`PP( 0Aa0喎p蔫+ԨA0+ -LP`@?0pSh*0 0 00喎"h p-P@L R0<@1/P8 R:0 0 000` 8, 0廝8, 0P0 0 00ph -@LPp`0 h$0H 0!0  0 0/ḩAlcc+c/ -L@ Sp1p!PR` *R V b bxPW*e -LMp0000 0P@P)`00 V01 0!00 0P Vj`` Z ` `` 0P Z i0Pch(K/ -L`P@(Pą "(0 @p 0  pX  Dq`Z   ;qP -LMQ@p`P Q Q-@@ 3R 1CR 1CR@0S05@T xm"40 @KP 0  5 0Sd2HZ ʀ0@ !@0 !! @嬐K NP @T1W% 1CW 1CWZ/0  @ 00S @T1@LTE 1T900 1T0:0 :T4 1T3 1T0 0f|)T,Kz@P @" K| 0f!0T 9@ , z 0f4@1@@@0` ! `0 !!4TC@@ 03/@@(KiA -LM`pPPP  @P 0 0 0p `PP@(K p-P0@L```V@ (pP`p03 /p-8@XA PPPQ Pp/PPp/ḩA -LP %? -$@0P,0000$0L4`p 6/ ,0`0,0$04 8/  000000,0 00300 000 $04p 7/$0p4 8/ 000 00 00 00 00600 -L`p0@Pu  p(00000$PS00 008(0 003/$04i 8/00,0(0   0'ᒰl '0㈰H,0 8V(m%? @ @%?%? &@ @ @ @@ -PL$08@,$0`4p'P 7/0 4/ -P BL@0RPH+P+<+h+ 0"SMG0 #R $04P 5/$0`8P ;5/7 #. 0S$04` 6/$0p8` 0 4` 6/$0p8` 06/  0"S 5p -t0L0 S S= X 88S!~I 0Y Sh5gec` @@B -1@L0S@#0@9Pg0H!Rʀ !H0 0000 !B? S{X00 !! HD봀<8f00A|3c-Alcc+cS@u@@@B@ 0P0  /$$@ 0P0 /ddPD0 R0   BQ 0R /fc p-ALM0S=P``lP@@# lP@ lP @lP0`0 S S 0 |0RKph'@0  X 8e|PKph KpA@@@ @Ű@p@̰@ec` a -L MI FPP0, ?H; 8 R8P 8 mt7P77070'7 7'0Q7尤ᴔḄteUE& 00000000000*P7 HGH<'DWSDC$ 6kP C7 $F v "6F  䆟6䖟$F06P06@6F#606i@)Q `V*& ` B ),0 l ,0a`b`  @P:H&b P B *,0 l ! a ,0 Z5pW y'y Ee0 @P:5U0*0C0l0HX:0倥0C0*l!$00c00JZ:04 0C0*l0 c0JZ:0씟 0C0*l0 c0JZ|:0夔 0C0*rl0 c0JZi:0\ 0C0*_l0 c0 @PV:4s3aP  B *Il3#@P"UesdP"P Ue43s$ pa t~pP` a 0`, P, >00g `2` :2` :2` :2` :|h2pb 9s렀 :k`V<2 00821aQ 0 T2$B 1!01 |10i)0 03/x!03/03/ 0|A3/,bL1❠<1☠,1ⓠL!L1 H!H1 D!D1 N0 ! 00O (K* PCEҰ@@%?0 DSBO|3cfc ecKpA+/0! /0@-@P$ 0/ -LU@ -Ln@ -LMQ`0~pp0N~@pd 0.PP ! `d``0K` |,K 0~V  0 P000 L JZT:0(K b@G?18#811 - R R - -L P &? -LP`ᴽ@p v  `(000$p00 00(0080+$04po 7/00 ,0 $04Pc 5/0H,0 00 ,e i&? @ @&? &@ @@ p-$0@L4P? 5/$0`8P7;8 325/ph -$@0P,0000$0L4`p  6/ ,0`0,0$04 8/ 00) 00300 000/  000) F70S S S000 00000$04p 7/ 00<000000000,0  0`% 6000 -0BL@P`SB0+p+\+P+ 0"S?9 0"S $04P庼 5/$0`8P岼 ;5/)03 0 $08塼$0p4圼` 8/< :/  0"S pa e i -L@᡼@pP{0Sd`V ``ἉV @hHYxh_lDR p-T@LPe/i<(0` P4 S<0 0# 3,0%0 00%"*!, 50 54 %4050 ,0` 80p0R$h PM$>404<0 XP0008,0P PP00;ppA"@WEV p-L@9`P d`@hlQ x+\`X d0S  0ݍPphp6@!@pA @ :: #0-@L!*@P hP׈d0S`@@D0pA p- :P:#L M@!L` P d0S 00 0$0`?KppA)8+ p- :P:#L M@!P`P d0S 60,0 0 0`KppA)8+ - ::L#*pȭ@P`[ hPtd`V \1W T1WTe/hT0 0T0唠 ᧈ`= Z ᠈`60W 1W-\ 0` `  d  $V!Zᇈp匀 0+1Y ` d0S  0+`\`pd`gpAedAhdr @ b -$L@!::#!VhpX d0S0)0CS 00# 00`P㊤``Z:V PjUP!\0 V , , g 0PeP0 0mipA -@ :P:L#V%`P@# @p0PUḇ T0PP  T0PP 000@姇嗺PЩ@P! pAbA -p :P:,a#VL$@ERሇӬPT" ~  P  ت떺P弇 T d`\]Vd0S d0Sl娇@P0DU W0@@  W0@@ 000咇 吇pAbA -8@L4 $ئP hmpAbxA=@ 0-LMPPL00S @0 @K040(0 0 g K0AAaY@P/00S0   /A|3c - LP p:\œ\\0QVQ :@@<4 8$00 0aw@T@$+bfcfc+b -PL0M P@70u@P2<00 P00 0`p 0` @@@ @$P(p"0 0t0h`00 0 0 @@@ @$P(P,p u@PKa$@b@ p-L`P@P0 !@p -L M`pPT 0TT 00PK@h 080 0密 )\040 -壆 R$ɳPW 喆\!P \10P ,P q > 儆00S ih1p4TEOp0S P8PE PoU$廳O((KfcA -P<"LM\a @wRp4  R{ Rx Ru ppp t x m@0040 -R  pPZ=S 8000pWppN,0K0<1 0YpPE,  L00L000h06#::`h0(0h0_,0p  t 0  pN  $IJ, pP ,̣ 0 0 0X0pPu/ rp(K踩Afca@!@ -( L00CS0B hkbfcT -,0L R8hGbfc -1LM$ K\@Ppq R(T!0P 4h  4! @@ ` ! 0 N0 0$O$ 4@P  $$弲$("0$ P0$ Q0  $ t0 S$Y 0P0 x$DW$  K踩A@@x3cfcfcfc!@c c0S  0S 0S  / -0L0  Qx#贲@ 0-PLL@Ƅ00 P4PE P U$WM(c0fc -0L0S ۲@ p-@LP$ `P $ᦻp@ -00L@0  ,#, $ 0S0hof -LM`P@径m$pPl峄h0pp \1PP $۱P 4D$U00M 囄KfcA@ 0-0L@ R R)P 0S 00 0,,Kd \! !Sd00S 0 Ln00 f4$ᄱJMY0$@A$c:@fc0  2/(? p-L@`PP 00 3/pp -L0ML  p@    s 0 0 0$0$@ PP0 M$`0`SPV 403/!PP: 8  R00 S140@ 3/40< @ 3/L0 8 40 00000 @0 D@ ,0 0 , K0D0Kѧ뷶P <$00S$0  P0$P0(00(0P@00@0 @Q(K]@ @y2+ -PP``L@p hU 0$0X U  TV  Wづ 0S腳@| 0-0,00LP00$@ >P@T0 0-LP$@ -@T0 0-0,00LP00$@ @T0 0-LP$@ @T0 p-!EL$P$`48p p-LM`Q@ P?.""0`pmp魳@ҳ@ -0`L@`0p3/f[ P03/^[03/X[PU -pL@0P`3/H[H00pp03/:[03/3[03/-[ȀX -@LP`p 0 0 0 003/[ 03/Z03/Z03/ 03/Z03/Zp`X`03/ 0` 03/Z03/ZpW03/ZX -L@P`pD 0] 0X 0S 0N 0I 0D03/iZ -3L0 HP 0-HBLP000,000$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -Lʹ 0@03/ 0$0 3/p3 0-LP娴P (0@$0(0 0 03/0h000S/Eaڳ@ 0-LP@0P 03/0a -(0$ PL@? 08`y p @p {T &,p |'sp @{ 00 {08`0S>~x'x<0 6/(0@ 00z| $0|8`, 06/$08`$ <6/U }_$04` 6/ !YPU(0 0(0`0\ 00ݾe  0(0,0<, 0:ԨA@+ -$0L@P ` 4P߳ 5/  (0 B 5  p  V{  (@ 0 8`峳0 6/(0@ $08`娳 06/00Sm1$08P嘳 05/(?@ -$0L@ ( PPUUPP#4`} 6/$0`4pu 7/``408 0S40 04`03/p -(0L@$0!ki8PJ 05/P$04`A 6/ ` PXdU0S (pp$08P, ;5/(0/0(0< - 0L03/ -$@d L00PRh ,00R0QQ `C,0p n'0.LP<`6/00d0,0h0 -( L@ $P0"(0, <    10 DDD#\ 0c  #  #N c,pz  #0">bp,0   &0ݠ".b,0   &0͠H`"Lbp,0   (0㽠$" b00 X   080(00(0+ 0㧠!a00  080(00(0+ 0㒠\!`ap00  080(0 @0(00<000z$!a00  080(0 @0(00p<000a `,0   0R` W (0 05<0` 0PPLi3@@ &@@@ZYA%@1@;@I@S@^@m@w@(A+@@0$Q-/ -L(0@ <R<0S    0-LP@  0P 0?."S @0S@0 p-@(L - $04P婱 5/$0P4`塱 6/0  [U X0  PpU<0 p  $0$P Pp pp@@@d00(S\/#S!/&S < S  S///A/#$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -(0L@s 80(0 -LM@0K0(P`f0Kp,p0dflf(0:*D04Z  00=J, 00 J48E$KԨA@B0S 0S/P/ 0-LP@P@ TdP @T0 -L(MP< @ R`P 0` @P ᳵpPRp@0(00( 堐  D0 g]D0`  :00  p[]VL ]@0 S<0]<0 ]B]0:(   4K7]000KT14P 0p0S0/0K 0  0 U 10  0 0Z Z Z%U# 1p0  0 0U 1p<  0!1 U 1pB?  0! 1 40K0(V00  (Kd1c?Ab -0LM@ K  \P0(0$0 K cP 00S0(00$0 $,0 0Oe0($0K?ԨA -L0@L|0(0$0S 0h}c 0-P@L0MPPK V00aR S0 0T0U \0 P0K0b -L8M @\0 `P% * ,0KP ,0 QP%*8PU (CP`7>  0 ($880 R 00SHpK \ [P 0S S3H0SD0S@0S<0S H0[S<2XpK [P0 4#[P(Pbq`  bPY 00SU$0SR H0SD0S@0S<0S HK bP@X K $ 5(0s& 8K80K ,S*R'RS40 ^ P040\Z`p = 0 \ `0 qd\ "R Ld|p0Ud(PU @ 0S PP $M(K1@d1c?ԨA -L$ML0 ~00 p `P 00 0c` s@P\700 00(0 PP@"sI100GP00 gy+ `U&z 'zzgWp!R  P 0S0SP \0 X1# 0 x 3S R}(K:b9bG? p-XPLT x 0404@` 0`p b:bG?9b -d1`P ``LR@p< `<^a<Na〢XaHa〥Da0La0 P" `0  Pb 0"* \ P: Rl"! (S{>C"( 0C4 0XD000W `d0`H(a0000gcgcQfcnmX)?p)? gc -LM`P@,0 p0@`~>2 >+%8(d`1刀 R) ,P`$0 P0S:0帐0A 0PS:|0``FPl0l 00`0,0 ? r0 d`000gcnmX)?p)?Ǵ@Qgcp@-0P0R0\*`P P @R@0@@0A@ P@ T .@@0`@P @0@R@0AQ@ @ T00pX)? -L M@`0 0 S0 00.SR.S.00 Q 00R.S.000VPPP.U U0SZPpPB0  X .XWpWpPUZQ! WppaP0 4  0Z UPPX 0CP 0 SRR4PA S0C R .R Pl0P p\ Wp0r ppPZUPW 0CP0QppSpWQPS_000S00U0Kp VP' _0g _`VX0#03:V0 0 C Q * Kc gR00~  @*0K  W:P(KX)?0@-A@| T .T @C P@@\00 0 0 00P @Q0'JS@@@S@PQ0@SDDSAQQ2:0P0 0@0000@000A- @@P0SY? L @ lQRQ M:U QI ` QQ@J@0q0AW:@T7P`PQ@ZT )@0q0AW!@TPpP Q@ZT R0 p@0ap0AV@T\  0X)?@-0Co?@@\@TY@   RP @?@ PUP /U0 0C00:PU7@\p*PpWp /W'00Cl!V!:@T P\@*PUP /U @T @\ /\ 0S 0 00  00S*/ -L0p S .SAQQ d^ 0P0P c/0c/ M0Ѝ/000S/ 00/ -@LXu 0, "(0 @00 800 Q Ahuhc hchc -LMK U[ K -L Mp0АР2@0 P,0 u,0  0a(0U,0W 0S$00 S80S X0 40 luDu40P `Vu(K hchchc p-LMmll0`@0 0|P@` @ 0 00@` @0 x0˸l0l#P \tC tD KphtaaXa@agcXb@A hchc,?hchc -0LM $0KីPt 0`P$ @  Q , (q P 1p0S R u ᮸ KAhchc hc -\0\@LT0 垸H  <tCt0t,vl(tl$hqlhcXb hcgchchcXaaa -LM0pPQsHp 0@P@`(30 K 0`P@@t 0`P t0D| /T00@0``@` (p $0,2l0͕d0Ht

0 >  0 0e ` MiP(@ -L(M@D Q@@@@(K -LDM<@L 00 p4`0PR:l`c10 00, sP ` 0I`0` ,3`0`004 K 1@ K,0KP9,00h Sd0D BD @K21000000K0 40 :NP0 00D d`,0D``  JP0@ 0Q0 0P0(K `000!I<00s40H SS 00T0 40X P 0\0 I@d  `F1HQ 0K0(LP^`4 K 9@ K0t`PRh @K B0000000K0 40 M0P 0`0 :d @`VT\` HKl h @P H0K l h0 @0 P0 HKl h @ P T\`T\`l0K 萐 00P0p0l0`H0K r? 0SR0 0 0S X 0HIV 00 0 AV0dqx(KXaA@-@ -L 0KMc > 0-@LP^0S ;0h^ -@`L⨀pP W||p1 dxP pP F| -0 p F `BpV ||0d x -0@LP0 d`w00Sp |pVe|s|q|0dw -LXM p0PT d d,0 d 0 \ RS dR @@\۔,0U6|D|,P @|̔*|0(|aS a@P0 `P00 0S 00.S R 0  \ 0 0000 ߔ@X0 $ dHw먐,00S4` \0l  0t0 @0Ĕ t0\\ XQPh  TS ,{0,0 y @P( 0,K\ oW@P,0娐S' 0S$ P  t0 Pt0B@ X R@ X\@ @P,, E,{,@ \@ K@P dwP040 00c~00K )W@P WT  00S X0S{Tn{E0 00d Sp  XP pNT Z{CX{D  LKt ;=t@K 6=`0l 00040 \0Pt LK %=Z80p 080d00 >PO0 bEX\``  (02 @P>`0,0(0Sd0` 0,0-hP5 \P4ƹh `P0@b B#000040K0 l0 APT  4t>0̓T@40,:04sT4-?P 0幓@0 0岓,P zz000z0zdLv(Kж@@ -L0MP @0`S< S `000 0`0 SppW  0Sp du `0RQ pPd0`40H 4  p@0X<0 Pp L 54W2l `p 00P0K  40 A1@ 0qpPH `6`>0>00S H      H @ H0 0 ,   000@0D 8 HPH D/<0S$0`,p 0&((8RGAP apD [0 0q app000 K {PD0S `H pHp `H ` J6W  [0K!0  08p 0 0000 K Jp0000HXZW -  40)0 Ha R0 0 Rpd0up(K@ -L(M@`PXCS0 000?00'> PU0hVcaԨAhcИ,h1c 0- 0L @00  R @ \ P\ r l\ r0 l\0@TS  h P  倵0004A5@ -!1L0!0q1A+V1 R R P 0PSh\qda@20帠s   bRPU PP PpP3U 0s   bR0 Q  mP000 @Td0t@ Pp R0SRP 8Pq0mVaԨAhc,c4Ahc3ca -l0L @T \hP P@  г8ͳ00 0$ 0hݳao@hchchcԨAИ, 0-LM P8L00?000@00?0: =?00 040S #S<00<0 SRx <0 S R, T Q0S 4 ⎴,0 0R0a0u@@hALa -LM1 @40S #S<00<Q|0Pp<Q P L\0S, Q$0 0Rh鵝@@hA p-@P`L( 4U`0`` 0Pp P0-L Qٱ0S @T0 Q PQ( 40 PUP( 40 @0@@ -@PL 0S嬱PZ pQ`pPX3LQ`pPB 80  08 <0P( c4 R0 P800 R\   !(  !,   !0  !4  0SX00SL00S@ 2 R  ,PKpa Ahchc 0P-L@S,  P' 4 00 S"PP 00S 0S1STT 0 00S 010S D0$ 10 0hLaԨA -6L$MP@P p6P d6P 0PL6P] D6P 86P% ,6P $6Pz6P 6P) 6Pp4J/015`Pp W` F0p10000 020PU X~. 1T5D P`I ZI 0X0 0d0$080(0<0,002380s 0  !PQ RLp H @ < QL 0000p `@ p@0  W 0(0@80@pTs%@`PVD8 01 0S @Q<Q 0S @ R< R<001000100010 00100 0100$0100(0100,01@0S"  S:!`\ @p W

 0P$T4ܔ \K0V 0 (KȜcĜc8a@d1c -LM0  @ 00L 0 -!pL@Q10000 L 0 S01"! R00 0ShǤ3P (PMHH 8?PP L‡ 0, S10iH  `'0   PP00S L 备0 @0000000 00W0000 x 0\ 100 08 0iȥaxb@c@0A@a@8aO@ԨA, 0-l0L@0S PP ȥ R8 80 >000CS000h0axba -LM@PP|刦[L` p= \  0    w0 000呥)0 j fL0S'M00S#40%S S SGS S4KL` ǑP  -P1l0    ; RH H0 {>000CS00 $Kh@@ܼ@@)@xba p-1@LFT +PPd0 LĆ 0 S01  L⸆ 0h SX10J R @10S3 , - Q 0!1 `00/ 0٤' QR 60000S L `z`0 ấ Rh h0 =000CS00" 0phFck@@@c@@8a,@ԨA,T@xba -LhM` Pp@<K l&Y  l60S :@7PD 0Pux 0R@  ,0KlP ,0 Q@@T EP`忒>  0 ($8c 0LpK4 8 ,|  #& %PPL0[S 850S9 0 /2|@   0S40S# 9tpKH P40S# l@LpKT@ArP 0 P000 cᮅ@ <KzP30S X 50 00S 30S Ꮕ@D 50@ΤLK pP P@T 0Y |1S (50`x`3S`V U R 010`S D0 #10 02"00S1 X  R  5 0 +0P|   "X| \ SD"<20yRX% | R 50  0S 000S 1!0 0|  1 !0!!0 R00S- X1尐HX ʀ 0!0 /0 0 ! D-P 00SD0` !`0 !!4004000 L@P`]C 0  0 0] ,|(K8a@1@d1c@@@9@a@@ԨA@aA A -LMp@` P <K$ LK$6 00 0Rp ,0K⿁P ,0 QppcW FP`>  0 ($8\K @}$ #POX 60SH GpDP 0P傣:<0S80S40S00S$[5RH0SD0S@0[S p50Sl <KP@50S @U \0[S50S KJ <P40S  :꼠Z  Ġ  04 务8 ,% 04 8 , 04 8 , 04 8 , 00R00S 30S L0[\pK0 mPp@00KK00K K K@ P 40 000S1@P̀ 0p0lK0 R 50 00 S 20S \K~J 50形u<0KlK 0 )P0 " R g 㩢<0 S80S40S00S}P| 0S000su  Ȑ R@@S"80S40S0\1|K  "P-0 0$|1 0S000  0 ($8DdKF 6sP00S5 q1` R ` a 50 00S 00S <K`F 50`W `0000<K0G PP`p宍C 0  0 0宍}x(K A8a@1@d1c6@`@ -L`M@`K\@Kp $ xPK    0x0K\0K@0K0w0K[0K?0KpK0600$0K00 O $@Q $08  B8 $0  T0$0 Ka p-H0L`P@ 0S "'P @Tphc - 0L@~@Thc -L1@ R 10S[ |1x0废Ul1`VPpP 01JPW  P P0S qWpp$00S0U  RPU00S 卟`VWU pW0pU  P P0S 1S]`ZVU U /hw A8aA@hc@ p-X0LP@ ` 0R 0d R⊁P@Tpa -L4M0,0 \0@p 820S $ d0)w2`PU \0 d0d R[PgPUaPP P00S PUY HK0H0K@K(0,P  p d0$pA,0K0HK  0' `P ,Q d0  \00\000S d@p}Pz| 0pP `嶞,0S8  B8 ``(K00S`8a@aI@a@ -LPM\0@, 10 Sw G d0㈞oPGPKHK@`K0cPKdK(0\KHPK,0K0 d0KKD 0 K` L `P8\0,0Q\0 41  B (1qP#U \0d0d R ጀP P 0S l ~d0 l3PU h00S ~ d0T`!,P 80S080 `(K8a@aa6@@ -p3LM@X0 ` P@T` @T RPQ 2@0S00S X0 \0`P\00\0\0 `P\00\0@T R R X  \  \ 0S 2 R@20S00S* X0' \``VpP 0S V~d0 p喝\0X0 N`P 0S A~d0 d`偝@TL1@ 0@ 0S `|P@T<1@0@ 0S `kP0  00000@T0@  000@TX0<0 0JE  r 3\ REv0@a8a@ @3chc 0- L@P 4J5P P`00S`0`@0h0a -LM0@Q080<0\0 c`P 00S } d0`h0S#0`S   `pl*5PU 00CS0 8 Ҝ5KhK8aH@a@ -x2L M0pPSa5 RH2@)*S$0S00S \0`0S  0 R @ R,0 B~,0Ph0Sx @T1 0RZlx 4@PT 0 0 0d0$080(0<0,0X0pP 4=1X( P T0@0`0d~0  Ru00S 0 0@0\X0 P x00S | 0L/Z  000 p(KLAaa4A8a@ -LM P`K@  p KDhK0(` 4S  $`0KT 0:P 10Su iX 00p0 00 T ,00 00 LK #P V`Fp10SV tƛRpW0sX1p P! aPp41pb0Wp! r 10cP 0 a 000cR010 000c 8p 40 Sp#L0 0`KL0 0\0~pP{PP00S Xz00h  h epp(K3c8a@(@a4Ahc[@ 0-LP0@S00S 0hgl, - 0@La00SP  $pW p R 0 0P`0S P0tS   g3PU W J00CS0 $ hR3 Ahcaa@ -LM@ ` 1\ Ph!  <K P h1pW l?0S {hQ@{\@00 0ך<0[S;0[0S ?0S <K{ Ś 0R0  ,0KxP ,0 Q@a@T NP`>  0 ($8tPKF TP>0Ss 叚o0 PhT 0( X 0K \K<0K0\U0K 0| 4#$4-8 #88K00  k=PP0S N0?00%#@= 00 04 8  M0S0|0ai|PKN@P x[WN@] 0[p0[[00PN R,0 /p<0S R@8[S= L< H<0RlpsC (0  0( ,0s(( *2@P" ( K;pXpW0p00@@000hPUA 0K K 0⠡ {! 1 ထ 20S- R 0S%  R0S 㵙0S S 00S0S `z 0 K%00K 0K0KwA0[ 0̀  30K0@0[  000K00K 04 8  0 4 8 v  0K01 @P7 0[ XXX00X0R 0800<0<9 P T00[ \0 `P 0S yd0 `<Z`0C R@ 0S0,@ S 0[ 8 80RdH円C (0  0( ,0円yK , KL@P,P0Sm y 0[,@_X0080<0S,@0[U PQǟ ` X! T1  0! 1 |7Q 帡 0A p |t1 ! l u00Sp@m k0ASg0V`s 䠂d ` Y_K0VKYZYdQ00l0Ȗ QS: S6Z0q 0V_K0@PdA `Q d ` 0p@P|A xQ eK| x  ܠpAj TlQtAelࠓ TlQ e ls0 S0!p Z!Y_K0ؠ@PVK__K0䐂蠂@P0 RV㸡QA0S PT d PX  0S (0@0[̐LK  1 z xP Fx1S R ` lX!SK SKX 4( K`M?K1 ;K0Y  (K" RZ   vpp  0A0 0-L9f@3P AP=0@-0 !0@P00 S: -L|MA`p{PP ` (` `Kt, K,P `  0 00 `00\P L@ 00 00u`w{$Kl'- -LMdP @p @ ̠l` P0 00 0X (KԨA -LMd0`P , 0 0@@0` V1pp|2~ 8 07080`! 0wpPV  P 20E7 4 07240,00  0p34p0WpV  ~P  0,0 30S0<0 62W'<0Ph0h0d0K 0l p0K -LDM@5P\d0 ` p0L Si707<c 0  1 04,L # 0` d0 0PJ 0  0 0@P: Q*D1 a10 R@ < *0 0Q":Q:X 0 H p000 T P T`$00$07 070  0S8 D R 00  d `0 L0 V Zn`  <0`S80d S<0d K S80S* @3Z<# H0<000 0Y`P( 08 `p Zn 08 S0D Sf 8D嬒 08   000  0hO <0S80S*`  H TK0 a 0# " ?0 0TK` ?\ X0   8 4 0 0\K  !0  0\ K0 08K  Ah`0S,p0Z> HP``00S  0X.L + ̀v00@pK` pP0` ,p `cx`/xPß p`0 00pK0 g(K踩A.bc -1LM0`St 0ԡԑd0P @v 0@P-0!0S  R ,0 0ti0,0@,0 0,0_01!0R1F T001S9\!0R"%U   P \!#P 50U0P1S)0!1SPxP1|01`1x`a0100HaAchchcԨA -L|M4 80KT0 00$TK`+p4 L0 Pp H ] ,0WD 80 4  / 4 00Z$+4L0 PH 7 @   FE0p d @p @, @ , pX)0K0 0 0 KGPX)0[SW 0d$SZ@R d 0Q p@P ! Q QC7    EPP<D R9 0,0bDP 1&44  DP'6<  < PL0 L H0 X |6 \1!SVP 0P8 0 0D6TK\1!PPUL@KL0P@p Pdd0HXp PtK)KwPT 0 d0 0 0 00P400 P W 0㈐ 嘠  P`@&,v 0S$L0K  ?Q(Q.020 0 02: / 0 PU0 p@S `ሐ嘠00S0 .0 Pp pB W p.0LK |  P. 0/ K|$PP0 0/ K$P/   $0 ,P |0  l\1 K 00\qPP \ !$ 0 K$.WUDP U.0 0BS.2Ud#E

<0 0:@Pn 00600 L P0P  JYZ 00 H <0O 0 ^ 7S 0R  0R'70,0`$ 4  Z#3\PZ4 *P@ Rڸ PP u ~H <0S c044 4 YR `a@R0 0 504 38 5  @ P X` ` PT @T0S 0 @  D  00 0 0 /0 @@0Z*0@0\*@\ PX`40 \0  bS!0 000 ,   0 KgD  0 0 0  00 ,0 L0 , L0P   FD p 0 L00 S P0,S0 0  0 0 , ,0帠4  c1 b 0S D0S7S< :P 0   L P00600/P  # p幇Z4,  0ZQ Q Q 00K  080Sd圇W  Y 0SZ (K踩AcHa.@ -L000) $ O. (-X@0 l0 0 KP0K0NPP `{*0pW P. 1lK6TPKh0 0 l 0 KP0K,00C0`p 0R 0u03Q0S(KahcHaN@v-hcT@ԨA -Lh,hc -LM@P, p 堐pa:10\!0 [4 MP1:1H1  ; 1q>00,00㤀0Ot\` 0 0[4 $1+  : 1PX dc  0 0 01;; 1 :1C\ԨA\@Ae@ -LM@P 4Kpy?4aY `VI,!0\B R> R00 T 000``@P,=0@@0@KPn< $0@ R PP R (08 R@0 0<0K $ 0(00(00 (K4AA -LM` 0@ , pP@K 0p  V 0u00g S 000  4 K ,K0K  `P4p T@q10S0cKSg!0 S004e` `0S   0 R00 ppS \81 ,00<00@0 0<0K 0$  (0 p000``7?C41S0 .?:41 &?24a ?,4A @0`0g Sp0p ,K0K @P 6T@,0 000 0(K4Aa 0-QL@HP @Q40 @)  0@0 00 @ 0  @T00 0-QL@HP @Q0@900w80 < R0$ (0@@ <80  R0$ (0@@0 0-HP@LU0S000 R  E0@$0S e,P 00S0C0,X 0S000 R 8d@T0hdꄆba 0-@LP0S u0hR -L2LM\1@hKt`K0 pKP{ 2@eKP_ 00 06 80< 0 Q=!KQR 0R Q QR 0t R0p R0l R 0000000h R 0d R$0` R 000 00$0(0 R 0(0 0,0 0s@Tt00S`@B X0XD !/ ,@0S 00(K踩AbaԨAb - @L : h>ꄆbn@ -X@L0S R000(u0S @h$ꄆbb -LM10\q0S1 Sp=1`K@0 l<`a!P/RQ 0001 0$1U pP Z1p0S pW0000p0PH@C?K8c0@0 ph0`x0d0K  00\00X0K 0$00(0,(0 ` 긩A.?.?bv@p-ab@8<P\  /M0Ѝ/ -PL@`pX 0mW7S c/P 7S c/PP  0-L@;PP00S HH 0vU 83881$0hc@/? 0-0PM@L0 0@P @4jh0h0 0@P @*j00@@@ 0@@EP (+wK0@ahc@icb@h-@ -L{nyn0hhcicb4/? -LM0 p0P< @8 4 4@0 B 8K `P X0,0 UC,@z9P` P\JCt1, K 0}5PPL;k `,0@TX00P0bP< P 0 0G!kTB 8KP C@TPnbTll,8,|@|`\1\1,P `d ,. B`(K茄chcicA(/? -LM@p0PS` @`@V 000 \1'0    7o<070S$0S  wPV 0 坄鸩Ab -PLd0@ p00S 0S`6B4 B0S $0S z 0$ ]@QPadTlP P 0S4| k b@xcichc`8 8#4`#/0[w cb 0-@PL0T 0hXj0 -0PL@U 000`51  p~o1S i#a p-L MP0`S4 Rt1\1U  8P@P0`V@  L @ +P@C ! 0P ,00w 0@ (T @0 07T1S < wTt T#T (T(@@Kp踩A@@ -LMP`pRx4P@0UNX4 00000\P/0$0 IV   $p  3PE0000C0300400#  P0@000[ 4Kdpq]0<0 Y<0S @ R 0T PpW 3#00 0=# 000c< 3S80< R D bP 0 0b S00S OP00 0   <0 <0 PH0FS8ꐕ--Ȕ-Д--4-40000c< 3S80< R D bP 0 0bS00S OP00 0P  $ $ 640330V0- 000c< 3S80< R D P00 0b 0bS00S WOP000pV00P`  &7 0S@0VV0P<0! !(Kpp{Мc؜cdchcccpccc -<@LvP (0  0( ,0h 蠆b 0-@MLH 7ud u\P\0L0 0VD0(0 0V,0l0 0V0順b-HA@@"@ -8@L\u#uHLV(}VlhzV꠆b0/᠆b 0- PLH@000h꠆b -QLM0  @ R K0P KA -LM4 P 000p4 P0 D H0I_P0@ 00L0`V! 0  (0K`#000 0aP|N0   崠ᶠᲠ`#g]MZX$ 0 ! (0K  #000' 0aPUNp`  000"?]MZ< 0 L0- 9P4 ]Pb z  h1 $0Y0R0S  4 WP101c1 Q Z04X 0A 1 0011101D0S p`0pK~V`1eo p`9S `0pV`1p`K~Kn p `+4D R Dr 00 (0K #000!0a 0 R(K00!ap`p`}mp` eP 1@010@00`0d0&:hd`\xtpl0|儠 (K@AԨA-@ c p-@LP`qQ h 0ST PH00S 0(@= 0PppԨA;@@Ajc -#LML@0@L0P@3PsP3d@ 0PS 04 wPL0Y/0 0 ,00#1ST`S 0!a `Fa`!a `aZ" 1X0"2<0V`YZ ` `( 0R $ t2O.l sm 0 0 0(0$ S 10 1 00 0_D R 0eS0(0W0`VT 0 0  c00cR (0RF 0  0| 0R<!0N P6 1 0 000 00P0 0f000  ? 00`f``X 0p`0`j 0  j V,@P.000c< 3S 80< R D bP 0 0b, R8H00p0  0,0S04 0 04000 p(K -LM0 , p@`0S0 p, W00 `@W 0 VZ 000c< 3S 8 <0SDP0 00b 0b0, S  00` 0p@0 0}G0P 2 00$N800 YN000P0@80D080 0000p0 p@0I0`0g0GjW@1X LgPD 0 < 40 40+P !00@0H008@L000@0P[UP peWP@@ 80 00P  p0 p0 0, 00 0`0`0UP!U  \0`000000PePp0PPeP 3S80< R DP P0PbP0PcU W,0PHH(KĜc\  c0S0 /H/ -LM0 4 P`0@``h8 B0SV0SS  Y ,0 !PUK `V Vp p, 0< t=P<>,0 g`g0,0 0  ? 00pgpZ0 R 00 B  0  l lY408   c00RPV0 0 0(KoH(K -LM, p`0@PPe\ 3S!80< RDPP0P0Pc0PcU,PE0U00  |0`e@PPP2LFVPD080P0000ZP0 00 00  B pVVF!p C`g@pVP 00, 0(KM0# SЍ/ 0-@L h0@QX0P $0S (0$P<0, PX0=U 0 0hQ0xc 0-@L VX0P @0S@PPX0!U 0h|V0X0 p-QL@P X0 (``F(`X0 V0phdVp0b -L0@Ppa9 $`V6 X !?Y`/0 Z `fFa`X0 X`  0S ,0 0 $ ,0`V0S0S `VX0 (00(00bxc M-LM080 d04  p0,0 40`0< @H $0SD 0 @0S_P, K 4 0X0; Z ,008 S 0< S$0 S] $ ,0$Z1%U X0e 0U0 P(0 'P @   R, @0 ,0$, P004  8  <  $ S, <0 S0<0(00S0  00,00,00,0(00(0X0 U  (K0bI -d0@ p7L97$0S& X0P` 0 U(PUV  ($tp h0 $h ::#0,0(0 480<8@<DDHH}LPzPp1$u!0Ql$i,f0S00 h^p0t4 X U$R(0O,8p (H0<E4Dp >8H;<Pp 4@p/?? -LP@Qp 0' 00c< 3S80<Q DP000a0aS00S dC 00@0`00000)00c< 3S80<Q DP000a0aWS00S C( jR`0 /?00S0 i000000< 3S 80< RD P000jS00S@ @00@ 00P 0% 0   t0,   , $ 8 L5$ 18<,07 4X X000c< 3S 8 <0SD0P 0c0 0b0W m@W[eP00@ 0  44PGqpG4XX000c< 3S80< R D bP 0 R00S %@jZ`n>`P  @0``fl 3S 80< RD` P0`b`0`c` V `! !0P f00000Z pgW` 0  0S P00000c< 3S80< R D bP 0 0bS00S ?P00@ 0R 00  b 30 ]p PE000c< 3S80< R D bP 0 R00S ?jU`=`p@0``fl 3S 80< RD` P0`b`0`c`V`!  0p00PfU 0`   cR00S 0000 000(00 00@(Ktcc/?@ -LM@A 0K#D QC00K`8 8#4`#/$0H 0!0  0 0/ḩAlcc+c-// -0L|M0pK`P@` (0 -(0KX0 00 0 00pz3 00IPZ(W$Ka -PL4M P@e^@P`1 `00p 0\ 0\  @@@ @$`(pHQ<1 P00P 0 0  @@@ @$`(P,p3Q000 '00 00 0S? 00 @@$`(P,0pQ0 00l00 0 0P @@ @$`(P,P0pQ@PS$Ka$@`bHA@c@- -LDh< -L 0 0$ `cc -LMP@pg`T@3@#T` $K  bKjP'f K p-LM0@S! C   0C?S RP0KP `P0X``K ;`P c$P`Kp -L Mp[!P` @8d0S/H0 ,X 0S 0 SP <9d%0P S X   0;P`$4@T9!(K(?c p- 0LP,@!,'`P@ #p - @L,Pp'`P/X0S<`& `P <1 01}K<$P=p.n.{`^v\~Z!N -4L8M `@ pD ,0Ks 7Pa@  Q 8<QDP``Z9\00c< #R 8 <0SDP0 00b 0b0Z "=Zb@0000@ ,0 @ ,0  , L0 L0JJ !P'% @K,KP uP |< P80K0<0K000K 000 0PP Q<0 Dp 000bS0 0  4 K <K0K `P40"P 0DK<K0 K0`PU< 0`000f/S0000  4 K <K0K0 `P4` 8,<Pyq 0   P030#P0#S ` PP*/ R  U 0   P030#P0#SD0PpPP*?0S006  P030#P0#S0W#2X ?0S00 0!1p  0 Wr!10 R 0b0R?o$ 0c0<01018;(Kc@ -LTM7 `X \1, P0 0@80 pXT  1 T P06X  D ,0KXP@  ` 7 Q8<P DP `l` aZ8^00c< #R 8 <0SDP0 00b 0b0Z ;Z`@0000@ ,0 @ ,0  , \0 {\0J J !P'4@K,KP P/  ; P800c< #R80< R D P00 0b 0bS00S ;@0000@ ,0 @0,  P 0,0 80KT0<0K000K 000 P0{PP QX" <0 D 000bS0 0  4 K <K0K -pP401 P 0DK<K0 K0ApP%U 80S 0S L_< 0pX0 4 00gS0000  4 KX <K 4 0KpP4p 8:P 00 0R 0X| <00` P L L0l/? 0PK 040` L` P P KP L !0P0K Ġˌ4h d0 hK`P L` P0K Ï!ȟ0 Ġ h0K R0\( ,0 $ 0 $0m`j 04 b`$^0 8 <0@ D0 0H L0<0OL GB 0 $H L00 408 <0@ D00|0X89T,(K踩Ac@@ -3L@HP`X ʀ0p !p0 !! 0S000 430S'   p0 pp0 # 0p0 ! 0  !!0 ,Zڨ22 PT<0PT0 00SdSX0d0X0  : 0S8: R / R ,Ӑ Ր Rp R0Ő R(Ð   $ R / R ,ӌ Ռ Rp R0Ō R(Ì  ( R /  R ,  R* R00  40SS(00  80S S00  @0S S0D0 S0H00Q0p00D  S00SH  wD0SH] 08? P P踩AԨA c&@B@ -L@M\0 3`P0p S4 8J0 Ȁ00́10@D0 ,* 0H0 $*0(L0 0P0 v?T0 ~?X0 $P0 0 S 0!12 2 0X0:0000(00T0刐0\0 (0bPrPp 0 D00H00 @S  0b0?oR0c0<0D0S 5PS:P0:C0 ,0KPH,0 XP7`!;6 0  0S p   0p,,P0S00L00L070 Ph008<0088D000p K40A30<0H@PpTpL 0pK0g00  0  g 0  ? 0`0pK0`0 `  < g<K ,0K/P P4K0080K000K 000  \1P   刐Y; 80 P000bS000  @ K 8K0K 0P@ 6 0Rd80 000bS0 0  @ K 8K0K 0P 40 40PY@00  \ X  0T z P L 0x t 0 pt xK)(  ^H 0 0 R40S80Sh0 Sl0S p0夀S00x0  x x 8D 0 000bS000  @ K 8K0K /P 4P@  P 00DK8K0 K0:PDXP \ PK0x03\ KkPx \T0H0 t x0Y T0H 0 L 4 P080Qpq80 000bS0 0  @ K 8K0K P@00 P04oPP p`   g  Q  P R  PR  1p 101  :pP  1 91pp(K0 8K00 K0pP 4PEDpx0S 0T <h@lD p 4뼀X2|W l| # 00 0\0R0S | 开0l  帐| 倀 c  Q    |0SPP q*똀X p`KP`0p0C`0 r`0Sp`K<!뀐U|P(K-@E@c@.bAc -L\Ml0 d0p 0h @ |7Pp   p 0$ H 0 d0 00KD@ "Y`@  W 7 Q8<P DP@@@a@`@@dL@aZ4\00c< #R 8 <0SDP0 00b 0b0Z Z@0000@ 00 @00@   000 JJ0 1P'1@K0KP &@P, 00c< #R80< R D P00 0b 0bS00S @0000@ 00 @00  P 000 X?@*d0@@0 a Q 8<QDP``T7\a #R 8 <QDP a 0b0T DT 2@@0000@ 00 @00   000 DA@D01 h I @K0Kh 0@P l0080K0<0K040K 0D0K0 0'@P AY <4 `000bS0 4  , K <K4K pP,0 20RpG< 4p000gS040  , K <K4K pP,p 8S@` \ X 0p0 T P p0pt0 )* 00L S 00S 4X80Sp pp<4 HP 000bS0 4  , K <K4K r`P,0 8 @5bP `0HK<K4 K`0PHP 8p0 p0@!Z` W 0t03TK` KPYT0H0 t x0X T0H 0 L 4 P080 80Z' '0 `d D0TSP(Kc@c - ML0  0 -LlMPd0 0娀@ p>@|x p  x   H00l   `00KD dp t h@ p@ d tP\ 7@@@ Q8<P DP  a `ľ a T9^ #R80< R D P00 0b0a 0 b,0c0T T}@0000@ 00 @ 00 0 t0 t0DA @D!P'1@K0KP @P, ~00c< #R80< R D P00 0b 0bS00S @0000@ 00 @00  P 000 Z@0h @ Q8<\ DPlnľ aT7Pa #R 8 <QDaP`T ;T@0000@ 00 @ 00  0 t0 t0DA@D !p @@K0Kp  0@Pd @R_ 7h @@@ \8<^ DP  n jnl T7h\00c< P 8 <0SDP0 00b 0b0T T@0000@ 00 @00   000 0DA@D010 P'3@K0KP ,@P. 000c< 3S80< R D P00 0b 0bS00S @0000@ 00 @00  000 0 PYp?@@0l @ľ Q 8<\DlP a T7Pa #R 8 <QDP a 0b0T GTx5=@0000@ 00 @00    000 DA@D01  L @K0K 0@P  0080K0<0K040K 0D0K0 0*@P AdQz <4 p000bS0 4  , K <K4K P,0 ,60Rd O< 4000hS040  , K <K4K P, 8U@IP T t L  0` \0  |0 뀠KX t0 )* 00d0 0tS00S4Y80S <H` 4 000bS0 4  , K <K4K lpP,0 8@\P p0HK<K4 Kp{0PH` 8t0 t0@Zp X 0t03`KT K⨾Pd\T0H0 t x0Y T0H 0 L 4 P080<4 p000bS0 4  , K <K4K P,0 @30Rd N< 4000hS040  , K <K4K P, 8@O0t0 t0` \ X 0t0 T P t0 | 0K L t0# " 0d S 00S 4Y80 S <HP 4 000bS0 4  , K <K4K pP,0 8I@p>P p0HK<K4 Kt p忽0PtHP 8t0 3t0@(\p X 0t03TK` Kt Ptd RT0H0 t x0Y T0H 0 L 4 P080dp p8 p0Z' '0' '0 `d W0 `d D0TSP(Kc@c -0ML     \!  0' K踩A -L|Md0 0` @\0 0`X <T0 0P0 L p  b, #R80< R D P0 0 c00cS00S @0000@ ,0 @0,  P 0 ,0 尽@0   b,G :@0   b, #R8 <Q DP   a00cS00S i@0000@ ,0 @0,   \ 0,0 1 000 0 00000 0 0&#R8 <Q DP   a00cS00S 5@0000@ ,0 @0,   0,0 \08 K0ǟ0 \1.P T RF `0<0 D0 000bS0 0  4K  Px40P 0DK 0PkD ` Y<0 000bS0 0  4K  PR40  0 08 PI<0 000bS0 0  4 K   P340눐 ` T0< 0PS! 000e S 000  4K  |P4Pp`m l` p p0K h d0 000eS000  4K  ZP4PN 0h d0 H0@SP8HP(L0lcY0 00000f00  0 `f`0 0L 0Y80ph0K 0 0PḐ0L 0C00  \ L 0 B  0$P 8 P 00e 0 ػ00i00 0 i< 0P0 00aS 0 P  PsP T0< 0PS 000e S 0 4K  000eS000 4 K   PK4PP0S# T\ \ 0  t0 0x0 xK  |  K T 0 0T RPPzP0SPP㈐P`!<0 000bS0 0  4K  eP 8?40U0 SP#*PpP3X 8 X P0SU1 P PP L R0b !008#80p0 00h00  0 hP0S @0@7887 P(Kc@A -LBMd0@ 0! 0 0`x ,0 0  0 P  R  0?R:,000\ 00K$7 pPD PP Q8<\ DPlnľ aU7P00c< #R 8 <0SD0P 0 0b 0b0U U 7D0000D 00 D00   000 EQPE01 P'պDK0KP %PPD0   b, #R8 <Q DP   a00cS00S D0000D 00 D00P   000 1 000 0 00000 0 0 M0I<0K0@0K040K 000,: \1sPP tQ@L 4 000bS0 4  8 K @K4K 'pP 80P 0LK@K4 K0;pP <PLLU@4 000b S0 4  8 K @K4K PP80 @pK4K0 0` @ 4P0 00e S 040  8 K   PP8P  0@S`0\c\0  夹00000e00  0 PeP0 0 0\D0!00 0K  [` 0 0 S00 0 0C00 0 B  0 P < P0 PPf P V00e00  0 PeP 0\0 0X0 @ 4`0 00a S 4   aPPGP @4 000b S0 4  8 K   =PP180Q    ! ! AoK`PP `  CK   P@ 4 0 00aSST040  8K T PP8T K<@4 000bS0 4  8 K   PP80P @4 000bS0 4  8K  PP80PP@U<dHP@ 4`0  00fS 4  8K 0P <1 J1P8` 7S P >P 0, H0 00d H0K␾PHH0X0,0 K,K0Q= H0,#T001:C6 0X0S2\, (K0$0!| |T h Kx%0 00aS040  8K  ^PPR8R@ 40 0  0aS 4  XPP>,P P 0,0 @4 000bS0 4  8 K   *PP800SP0PP`@4 000bS040  8 K @K4K PP <>8 0 SP#*PpP3<  RU00 Q0\a ʷ008#800 00e00  0 PeP RP @0@7P887,P P "(Kc@A? -LDMT0 d0P 0P p T7L ` L 0$ H 0 L0 00KZ@D  [ 7 Q8<P DP`l` aY6^00c< #R 8 <0SDP0 00b 0b0Y xYD0000D 00 D 00  0 X0 DX0I I !P'1DK0KP P, 00c< #R80< R D P00 0b 0bS00S 9D0000D 00 D00  P 000 JX?p"L0D0  Q8<\ DPlnľ aY9Pa #R 8 <QDP  b 0b0Y Y3D0000D 00 D 00  0 X0 X0II !P DK0KP 0;P ST00<0K0@0K040K 0 0ˮP py3VX Z @ @4 000bS0 4  8 K @K4K vP80j@P@T<H_@ 40  00hS 4  8K@K4KVP8 < F0S ,0 @QP,0 P ,0 P{,0G7S P ѼPs,P 00d,0K %P,0 < JXpZ, @Hp 4 000bS0 4  8 K @K4K P80!P 0HK@K4 K0PHp0S< X(K p @K4 K 0 PHp p< V 0SY,00 W ; (Kc@ -LM`0 40 PO0,0 0S2$@|!\1 1 \xp 0 0L1   G"   G$Gvp  0 p 0000zS0-\10 0P 40S 000 \10 0VP`  *`V \0\10,0K00 ,0@@`D$((KM@Ab@? -LMpP@d0d `S IT d SD0S0@0S0S  0`P,@ 0 000000\1 0 0   XX0S    T 0S   ㇽUKYT U B@(K踩A -LM@p P0`SP1 R9 S @0S K _ P0S N00 \1FP \10  0@0S P KP0S7:7 0` d0W $Ko@A -LlMp`| d0 0娀 ?@ d Z@ d $ H  0<0  t x  00K, < p@ ZPH  W 7@@@ Q8<P DPi `i a T4\00c< #R 8 <0SDP0 00b 0b0T @ TH0000H 00 H00   000 DA@D01 P'1HK0KP @P, 00c< #R80< R D bP 0 0bS00S  H0000H 00 H00  P 000 x RPn ?@np0@H0  Q8<\ DPl iľ a T8Pa #R 8 <QDP  b 0b0T  T< 0H0000H 00 H00x   000 |DA@D01t x  嵳 t0HK0K x0@P Z$ 0sH00  a #R8 <Q DP a 0bS00S f H0000H 00 H00@   000 :002, a #R8 <Q DP a 0bS00S 5 H0000H 00 H 00 0 * H0 a #R8 <Q DP a 0bS00S  H0000H 00 H 00 0 h) H0 a #R8 <Q DP  b 0bS00S  H0000H 00 H 00 0 ( H0 a #R8 <Q DP  b 0bS00S  H0000H 00 H 00 0 ' 040qsh 'P R4 H0 a #R8 <Q DP  b 0b S00S p H0000H 00 H00 @  000 400<89YH0 a #R8 <Q DP a 0bS00S ; H0000H 00 H 00 0 $+H0 a #R8 <Q DP a 0bS00S  H0000H 00 H 00 0 <@0qsh h%P R4 H0 a #R8 <Q DP  b 0b S00S  H0000H 00 H00 @  000 40<DH0 a #R8 <Q DP a 0bS00S  H0000H 00 H 00 0 $+H0 a #R8 <Q DP a 0bS00S r H0000H 00 H 00 0 IH0 a #R8 <Q DP a 0bS00S D H0000H 00 H00@  l" 000 0T2000 008p 㦹<Dp 㜹t0 0@0K0D0K040K 0<0K01\1 @P AP`ZP `@ D4 000bS0 4  8 K DK4K @P80 @ddPP`T D4 000bS0 4  8 K DK4K @P80!`P@V@>H@,D 40  00aS 4  8KDK4K@P8 @#c@lc4A?|ccAd L0Kt@P @ `L0ZX`6 D4 000bS0 4  8 K DK4K Y@P80 @U HDP D4 000bSST 4 DK4KT I@P @XU@@ (K(` DK4 K0I@PP` @Z D4 娀000bS0 4  8 K DK4K P80 10R p ND 4000jS040  8 K DK4K P8 @ @_00 0h d ` 00 \ X 0p l t0 T pK0# " 0p S 00 S 4Y80 S  DPp 4 000bS0 4  8 K DK4K 㝿P80P PKDK4 K0 寮PPp @$@%\㨀 Z 0t03\Kh K ۮPp0ST0H0 t x0Y T0H 0 L 4 P080 @P`0Z' '0 `d < T00R0SPV 4t\1x 0,0K0 0@P!,0X`00S0V0S@ T V W  w t g|@0`z(K -LtMp d0`娀 0p D 0 p>ph  h | 埫0t0 0Y( L 0000 <  l ,0KY@@  |Y 7PPP Q8<P DP  a `ľ a U6^00c< #R 8 <0SDP0 00b 0b0U U@0000@ ,0 @ ,0 , |0 |0EQ PE!P'1@K,KP PP, 00c< #R80< R D P00 0b 0bS00S @0000@ ,0 @0,  P 0,0 㗮0S@ PPPx ľ P 8<\DP ` `U8x0S00c< Q 8<0SD0P00a 0b0U :U@0000@ ,0 @ ,0 , |0 |0EQPE !  ?@K,K 叿PPY' 0s@00  a #R8 <Q DP  b 0bS00S @0000@ ,0 @0,P   0,0 900, a #R8 <Q DP  b 0bS00S @0000@ ,0 @ ,0 , ( @0 a #R8 <Q DP  b 0bS00S @0000@ ,0 @ ,0 , ( @0 a #R8 <Q DP  b 0bS00S g@0000@ ,0 @ ,0 , h' @0 a #R8 <Q DP  b 0bS00S 9@0000@ ,0 @ ,0 , & 040qsj &P R6 @0 a #R8 <Q DP  b 0b S00S @0000@ ,0 @ ,0P  , $ 0|0 |08Y@0 a #R8 <Q DP  b 0bS00S @0000@ ,0 @ ,0 , $+@0 a #R8 <Q DP  b 0bS00S @0000@ ,0 @ ,0 , <@0qsj $P R6 @0 a #R8 <Q DP  b 0b S00S `@0000@ ,0 @ ,0P  , $ <|0 +|0D'Y@0 a #R8 <Q DP  b 0bS00S )@0000@ ,0 @ ,0 , $+@0 a #R8 <Q DP  b 0bS00S @0000@ ,0 @ ,0 , l P@h`?P@@0t PP Q8<P DP`l` aU:^a #R 8 <QDP  b 0b0U U(@0000@ ,0 @ ,0l , |0 t|0EQPE !p l 嬫p0@K,K l0PP clc4A@?|ccAYI@0 a #R8 <Q DP  b 0bS00S W@0000@ ,0 @0,P   0,0 0#0000 008p 㹳<Dp 㯳 0080K0<0K000K 0D0K0l1 \14PP rQYh U@<0 000bS0 0  4 K <K0K @P40`P@N <0 000bS0 0  4 K <K0K ɺ@P40 8`P7@P@T8@U`HP-< 00  00aS 0  4K<K0K⣺P4 8:PH0K d哰@PH0X@ 8P+@<0 000bS0 0  4 K <K0K zP40_V liP <0 000bSST 0 <K0KT nPPV (K`$@ <K0 K0`sPL@ 8P<0 `000bS0 0  4 K <K0K 7P40 40Rl N< 0000hS000  4 K <K0K P4 8P_0|0 |0d ` \ 0|0 X T |0  0K P t0# " 0l S 00S 4Y80 S <Lp 0 000bS0 0  4 K <K0K ɹ`P40P LK<K0 K0| ۨ`P|Lp 8PP`(\` X 0u03XKd K| P|l0ST0H0 t x0Y T0H 0 L 4 P080 @ ` `8'@`D U00R0SPu3UU  TX (0K $ #'\! 0  PPL0X@ U T pP0@0V' '0 `d H(K -LpMpd0` 0t 0 CRh-l 0CS>0l0 -@> Yl  l  娠00T0   0<0 40KEYPD  [ 7@@@ Q8<\ DPlnľ aT6P00c< #R 8 <0SDP0 00b 0b0T TD0000D 40 D 40 4 x0 x0DA @D!P'1DK4KP E@P, 00c< #R80< R D P00 0b 0bS00S D0000D 40 D04  P 040 0S?@D @@@p  P8<\ DPlnľ `T:p0S00c< Q 8<0SDP000a 0b0T ]T K%D0000D 40 D 40 4 x0 'x0DA@D !  `DK4K 尹@P eYD0  a #R8 <Q DP  b 0bS00S D0000D 40 D04@   0 40 90sD00  a #R8 <Q DP  b 0bS00S D0000D 40 D04@   040 800, a #R8 <Q DP  b 0bS00S D0000D 40 D 40 4 ( D0 a #R8 <Q DP  b 0bS00S D0000D 40 D 40 4 d' D0 a #R8 <Q DP  b 0bS00S VD0000D 40 D 40 4 & D0 a #R8 <Q DP  b 0bS00S (D0000D 40 D 40 4 % 040qsj %P R6 D0 a #R8 <Q DP  b 0b S00S D0000D 40 D 40@  4 $ 0x0 x08YD0 a #R8 <Q DP  b 0bS00S D0000D 40 D 40 4 $+D0 a #R8 <Q DP  b 0bS00S D0000D 40 D 40 4 <@0qsj \#P R6 D0 a #R8 <Q DP  b 0b S00S OD0000D 40 D 40@  4 $ <x0 x0DYD0 a #R8 <Q DP  b 0bS00S D0000D 40 D 40 4 $+D0 a #R8 <Q DP  b 0bS00S D0000D 40 D 40 4 00CSD0 a #R8 <Q DP  b 0bS00S D0000D 40 D04@X   040 h0 h ::#Vc@/?lc4A?|cAc a #R8 <Q DP  b 0bS00S xD0000D 40 D04@    0Q40 0A0l0 00088p ֭1<.Dp ̭'0pp0<0K0@0K080K 0l1  \1Q@P PAPY p P< @8 000bS0 8  0 K @K8K @P00DpPPF @8 000bS0 8  0 K @K8K @P00(PP@U<rH@@ 80  00aS 8  0K@K8K@P0 d H0K⵪@P <PP,H0YXP/ @8 000bS0 8  0 K @K8K 㛴@P00(W P @8 000bSST 8 @K8KT ㎵@PZW@@ (K$P 0@K8 K0哣@PLP < W P4 \1 0,0K00@P,0XPY @8 p000bS0 8  0 K @K8K GP00 40R l N@ 8000jS080  0 K @K8K *P0 < @0x0 x0d ` \ 0x0 X T x0  0K P t0# " 0l S 00 S 4Y80 S  @L` 8 000bS0 8  0 K @K8K ٳpP00P 0LK@K8 Kx 0pPxL` <a@=\p Z 0t03XKd Kx Pxl RT0H0 t x0Y T0H 0 L 4 P080 <=T U  t0P0Y' '0 `d (K p-@ P0L 02`rVV p -LM`@0d ,0 ,| R 0 PZ p0   t0 @K4K`00 @@ pϟ|`0Q0`0 (0L0   0<0 00Kp a| @D R b p7PPP Q8<\ DPlnľ aU;P #R80< R D P00 0b0a 0 b,0c0U UD0000D 00 D 00p 0 0 0EQ PE!p P'3pDK0KP YPP-   b, #R80< R D P0 0 c00cS00S D0000D 00 D00  p  000 P Ԣ0S/?P-D PPPx  P8<\ DPlnľ `U:xP00c< Q 80<QDP000c0a0U pU ^D0000D 00 D 00 0 0 :0EQPE !  sDK0K óPP |D0Q   #R8 <QDP   b a  b0, cR  R %D0000D 00 D00P   000 R340D0  #R8 <QDP   b a  b0, cR  R D0000D 00 D00P   000 bb0sD03   #R8 <QDP   b a  b0, cR  R D0000D 00 D00Pȟ   000 00/  #R8 <QDP   b a  b0, cR  R D0000D 00 D 00 0 ' D0  #R8 <QDP   b a  b0, cR  R UD0000D 00 D 00 0 $' D0  #R8 <QDP   b a  b0, cR  R $D0000D 00 D 00 0 `& D0  #R8 <QDP   b a  b0, cR  R D0000D 00 D 00 0 % 040qsp |%P R9 D0  #R8 <QDP   b a  b0, c R  R D0000D 00 D 00P  0 $ 00 08|_D0  #R8 <QDP   b a  b0, cR  R {D0000D 00 D 00 0 $.D0  #R8 <QDP   b a  b0, cR  R KD0000D 00 D 00 0 <@0qsp "P R9 D0  #R8 <QDP   b a  b0, c R  R D0000D 00 D 00P  0 $ <0 0DD0  #R8 <QDP   b a  b0, cR  R D0000D 00 D 00 0 $.D0  #R8 <QDP   b a  b0, cR  R D0000D 00 D 00 0 Z  #R 8 <QDaP`Qc@lc4A?|ccA  b0, cRQ iD0000D 00 D00P  000  0Q200000 00)8p ǧ"<Dp 㽧0 A0<K0 0p \1EPP Q|\@P : @4 000bS0 4  8 K  PP80PP@E @4 000bS040  8 K  ٮ@P8 CͿP@\@<iHPg@ 40 0 0a S 4  8K  差0P800dH0K ᪤0PH0|X0Pt0 . @4 000bS040  8 K  ᓮ0P8 sU 兿@偿P @4 000bSST 4  T ㆯ0PYTU@@ t(K $ 0 0劝PPL t  <UP D\10,0K00  PP,0X0t0 |\ @4 0 00bS040  8 K  :0P8  0Rn@4 000bS0 4  8 K  0P80 <0 0P0   ` d  0\ @ X T p l 0P t0 @0p K "!@@^@ @x@ 00 R40S8 R   x P0p0  h0 Sl0S p0 S00p0 x p @p@ @Lp 4 000bS040  8 K   姭@P8  噾P  0LK  0巜@PLp <,P*@P \ 0u03XKd KP0p0 QT0H0 t x0x R T0H 0 L 4 P080p@P @@ <U |VU00Q0Sg R R `VP@|@\00P0S`$ dPK00s 40s0 0  4 080<0s @0sd0<0`0K @ 0D08t \1PP ) t gᡥt P0 t0S qU 㐥0@'T '0 `d Z(K` -L`Md0 d0p PA@KHL6  `D ,0K 7@a@  Q 8<QDP``Z9\00c< #R 8 <0SDP0 00b 0b0Z Z@@0000@ ,0 @ ,0  , h0 h0JJ !P'Ḝ @K,KP P  @%@0 a #R8 <Q DP  b 0b S00S n@0000@ ,0 @0,  0,0 = :d70080K0<0K000K 000 0b@P A<0 `000bS0 0  4 K <K0K P40 (30RK< 0000hS000  4 K <K0K P4 8@\ X T  0P L0 t p0 h ռt0 tK)0( SH h 00S 4Z80S <0 Dp 000bS0 0  4 K <K0K 㫫`P40A埼P 00DK<K0 K0h 彚`PhDp1\` X PK\ K0PYT0H0 t x0Z T0H 0 L 4 P080T-< 0`000fS000  4 K <K0K i`P4` 8@1  P  ㏛1,@91ḻ8(Kc@c1u 0-LM@P[000 070<7K0 -LM0Q 0 \1鸩A -LM0 @R" dt     \1707  \1~ 0` d07 07<鸩A 0  R /0S*/ -L MNP`@Kp } } 0@@K 0S } @ p{_0 0S !  K -LMPp@0`K  0S( }P@T 0 Kdb -LMpPX@,0  `hR`` บX, P@fT``FbV  ᠚, Z0F$RT  Ꮪ@,  -L'M2    00 S 06/7  0"S d7p777 -L9P 7? -LP`@p9  \`(000$p00 00(0080$04p 7/0H0,04,0 ,7i67? @ @88? &@ @@ -(0L@$0!ki8P 05/}'P$04` 6/ ` PdU0S (pp$08Pr ;5/ -$@` 0,`00$0PL4p_ 8/$04W 8/$04`O 6/,0`0,0$04C 8/  000000,0 00300 000 000 000000 0`l86000 p-@ BLP0R-/T/@// 0"S*$ 0"S $04@ 4/$0`8@ ;4/03 6  0"S W6p666p`8 8#4`#/$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A -L -L 0-LM@2 @ P DH2 A!>A0B30,0X 0000q70!  0,2U0C,2 @2 D H2@2 D H2@2 D H200S 00Y&0S#7S  0Q!Ġ0!AƠ \0!Sp 4 80S< < <08 7 0W P ,80S< < <08 7 0WZ0Sp L P// X|7S ,20C,2(K1U@ 0-0L@0P<80h 0-0L@0P.80h -LM@p04P0`t8S zpPT{ .800(2S82\1 1S( P0 0PP0!0P0u0P0RpTS p &  0#$7 S9500 0$0'507" 0H!(7, LS0 0>0 00 Z00 0 R X 7S  0#  0#'0 R)%00 0#PP0P0]. P,(Ko(K踩A @1@8@M 0-LP@D0h0$ R $ :80 t(R .|!A/ -LM`@ <@p80 , 0<< pG4 S00Pp#7S 8, Q76L0 80,S'&0702600 < @Pl 4>0S :S @ 0(h00o` 00 h07S@7S7GS ᴃ0$ 0#YpP8Q(, % @0<007PP 08  7S0 00330$ 0"P 0P(K -LM`p0 @t8S 0 4P0 0<3@040 080  0"7S8,0K0 40 ,0 Q  ,0'R&* ,0# #0 ,0 $0"XI,00L,0p Z7Sh8'08R)%00  0p"@2 D H2  <0M!40 80@2 D H2 Z Z Zn |200 <0PPQp~ #I$0200,0s04pS 8yQ`A K   0RS0!1` V03 1:0, a 0 0  0 0  0 0p7S 0  , 0   0S<0@0@0000p0<0@@`~ 4#000P~ # X 570g(Kd8?|8?8?8??@8?8? -L@{T0t8- -Lq0p8 p-@pLP sP!m`PK"wT2S ?H0$S8X[Pp$ b -LM@P! TR?`>>PU`^>PU`0X8iHɟH9 r p 04  WX &042:042<"7?  ,0 PTR(L2,P2T噇[03P 7 S9500P 7 S95003  0P 7 S95003 P 0P 01 3'`VZ7 S950V00F00130'R  0`?VW` 0  TrQ< 80 < 80U `,p0,4PH4 L0  Z 481S@2 D H200Ņ@D00\T10 1m(K &@ZYA@@@ -LM 0`QP p p <GOKV < 0 KW3A?@ -L@pP`?0s S0s  SP" Q ӁP P Q ʁPP Q P P Q PW 7/ZP`FV -L@.0003/ -X0L (Q@ -L<1 SO :L0P   c4(0 + - )(000Q?0@  Q TC QG X00X0$Lp-pK ,`0 03/pP@@ p-(0L@S PX`$ 01S 0S ` X00X001X  D  bQ:@ Q0Sph H0 03/ ,003/@ -LMX0@`P p h 0  0B`†0⩒ 1!,0 >P 0 <` 8p ,0S,00K S    $03/, Q  $03/   `$03/   $03/   $0p3/   `$03/d`, P0S<1  Y㰐K Y    $03/Y   $03/   `$03/"A@  $03/   $0p3/   `$03/d` PZ㴠I Z    $03/Z   $03/   `$03/   $03/   $0p3/   `$03/d` P0 , 0 80 0Rp40, 0S)   $03/ 0, ,  +  +    $03/0P(K -LM " P@H`K   03/ P`pK00K 0@;K0s/ -LPb, Q0S S @L`0S V `V7$!(10a. 0 S) // /(/0/8/T/\/d/l/t/|/84n,($ e\0S R  N@0 E0S S=: 0S 4p .0S pA&$p 0X0S Dp(0S AQ  ,p0XQ 0 0 0 0 0 0  t0@ d0 T0  D0  40  $0  hATo`V/KO0S Z iE@V@b@u@@@ZYAW3A@@@@@^A@@+@6@<@J@Z@y@@@@@@@@@@&@<@A@F@Q@V@gAd@t@@@@@@@@@@@@ -RpL M`@0 $1 Ss (1 Ss> " ,@ @PY QV 4 uP4QZ,@ YH!0S ,=0S Y 62Y.0 W 0h R 6@P h v0041 p@0410C R PlC/v0B,@  X P(K49?a@ZYAW3A@0AA @C@`8 8#4`#/ -@L -@Lp@-0@$? lŸP@$? ?RPP @%?  B`P%?  @,? R\uP @%? A`P%? @,?R\aP @% xA`P% @,R\MP\ 0A`V @ TR\ =P\ @`V @ TR\ ,P @%? @`P%? @,?R\0,?Q T@,?\ 0#?00S0R  Rppppa W 0-LP@@Q P 0S@0 -pLP@`Zp @X - 0L 0P@a aw@ 0!/$0H 0!0  0 0/ḩAlcc+c0 -SL@ 003/01X 0S(Koc 0S 0,03/00(K而b :#OP 008 00T 0h0逌b -1L\1Pa 1D0@0S[0h!刀`V !D ` #2 1SQ< 1 !TTU 0T1T40L03/0S p 03/03/0 pᤀ 03/TT  0?|003/p0 3/U㲁 0  !!80 00(0TTDV0000踩AchAb00`000 4 `0@ 㕈 0I@I`,P <,p0S, 5plPd F"  1SX84#1  0"p` 0R P  ` V@iyP JT:tBtb<03/03/03/010ˌΌ0ˌΌ0;>01 0 /Da -LMPP@ R R  ! ! ~p~.p `p, 0 L0$& r 3 V R$* 0X;001FVfF7 R 40 8 .P408M 800V00S$ ?, A0XU.  0S HXhF X  000!:JZjFV(K@4cccc$c c@(@0/xb p-PPLM`@ a' 0@SKpxb@-x 0'R @PA@P `S:pA`pUT Qxb@-X 0'R@ @S:L Q \ xb|1 -p l1@hq0ddadQ `L00T0 LH @@<@8@}0!0;0SSP@@@1+ 0+B 00  A  0   UA 00. 0 0 0 0 0 0?00?蠄cc 4c ccccccc$c c!i !ic0cccLcchc,ccTcccĄccc/Xc/8c 0-0L@`Ppn`n`%:PH!5K #;!ZzjFVo0?0000? AAZ@ -L@z`$P :Z!#U L0HS @03/003/J T:T:003/0> ,,0 3/ ,,0 3/ P W  ,,0 3/Z W ^^T0 0 ! ,0< 3/ikkpkP0 o3{0 \  0pPPKH0 0@0 _Phm ` 0\(K耥blaa@0A@@@5@[@@e,@x@ @/@@ @@@ @l//G-$M,9IZ;H ,ᬁrᬓ P0X 0@@  P@ @P\PP P \@T& `@ P PPU\ ` @PPP@ P@P ̠D`Pf( ͠@P0$Ѝ0/ဥb -D0L Q ,03/0S O뀥b@ - D0LQ \0`0  (K@@b@@@E@8/ @/cH?0X0o@@@ -10LM0@`ᬠ,0 , 0!v  P 07d Q DppQ 0S PU Lr0M2L280S0 -LM@c0   p`, , 00 QR XJ !O RU\ y0&A0S 0 ^ < 0 A   YCPW "020L MLb 0D0Q @ P0S \0S X0   @r! 0B"400CS40  A!,08 R,  ,  0  @8 !0@ 8000X3/ 0! R8 08 !01P p`V,  , ^    (K@ -L M00 0@PS, ` Z.0S+ u0  Pp  0sQ3# 4 u  P4 000p` W,00000(KSHh2h2 -2LMP 0@(0C*st`0d0L  K0pPk 0SQ eP`X, K0pPZ,`VQ ePO0<00D00 78 H0R R22H0 0SH01H0VH01H0 `q 0 4P0! @ 8 018 @@0 0s S#4  4 J,@80 8@@  R%40040pK茥b -L M`3  k=0s,0  0R 0,0 0 000C00 00 00S   P00S So84000Z$ <0S S`@0 R[  " x 00//ᐥb@ -0@L\H 04!N?\0\022\`0dE`@p  P;<`pT0X`LTwP2`0hP4p@0 "p0`00 0 0 `0p0 `0$`0( 0,p1(`$0BP @ @ 0!p 0` 0 0 0 0  0$ p 0,` 00` 04 0 p @KlG014@ @0 (1<0 000 \0,0 `0(0 @00$0 _  P@0$00$0 @K P@0P P 0 0 0P 3/ ) K@@A@M0@,L N@@A&@G0DAB@F0! @a^@d 0-@"@L,0Dd 3/\P@"D0\0d 0$0 03/$00 03/$00 3/M>$0 03/ E>dC>$00 3/H;>D`P$003/P}P/>Up N' -LM@P`p GE0 T0p `00@~0T0@0P/PU@`V$ 0 0, RP0  40 0 400X  R Z 1 !P` TP(K@- 0 lR@b@`PpVQ:@TS?P00S b0S Rp3@-@T̠0    0   -`L@P p 0p0ZQ :00000d0 0AS` 0 0PP0Q  0 000 ` PP -L2LM0`pXR@@XT2 D>Q d>`0SP sR PfU1 XP1(` X h&?x1xPP0  EPWXF a, 0VpP= 0`0 ?0 =0, KS,0S@ jV! T*0S P0 00 P\  RPLQPP`f10U0 00 0(K褅cbLacAI@H? -LM PQ< @8 p4P `  O`P p P08#840 0<, K,0S0; xGx@p pW U W 0@ S PP YY  0 000@ R@@000@0S@0<   U P    , `R.@帠T@ 0*S pJ0S 0 SQPp@T0S J R@0S000U@ 4 8C8RḠء8` 8 VPQ @J"0 S 0p 0p 0 xtW 00 0@  P0P`@T9(Kv@ p-PQL@` 0 pP ` hVP P 0Sp -PLp6`P @  dhDPW@  EP 0@@T  R R; 0S8   R RQ $  BR  Q RpQ\P U00\2 P  PU 0yP\( T0 P0 `S R 0 Ro幼P 0Q  p`0 R00@0 S0Q00 R# Q0Q R ` L\  0`SRR t U `pP0P0 RPP 00 00  ```<Q 0`w   R0@c@@@0 -L@`0S00 PU 0 P0S 0p4/PP 0 0-P@L z0P@  0La -P@Lp <( pX`0 0` 0帀0d0(0 0 00000 0bw0t0q0${0 0-0L@SP p, S0P 00h00A -(1L R 1@ 1$0L@PTpPh袻 SPP`H  <0 `0`0 V:tPh PT 0 004P@Tb.@HbcH@A|@c@@La$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! -@p0 LPQ`T  ` hD0Pld`>p\>pdX>l0qhp!pgtpPLx  !    |  5T0 0  h pad aR c,>>%>101010101010110ST  !  x!  0C Sꤝ0ȝ0ȝ0ȝ00ȝ0ȝ0ȝ0ȝ0ȝ0ȝ000  T00T0OT` '   Aτ00000000000  Aτ00x00t00\00X00`00`T`踩A@000D00X00Ѓ00$0X0D00(0H0|0T0 -L@P 0`00 0 3S80< RD  b08   b'R  R 0(0C00(00( 㻅@Tq 0P (0(0(000 +`0040K0400K 0 0噣P00S105 / +4Q Y  *P0  +L 0  #$ #(#<00 0`00^004 00:S 0s%0 Q*000 (K j(00  0Շ@P ( 0ΔK  0ȇ@P7000 0040K0 0 00 0:S4 R 1@0V] V6 V V'V@ HV3Vn ʄVZ !aOVx nV}Qz!   q!   h!   _!   V!   M!   D!   ;, !3!B/  !*   "!   !   !   !   @`a  0 l@P`00  00 40ʁ R K0(Kad1c,b p-LMPa@U0 Q1PK  ! ⨓,P)KvP$P)UPiUeUUkPEU\ \ G  YKp  -L4M QP`p0@, 00 P@QE PIX J/Q#00L0000000000000000pp    01, LTPK,0S@4HAT ʀ0 ! 0  !!43 ՙP, ?P,   @0 ^P0 @Pၝ 0 5)190,0 \3p@101cT4K030VP @00Z0`S20S 0S24(P, 0S  0S0s S0S  6P10`@`|0pS0 V420S! 0SZ0S2z32(PP, g`0000K0,0K0 40P,0SP100Q Z  q(P, B`p@p8ܕ61 U80j0K0K0L0KDKp@TKHP 4P U[ 0S 0WL@KK0[S /0LL K0, -0CŗחhGX  ,PP(K0nocԅc_@AlApAA?k@Ah1caw@$0H 0!0  0 0/ḩAlcc+c1M/ >0 /`a --L0M,0 $1 p@P0!0R+1S R%P  .P P  .PU  0S`P  0PP@TU  0P (K`aʚ;/ 0  2( 0  +( -LM Q@p` X2HZ ʀ0P !lP0 !!P0X0U0SnXi,0X0H0H0H00d0|0H0000t0H080P0l0H0sQT <OWȔiFᾔY 0S 648V!  8  0 0$P 0S 0D00 S P TT008  8  KP ; -0P 4   0   :0 F R& 000CS0040  P P P j0P jP j00000劉@2(0S  3/V@8008040   *W @K QP  P V 80080@@7@@@(KP1c(c -L8MTpK@`P4 00 ,0 P` LP H y K -LM1p aP40S   0 R0 0  R 2/0  0 0S0C0|冒@T 0  ?QQPUW(0(( 0KhYLc'0P0U0S U`X  /00 0pPuP3WPU X H0' w40 0 |1@01G$KA|a -LMp0 @@4 0,0 8 80 SxP!Qu` X``0@ < @p 00pW00  0 90 RBV  b0X` !` P Y@p0v03<W0S# ,0S& 00S 0!0S 0S P & &PX , P7V0040P0 RP(K?A --LPM`0(0 " ,0 00 V 0"K80  0Svg`P 0(wP4 00P php P T&@Ph@ 7Pp 04 Ne0S0h0 +P|7lPK\14  1x00 4 l px0 Q 0XH0 PS#3RXW0PRS \RQ RB a0P0"Sd0S 0"SX6 \1  0 P P00CS'9191 :1 :1 >1 >1 >1 :1d0So lK0 KPPj0 Rg Y008  B8 _lK0 KwPPY008 ,0  8 lK, KkPPMpW h, PPB`0S0S;P;W W Wp`,0h0 00d0 0`0 H 00 ,DPUXP TP  10X0 L0T0 300L0 RP40K lK00}40Pp H u%PP  %p@PlK 0Pg,04  l @D t HL | PT X\ `d d 8< \ 04 0 h l0l0 0lK2PPdQ ,PEPHQ ,XP pP X TPd0S pPTPdYppTP pPd R ,04pP W ,H0S S (0S l K3/,,0DX ,0D RD,  l,D04 R0 040H0S (0S l K3/ ,0T /TX (p TX S-PpP0@00hXW <$,P m1@p 100SpT $d&T 0 i(0Sd`cc$W01X㶂KV (Kp h0W" !7P$K0D0 h0SjPpU p7P@W3A(?AA|aa -LtMQ`P @t   u\Up4 8 0 LK4P  4$400 80 040 0L0 0< H0 0D0 0c@0 uL0 SS@S W W 1Pz@$TvK4 b \2PlH0S "Se 0Sb 1, K0K l0 0PZ<0l S 0@T @0Sʼ24 030 0, 0<P@< ,00<0 @1W 00W*0,K h0 0 t0 0K`0 0P%<0S 00S @ R "!,  4  0<, ]P < ,00<0 @T`@ t@ h@ PU7X00S40SO0P T#D @00 R <  aR 3 (KAtC1h1c 0-L8pW 0S80<0`@00C@0#W 21K, $0@0S 0+Kc|aa -L/00000 1`/᠒? P-0L P P P P (@00000 1`耖? p-80L@@Z 000 SN  SL SQ@t 0B  $d`dP (0tt 00St `B  $Q00SPP{`P^ tVhztdxt 0  TstPphpt 0  8ph\tp &@@ @@@@@@@@@!@ -L`@P-Vp :VzC`v`H P 0 S8  0`V_`# P 008  @ 0S$0 S(00S00@S $( 8 B``0V5xP8 0  S |  8 d   PPPUSd0U`   P 0Sd``0VP\0Ui -L,M@P@pd0< SX0SU80 00 03/8}q<|`0\Sc qq4X03/@` 80;80840K@0 @0 0 K 屈/ l0 4K 80P;80堠 Pd P0 0d0d00 03/1q<38 d0 S ` Stꀠ111 11̡1̡111P1`t003/`n00 03/lqd0S0(S@040 D000 0 R0C B, ,0 ,0S00 03/p0,0 4 KBD0S`A 0CD080P01 0R/x`msP*x1x!0r @D P`D0S0CD000 03/p 00 03/dp``vp0d00<00<0H00H0P`d0S 0 0S 3/80 x`(K2@W@Xaz@@@ԨA@1@@ -LM@P@`003/<0\ 0<00d0` 080@ 0  80 8088007780808S S S"0 0!000080080l08S  00 03/84 0808p0,0 Pp W00 03/ pp0 03/o",0S% W 00 03/op 0iQ<0 Gp PG @G@5@p@@@ -@`L@P<0p PP 0T0 0 T0 @0  B 8080;80 @0" <0d0<080QQ d0S0S80@;808080d0S} 00000@@qQh" -0L@S 3/pP0\`0P0[i뀠PZp0S$!PCp0p 0p003/9 0p00 03/q5p0 V 0Qp 0p0 lp>QZ R00  rԨA@@$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A 0-LP(0@0U @T0蠩b 0-LM@Pn; 0 <S 00 03/n'\+ R00 03/nP S S 000,0 @.P 00 K0h@V@@ p-P@`Lh0710@61d0S(|111Ы11111\ `00c1% 051lA4!0`5alA4! 7a00 03/h:n 0 000 03/<d-n07180 D@ph/p@@ -LMP`, ( U "S "S "S0 "S Q 0$00S0 JF\0   gFP((  R00  $00u 0 m04 1#$Q b 08 <0j`_:`phR 00ph0A 0-LPV@0hA -L?\0@  P\0`0 j\0@0\0@0|3c p-L?`@`0P\0  fP\0`0 Tj\0@0\080 .h80080p@ -@ :P:L#V%1@p`  TP  T 0 UP0 UP 00S0 0A -L,M8PK< @  %0  80K@PP`p  ġ000 0 `< 0@CpPWp @0P`K a0 80K7K  00< 0@ p`P.@ 0p8 pp4p0,p(p00$P0 `P0`P`d(KA N  Q-L@  Q  Q Q  Q P 00 03/0d0?oT0c0 T$$0$ <h@@@ -$0LMK 0; K3c,0 /J1 -LMP>@Ƞp  0NDP1W@, e@ P0 `u>B, 0P0 0UPi @`88`\0h@P@`0\0T p`0W 0 0 00&c/D8h -@PL@F>80`jP Rn  Rx $Ry R 80 00 03/X[g80<80NL l00p0CSGn00S7x0S4ypW=x`@giP0 0p iW=)gO80080<9(pPp hh@80080-pn00Sx01Sy0SOpp%@3@ԨA1W@{@ -L M0K0 0 Kl? 0-LMP4P @Y U P0P000L0 0 0 0PP0000 0 0K0p -LDM@`\pK` `0 ',0KV0 00 PP V ',0SY[ P\0K`0?0SppW0 P 0xP>0P(K -LHM@`\PK`p ,K`0 V(0 0 q0P V (, RY[ d0 d0P\ KP ? R`d0 ` V P R P.d0 0(K -p ::L#M I  `/`P 8 ,|7V# p7V d7V`7X7V P7VL7D7V 870S (7V 7V 7VY @@   0 Cp@6V 6V5 6V x6V\ d6VL6Vi p6Vxd6Vu 0VqgL6V6 ,6VM :06V 6VbG6V2  60SY5VUTe/hT0 ᔐ0T0 @WR @< \0T0\0 X0ZF@P|5Vp%20 6 X#::<%T0F@\00\0c ,@80T<<8080$  @\0T0\00 80  Q80  0S0Q  R@ @P80  R`0H0S\`K0 00`,0K0 0&@P,00 S``0P0P%\`KPSXtH0000,0K0 0P,0S``0\\P `0pH0SBڌ`K0 P00,0K0` 0@P,0S``0        R 0?00,0 KP KK< 0`hK0`^-@c^ \0 0S \0@P@0`0\0RM 2; # @B ';  5  0@5 @$@*% 0S@$0,K ,5@P`p,5,00h5Y   0 $@@ @@(K0AmdQ @pd td@}d(@QQ@ud~d(Q`wdedArdApd{dЀhd|dk~ydgd41p -L|M0@PS`,Ke< 0`Wp1 00004PK` 0 0`P", P< `P< 0@0F[0 005: 0G0[C[ E[  ᐠKᐐ 匠 D[ ᐠK  Z YZ 0cp !0# 4 0^@`p00`x0 @-p &N&J0h x 9\ `P (Kp@ N@b#@s#@4@4@4@A#@ - :`:L#fM&0 +@Pp y9Pp @0,0 bD0`VSV`P0040 0S4|pP80 f ZYpjV Z  00 Pp  #P P P pW Xq 00K m80080 .pPV80 2080dDP80080G P%Tp -X|80Sd08088X0(0!0B P dYp! Y T0(V 2S  Z  Z 0 f`0 f` 0,p00pQ80 .800800S4p,(K0A41f@ - :p:L#vMP'*`P+ 8P' 0p@G :@P`080 T0 "R(`r0d`T  :@P``0A -L M`P8p@P0 00l0S409400000SH0S\00\0 d2gc0`p`0100P 0X00080 080&8L!=>=8c0cPpd JpcW W Wpx|,pK!0# XIl00p00x0  0h d0ccl~ct p0 P`c7P 0(9 K?`a@ &@@@$@101 @$0H 0!0  0 0/ḩAlcc+c -L`7HP@Lp00<0S i>- p-L M`P7@#cbP0000 0 000000000$0 000000 0P00P0STʈQ^5+ (%X"01 P1"0P00S  @00T00S P)TP   @DP,^ RP,x P @ P@ g0T0 4 ],44008P 0 <@ P@4P P B@XT08P<@,L 0]/(Koz@@@@?A-AWAyAAAA -0L@PJ`d2% &0[]2[0S V h]d`[VP[I2"28[B2 $[h[A@ZYAW3A@@@ p-\0 L@R0%0'P0&04,IO`P`VPp(!D?$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A -LXMPQp0k@;dhd`X tK505K20,0 0X` 8p 4P 0 3/U0 03/PV,0tK@00P ,0 }K -LXMP@`P0T@㈄0xpK@X N`406K@2000 \@ XX00 K -阠LXMpPd@|`KX E06K`p 4 ?P \ 0w03?4@T<0p03U0S\00$K' p-LM 0 K0 0@`P 0`0 0%0   #. R 0( 0 0 400 0 03/P 0`P0 `P _\KpA+A -LP10@0P J\0@80@0800 03/pP` T 5\000 `0p`0808(0VBAXA -L M 0Kc ) [ K -LM 0K c!   K 0-0L@0P0S 0 # 0h0 p-@0L0`P" 0 # P\`X 0;000S PPU*<pU<pԨA A p-@LPQ0`2@003  0 0 `P00y  0P1P1 R0003/`P |[\PS `P (k[000pPAtA -LM 0Kc 4[ K -L M 0K c !#  ! K -LM 0K#  K -L M 0K # !#  K -LMPp@`@  0P @@@`F@V00 0`$K -LMPp@`@  0P @@@`F@V10 0`$K 0-0PL0@0 # 0h 0-0PL0@0 # 0h -LP@/0p(`V4  `P.  P ` H @pPT0@S00 (03/00000`000A p-PL@0(0S 1 0`R000 Q0 (03/0 phpA 0-L2/0P(0S @|0St}0hK0 p-`L@P0 3/@PT0 ,03/ph -LxM@0 `$0 PpPp X K < R<0 00ø6K0D @ "48 d d0 $0C 0P0 $00> !4PL H Ph_PU@P 0 +,\ 00 ~?0``H@a 6D 1H ,XL ' `["L0 a1@,D1 P3 S@!4Ò@1p4A[Ah? p- 0LP@2  p`X X\ P` Ha @b 8c `d0 eah l ? 0 ,4,$80 0  0 0 @P @$(`;3 00 0 0 @@@ @$(`;3 00 0H3 008 @@ @$(`:'> 0 <3<#0 0  0 3 00 @ @$(`:'.0 "2 0 0 0 0 @P @$(`:'>02 2 00 0 0 @ @$(`:T28 00 0 0$ @@@ @(`:28 00 0 0$ @@@ @(@,`:'> 0 1!80 0  0t1 00$, @ @(@0`i:!0  0 0$0 0 @@@ @(`U:'.0 0 0 0 0 0 @P @$(`@:X@< P4  p4 L4(K`bAAAXbL,2%@x+2@*2s@@AAOA$-2wA7CAWA.2PcaA$@@wAQ Q Q BR\ SH S <0P/$0P///p3ctbQ Q/0CS (0P0P//tbA QP62h62@62@62h62h62h62h62h62@62(0P0P//tb,0( 0S0P//@tb 0-L@0P+P 00T@@@00Atb 0-AL@P Q2L72727272727272727272P@D T!T<P P h0PT00S0@00S 00 0P000tb -AL Q88292829292829292829282X8282S# S'00S#KPS St0Pd00S4 R 0CSS 0Ptb -@L|M0pK`P` ,0 ,0K\0 0 0 0 0 0px1y3PY ,0 S $ Q 0(Ktbp3c -3 0 1!40 0  0 0 @@ @$(Pz81 00 0 0 @@@ @$(Pg800d1 00 0L1 00 @@ @$(PR8'> 0 1!0 0  0 0 @@ @$(P<80 00 0 0 @@@ @$(P)8'> 0 \0\ 0 0  0 0(0 0 @@ @$,P8(K軏@AAA927CAAx@0 /tb -|L t塲p@p h囲d \喲X P呲L D匲@ 8凲82%@tb52@52s@62.@72G@t62_@ -4@L囲噲 嗲啲哲h萲tb -PLM :P@@xx 00p l 0@P \IP 0@ N:#@P (uIKtb62AAAb A -Lfp3 p-L@(P`PppA -LP 0-@LPT0DD00S   PEUP000 -@L@D TP 0-@L@DP T.@2@2@2@2,A2@2,A2 A2@2@2@2@2PE U PEPE PEU UUUU PEU U 0U6 P000 0-LP@pU0Ud00S   @DT A2A2A2A2 @DTP000 0-@L@DPIT)B2B2B2PB2B2B2B2dB2xB2B2B2B2B2B2B2B2\B2UPEU :U PEUPE PEUUP000 -@LTP -P14ML 00@,PK 0 0lp$0 0@ @@@ @(p~60 00 0 0 @ @@@ @$(pk60 00 0  0@ @@@ @$(pY600X0 00 0@0 00` @@ @$(pD6(K軏@AA7CAEA/ -L ۰@ |հx pаl d˰` XưT LH @弰B2@bA2%@LA2@X@2s@ @2.@?2G@?2_@ -<@Lΰ̰ʰ Ȱưİhꘪb -PLM :P@@t0tt0p 00,@P \GP; H@ 8U@P ,GKD?2bAEAcAbbA0  ")0 !Р!0 ! !@-A 1H0000S0|!18 p-0`@0PL            $ ( $ , ( 0 , 4 0 8 4 < 8 H<0@0 p<00010070p -L1LM\Q@ p  , KH01 凒0`kK @IKkOK1 (1 1780,1  K/K-ӊ@ T 0 000p 0 001H8r0<0,0S101(K踩A@P/ p-0L@P0 a @ R  v101101 pp             $ $ ( ( , , 0 0 4 4 8 8 < < H @ AQ/0  /0S  0S 0S  /00C SK2,K2,K2LK2LK2 K28K2LK2,K28K2 04  0, 0  0 //0 00 0-LM0<<0 ":: #6!@_/PDF0A -L  -LM@pPH 0 0 ,0 0`S1 S;đ1\1 110S 0T 0 0Q 0 l0T00SD1 0001 \1,P 2F00C0 PPE P0S00U ` `P 0Sp0\10K 00< \10K 00 U, (KA.bAcAc 0-L0 0 $ (0PP P:" P0 0-@PL0S000S 0 T03/-P 0h0 -0L0 A P 0Q  !-/ -pL@H0 0S ``P`Huv 0S(0 \1h hX踩A -LMp@H0 0S ``P` uv 0S S00T0 \10 0W 00(0 \10 0EK踩AA -L@S0 00 0C 003/$04p0 7/0P0,0C,0 4eC3e$iCؖ? @ @??A &@ @@ p-L@d l妽$08P ;5/D圽0S (0 $04P 5/ `p踈 p-@ BLP0R-t`2`2_2`2 0"S*$ 0"S $04@ 4/$0`8@ ;4/03 c  0"S *dpdddp p-0LMYP. _K,@g0!nK2 ~?002 _010     0SP40 ?K0<00?4/Kp+bfca0002">0/S0?0 S/fc, ,0  !0S/fcfc 0-l0Lpq vP@PP 0DS$P@`@0 0  0+ba -2LM<03/2 r0s t20S`B0S R @2DD ":: !#&d@~b "ʠ ʠ !,&X@pPs 0Sp %PL@u(KoF@=P>y0Q @010 , ,`#46ShD-@ 0 tULX1* 00K aP P@67/PU*(Kd3@g3A@ -L M,  0\p@0 :/`P0 0 0` 0 P0Q@`V P ,03/PUHZT @D0PP R(Kd3@g3 A@ 0-LP R00 lP p*@H0S 88><0S C<*@T0R A ? 0-LD@ R00  03/* PUa 0-L@P 0 RqP @T0 p-@PL`P 0 R[P @Tp p-@QLP `P Q 0 R?P 0s Spppppb 0-L@P R| 00 00  @ 1  Q 0Sp1 0l10 000a 0-0@@P0Lpc@h@  00P 0S0S0S000ba 0-LM@ K 0 Q0SPPKU 0SP0S   K0 p-@ML0 ` 4|4?Ph 0`PYX 0PPH0@@00D080$ H D@$@(Ppb;An A@g2=r2Ț=Aa -0L4M(0S @ PK<@%000 $0p0` @@p@ @(`<+$0S '>000L00@0 @00$00@p @(`$+ Kax@v A-a -L MP<`@8p (0@P,0UKa A2 -\0L M0 PH`R 0 @8p (0@P40UKa Ak2 0-D0LP@ 0 RP @T0a -L@`PpP  0RݾP PUpW0  @` 0-LM@PPP K0 !R  R 0SPPKU0S   K0 -L@0P h Q0-LP 0h!,0@P@T0a -L0MpT pPP@P @`PI 0 ]R*]?< P u(P 0@ ]k(@T<0 pP00`D0H080@K40?D@ H `0hSFh 1   0P `BVFhV 01SOvQ @VD@ 0HA`J#T@000@T1P0 - L P(PX<i 0L S pP g !W   qW@  L 'IpV" p00C0D@H`D@H<KvB@嵻0+0K+K  0 ` V0I0``I*K c RDY X0 `$ %X0  Z,00000040040T0S 0P'<0010< T!G0@p 婞@d!ၝ00SF yPD B `00QU1 /P.  呞0S! fPH pP  偞 R {H  ᰪp 0W H  D- ᢪ`VD圪@TD o@(K A A Aab A4?6 A\ Ad Ar A~ A A|BA A A p-LP@`cP 0 3/p -p0PL@`\0  \  X  X  0 R i -LM00 0`p P, 0@*Y& 0R" 0C8SW  0R᳼P YP Z 0 0:/ P,@ @0SPU,(Ka -LM00 -LM@`, plh ,Px P V 06/ ^P@0S =A -LM@Pp 00 &Poa000)0S0S40 0S 3/PP40,0P40 -P.  <:0(0S 3/1 ` 0R P0S0 R`PX 0S ;0`K0U  B    R0S008    ,K $Kba A A -`@Lp0P`U 1/%P,,":P0p `00a AD? - @L#L00L0hib 0-h0LP0@S1/0%P4900(0P @D  D D0h0A Aa 0-,0@LSPL %P4900(0@ PL  L L0h< An Aa -0@LL00CSL04 hb -LP`pV@ 0,0S 0T00 03/^%pW 0-,P@LH@ 0ha p-PL @P 0l`S00\P80 ` 000@0000 3/Hpba -L@Pp~`PS90S00Q0_18     `  0S 10S 4t3:T =\,:8H:2P/ $:)P& :X 8/00 P 0R  ᩺P 0R0S00PPX?z00 3/40<E94' Aba0A A A A ALa -LM 0 0i p-@PL `P  0ph :p A -LM`p0P 0@qP  0@h:T T00S H00S )44/$018%:b0A ?W3A -0ML   K -LM 0 0 K 0-LH@ R0D0 03/$@PU a p-0LPP0`S 6/Pl0P@0S 0S @T#00@`T P T Tppba p-8L0,A( UL0S r A3/0@S`P@P0 3/@PTU0 @P  R0T0 #PP3|0P` hP@0S `H7,:U 404 4U ph77pbb|Aa|3c+ A &@X3A3 A$0$$08S0   9|3cȪbh2b 0-PL@HU 0U 0AT 00@@0b -Lh -L@4P h40/ -40L@ 0 0SL0S 3/P 40040 -40L@  0SP0S 3/P 40040 -T0LS 3/T040LP 040/ p-0P@L0P0LM40`040 *H Ddi,, ]0Sʐ0Sph~ d? -L@& P X0S 3/X/ -P@LȀp0 00-2 &00C04`` 0Sژ\!Q PT Ԣ:000\1 `0긩A< ?> B K 0-@PL00CS00 0hꘗ?f /\/ -40L@ 0S 0S`0S 3/P 40 040 -4 L@  0Sd0S 3/P 40 040 -h0LS 3/d00\` h00l0/l0 -SL@ 3/0\0`0d0l0p/ -4 L@ 0St0S 3/P 40040 -40L@ 0 0Sx0S 3/P 40040x00pt |0/|0 -SL@ 3/0p0t0x0|0 p-PDL`P@ H01S 3/@D0T:pp -HPL`D@ 0P 0S:!p @ !సDHpU  ! -H`L@Dp0P R R PU:U1G R U lDPHPZhj!PU:01  p-PL@r1P  ha     80 08 <0P PU UA 0  P \ R \P  0 Q 0S0  P \ R \P  0 Q  0Sph ba 0-0L@ 0S S S (P!P0hPP00C00 R 0SPP0000 R  0RP0 -L@Th p-LP`@P  P @p -0L@S700h 0-PLP` L85P415P(-5P@0bt A@A -L@,(0@T   B B  hba p-LM0PK` 8P VP@0KKp -LM@PK`~@p"V P V  PP4P 040 0S  03/Z4P@T@K (K -LM4@K`PF Q VpPPp4KK -LM4PK`)p@ R 0 R\PP@T0P4K[Ud0  XM50S  R0 0$0 PPKa A -LM`@ 0`$ T $" 8pK0$0SP P 0$0 3/+P0SP@8K Ka -LMp`{@Pxx x0@AP@P`` T0@@P 000 80/P 3r2r2 Atn2@g2 A A -LMp` 0`@P  0@ P@P 00X  p@P `@ 80`` 0@g2tn2@r2r2 A0/ P-L p3/p@-0S0pR@`P 6bPU 4B <0p R Pb<Š@` V 00p@T B p - QLM@`P42P"000100 0J!rP,0 V :T, 0`gV T0, `TA0000 P UU!(K -L 0b0a<0 200 00 A -LM`P Q@"rUPP 0 | 0  S0 SB   2)h  !0  G♀#ጁ4 p% rr2 , f\!Z 8 4 0  08 0 8 pR0500Pl `,0 W S:(K AR A -L MP @RJ R#r!b"r0  | V  pp 0 R F, 0 #0s# UV  00 0 0p 0Pe0PSPU<1, Y0S:PEP(K{ A0 b a0@- @B R -LMR@p` X0H\Rt. X#"R(0  ~ U   0Rj+ !4 !,  E☠#8 P @$ r1 g\!X0 , < 8 0,  0< ,04 <0,0 00`l p@ T S:0@0j0 (K A A -LPp `pbrV: @0D  0: -@Lh 0-LM@PP 0 S    p 0Pe P00 0-LM@PP 0 SHU 0P PK0 -LM RP,0 `@pw WPC%  PUU:80S5 ST!* (Ko,0"Rp#0I!4 00 0s T: 00`P@e 00@`@4  p, Z00T0S(K -LM@P 0 S 00` 0K -LM`p"@P0V`!` yW V* fX Ki+ -PL@pPU` 0S sP0`` -LM(`K00&@pP0嬠嬐 R  P0 0Pd0 U:T ,0S4 \sP,00,0 ,00(K0iA &@@0\0S  R H S< AT@@"c(A$AlAhAdA`A -@PL@PL0 D000\@  R@clAhA -@PL@PL0 D000\@  R@clAhA -L MpPP, > @`2 0 R+ 40 0 0  -P40 R 0 B R@T T| !R U , me,0P00E0`@0V@(KclAhA(A$A -L MpPP, > @4`2 0 R+ 40 0 学0  ݁P40 R 0 B R@T T| !R U , e,0P00E0L`@0VD@(KclAhAdA`A 0-ALP@0$D0T 001S 0 00!@P$0\0S R| Sp !R @ @4%Z  ZP@P@P0cdA`AlAhA(A$A 0-ALP@0$D0T 001S 0 00@P$0\0S R| Sp !R @ @4%Z  ZP@P@P0c(A$AlAhAdA`A -LM@PTp`K4X 00 0*H Q;W @  lg 0 L Y1 : Q4'*H@Q @"4Y#3 QY\T dP P0r3Q3P<8 < 8 0P00R  R   ,^@P% ,j!,剽,冽#@D<@800PD ,u0@@(K -LM  K -LM00 00 0 0 K -LM00 00 0 00 0 K 0-LM@PXP 0D0 0-@ '@T0hAAA -pL@P` 0JY `PJ `᯼. 0S*: R*U X0S   &'Y UX*XPE P * 0PE 00 PS00``QƼD 8_V ⦅ᵼ AA Pp- L@` P#PPU:TT 9RP T 03 11:T 0S:0 0S: 0 R 0:PEPp8AJA Q-0LQ 0hgA -L(Mp`WP  0M V 8 40 傘 V840B:! SF ` @P 0 ꔜ @ PUY R:0@@ @;b0 唘@;b2!/2!/0!#/@-0"H00@T \\:@;b00 0Q R://@;b -0L 实p3@;b0@-000 P@ @@0 R:0@;b0@-000 P@ @@0 R:0@;b -40@Lp`PT@PT:@;b20~20~ -L Mp` P'?0@ *?T++ T T,  40h0X1000,00   00E37 PU`@T(K|a -0LM0 C\|05 7:%Rd05!05:X >0D D0 0K[P  K KL;b;bHc 0-LP@P  <0@-0p  @B\X 5 7:Q@ 505:4. . @[ @ML;b;bHc p-<`ST\b`b p-LP`0S   T003/p0@@Tp p-LM@$嫫tP0S R 0(0 0h,R h,T ⓫X \0RT \00\0X T ӫ八T 00CS0T xpt`ūwPK00% QᷫxIt`Kpbb|abb -t`L@pU001111(! ,0!48!<@!1 a$Q 01300S0tPhh堈PQU1Q11@<1T00SHFzp@ K40Qx !@,x a*\b`bA0Ab|a -LM`Pd@+pP 0 000 0 00000000k KXb 0-LP`復\0t@P1H0P1,屩P1(0CP1rAT0hb|ab 0-@$1L(P3/0hj -L M@`  P0 qWp 1XpP10P \\1|0, 40 mO 0<@\,| P 40R ᦩW& ("WqW 01D10CD10 Sp 0S ! 1H10H1pKO 0@,10A}(KMO 0@418Ap  {cAb -@Lpk 0aQ 111H1D1L1Ri -@LrP1S!1R 1tPx01!p㤀 -ݨp&oo⏟PU Q pQ p U 0 V⻨o bb|abTb -L@hXb -LM@4P!u`0S d3/P t`&P& 0$PK0%0p8 00R |0 bR:<0D  c,0R: Q(P (K$KK/2@ -L@_hc -@ML0  T00 --L M@00 00 T00K 0-LMP@2 0P300S0hK0(c --L M0 0 00l00S5 K(c --LM00  K!a@ -LpZh1 0S \A\1S L iTP |\1!!!40040 10S1 `VAo``0 00S 0 0Q 0 @0S P 0p PptL00S @0@ 0Q H0 @AA0c$caAc ca04c(cA`bW3A@,c --LM --L Mz0 0 00y K --L Mi0 0 00h K 0--L M00 00 K p-d0LM0`@P FV 40` 0Pph>p|3c!a@ --LM  K --LM00   K --LM  K -|0LM0pP@@`W H0p 0`J00Sh|3c!a@(c --LM  K --LM00 W  K --LM  K p-h0LM0`@8SPV 40`O 0Pphp|3c!a@ --LM  K --LM00   K --LM  K -0LM0pP`@ @@nd0W    L0p 0`c 00Sh{|3cTb!a@(c --LM  K --LM00   K --LM  K -0LM0pP`@ @@W H0p 0`d00Sh,|3c!a@(c --LM  K --LM00 q  K --LM  K --L M0 0 00' K -p-PPL M`@ @T 㼇@P@``50 0 00Kp --T0L M\1 1l  10 R    0 K踩A --T0L M\1 1l  10 R    0 K踩A -0-L MPn 0@@ @00 R0@ @cK0c p-LM`@PO 0P(0 R0PEphac -0-L M@P2 0@@ @00 R0@ @u%BK0c0Q  A A - pL@W aWPአ&hҠb*AA -L@ 00 -@L hj p-0L@PU40`\100 2& ⩟PD00D0@0D@00P 0tG  0` ␟ GP =  0@!D1 Ο00p(cA>b,+b*;A 0-D0LHAT ʀ0P !cP0 !!0踩A -0L@ !R@0 !! -XQL0SQ  K@1@`p P  R00 `000@@@T`@P P  R0D0 @000PPPU Q   00C0@0SiG>bA?b/ -L @Ş00 -LAA -R@Lppٞ PU0 PQ PU:s Q `a ~ i0 00 0qPw3 -@L`᪞0VP51p3:0V * 0 0S P q3/PU 0Qiڞ -@@L ^ -`L@xPU" 00u0` pS   01S P 3/`0V:᨞i p-P@L`M@T 0V`2A7@#ᏞpP/0R 27#/ -LM@P-0SG UD*Ponl 01,0 `p`V 0U*PVT, 0 S   !~P0S00  0p0p86V o,ޝ`U:mA p-0L@SP$t!S! 0Tx0xPPEP -\0`6T 80@@PpppcبA@BԨA -LM 0(0 $0KK  K(@K0S@  (0 $@  bR =)( $ - (KK -LM0 @  KK -LM 0(0 $0KK , K(@K0S@  (0 $@  bR  0( $ 0 0 (KKʚ; -LM 0(0 $0KK S K(@K0S@  (0 $@  bR  0( $ 0 0 (KKʚ; Q0S < S /S S///?BبA Q0SD S /S (ϠS///ɚ;بA 0-LP@P00 -LM@P(K 0 Q``pp000(K R0  aQ``pp@000( 0 $ K  Kɚ;6eʚ; p-LM@$K`$K R0$ 0 aQ @@PPd0$@ P 00 0$ S 00S$PKl@P<@Kpʚ;0P #((R8 4@2@1@S@// -LM0K@#4 K S啄0 0-@LP00S0  @ 0!0000100@-@P LUP1 P1 UbPe`P0 A@@$ b`` P `\:00 0 0  (ꀺb - p@LP\0`̀0S\0  0\P 0X00X0\P0S   0 X00CX0ƛ 0` PS 0 0 00X0@S 0@耺b bb -QL@`JP 0 : Z p!P :P쀔U전`Λ!00c100C00S   0 > Q`V:@ⱛU  -LU0$@ pޛP P`啛UXUPUV AT@ₛ<hꐺb bb 0-@1LP00@!0 R! QA @0 -1(}P8L@ p0 `S L0 JP0U0SP+ 0QPUa1:0P \P0S   0 X00CX0ښ 0X PS 0 0 00,`,p X0S Minꈺbb b -@L ㏚@ ㋚ ㇚0D(``H0 ! @Rpp  ppP@`A 0CpW  (P,`H0耺b b -@L0 1$S$!$!$1 ! šhYꐺb0/ -L@MD0 0R0 @ @@0 `P pP  !< T H` :<0 Q8U<0@ Q U001L0 0 P X0 8< QL`L`)PU  , K0 @ D0Ph P0SP0S :,K @ D0PS PUP R P<0 S 0@D 0RQ90S6P0 \" L0T0  4 K `00 K 0L4TP 0  0@K -LM@PTb!0`SfGc1CZAZ ,0KP; L0LP4 80 ,p嘁  x 0S 0  p 0p00l00l0(0 0( ,0 W )110 P̘ʘ0\  BQ   \Q\ \0 X00X0 0S X Q80< X0S (K bbb-P 1,0 4p pP PPU P 4pXY*W` 0p03R0SP00CS0@HT WH0,# (Kbbb -,LXM\1 q0T0 P0 L0 H0 LP ӍT KD0K\  t tVP  \Ὅ$@T @D H0RH0(0H0D ZT 00C 0\1` q04 0Sh_P0, a  0 ` D4 4 Kp  l X   $ \   \  p K0S@ K|@P0S@ 0S@ x0K^ !0  PKp -h0@L\1` q~00CS0P 0PP~U PVE踩A -P@L`| p`^~0000001(01,01001401801<0L!P 1@D T0H0AA~ -@`Lpn~AP ,XH00P\ ` , $0RP0T\ ~踩A -L0M@  L ` 0cqpP0K,K~QpP00 (    h#D D@ d 1 P8 HCH P 0RT*0SS P@K  &PM<0SI SF80SC S040 = ] 0<0 ?80 v @}FF0 0!S 0N TL 00@K ` ](2H0 02!000'A*Ap@[1P0 }PPP0  ~  ~pJ00 0000JPK } p7D R}p0PPP0 W!P0 P}=Dp!sP0 s!!P0P@0Sk/1!0@@1}@`0 , PO,0L0 0, PT V  (K000}0000 00 @00 00 @00$`(p00`0 0T000 0 0 @@ @$`(p$Kx@uAzA 4c`@4 -@Lzt0\1@iPP ;{)0D$ R$P00q000-{0zx0`0 R0aVL0{4z40( a  B {q@+bAc.b-b -LMp> ^ 0Pz@`4K 01S  0 +@0T:TzWW@ T 1p@2$KA@+bcA -L|MpKPAP`` Z,0K\0 0,0 0 0 0py300 00XPYP0,0SP,,PUP&pFzPU* E!0Q0S:XzP  KZ(0(vzP(Kc@+b 0-LPez@z0S0 -@0@@L P 3  ? Ac04%@ -0ML00@  @`P@.P 0R( py0S  $z\ `V:qH 0D0z`K`  @P  @Kc@+b -0ML@00  0?PKhK -LM@000P ,0  0?Pnġy 0aRZ$yp_pP tyW0t,0 H t\!@T $ YS(ypC1ay1`0S 8Py P y0yy%aV0@@ 0 S !00Sᣡ;kATD0wy4uyQ ,K Dpp(K踩A@+b.b-b@ -LM @000`P  02?PpsywpPjt1\1@Tt0040  1 D01  t8y 1R RpBz xzx( xx axPy* xy`` ypZ (1Z 0@,0 #jaV xY Q ,K pp40S 0x00@D01  x(K@+bAc.b 0- QL0 Q Q00f<P00`<P d0U PEU p0P000 p-LMP@`Kx ṿPP00 㠿Kp 0-LPx@Cx0S0 -LMr  zx@, 0 0s 0So0@SlP a$xKPPjx0` xdx`0 _x0U`1\1 Q x@p@,0S (1, R800Sd``  0v03 >xP0+RP d RpP RP pPSPEG<0  `P>0P P40 !x40p0d`S 003/xATP0 40 xY4000(K.bA 0-LMPK @ P0gK0 -LM`Pi@Pp <000  !=pP Bd p0BQ0CV U0w 1 wK p-LM PK`K@ 0P   PQ  Kp -LMP0p (K ,0 PsARw(`P $0S\40` W(,KⒾ(` 0S ;wb@PwF 1w{w`0 vw; A &w000  ]=P gw-p,KP W (1W$0SVwP T(P N(00iCwQU =wX46w(P ,K5,P !$K踩A@+b.b -LM@p  K k`P)iPP`! ``  !0=P 1` wlQ : -v 1 v   ` K -Lٶ -1000H00<0 @00$00@ @(`\$Kx@ABb -D0L`\Q@1@u4QpT<`PUhv긩A p-L@`vPu0Sph`h -LDM@ `3QL P \A 4Kp  R )3L@ Q\@0倓Ha<0 `0D1 0@QDX` \ T0 04801L Qd @` pv\ X ?U\`@0H `@ hP GD @pPD l F0Pl  "\Ÿ@BBAR PK=PP] V  PN FTW  PA 9TX  xP3 +T00 0 00000p03V0S  r0y03W0S  g0y03X0S  [0KU  (K踩A 0-L$M@PP K *P 0K , (0 0/,K$0 0000 ZK0 -L,M@pP (PK P PP 8`K P ` 00 `5K -0LCM\1p1`10?R(Q UzP@JOK P00 0P J?KT [ (K踩A -L$M@pP (PK P P P 8`K P `0`K p-LMP@`u0 [$  [$00 $0K Kp@BE/0 p-SL@P@a S9@410<14Q` 0p 000p -LM0@PS O0SS 0`9sPJ 01,0 10S ,0SU0013D1 S H"!p 0  , 0 R p  008CX4 0P0s03PS,  0!8!081,0S0SӨ5sPU 00t@`0e0?oU0c0S1pr 00 0 0ᝨU (Kos(KBb|? -p`Lpa@PTl@0 c[0@C@0c@os0|0 00wp@ABbA$ ZR 0-0L@S 0Pr R 41S0410 R  000hr0 -L$M`QD H  0(K0 <0K 4K p9 0A\Q0pL0 @A40 D01H@P!V @K4KxPGr0X 0 S r001mLH H0哧 ᩧP Jx #X(K踩AAb 0-LPfr@r0S0 -LM 0`P?S@R 1x0Q  RMpQ5WH00SDU*1q |PP tpWWpp 03rU``/ qpp 08`P 0S ۠ rx0ru U  0 0 e0Kh΢``K.b p-L0MH@KP0 `gQ  P Kp p-L0MHPK@`0 PQ0<0 1x000 4,  mKp -LM QGOK,`p6Q qq q,K -LMG_K A`,dpP 1p Sqp qWpK -pALM>W`P00KR A00 ,0 1  Rl0 Z8p3QdnX3\0SP3  !ql0c -L$M, @R R ( Q@  040 000 08 0pW# $ 00X4(0 0$ (0,崟000S 0PR010 M0cS 40 `V 4 0 R 40 p< $04p8 0$0(0 0(0,償, 000S 0PR010  P$ 0SD (08,8 b000S , SJ b^hQ#b\ 0 !$1) ,U >Q0bS 0 0 QY' , 0 , 0 000S 04 ,0 $0i4  i6Q ^ Pee,04  e e0 4 0 S$08 (0 0 00!411d, 80W  $(0 00S0PP0P00S0PPPp 00 0!0 R!100Q0;S0PU- 0$!S)$ 0$1(`T `R00  0R010 0@p0C 01  @ -W@+R`(K܋c p-PLU @ UnE,P x10 00ST S S,`U0 $0  P@H (P0"(8#( $,$$!("(8#8"8S  0!1A K܋c -L$MPY0S S Q 0 ( 0 pJpWpp@ @P ṝ`Pr 00pp40 5 0*8p 0SiEX PD 0<00+8`40 4000@0H00P L00MṚE0S0S (0,0 0 0 @0 BY @0R R@p5\ @ @   @0 5C x1C Z  [  v  w  @0pp`   @0 C |C  Z (@ [  v ( w  @0 40 8 0 4 0 8 0 8 01 00 00 0D08#,#40#400000:#40:0 0 R `0* D <T< @0 a@0P@0 < @0 0*       :00Y00S: 14!0bS5 0園@0 0&?  0H"L2$Y0S000 S 04 8 <:#$0 #(#< 0?  0X"\2Y0S S 400 a 000  0b֠ 40 c00 000  0b̫ Y0S S00$10000`00400 `Y00@S S! 0 0 , S ; 0KPD㚻,00 0l7/(K(0(0尐Y, ȜcĜc c܋c8ADA -LM@P`00 <K<2  A0!@SD H L" PB ppX 4 0(KS00p1 4 K 0Pp , KWP, HDP`>?  0" 2?W P +p0 P0PCP`#0  0 00  0 00T2 彲T2@TW  A0@2 倿 XpA tlA벊p 04 8 <00S S 0 0#Y  "DH2 L cP0aR L2RD D0@200CT00P0p1= S:0:p1`0`S0 [0 20000100  0 SP00000p1  10S:0: 0 d10S:0:<"  GPQ`pr0  0 00  0 0m<)*0P@1 ` S0000S0000?00P@*?P!>  0"2?(Kb܋ccc bbb?Ȳ4ԨA -LMp@, K *PP0 $ 0( 0,00R 04 8 < bQD  0S d`㸰Pn 000S`@ S@`@`0S S:-V %05ᲀẄdݾd0S d 0&TE  `80 ? & l0@벀 庄8000P0 P099P0T& 0`貀ẄUT 00S 0S P 50P  5P 0S `00 0 SV0404*S*ʗP 0 0 ?V t$eT 0S0 80 4 u?80  4 ! ? *P ;8VpTpp00000 Q ""k! `0 j! ""h! 0 i!:0=0T0t1P7 01 11141100$1012,!尛0`?0ࣽ4 0  0 04: |20S0;0: \20S080ᾛ :S;$2V `垘P 2T p9P1;X 1R 1R0181!0100(10110141h10?0JD0S$!00! bR01$1,A x10+;劫`> p 0!1剫@c- 0 4 8 <000 0QZ  f 0^@BL@VP< ` 0"2U (K@AԨA܋cbbbbc --LbM1[O01KP 0p00 .P0 ` 0 0-DK @>0  P0#2S S 'P 0R@ *P 40K⤛P 40 Q@%@ :T  0`ha 4#$4P!8#8b,0 P0T1 Q PtQ yP 0R@ *P 40K|P 40 Q@%@ :T hQ 04 8 <  $( $(,r  $( $(! $"(#,r S 04 8 , 04 8 , 04 8 ,j 0Sg (0P0i,0  04 8 (T  t 0, #21d1 dS00^0S LP``<  0!1a8 dP `, x1 p1 C P 0R@@Pd!40KߚP 40dQ Q@@ 傺T KP`1>  0!12+ dap `F Vxa   0SpL; R  PP0D0 p@ mpQ < TKdK  P  Hq T!R Rd0 40O?K0 0 `0 $0d0h0 TK<  K'= dK< K=0 OK$H TKd0K`pP1[D卩j?  0!1助0 dK$0qppX!WR1[嘁 圑 Hqhh>  0!1id80S a0S 0`K4 8  # 04 8 0K 1 # 1 Ă `$, ā"$ Ƞ("(  ,8{hqhpXq 0 `OK$<0}pPw1[@ j?  0!1 0 $0pPZ1[嘁 圑 Hq_61  ఁ崑1l60S2 !0S.h1KS0K X1 %1. # . #. # 04 $#4K"$8("( #8 KD]- XQU  p0R{ :XaP(`a W (P X zHq嘁 圑 1[y d,0 T P1P` TQ 000 0S Օ' 0Q,`4 8 <PcUt 0#0##<00 4S0C0ą#40ą ȓ ĕ ĕPEU) TBF? 0!1>  ? !$1=P0! 0 $0(0,1R J? 0(!,1>  ?0!410 `e$(, " "",  $RPeP%TP 0V RV? 0X!\1 !j b $(,Z@LRϧR?  0H!L1ͧ§ɧ  04 8 <!0bS[ 1S50 $0(0,1R+P` 堧>  0`!d1`j 垧ዑ0 0 $0(0,1R 5cS^OK>8Z0 grPR  04 8 <`` 04 8 <000 0@;P7 P 04 8 <00"1@ cԋc#AOA\Abc8A܋cH?cԨAlbbbb܋c 0`4 P8 P<``00 0p p UHq嘁 圑 P ;S ,0daT0H P1` P  0 h4$l! l W P 810S P ő00h!H117  K9K 9TP P, T0 K|K 0K1 C: 1K$'KT!0K K hTa0 xK0K1 `K-: 1h$'K0K`KK !:0 49K1? Ht!0SH0P 1:P, t1H0 0N0  b, 3S80< R D P0 0 c00cS00S D0ta00 91 0S8  KK ᜑ Hq+ 0S  ,0H0KK P1 P  p 000S S pX P!X pPU} lah1cla vHqa嘁 0圑  TX X h0S000 0S bP 5PUh P 0 0$4R.T^ ^ 0  00 04 8 <Ph ?p3P EP`ĥn?  0!1ť$4Rx1p!K 0D0K 0K ,0+PpT60H1;Sh6`0?0HpaV D0K0x!0Ph0  03 700 S S070v 0%PT$7 0gg 0X\e@ 10cS103/D0S`1  < R`!  ta b `! `a'V``a +RL RIS l!@ bRB $l$(,^RQ3 ^04P,S x1 cR80p1@0l1,0 S ( ,n^410cS81Q :;S `aHqP㜑 `!B L1S P lRX)c0 X 0 00 cդ f0圡^=  ?!1x|Ǥ!1X0cX0ð1Ÿ10h10   $ ( , aR901Sā5 04 8 <!01 cR1i 41RB 8ɶP:0?0*0SI F Q R~  baRSr$!\ `0$1圑 HqW.  !    0 , ? 0In;Q& <0S"  DSaQ0!@QT S* Q!0D1@1@!,00@11  Q  P1;1d!P1$ U0 QUPda `$!a01|a 0b `?QS 1 0D1@1;S Sdq aHq嘁 圑 H  04 8 <! bRL4!0bSHʘ H!R =|1S HX( 04 8 <!0 cR!1 cR1O똑@ >0S 0堮80刣/ HL"刣 0[4 8 <,10$1010000 ;X@?Y `:PX?d\ pԗPx?;Z 1R 1R0181&H^ & į@0  0 0Aᰣ0`0`Sk1h1j1i1o,0K [L1S /c 04 8 <0#$0 #(#< 0, 1Z cj 1,0 p1c>Pl)n嘁 圑 Hq尢F?  0!1> , ? !$1 唡堢 04 8,  048<pcWڄ!R 0#0##<00 4S0C0ą#40ą ȓ ĕ ĕpG,0W#!; lp 1 Y`F/ !.1h|/ $!1 O1X p" 0 $0(0,$1R`1 0J>  ?0!41(,;(Xa  04 8 ||  04 8 <0#0##<0,0 0g,0 04S0g0#40   X 1 ;S,0S ᘁ 圑 HqjPܡV?  0X!\1ܡb 1$!0c0b ,$(,0pW4忡R?  0H!L1弡,0Wr)孡,>  ?P!T19嬡? ; S<0 $0(0,$10cS1 0P4 8 40 8 00 4  8 4 0 8 00 4 #$40#4 004#$40#40b 1aPq S㘁 圑 Hq0 $0(0,$1R000\81 H `d1 (嘁 a圑 Pq Hq5P>  ?P!T14Pl ,0P 0n,0  Hqa嘁 圑 D0S  04 8 000 0S4 嶊P0 00 04 8 <00ꘑ,00,0  04 8 <, 000000 0 뜡Z  +꜑ pHq圑 \ LPP T0 $0(0,$1RS000$10$1(K p-L0  0'S(㾈P T@P`>  0!1 0p܋c -a@LP(P0zp q?  0(",2œShR: S3 00@!0 S+*$a墜">  0 "$2壜e: 08#8:1  S0000S0000?00t`pvv?  0!1wjP c0Dᑢ0kPc܋cc0b?Ȳ4ԨA`8 8#4`#/$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A 0R0S 4  0 D R0/ p-LTaXQ@HP lKFQ\1Q+UP1P0a U PxUxP408+; R0Ҳ;pA?ԨA -LMP@U4(p 0S(p400 P pQx  Q/PU0SP0S x `R R ?` r(<U`P  1(0`0 V ᶠ(` 0?P\ 1DS \ ` V Q ROi223K:iF# AU S< i?`0 UP<0 i6V3 p0St0Sx0s 0K| .1S0:P 1S 10Z @ R< R Z @0S<0 S< iUP  PV 0S SPZ@J;`0eZ 01Q ` S0!t0 ;tPe U P!P \P. 86tP8%85<6t P<% R0p 0p0 0`0 < P 0S '1Px1D  ` %0X0K 0 W0KVKUK  @ j1T ` `0 0S `X K  0     ` 0 R#! R   `$X0KP (4 t1 0c0 rlo ` 0 ` D!R! D1h0SH h`XK! P    0! @h 0 I0PD0!0 !Q  @h` 1 $`F((P V@`   @`0` 90:0&`pV2 ` V00R0S 0  0 0/!410cS/h d 0  0 0 0 hK 0 0 0 0 0 0 hK 0 0l1$ąPP T100S 1X 0 &DP0  <  0$ $  8P@ PH L00 0 X00 0 1S 1! R!01& 0崁1"1S$bbܚ?bbb AĜcAbbcԨAf@bD 5܋c?Ȝc Qb01Qʸa0 3S80< R D P0 b00l 0 b,0c0V0 0Z000 0P[\傗0  0   0!00cS 0 01ZPP 100SnX ]PD 0<00+8P40 4000@0H00P L00Rx0 0P Ph   h0   0 h (0SX p Rp *;S 30S 0  1 CS!P30108p0 + V!410cSp 00s03V0S ۖ?  0X"\2ؖ p 0p0 0800倠@0|5 d 40 8 0000V8P4 N 40 8 0$E 4 0 8 0 `Q ` XK*` 0 10 0 0 0#\\ i!820Q$1 0cQQ28 #,#40#40!10cS01 ڜ S0!8#,#40#40x R R50000S<4`0,00' 8#,#4 8$0#(R 000R 040<,0`,00 8#,#4 8$#(R,B B "$ 0S 8ZPE!|01Q140aQ141L1S7P!0L100  00 40 1P"|Q !41R!0R 8!P ᓧ +7 0?0~14!0 bR41Ő0x\( \>(<(((Q X000pQ0001P. p00(h00РZ ~PD Ꮲhp   00"42UP  PP  /PAU2U;S4:PP|Q0`f`0C \:`*0Ǧ<1X|:ȁ0  0 00 @0  0@ D0: R$100! bR01$1x10   00Ⲧ0S !4;RX \ TP(P(KP`41S00U0 0XP; 000 -p0`!0L@RP'0 0R"fP 1W010P`00P 0 R01 p p101 01bbbc -40ML 00 00  KAc0 /101/ -L,MP   ABAAB S@@Q@THQ <Q  `   PJ4i\1QT0 `p ,K' 0K',00 c#!c!b8"8#4b4# fR, 00  iR cRPK!T @D BT @ P 2j\( K($0T0@TpALKwp10cS1qS\  $ (  &@Pf q_0aSL `0bS @D0aS0bS1T @0C10 0C00R0010 ,0p gRpp%S0` fR`` @fQ0gS0P#  0cQ000` fR``@T 0bS0@P 0! cR1T Y(Kbbbc - 0@L4 P`8 < dR@!00dSʜ1 px0C10 0C00R010 吙 00dS0@0dS@Qbc 0-L@PP1H0C10 0C00R010 hQ0bc0   / l\ l\ 0 0c / l P/ -LM+;@R0`;H $ ( ,aQ&0pPK;p%孤Lq0  0 0 0c.P`` 10c!0,6&08a0041 b<1R<181% 00;08!5; 04 8 U 00#2S S < (0<0 ~}@P gX PD 0<00+8@40 4000@0H00P L00z}` pPD p`(PP|zk0 `""R Rp`"  mz`p < , D  H  (X<  R P < 0H RMzP1X }PPX' 5< 000SHl5X T0 yDPT0X  <  0$ $  8P@ PH L00)zz Y YP.`0 00 0P0"(4 0(8(0p8K 0 X T0 "T0 "X "0(P0 04 0#4$ "$ 00D0 Pg 40 8 0L^ 4 0 8 0 0 0 0 D  ,  Z@ i1R#@ @ L3S08#,#40#40 00P0 0< Y0D 0(0  Y]" T0 X !X Ƞ,x,̠Č ,Ġ T0᳜ <0px'<'tp2p'tp009 0( X 凋 XZ Ƞ,<,ă,Ġ PU 4(PDt100P00P0%<01P0S  P%4P0%8%\0PZ   R( P(R 4 Y Y Z 0 1S;0(Ko0 (Ko7/(K00X0 !Yn YPp`nL0 0000< ~< H0~x@ĜcȜc8AA4Ab0 ,,,"R "2R  S 0 "`"d!!B!R  T0 R D <0 !8 !0 ,  !!< "/b0b4b8b<b -0ML U0 00 0~0  0 ;R< p00<0S`\-XYE&΍00 Kh$bcAccȜcA44܋c -LpPX1@PP H~/ `0`00a1$0ap1a(  `  ᒟV`W WP(p0@0X00P0 4PDB@_0P1h0d00Ct1 P՞Uў b@cb,?8ADAcHc 0-PL R00  0R010 w8@T @0 -p@`WL(4V(404!20b!0?P00Sh PPe 0 08` @T0 T儠 Q ⪠iᄐ删倐  X,匠 Q ⪠iጐ吠  0<P | 00t0 0b SR a(|0 P( | 00b | 0'Y0:0,uP nw000W:0 00ƌV p後œP`pY(0  0( ,0ZlpP(``PU40P؝i =z܋ccc -P0LU(PS(P@pU( ;`S 0;:0  0 0  0  0 $0<W(00SxGxtk܋cf0 /c -0帠LI?`@p0S SPU P P Ջ0  0 0֋]0:0J@ T0mj?cc܋c -@L0S 00c -L(M0@`SPc0S`P^P\ 0@S|1\P PW h10SP UQ 0 Sp? ( 0R*T@@Po9@Pj1@80 00@@CP (0S Z PU ! @P @P 5 @@05R 0S00s00 0S0 Q0s000" NKlj01[NKShp倀7 0`P  (@(8+@@(Kcac -@L|M0pK`P` ,0 ,0K\0 00 0 00py3 00zPY,0S0 (Kb -L|M@pK`P` 00 (0K #\0 0 0 0py300 00~zPY (Pz700,  7 (Kc -LM4@K`pK Q` {0 P00  0 0pd@ 00TP 00Jz0p`s`3P`V< pP ,P<7p7(KHcc -LMp Q2 0 0" W   ` Rac@P0W 2 `3 " r 72 @P r 0 S PP (0xPK -r2吒 W2  W=( p 0 B  0R 2 L0QR 2 1R 2 0|2   x t"  S" ( lR " p" ( h" dR `rK_Kt&.KpupP"XKW!KtV?Kp& D( p&K 0 B  0R R 2 P02 1R 2 2| S0+0x" t2 0^2 (0lR 2 0p2 (00h2 dR `rK_K$ L00?K2 r`0P "XKW!K4VKK0L00p0PpV00Z0S K -{0P | 2 62 J  0Fs `@"TBr2W20600(Kc -!1@`pL1`Pᄔ႔; C(R00?0! 8Sl00?0T00?0X; S 1S  hJԨA -0XML0?,@ 0 0Pp` 0 0 @@@ @$`(PN< 0 0  0 0(p @@@ @$`,P9< 0 0  0 0(p @@@ @$`,0P"t> 00 0\>'0000 0(p @@ @$`,4P >Ο 00 0 0(pD  @@ @$`,04PD= 00 0 00D (p @@ @$`,4Pd= 0X=(p00 0@= 00 @ @$`,0`4P= 00 0< 00000(p @@ @$`,4P< 00 0< 0"0000(p @@ @$`,4Ph< 00 0P< 00000(p @@ @$`,4P|< 00 0; 00(p @@ @$`,04Pf; 00 0; 00000(p @@ @$`,4POp; 00 0X; 0 0000(p @@ @$`,4P8<0; 0 0 000 ,0K(p @@@ @$`,4P 00:, 0 0 0000 80K(p @@@ @$`,4P`:, 0 0 0D:D00$08 K0 @@ @(P~ :D 0:00 00 $08 K0 D @@(P~9 00 09 0 0000(p @@ @$`,4P~`9 D00 0H9 000(p @@ @$`,4P~ 9 00 08 0 0000(p @@ @$`,4P~8 00 08 00000(p @@ @$`,4P|~d8 00 0L8 00000(p @@ @$`,4Pe~8 00 07 00000(p @@ @$`,4PN~7 07(p00 07 00000 @ @$`,4P5~d7 0L7(p00 0<7 00000 @ @$`,4P~7 06(p00 06 00000 @ @$`,4P~ <06 00 0000 0(p @@@ @$`,4P}P6 00 086 00000(p @@ @$`,4P}5 00 05 00000(p @@ @$`,4P}5 00 05 00000(p @@ @$`,4P}T5 00 0<5 00000(p @@ @$`,4P}00%4 0 0 0000 0(p @@ `$`,4Pv}4 00 04 00000(p @@ @$`,4P_}<0D4 <4 00 0$4 00000(p @ @$`,4PE}3#0 0  03 00000(p @ @$`,4P-}3 00 03 00000(p @@ @$`,4P}D3 00 0,3 00000(p @@ @$`,4P|2 00 02 00000(p @@ @$`,4P|2 00 02 00000(p @@ @$`,4P|H2 00 002 00000(p @@ @$`,4P|1 00 01 00000(p @@ @$`,4P|001, 0 04K 0000 0(pD @@@ @$`,4P|!0Drs@AbADbAA@5bAbAbA$b#A(b4Ab=AbGAALATcVA5_AbiAbtAb~AbAbAbA54bA8bA<bAAԋcAbA@bAbCA0@bG@5cA0bApbAxbAtb Ab-Ab9AbEAbPAbbaAb[AbjAbA5vAb*A5AbAbAbAbI@bAbAbA bAbbLk5IAb@b  00 00$00 @@ @(P{0 D00 01 00$00 @@ @(P{ 0  0P1 4 0 000 ,0K(p @@ @$`,8P{1 00 01 4 0 000 ,0K(p @@ @$`,8P{1 00 02 4 0 000 ,0K(p @@ @$`,8P{<0T2 00 0l2 4 0 000 ,0K(p @@ @$`,8P{<02 2 00 0000 0(p @@ @$`,4Pk{ 3 00 0$3 00000(p @@ @$`,4PT{`3 h3 00 0!000 0(p @@ @$`,4P<{3 00 03 00000(p @@ `$`,4P%{004, 0 00K 0000 0(pD @@@ @$`,4P {0$0D  04 00$00 @@ @(Pz4 D00 04 00$00 @@ @(Pz005, 0 0 0000 <0K(p @@@ @$`,4Pz<%0  05< K00$00 @@ @(Pz5 00 05< K00$00 @@ @(Pz6 00 06< K00$00 @@ @(PzL6 00 0d6< K00$00 @@ @(Pwz6 00 06< K00$00 @@ @(Pcz006, 0 0@K 0000 0(pD @@@ @$`,4PHzD7D' WppP7P'D0 0  00$0 0 @p @(P.z7, 0 0 07D00$0 0 @@ @(Pz(K -LM 0`P0@ZZp Z 00 >LL nSR36`T Z Z`{ p kR@S@@VU V`eIY `H65x65657565750750Ky`PU00S0000N0Ky`PI00SCڼ+S;B>,K zy`P;,0S14 ,K oy`P0,0S1) ,K dy`P%,0S1 ,K Yy`P,0S 1Y Y 00;(K0! zx``*`(KAD? - 0L@0P0S 0S1 `P=1U;10;0 U/`2 塏`P,Xp u`P"pW pP0;`1XP01 W ᫂17`PQDbc -;L@S\95\95\95p95p95x950; @00;T5 ;S20S0S (P t{; S 1S" ෌ S0S \00 M P@ 0S ,00 @ P@ԨAbb 0-0L@S(PPU(P;S0h1 Q0h9{L~@P 0 -LM 0 \0@0S S 0(Koi 0(Ko's40 0 8 0, 8\40!HF-40S S$g: }bm~&.5".\8 40 0 l8K S Sp``p,xVVW \\HWPPVP\ <=5?5P=5=5$>5A5?5?5?5 @58@5A5H@5X@5@5dA5A5A5WV8/P+1( 1Sx01#S S.    ጂP`0Sd0Sh0s0 00W Q PV Q kP0;W Q эP  V Q LP  ÂPp0St0Sx0s0 00X}P3# W ᙌV d~0j1j1 SQB?yy` p 0 y0;2`0?0K4yNPz궁w X 0SXf|i5At,eX 0S 8 Ad8>dPT0S1@J 1 Gd1 D#F 000ed10#d1< 80  c00cR00 sd7,X#| 00100L00W  V  {"W  V  {P^-,!/(Kcc b܋cԨAA -LMQ`@f R Ra!p!P!|!x!pt!Pp!l!匀K` 0 S 0 ( K"\  0     o 0r03P0S/,0S+* BR&C5C5C5C5C5C5C5C5C5C5C5C5C5C5C5C5C5C5C5C5C5C5SW  S SY SS0 0(K蘹AAAAxAlA|AA -L  hs@ @I@A    /Q/ 0S   b0B# 88700 0000C0/!0 0 P//%0$0 0S Q0cC1D  0S Q 0cC1///Nk(%0 0$ 0"̃\s   4##R  / L##R S///$ 0 4LP/PPP 40P</$0P/0P/bbb -PLM P/$0 L 4 `, sP*+  0   0 s0P s| , 80 s`Pp80 s80s ,0, L v"@H 4 0 0  00@H0X*1$0p4 0@L s# 0$0|00$00 0 #! B? 01$0 0S$0  #! ? 01$0P@! 0@(Pp,0 %0 `00%0`0 R!   ! 80 .80`, Y `%pW`(P(K<@bAT?A:AbXcؙcc4c 0-0L@T 00S0Q@ڴ00S0Q@@P PP x0 R  d0T又P P0$ (P 00 P@: 00!0[P10%0C00}n00`tv  ? W 0/T0#0=9C =C0 0 0 S0S@@?B -LDMS0 0@q0P`l0 ,Y X lH0I 000W880090 00q 0pcGsp088700p0W 6[ 776K6[0"8 088S2  R*078800$!Q `%`&a(KoT? -LM@`|p  0 P, 20 0@x {0 @o!0 0!0霚c -LM@`p  0 2"@P <0@0!D0#H0#,0#00#40#80# 0B E0 @9!0 0!0霚c p-L@`PPe Pd 1V0$10 VT%0` 0 \ , $"$"( ! !   ! ( !!   ! !  ! (0810$0f-<`p0,``04 2$"(01 !0  00!0(01!0  00!0P0 !0  00!0(0810$0`<6pp p -LdMPP $0} 8@7 !$  100 100 | 2"0 #,p0 `7@P] <80 2!0" 01!0!0 001!0!0,p0!0|0$0?L tKm!$  100 100 200 | 帒bp@P" <8X<80K,H0K!0 b01!0!0 帒01!0!0 02!0|0$0$00$0(K -L|M@pK`P` 00 (0K #\0 0 0 0py300 00dPY00T S L S ,  , SP00,  (Kbb -L 哀 $00$00$$LLLLtttt  H00 dP,0 h[ca5cXcbb -$0`p`LP4@T 4/ $04@}T 4/$0@4puT 7/@ $08@kT <$08@cT 04/ -L勢P ? -L`PrT@ITnTpv0  P(000$p0\1 00(0080֠00l00$04#T 8/00,0l0S    $0JB  0%>B 00, l0d0 X 0%PHu@4mo? @ @? &@@@kAsAZYAW3A @+@@ -$@ 0p,p00$0LP4`S 6/ `000000$04S 8/  l0000 00000S|,00,0$04S 8/$04S 8/ ,00,0 00300 0060000000{A -(0L@`Ppp0S 0ESmDs5q5q5s5 0"Sjdp0'S $04PXS 5/$0`8PPS ;5/T03K p pGW$0'Ҟp0p0= P$08`3S 06/2/8`(S 06/$08` S :6/8`S 06/p"0 #R03 opԟ؟ܟ蠆 -L8@P ?> S P  ? -$@` 0,`00$0PL4pR 8/$04R 8/ ,00,0$04`R 6/  000000,0 00300 000 000 $04`R 6/00 00 00 00600 -LP`R@p幠s}  ~`(0 00$p00 008 0(0$04pkR 7/0H0,0},0 ,}ni} ? @ @$? &@ @@ p-@ BLP0R-v5v5pv5w5 0"S*$ 0"S $04@5R 4/$0`8@-R ;4/03 7  0"S pp$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩AQ0@/;//Q0 !88S0 00C0C0CQ0C 0C3+C? R0/ -L|MpK@`P` ,0K\0 0,0 0 0 0py300 00aPY,(Kb p-dLPH@d0  c?$ (0 1R@0@L1B @@Vpc 0-HP@L<c 1S0 10 R  0hc 0-HP@L<L0S000 R  0hc --L M0 0 0 0v K -H1LP@4`p  0 000P1~xPPzP UD P1 Ab/PPPe x 1P`/000b? PPP PPWU" Q U <`p  0 000P1 xyP ; U P  b?0S/ `p  0 000P1x[P b?0 ? R}5 }5|5|5}5 }5}5S0C H!B00000b/0P c@0? 0-0L@ P1P5P1P1   P R @ 0S00 T0S T0S@^<T@@?@0h50 0-LP@ + (%@DT0 0-L@UP 0SPL0 S@0^@0H4:0(0@0000?@?cU EP? -x1LS 3/ 0-,P@L0<00h[c - 1L@Rʘ?$㴩P -LM@ZP _@` PK r S =Pp`c D .Pp0!:00 0K -LMP1!P@ RlPW !`V B/E BR!P ? RE n ;@J 7F0hFSC b?* c/ P$pK`P  $ PP15P10:0b? `a V`8`VZ`x W 0 :0\'0  B K0?AS/0s/ - @Ll B1Q2Q001?0~0B?0P!?0~ B Q?0P00? ~0B0Q?01 -LMDKp@ `K|K  0S0 E  ,KP@K`Kx`@Ppx$KKK(Kc p-P@L``0P`@P@00 qP$ 00S pcb -LMp00@`T7 @T6 PU@%3T 0 S*  }Q 0S  'P   0S  @|PUX H03 $ @3dP夠K ⩕ 0 0 "0 +w  dT x =0 "w  T +Pp6q00 !0 R$0S S 0 0d H0"v0 d0!H0v 0S $1 Q 00=QU0@ K4K0P8 0,0l!N=0S,0 4 K  =9C4 0 =C,0 80$!N=0S80 @ K  =9C@ < =C80 0t0⨅S SSPP SD00DTV%UP,'@080!d@K dT 40Pv ặ(K A+ AH AXch Aw AR@ A A@A@?B' A p-jL@P`z0L1B @ T A>A@Vpc 0-@ 0fPQLDD0XS 0B$QPf?0U0 Ac -a L0R@PpL  U  0PP0SԨA 0-LP@P   0 0f@ -1LMؑe P21`c`ooS`f`` 00a0?oQ0c0sY !` F12g0 "!10CS1!1R10!1 VPq00p0  K0!K U :U X X  Z  JZ P J<@T(0(K RP.bcb p-0@LP`?Ppc p-@LxtP6/ 0 `P0S`` 0LaBi xaVpc p-PL@`MU 0P @R00` V(P 000 00`P0C00 `L1B  ````mpc -0L #P -LtM␡pPx@ ` \0L!B  @ 4G <(3\0 !Q)l0& R# P! GP1 0Sp!r /I`d2D b^P!p RdU dS`1d`#pK }G0PRP`>H1p !?0pU1pfP!P1`PE0 S$d6l   s0Pp`00  ? 0`PgPpp댠JP10 SU80US  pp0PP|M#0 S`= < Hp# 0 0 0S* (KcA.bԨA0? c 0-HP@L 0000   @@0  0h]cbc -@L840,  B R 00 hFccb 0-Lv`P@v v0 (4 @{`l xq 0 0%#011111111111105b A A A A A A 0-1@L01111111111111S !1R 101! 0Puu7 A@?x=(S4Q`OlMKI̤ʤv0h `.bcb -LHM , 4@ 5NB c2(`K@ @&0 0Pp 0 0P$P @@@ @(pa2 ;00 0 0P$P( @@@ @,pa<2 00 0$2 00$P(,P @@ @0pxa1 00 01 00,< $P( @@ @0paa1 00 01 00,00$P( @@ @0pKaH1 00 001 00$P( @@ @,0p6a0(`K@&,K0 0 0P$PP 0 @@@ @(P,pa'>00 <0000 0t0 000K @ @$P(pa(KccT5cx5G@x@ A Ac A c A c AcT@!Ax5b B12 "g0/ !1 S!10 !0Nbc -@L$ 0  (h 0-L@P TQ @Q t0  0 0>;0 0<0MQ x]$0hѢ0 0-LP@PY0c -L@ $Ic 0-@Lpl0 R  f? P< f?C000+U 00cحA.b 0-PL\@0T00 LA00BI B00c 0-@PLU0  @  LQBY "N000020c -PLp@ ' xP`  0 \00\0 PP`  0 $00$0,P`  0 $DQ) 00tQ `   S 0p @  W<0S`H<> L14 0 T`S`0000?V$0!P1  T0SD1  aP xP000L1 1S 3/P0000  p  9|0 / b1WW   ^?09c1WW P15v-T 00S P15P1N, \1WW]1WW XW\1W W  ^1W W X@   a1WW 0l<0%L`1W`1WW W  p p W@ p p < SW1W W 0S Y1W(W&  3 0R  ` v0S Q 43 0>;0 I X1W4W`/Q P0 P p Fp0 P P r @ 7p0 P P X  @  R tZ1WW lf1WW  ]b0T  0R   1RVRxN`cPHZ[$@ W T1W U1W V1W   W $1  @q@!0Sb/ c? 0  :0/`boᶠT1WW  ` JhFV`#K`FV0  k`!a1R P15P10<0m;` ccc0? 0-L MP10K2P10@0PK9000 00 P090K0 -P1L@ P1T 0d1Pe1S p-dL@HPHV$($](/0$ R0pc -`L@pAP PP 1RP 0L1B P U Q ~X y(c 0-L1@L;P@ >@0c -L@M@T X\ T 0@ <0 T5TuP\!8P PP aHP 8P L1 Q-l * S' \APl01 0S$$ B4|}[dX  X [e1d!SL 0SWyR0D ! SNSoHQ@Kc DPH 5PS@KcDP.4K}c4K@0K P R0D%SOH R@Kjc0DPH0 4Kdc4K@0K P R0D%80,dcPUP , PT0S@ L "0LB H0 U0 \  K#0( \Ad1#XS #XX? 47-  ` 0 D XPT`D_YY ` PP ` QZ X 0 -T1YY U% ? P 0S U0 Y T1Y U1Y V1Y0DQD0 Y0Ld h0 w Pd h00! 0SD1  `P x! P000OL1 1S 3/P000((K@V 긩AԨAc.b -LKM<Z  Q@Pp0CQ.*<Q+ <Q' 0C<0S <Q 0C<QJ0t<Q l0CQF:0Q0 H<Q <<U:0<0S5$  a, sA;W +`P M+\1 !1Pl  S 1 0S l0 ?P T 0\;U 8P;U D;U Q0CU~ 0U 0CU:U 0U 0CU:U :U 0UR 0CUyT:U 0CUq:U 0UjD:UV t:U h:U :U T:UXH:U :9UP;9U? 0CU 0U 0CUB79U1 9U:90S5 p0S0000d kX e*@ _00 [ 00c0 T0;PUPPK0S 9) 0S S 0H0HS` PP ` 0d0 D0`0 P \ Ks `P v !xE`xd.lVh8@0TP8``Q, 00 0  00`70S ! Rhl0e 0S00c\71 0RXl0U 0S00 71 0SHl E $00XL19L1X0;R060S ;`P6U_l0, |1S 3/`P{0L1$0h1(0l1(0S Q46U# P1#    2P1P@`H HKHKP12P10UD10H1P1  0;; 0P1 20P1 o,GQ00PP`% 0P ܀D0, 03/0 3/`P 0 03/, P, ,0 P! P!<0%P! P  1 0Rl0 0(03/0<0Fp3`10S 0S0S 0S #]0S1001010@l00l0S2P0S ! R4l01 UePP 2PQd2`1 Hb0R w( P%Puq 21 0Rl01`dPP 1 0R 1sP1ppa^Kh 0@_;(Y P  l ,Kp`P(,0Q$ )` '7`V7 0S 06/`v7` ```(Ktrtnt ttutCt gtc.bԨAAht@xf@^t t@{f@st@wt@|ft,@Bt @~fحA@t,ccA 0-@LP=@00c? 00 - SL@  '":P:#V` WUpP d0`p.P 0 <0 0000 0J!A !A!AU!A M-L\M0 00(@KP 0 ?c?b -,LP P ibf!Ab!A -@L\ X0T 80T 0S 0 0S   cb/b  -!8LxQ   Y; ]PP 6P% q8P7 U0@PPdRd #:PPڌs  8Pp U0@PPxpK 0u03R0SP#PT (KTbc p- `PQ": :P#6p LA00000P00P0 ,$㛖4  $㓖phpTb - @L": :#6H 0  0$000P0uhTb 0-X0PQL0A D T 0S xA@t@3@U 0Tb(c -!L@0P6PPh0SSPP `a1RpH 410UTP$ #Ra U!pP RP0aV&TRp ,⹖ ᷖYxN 0X ` ᬖ ᪖TQ0 q TbxA!A(c : :p-@#FLPPp0p0a@ x1S Pe PD0<x1_ 0003/P1;P1PPPQPpTbc 5 0-8PQ@L@ $0T@@? 0Tb(c -@L( T@ Q0(cTb p-0L@s` r #*0*`"&\0Q $v ,$n4ph pcTb -`,$LMp :: #6Q4V@0S 0 P0@0P0P1; P1  0 P0@0P0P1;P1==Pr d3Rn\3V< ;1V @3VH 83V`X,3V9 K0VY3V0CV/*3VO 20SJ&0S000Y 0 00S0 00000tS0 0 000H*x4qP0E>SzP1S000 00V0$ 0A>A0BQ3\000 0S00000CS000p0 -L@pv`"Q P%PaUP 0pe`0e00P 0PU00W0S0 S00Dh p-@L`KQP2 V0PPcU PPc)\P0l PS  eR 0 Sࠡ! BB.A.A B^"  0PS  eR  p 0-@LP 0U000 S % cR 0bPb 0S00UQ0S000h p-L@`0 PS S0S a P p0000` Q  c 1 R S0C>!>03 R S0C>!>0300 0000S000p!A -LM`Q@`Zڎ0 , SR S 0S@Ha PE000p<0 PSP`P`UP 0S  AA \!A"!'*J   " b  00 \:0 `e0000S000V 0R,%!A@-0PPQ @P  P\ 00cS@@10CB>A>A0B\3 c@-0l S0 0 \ @0dS@@10CB>A>A0B\3, c 0-@L RP  B Q AQP 0cS10CB>A>A0BQ3\R  0 0-LP@p040\1 1l 10 P 9/ḩA@- l@  \@蟐 @9 -L@ 0l  P x Q  Qd0 1!  Rl @@ l 00(h9@@at .b p-`h0PL\1 1l  10 @T 4/% 0Z9P:Pp踩A p-`h0PL\1 1l  10 @T 4% 0(9P:Pp踩A 0-L0P 1l  10 @T ,$ 8P:P0 -LM@(pRP0 , 0 " 0S0`0S /000 pKX0S p8ppwp38p`K9P0 `Q 00܀K 1AP0   V Q 10 p0St0Sx0S|0S 800S 0S0sP0 `0Sd0Sh0Sl0Ss`00,0K000K0 40[,`QppW8 iP0 1d0S-h0S*lpW' 4K0S0K40T`K P0 TKuK(04!00K00d0P D`K 0 {0 #K  ``V00S10 j4S;(0KpK 00@KP0 U 6\P0 " 5`@Ip0St0Sx0S|0S90 sP0  la04``p0 0X( 3S 8 <0S0D 0 8 0b0S : 00i0000 00 [<PU 0(00 0(070(""$ "$ X  XL """,  `   D4 PR 4D0 [ !  0c(#("$c4" R RR  R    QQQQ  !#8<0`00000 8#8"8S03 00 02 00$`4 @@ @(p,04PJ'>02 400 02 00$`0 @@ @(p,4PJ'>0T2 400 0<20 004 $` @@ @(p,4PJ001 01$`00 01 00000 @ @(p,4PtJ1 1 00 0 0$`0` @@ @(p,4P]JH1 00 0000 ,0K$` @@@ @(p,4PFJ04 00 `00 00$0, K0 @@ `(P0J0'. 004 00 00$0, K0 @@ `(PJ(Ks@I@K"AAAAA0@`bG@50cAh5P"ALA`0VA0 -L M0@`SPQ0SNPL0@S@qLPI P ,10S$q>qU?  0R, ( Q*T.}*0K 8 40 40  05T83["[0000p0OQP}83["[0 8 0 puN(Kp8/'d?50c? -LM 0@p0`&XP X/`"0S  ᶺ0S  d`T` 0@S*`$KMI`P$嶺 K -LM Q@P` 0oDQ BNT> OQgPV Q񟗋55855`555D55L5|555555555555Vu `WUXn11 NP0  c@ SYp0SUt0SRx0SO|0SL T qXBK?p0S t0Sx0S|0S92 mR `U101Q MKY @0@CKJRSMeMT"[-8W 5U 5-c0cAAX"A p-4@PLJP ` 0 phJ,c$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A8#8 8#!8#8!QA"A"!/1M/ J -(0@L((0M X h{J -LMp@S `$ < 000S76PP2 X P 00S(01  $K 0(4 $0DKP5$P 41P`01<@J80  08 <0J K,c -PPL$MPP@p`@0 P0S0S8K0xP0岐ᲀ0<0 0S T] 00SY2P@Q0SM4SJ`0Sd0Sh0Sl0S `  P8 0S 0S0sP0 +p0St0Sx0S|0S p8K P4 S 80S40S00sP0  (0@< 9(0P1* @0T%0`008K 0NPPp@uI80 08 <0vI04 _OPP (0@< P(K0cXc -LM@S`p$ > 000S S75PP1 X L 00S1  $K 0 +3 $0GJP4$P 31P`01<@I00  00 40I KXc -LM0000  0 0 000000 0Z KXc p-L@1 \) ,@P`H0  0 0 ,x    Q $Q EP X@P`H0  0 0Hp ppQ`b,c Qp-LF ,@x Q/ Q Q;T0  0 8    #,#$ ("( 0R  pQ l:P P@P`sH0  0 0tHpppp`bXc -4DML@ 00p` 0 0 @@@ @$p(`Fd4 P00 0 0(P @@@ @$p,`F4 00 0 0(P @@@ @$p,0`E'>03 00 0#P00 0(P @@ @$p,04`E'>0\3 00 0<#P00 0(P0P @@ @$p,4`E'>02 00 0"P 00000 0(P @@ @$p,4`E2'. 0 0 0t2 00P(P @@ @$p,0p4`ED2 08200 0 2 0 0 0(P4 @ @$p,4`nE14 0100 0 0(P0 @@ @$p,4`VE1 ,K00 0000 0 (P4  @@@ @$p,4`=E,14 0 1 00 00 P$00 @@ P(`%E0004'.00 00 00 $00 @@ P(` ED X VHfG`0PbGT0(Ks@s@d"Ah"A`bAA0@G@50cA6P"ALA`0VA0Xc,c@-\@ 0 \ @Q@ --ELtM0 ,0 F` p 0 F0p S @ *  00K7P 00 Q@%@ *#WT |DP`F0  0 0F0 $   0`4 $"dd#$4h8&h#8 S S  V R C`pF0  0 0c00 0P  0`4  <K3K?`K@K 8K 0LK4 4KO`KPKHK L0S 3P* Ÿ`#0S$4[R\0S L S`0S < S$3[R (0 @ K (01- ` V)4[#[0 <L0WPb5F80  08 <03FL$[WP 0 p0R3:(0 @ K00SXXl0K 0 -0`kK lKY`KZ`K{ K $&K  K ㈐Ku`Kv`Kg 0$(K 0P#@`L E(@ 0@(0,@EEp 0  0 $0E 0@P0(KXc1@0c -LLMxS`p@E  0 E 0(RP%P * ,0K06P ,0 QP%P *UU BP`E0  0 0E0 g$"4$(XR#"80 X lBpgE 0  0 $0v   $ (   $( $(,rm  $( $(! $"(#,rT  1PNH0K  p0 < @KGKHK dK $$K  l +  \KcKdK p0l$&K 0pP"@PL D0@ 0@004@DDp(0  0( ,0D 0x/(K,c1@3c 0-L M0S00S-P+00@S0P& \! R0 PP@Q0 0P4$8 <<T ( TK00?h'x50c -LM 0@p0`XP X/`+0S  w!0S  %T`0@dS S*`$K BP``$KB`P$n` K --LMP 0(0 0(p` 3S8 <0SD00c08  0bS00S 00C0000 1PUi 0(00(00S(@#a*@0\ 0 ` ~J0x0K0'w0H00I00'<'t41p'tp04pS00 0  0(0""$4( 8"([0 ,0000(<((X00Q00l@C@0  0@ D0C( h1d 00@7@.$K`bXc -L M Q@Pp 0(Ko2Z4 BS06T,Z`xHV Z 񟗑666666,6`66l666866H6\6l66V80S 0S2 FPtWP!0 X kUa "Wb @XP\CY101V\l BUECBX 0S --<,K <W1 \ 8,  XP9 W# U,0\0UU -4S-- RR4-S-4<(Kc0c`b8Al2cq"A p-4@PLBP ` 0 phBXcM@-00 L0 @! "0@Ѝ/ -LMd08 4 P 004Dp?@8KP#`#PU`0P ,` 0 K @@PP Q` 0P`@TP Q 0P`@TP QIPGppp 00K R0 00 , 0g00 008 Q,04S" D0`c N0 K@0p 0C W   Ἴ 0 R00K0 , Q(K -LM @p dT|0 ` P@  00 P@ Z YV0S0 1x t 01p x t H xKq| `t吀x0K   KXP   t0L SxR| 0@ ` X L0H !B|0T 0S! 0000 YZw 0Su0  1 < 0 @ ɯ@ < !00 , r8 4 "d0  0 0@K Q 8K  @K  0&d  0$,0K S<   9d@  5( 2 ( h 4@80t0 ,dPZ ᨠ 4 Tp l t0S p l p K 00@t@  d0 @PS ,0Wh^@B@00d0| (x0 8P@P8 08#880(00 0(0d0 0000K20K$K0 < .= K10K0 @K4TD 48 |Q> K20K1pK=pKd0  00   , K  L0x0?V0 SI`c6S0` Pp9 l R00 0 000ź0 10t000Q$:0 000x ƾ 0x B cdd K00 d ` S0p0Pp X:0 P\ x0 `Y x00 P R Y  00 0 0b10d K\ 'XT'h0  0\ P00 (KA -0Ld | Q\ \h\ @  P (p  0 h p-LM0P0CS;0 40Q R00000'`P `L00s40s, 彽`40S$P$`P 7`300 U. 0S0dP0PU& P# 903/P 9 0  0<  3X?P"080  (00(0d0 0003/d0)R 00 0T0X0$0 `$0p`V` 0<V $ 嘷X0S S SP0T0X0$0  $0Pp0 U 0$ K 03QPpp-pp00CS0^ KpA}fpUDU@U|fU~fvtnUU.b -L@W 00 4Q 0S:4  -L@D T0<0- p-L M@P0K cXU* U Z%00`S  Q B `2:lP340P  0P 0S @0 0 3/Kp%%A -LP 0`<0 P EX(P lT@p 40P 40@p00W: L b Q-L@ 85Q 35@%AK%A -LM`P pP0@X4P5WQ 0(  5Q 0hP4 \0$00开 WPW 0R  R  0$  R$0 ` 30X0s<8 44R0S  3; 4 \0,0 sp 0S$0]S(0S0,0 s W , P0 , 6 (Kp!, K|3\P p?40<0 X3R 0S00 03[ (3R 3R,0S 00V R W RX *RY R W  2R0S^0@0K`0?0K 0>0K0=0K0<0K;0K90K80K02 : K0@K K0X0,0(, P` 0 oI`pK0YIPsIyl Y  &4 a P  P4 3P000 rK p`00, J` Vp`L@ P@0, 0JP 0, 0JP0, 0JP 0004 KH 0P0K4 40P@ t 0 0 F0 0R Xp T(K蕰@X%A @y@j%A%Ajbl?? b%AbmL%AA%A6 @y2 0 -SL$0]S (PSX0 (00,00/ p-LM 0P@``>0 08 0R807P`3 V@0 00 000 0U P$q` 0T`P`[UP wU ` tU`,I 00 0080 00 0Kp b6 - 0L@! 0 0800CS80 P ?UP VJU00 P V BU0 0P 00 b -LM` @Rp0p0NZ@T 0P0 ጴ0  0:Z@A -LlMp@WP `Kdpf mP0P 0K0 p" 2 00S (0SPU 1bS 000 Spp 0႕P"bY00R0S `00000;0PS00  000 -K`墮 0 " b  0R r 2 <0r 2 1lr dr 2 0p2 0h2 0S`K_"K 0B/`2K00_2K⨕0S 0S 0B/0000000000⒕200 P L0 0Dp -H0 0QU WH 0RD*R:@? S<` 0 R00S4 4S U/T! 0 U&0Q! 0S 00m0Sm  jB hD D^P8  8 궁L RH20H20pS  T0S  0TP4 C0 T0c00 p0c0000p00 0I0(00 @@ @p$`, )d0d@d(T%y P <)44U~$(K8cx@I)A7c bR)AX)Aa)As@7 -@0 ML040 0$0 `P  K`c)A\ 7)A P/P/ p-LM@P`j 0H 0PU. 1P PPQP !00 S` 1 O PPQPP0S 0  01/|h -1@L0801 |h 0-1$@L?0TP1 ( ,0R1 r X0h{D!: $D!!1( !0A 010 >00 0pp 0 Q U8 Q3q7pu7q7r7 r7Lr7@r7r7r7ls7du7hv7|u7xv74v7Hv7Tv70r7U8'# Z  XZ  P1 e0 C 冠5n1S S S$!Z `, 00c 000(,00  c0 80(0尠M X 0S N"sZ1S S% S!W1 8  MP 9#[Y 0W 0S < p  <  R VP00 1S S!C0, 00c 000 , 0 (0 c 08I0 ( PL >580h0!R R R  0h00@ 00 0@0@ 0@4 D 8048 H0<0(, 00@ 0@    8=-9 *A*A*A*Ac+A$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAP ڀ0P !P0 !!0踩A -L!01 -L@T01- p-L`P @ 1S D3%<0 P  0P p +Ac -PL@`p R0 Q 0SFjpF0QP1U: -L(M0@`S 1 "\ PP% 0P"   pW     !$pK"AP0Sq` P_0* R  R Q:$K,"AP0Sq0 R  R Q:$K"AP0S0 U\  ` 0d0 a` fLK H~Q NpK `   %V$Km$Kܣ? -pL@`PPPp hP0P p0P00W:T!~1 V1P<1 <1t h 10SP02I_L1T0P1X0T140N, 0m m?|?ԨA|7S -LM@K K 0tPK -LM1S!R  0K |1S!2 0K d1S [l< 0K p1S [x1 0K K0# K -LH Q @0Q -1CQ010 W@ W Q-L 1S1@Q@ T 01hQ01 -LMP`h3P00@ 0000$Ph`c0K, Kp! q0,PK KPL0#Q8SX0S T0 1010X10\10`1X0S3T00 Q,^(P0 SbWc7 G!hlp00pSUL0SH0L R1SR0 10101L01 P 0pPY/0p ,!0p.0, 0p!p_/0, 0P!p0M 0 ! !101' 1 R ! P@ P@P@P@@P !  B# 1I@0 04@ <0 080 0'@KH (K<{7@ @c$+A6+AM+A`+A+A+A??< p-LM0P@KU@` "00 00C0Kpc -PL@0pSP 0Sp00P1010!R1 B!01f?` | 00`U0` ic+A 0 /c/ -LMPp @` $1? (03/P   0[  0Up(0 00$`00 008 0(0\$04` 6/00 ,0 $04P 5/0L ,0 00 0 oa0,AZ,A @P? &@ @@ p-@ BLP0R/777@7 0"S,& 0"S $04@k 4/$0`8@c ;4/03 m 0 #R  p%)-p -$@` 0,`00$0PL4p7 8/$04/ 8/ ,00,0$04`# 6/  000000,0 00300 000_ 00000$04` 6/$04` 6/p(@ 0  $04` 6/$0`4 8/`   006    000 p 006 000  000@00600 0 00000  <000` 0$0H 0!0  0 0/ḩAlcc+c 0-LMP @R 0 008 #8000(00 00~PK0 -L0 -L@T00- -L`P@pP p@Tx` PP @PU -LPpp@H`PP PU0HQU ʀ0` !`0 !!00CS0{!0` !r`0 !!`V P GP<ᙑ0U0 P踩AA -L@P p 0S $00CS (0SSPS  -LM@P 0(0 00 0PK -LM R! ! $A%" # & ' 0  -LM@`PV p>N U8S9B:;WE@=@<>@EAEBE C? DF0@PGy00x0p夀0P`尠崐`8 0`P (Ko(K b -LM0S000d0 0e000 S ! $ A! " # %' &0 d R -LM@P`Q p 4 - NR`px` 0    S  R  cx 0! ! " # &0$ B$% C$'  `P i -LMP@`Up0r0 00!0"P#P`0%P$0&P'P  0p -LM0@PS0 0CSꠐ7H7<77@77ܓ7$7R00 0ZR 000S00|00 S x00|00 0P 0S  0U U| 00Q 0S x,PU 0t`0 .x0000 0P W00  c00=<? 840<[0C$\ C(C<] ^0Y0X R84W 0Z <S Y0X 84W 0Z ,0/] \0=($[0 ^0,>084<0?<R ] \0($[0=^ >0?,84<0 <c0Sc 0   Kh Q 0lS00 0=00 7U `R 00 U t`A 00KhzU a`. |00Q 000000 0S8 0ŏ -LM0`@VPpG0@S/\P T0Q 8  P  PQ8 X(L\` `@D8 0"S9030 .0 #R/ #+ )$04` 6/$0`4pt 7/``408 0S40 04`03/ p?CG7 0- L@PQ P 0?yP 00 @$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A/ -L@4 0S000 R  hc@-(00S 0@$0(@ b 0-PL@U ::#6S 40HP@0(0 @ 000\?c -L@20 X003/ 2S 0S  -L@ R \0S0`\0\S -L@T00- -L@k`PpW0 H fpW R00 `F0 3/QPY1A  b -l0LQP@ L m@0@ %R   0  B  b b p-LM@P$K em$0K 0/P 0 P00cS0\`e0@L@@@@ $0S (eKp bc -LP`70@S  M P!00t`0h .bc :: #6S0-L (P@尋0$@0 @0.bc b p-` ::@#6SL@ jA@P ,00SRp %@ bc :: #Q0-Lh0 @T\P tL0$@弋08庰P P000 b.bcA -` ::L#6SP& 0R!@lpP V ``` 0P #X 寂 bw2A b -@ ::L0M#QPH2R @ R02 $2R !$ 2N{M`pVt1U 1UY 1Ujc 0 P c T U_X]0 1SX U` 0 ,0 ,0KH0 0D0 0@ <0 0 L0?40 1(P 8P D000 -40`SH K⑹P 1 P UQ 40SH KtV  0 C~R 0P   0? $K}f~f.bcAUUU@A p-L@PD0`s 0080 5#4  4 @4@P00 phcc 0-@LP&0s R$ 0%%40 000hc Q-L ~2A0 "! 00 2! p-L@`TTP  T  ph -L`pP0@0 %h -"LR 003/4h8$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -LM@,0 1P0S0S:0 S:$0S( ( (0$ d1  B ,0PO$PU,0 `PD @p0 0p p0 00?IeH0t Pe / 0 Pe Pe0( 00m}$ bh@43AB3AI3A p-`QL@ P L  |P , }pAS3A2A p- L`P |@ pA|A -LM2 ST00S 00]000m0 K0AԨAZ3A -#0LM(0K0'0K0&0K$KA4Pp(K @% K#0K" K! KP `2 H P0 0 V `V r  K@-0p`tpP@T 0S @T@TP RQ `S: 0-P@0LD@P 0U0е0 R 0S  R RQ S:000 -LP8pP`Pe 0@PA`V` | |PV 0  p0P> Q\ \\ \ 0S: R  0QP")0 Q @ Q Č\!pp 0P {00$ bm3Aa3Av3A3A -LMMP@`QPPqPU ,z 0SP0p8]PU8{P{080P0 0v8h4 KPb1p[20[ tc{PPX  0PP ZF0SB `0 `VY6 0Ӷ0` #)@00` 0P"p '{P8 PP0` 0 P 8`V*`V ${(K3A$ b3A -L0@pjd`PVP``+ ; KPP z  0-P0  zP`# \0 dPZ`lz`\d0SU`M0VS  0)PP4A$ b -QLMP`@,pK  P '0[S @M0T K -p0@L`P zP@ @`P0 000 000$000(0,p 0003/@P0 z$ b p-L(ME D0P, 480 G F0@P 440 I H0 H0I $p1 @04A04B04 04 0S004 04\0S``Jp `0P " 9`Ⳕp\0VW2J>00  C`V0X0S N0!< R  1`0 $      0S X SX0 04 p-@LP 80SP0P`8PU8DVxPP 0Qx\0S`Kx0\0phEx$ b -LM @`ᰳT0 \0SP8K`0qW ᠳ G ΢Pl Q XTP\0U^ 0P Q P(K4A2A4A$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A -L MP0@p `0`V" ` V \  R K  0P  0R   0 @0 K -LM  -P0$00L@STD0 `<V 00S 0  0 03/PBD00D0q D00&00000S<0 @0_0003/P D0 0 003/D00D0 Y]$0`S 002S , 儽= 5A5A! ! -80@ L<0 03/PD0 0D0<0@0 -D0L00D080<003/D0 0<0 @0/ 0-PL003/@P 8PT0 -D0L@0 80003/ - 0L@0CS 00S0S   0 0  B 00 03/$P v$ b -L M@0P0 0K`pP)`P! 0 Q00pp004p0 0 0000 0D00D0 0$`( 0PP0 $p(pP pK  00   0 D 0 0D 40/ 0-@L  00 0 0P  0P& ^D04P0D00       00 D 0 D 40/Q@-@@RS  \00P//</00S 0/ p-L@$P)0(00`00003/P $0S p -00L03/000/P0S00/00/P0S/0S801!//@-0 $ @0S@T\S: / -P崡0L@0 (`rW001 R D00&00000S <0@0*^D0 V0<003/D00D0V0H0S000 0 0   0$00S 0R*100V 0S  3/0003/ 0003/ 0S  3/ZWZ 8VXX0S `P0003/P 005A 0-L@P>0H00P0HPPS  @@"0 -L M@40 P崐 `P40p^  p&$0 000 p0 p  㴑]D04pP0D0X0p0P<}0&D 0,0K  ! ' ( ) * + ,- D4 40 PP40, [  00'0D0 0 )4 &(P*P+P,P-PD0}(K -8L M#80000 0 0| K -LM0 K -~0LM0K00K00K0K 0K 0KKKK K 0-LM0@ SP#PU HVt00K 00K K  K  K0 K K0K KK0$ b 0-LM00@P03/00K00K0  K K0K0 K K0K KK0 -L`Pp%@P`  0&4 0h0P 000T0 P 0pPQ\D04P0D0tP`` 47 0-LM00@P03/00K00K0  K K0K0 K K0K KK0T/ -0L003/ -0QL""  B"003/0@- 0@  PU \0勓l bp@-8A#X40`V\\ AQpP00 $00/ - 0LSPH @T4L@T@D5A5A'6A -LCMT0pQ@0P 0X T0S1s(0K0 J?KP(0S%![&1[401(0KJoK0!0P7(X` A+.0Z ă Ƞ,8,̠48#8>  #Ơ#à? ?0<<00  00 #à?0 <,<00P `R00$K0$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩Aù¹ -LM K KK K K0KKC4 K 0K+ K -0ML@  0PP -LM -LM 0 - LM00KK0K0K0K0K0K0K 0K K - LM_00KK`0K0K0K0K0K0K 0K K -LMKA 0KK K0K K K K K K -LMKA\0K0KK]0K0K0K0K 0K K -LM 0KA 0KK0K0K K K K K K -LM 0KA 0KK0K0K K K K K K -LM#0 KKB$A0K K0 KK0K K Ky K -LM#0 KKB$A0K K0 KK0K K Kd K p-LM`@PP  K^0$0Kb0#0K0"0K!0K $K K  K 0K0KDKp p-LM`@PP  K!0$0K"@K 0DD#0K!@K0 $K 0K K K K%Kp -LMP@`pP  (K!000K 0/0K.`K-@K0(*pK,0KGt00K +0K)pK$K -LMP@`pcP  (K!000K 0/0K.`K-@K0(*pK,0KGt00K +0K)pKF$K -LMP@`p@P  (Ky^000K`0/0K.`K-@K0(*pK,0KGt00K +0K)pK$K -LMP@p`P   KX!0(0K 0'0K&pK%@K0 (K$0K# K" K! KK -LM~KKKA KB$KK" KK K K 0-LMP@P K$0 @040 @T !R  R T:K0 -LM`@$KPpPP P P  0 pP0P $PP p00 K -0LM 0K00KK0K0K0K0K0K 0K K -LMP(@00"( 0 0p!`P$  p 0ܶX o $0K00 G$0S 1$ Kd8 -LMP(@00"( 0 0pw`P$  `p 0ᡶWX 4 $0K00 $0S $ K`8 -@0L<00 @|P ᛫hԨA`1AX6A p-LM PK@`{P 0Sv 0VKp -LM`SP@$pK`$` e 0S St 0T XPK p-`QL@P TV 00`F 0 `F0@SVʀpppQ 0Q0  Q   0///\ !L /S/S ! !1/ 0-8P@L x0 S( (0, 0@,00hMx@ c -PPU@@Lp` P1  a0 pq0 $0 `0P P ~P zw0 U 06> cxc - L!@P  !oWpx -P@ML tw80 @000     1K@ c{6A 0-@LP ^x PQ*' $$0@s  0hb c - HP0D@`0c #6pSL@#a1 : 00S P @`T:0D 1S # 3S #R 1P @0T: -0L@ hww)w(0`S, Pp, ,0( iw0! 01  BR PP\1 040 2`0V:00hu@ cA -L MHPvH0 0 a0S@ p2S<"  "  @P 0 0 0<TY wT 0000C0lB  >0T0C0 0 Av =4v2A020X:(Kov6A6Ac 0-@ LPEP$0$00 0q0$ 0e0hj -@LP`"vv$0S0000pphvG- RpP@Pp@/U `!R % X # 3X #R`L` @!@AJ T   A@@D@@@D@T@@ @ T: -LMp`<0 $P@,K00K 000S pd, 0000f, 00p 00p@TT040 8@ : 4 K80K400K 000S `d, 0000h, 00` , <08 0T, 40R000 00,0S 0 0Z00@,KT(K -L M`0$0 $0@PSpX0R 000$00Cs X$0K00  0j$ K -L MHP U`@ h0"&RP#x\Px%XWX W* o(U :0U 0U*  '  %Pq 0Dc PHdf0S` "v N`P\ Ku0S0 00000u00C0KD !! !R   1   0S :  g!T00CS00000,0 $00Cs,0K0D 00S u,Qu0D0H`00000(K -L0MH@H pDP  4 tH0*p 0< c( 0 080 0<<  8 0e h W, 08 S$00Cs1,0K0<  S < H0bD$00Cs!,0K00v 08 STW$ Aq Q,0K0 a0a8$ 0ao8  , 0As !S<0$ `c 0[$ <0V a q S Pe!)T R0 0 S< 0H  l0Dtt80S $0 D 0Cs4D4 a4@ ݼ4L ټL @04 SR PY μ@\ ȼL R ¼40S Ἴ tD0 W 0c hWT0 P 0  @P!T  @ e  0 Q@  0W @0  4!T4T0! @ 4 a!S4 S40W4 L   040  L!!SLY$`. W   !ST0!tS !SW$  Q>,0K0 a0m7D8   Pb0 x8  0hrV0$0W 8 <0HD  cDD0 P 0,AP%4"@0Fs (K8  0aB -ALhM`KXpKTs( @P( [,00@ ,0 ,0p(0,S`0 (0 , 0(`\0 sP Ps^D6s00S`@5 S@@12ws0S0 =   RZ00000 s    0R0PS0 Sls00`@S , , , 0`0S\ , \ 0T U 8s(KP2s@ c 0!&/ !!R p-PL`@!V 01P 0 # 0! 0Q000 0ap !& !@R !  B / -LM@p`Pr000000 0 -LM@p`Pr0S00hBS000 0p / -:ML040 00,0 00   K6A c)8 -L P00 c 3 c p-L@' 0S 2r 0S` r`P`trV 0le 0S3Dr380320C2\rPU 2Sp褠c6A p-0@L P P$ p$! PP `J0 02p02q3S8L,r2 02S#rV rppp褠c -@ LP J0 0 p-@LPT& 2S x@P `V q20C200q 02 02trpTq9D 0S4q00(X  BX q@p褠c\c`c p-LM@KP$P0@0`Vq@``"@ 0Sp p-LP`L@Wq8qq)r00phꤠc -0L@s >q0s00hq M-L0M000`qS@,g@Qe@0,0B"40 &2>, G"H` Dp 0 ` pO<0@ QH0L P@ 0<0 @ 0, Q8  8Y50S2R/ R,S@@ @R0 S<0 0  P T I00   B T@ T0 S0S   8PULP@4Z"WPVP `  0 8 PT X0 }IX0T `pZUX ,p(0 X hX(Kop(Kc\c`c -@`0#60)1D0 00M0@K@ < HL j0 001  D I 0    @ K0i000$0S( ( $ (0 40S8 8 804 D 00 <00,Q< <  000d0< @<000X0000,040<  0 <  @<0,@@ 0i(KXc| bcG?Xc -L MP`<0  <8 p4 @@0 '< 8  ,0K ,` PT, c@P 40S \\ , FHT,0 @ R`cV(K'8A? -LM`p@,KP 0 4 ,@ P, H,04`p@cT(K -(0L@S# 0Ah* R:4 R8848 $ R((( $   (0S  0hlhXcXc -L(MDP@L P , ,pK84`8 ,0SL0 8 P,00,0 ,0SR  84D P1 @ 4 < 8 $ 0 RH\< 3 HP R  P@0<0 %@< ! P0 RH0g@,D aP80<  R 8 R< 80Y:,0H0hLD KP03/P(K? R0-L@P gU gT 0h0 -LMp@0`<0 `$PH 08 4 =P0H `O0( 0c0 ,  6 0V0Y0S%1s" 00K 8K:p' 0 40  &}P 0`M0 Hp2 00K  00 ,0 `z<V``020 H(K58A -@Lg000hag 0-PLM@ g0S0C00hQgg,0 0,0Hgl 0P80S< < <08 ,0 c$3g1g'@0h鋯c?8A  fc -LMP@剛PPw 0SPs "So "Sl ( 000 00S U ` 0匞pX *0@PHXfP00S40S 8PUE,0 0,0@!0古0,0 ff000fzf,0 ,00,00Q4Q 80SfR'@ R,0800`4p8 <00@<0fP@f@ 0,@P'@f 0**cJ8A?X X0>0>00<0   @ (0Q S/ bAcĠc -< LM0$ $0 0KP Kc 0c -LPp`@}* 0@ZT:0hG? -L0hG? 0-PPL L@000   0R 000000`cP/Q   R0-L@P eU e0h -0L@ 00P`0 0(U f  xpP0  bR 50  U$p   p 000 -LM00 0pQ`, HPrPP U @T00@P 0U0330 0*P(T@,K=- 2Px0     ` 0 |, 0Dc0W0H00@(KU`cU8A -LM0PHp0@0`,0 ) Q,0   0)P  52P  |G0`ldV ,202+<&eV 0 (K`8Ac -LM@0PH0`pC)2 00Q  P d+d2 2C02 42P. /d`V +c`2`02+ldV $0(#62 2C020s 餠cl8A -X3LM` Dp 0P0 S(3\1\10"4"  0"4"@T, 2S @P% 2  02000 Y 0 s 00"00.06  e00\" 0!, *U30  0 0O)@P 0 I0001Pq Y/, 0 ;x0 0x0 <0p,0  P,0SZ c,0S6 2 VW P<0 0异 0c9+ dY  d62  Y  VWp(c*c2C02Y,0S cU 0DcV 0 000Fp pp(K`cAx8A8A8Ac -LAMP `@lKp7C=\pK[pKZpKp lP PX-0A H=0S X0 ,iNlK@:H@  L` D0 L !LpKP !80R84l 0S LKp 80@4\[K[[X \ l   Y K P K0 + Y [R$ RX  X "LbP 800 H0@  i8000 6 T.0000H$ZXPPLK"\ [RH \ L P!Pe%VUP! `h b"& BR  d  `P \ Kh  d `P 0h X`0c0  b8`KD d080L 0U0R0S X 0` a `P0S  Y 2< b3S ) bPUPaZ 80( 0  ! ~bF/K6/0 0F/K p0+K Kx&*n'!9-"40 K`c9AcXc -LM`8 VPW p0F0P#R*wPOs(aFN`c@@N~@pTH#P<,0K0008 0PP U00 T0S, @0N@T P",0hS0! 40 ьP,00 00K0P  U40p`c PJV(K b -@0L0S 00PF P  P 0 bhc -L8MP`22B1 01U00 0 !0@`K !0` P 00 P |"<08  l1 `1P 0 D!4ADQ(a0@pK0 p P 0P1 P [p@T0000 : *@00S*`@0 x0h0 p 00 0T: D0$K bPcccG?'9ALcR9A}9ATcH3(3T)AHc -LӥhT -LM ^PR'(^,' P0  `p @0 P 0PPT㥥@PT  0)00 0{P Թ(K9A(?9A9A -\1L M`P1p0PT@jj\(1 p-* 000 ,0  #P 2 020 00㸚\$MPp$(Y |\ $l\0PK0XZ\W <\800X pgXp(Ko\(K蜠c bG?:Ac\c`c -L@Mp`ᄀhK!P@ZU#3TYAl`K #Y`VP1@3:(KG? p-n`nLP@` e   4ph -L(M@T0^P,0 0t1^0 N&,' P ,K PH,pE14P `0T5A 80 00<0 0i@0 )0  ``C!0P80S@0S )P, 0pH' " "n @0< 40z:C40 40S$0,(K蜠c b:AG? -N@NLM@,0KpP4,`p P(ZA3300 PP 0PZ '0,  #l0, D"zG "  @01jW$0,00(K:A bHcG? p-N@0@N@ L`P0{ ph bG? 0-D@LP cP_ @CT#30 b M0-L0 0@ P<J[0S `"r"[[K0褠c -`LP3[2@p[P  0k 0SppW" 0 B(S"("0S 3 B0"32S 0S0Sq"W L[PEUhF[ꤠc6A 0-PPL L@000   0R 000000`cP/  R0-L@P [U [0h/ -LpP`@Z3S [@2S 2`02!TZV@"T 0 0PZ Z褠c -LlMl LK` d0 p| l` D L H @ 4 @ 0%@H| XPLK8`H4  00jS40 500 $@@@@ @0$PD@0p@ hP <0 40\0 H0SnNZT X PST 80p a]@PM ` P 3 Q3S80LKH$ +000@'80LK HP xT0I #X-(%( / t@Z3S WZ80LK H2S^202!EZ@ 0S ?Zh 80R $@HY0\ 80(`` a `0K,0 0 0@000  ,0K0 0P 0$00(00@P ,0 0 @P 崡K05:A8 b -L|MpK@`P` G7,0K\0 0,0 0 0 0py300 00PY, R 0S 0  0/P, 0 R  (K b -04LS@P $ Rppp0S $ R```$20S    b VWW 0$ R000W HQ CVV 0$ R000V i4 㣮c0T 6 0 H bD"& 0-0@P 0L0c0 004 $S   b 10S0h -L`@P 0Q" 0#6Q R0a V0`V00060V 0F R`f@>0P*  R: S3#`c -L P0T0c - 0L@ i(Vp`Pp0S \!S Vi0S ;[V000踩A p- `L@` VPpPP 0S Dp000p 0 2V6 0-P@LU000h"V~#0\10/ḩA - 0L CVPP U꘠c 0-x0xPM@L0 0X@@ @@@@G<0 0 0@@ @@@@:K0F:AcN:A -L8M`P&40L0 00#2P0 50 <0 &60H T0 0D @@0 0 8 40 D00S0,0  0,0 0,0  0@SN4 TK 0 ,RGT D$pD W@4 HR<8 LR8< PR4L TR2@ R/W a(0  80R$4S!H0S 0S<0  9PW 00S 3/ 0 0 0 0p0j 0 pp@ 0Q40PX0 00, ST0$0D 00 S40H S80L S|<0P SxL0T St@0Sq00S 80K 0` \0 (0Se,0\ SaH0S  R[W H RW H`V 0a<0 PS 0< aP < P:0Q 00S 3/W` 0 000C00  0  H0SD0 D H00H0Z0X 0jT0 00j 000S0`J 08 K(, XWVU.PPA @ Yp0 0D0 8 K$0T0(, 0T0H0, L40T00 P L088< @p % `PDpH`D0H0000@00P0P0S 0RP%P`0@ ` @;U qV m(K`@-04 S0@Q: S @T0@T$0 @Q@5 01: Q :@0S @T Q:0000 S0000 -LM80 T04 QP p*40 4P Qh@pQ0W,0 2 ,, K@P VW,00,0  $V,0 04 0PS:U04K 0p#p P W,04 0S,0 ,0000e,0 0(K 0 ,0 0 0pp P $@T 0S40%`# 7*  R*V  Q R 5 : R:V R * R* R  R`!`  Q : R R *W  R P:@W R*S*W eS4  S4 54K 0p@po P? 0S>*Vk W0 04K0 0e40 0p`pY P,` N 0S'*W@@W00S  R@!* 0S*W@@ W0 04K0 0e40 0p@ip/ P,@ #4`K4@W,0000e,0 040 ,00 0pPp P W,0 S 0,0 0S,0  ,`408 `0```(K -L$M`p0&$R@, P h%00 4 80 P0Q 0W _ 0, 0 ,0K`P 0< 0堐|R 4QR 808 v 0  0 S R00T@,0S*Z @tq `0, 0T00c  0 ,0` 0@#(KԨA bTc -L4Mp@` 0S 0 0R 00S (00TPPP 00T 0w p0 @pK 0pQP l<00U E $KG? btc p-L@PHP 0 D c"&0U0S00 $00S 3/` @Tp -LM00A: 0. 0 0p3 K -L M@`PT0$ KV`1P0UP!U`1P"00H $R00S P V(! !*0f 0npS*0cpW0$$00$0 $^:z K -LMp@:WLP4` @0S @p _PU 00 0l 00 0pv LP 4`0 4Q @Q a 0S1D0"QX$ 0H4&RE pV40S @0S00 80$0S 00 0@00@0PU0\10 LP @0S0 80PpPPU$40S@00C@0PULP` 40S @00CS@0 @` PUp`cA -L`hD`Iphэ 0-P@LM0000hM p-` H0L@SP`f  DD 00 $ph (0  0( ,0$0S 0S 3/p -`LPp>@ 000P00@0@h -LMP( K@`pDPT ( 0U*0U (ZE 0SB$P?H0S=W 0pR0 ` 0>(000p00C00p`WV0S000S0000C00  0  0( 0 PeP 0P $K -`LPp@M G00000   @0@hH -L MP@`TpP0Tp!V`!Vp1, KPZ,@4 0W 0W* @0Sn 0S* Rh  Re@4pT 0S:,@V 0V* @0S @ @T 0S:p@0S00  80$0S 0`0W 0W* c0V 0V* @00@040S 0S* R  R@00C@0@ T 0SNWK@ T 0S:,1\10K,@ @0S0 80|pP@ T5 Q:1:@00C@0@ T 0S:,@ @00CS@0 @ T  ppp(Kp긩A -LM@P`TpP0Up!V`!Vp1$ K$PPP 0W 0W* V 0V* 9X LP4pU 0S: K -SLM@P`0nTpP0Up!V`!Vp1$ Kz$PPP 0W 0W* V 0V* <P4pU 0S: K -LM@`Pp3T0 KV`1P0UP!U`1?P  0V 0V* F 0U 0U* 0S  R R$ RH R 0 P  0  $p(, lP8K 0  T0P  c""00R#3// -H0L@S K00 $0hK -00L@ $0BKH0S h0000 00 0p0 00(00 @@ @$P,`\(Kos8Au:A8}:AXc:AX8`c:A88:A b:A:A b -LM/K`P$K(Kp@/&4/ " / " / " / " / " $/ " (/ " / " / " $/ " (/ " ,/ " </ " @/ " D/x t" H/p l" L/h d" T/` \" X/X T" \/P L" #0 , ( $         " xK/ ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / |! /x t! /p l! /h d! /` \! /X T! /P L! /H D! /@ 0ML00P0$00 (00@P,00 @P K08 P3/1QR/PRT//N/N/ -L$M @4 8 D (>0>0Y#6<0  0`P | , K4Pn b R*DQf QcY 1@ 0  $  R 0JP@ T:?H`$pV 'DW( #D%V ,Da5P Q0q03W0S ,0(0 a  PJPH L @ T:WHL =DV 9D,00,0 4D ,0DS  R: `` 8 40D< `(K? -LM@ q`0 1/ 0S, S:^#:PP^`cP @(PUDp$ KP$0` PPfX 0 00  K -L MH Qzn'z``n`V@ pg @PDPA 0K@ P wK -LMP@ q:N#:@@NPc@` PD 0X -P@L:N#:@@NPc@ q` PD 0h~ -P@L:N#:@@NPc@ ap P WX8X8X8p8888D 0hD hID 0D 0h% p-LMP@ a:N#:@@NPc@ YPl0 D0$&RD0H$@0&dQ`0S#3 :0 0P p#pp`c p-LMP@ a:N#:@@NPc@ &PD 0P p !Q 0@0D` #/ - 1LD  -RL,MD `00 @DP h  00 S P,P :#:Dp , L Y0 Y:P0Y*U 0I3 0R 3D\1 1D @0 p@p < pR:0S:  P, 0, p 0k,0P8,0 pa0 d040 P0S 20\1!xPP,^XpP b PD p `V0 PE0p03U0SP `D Ppz H 0,nj,  0S 00L 0 S 80 =cL  L 80S AH0;H0 Bx@,000$V00 0 D 0pPP W: 003/50\2   0, `0D D0!&R R 0H46SD0 0D@00 0PP 0  PP(KG?A`c -LM P PP 0 0 0S, `@0 :#:0  c*,   0P P  D 1L0 3/,0S D @P, %,0 5P, ,0 ` ` yP 0 (0S`0pSpSS S C0 KP   6W  K  PP&T0w! \ Q  `Zp F RSPPSPP 0pp"$  0%b0K!v00 w0S50P 0S  0-  0&pt! 0 0 `pK p`@0 ,K`00D00P,  Z 0 00(K萙=&0/ A -L,M@4  ppP`0:  0:0S80 0SDL T0D T:4 P0T*W  @D0 W@ P@*40UT 0D X *8 0f8 (0K #0 80i0:P,W WD 1 L0 3/@(K*x 0p P 0 X 1 !040,p@P u Xvp  0 KP@X 00 RQ i RL$ RIH RF4 RC@40T? 0 S<$Y! (0  @ <0 0Q <0R-@0Q* 0H L D0 ?D0?00$HL (, 000000 000T00T040408080<0<0L0@@@L0 @@T 4 WU00  040SV 8 0p @p@ @(K p-LM0P@P TP  0P >.D0 >0.0`K 0` PPPKp p-L@P`  ?(0 0P (00`phꀺ? 0-PL@U 0h?0 0-@LPP ?U?PP0 M-L@P0p>X `>  P `WX?(Ko?ꤠc M-LtM | 0@ K R0"V pZCf> Kx t lKn0V U , @ g0,K   x K0pK02S kP >< >2S0# "  ",0Zh> 00 W0   0     , Yt>,IxK,0PUo6x t >tx0 KC (K:Ac$$0(( R  SQ/\///$0( R  SQ/\///,0  S/! 0`cG-$@xt @aQqP $0 ApP $0 AP $ 0A0  P $ 0A0  p@@ T 0S   0 0S  0 H0  B " $  B$ $0 T$      @`cc 0- 0L@SP0SY x0RIPd`\ ST%00C0 0R0 00 2020 00(?cc?c 0-@LP80h 0-@LP0 S0SnY p0RP\XT SL00 00 0P0 02020000(?cc?c -T0L R* < 0A00 $  Q00 `c:A -l2LP`2`VTr RP @R$ @R!*(2& " Qq!pWU pGPpR@`E @E\ P] @pT#R!*!@DF@2 A@ 2QID1pW- pGPpR@`E @E\ P5 0\0@( 0 R@"!*& 20Q0pWwpGPpR@`E E@T PT<0Q bc:Ahc;Ac -0QLM0`SA♲0>0>000>00000P0U N@N@0eS* p`0S*ၲP*p0 pK @@N@N@ PL   0㽭JT:(0 K b@c9;ATcb;A;AG? -LM40 `1p, 00 SH X<, W:($1P U1@A, 0  09(Ko5 0R@TP0 "W:PU0`Db@@ IY `FP00 @rR,0 040 0000@(K`c;A;A;A bhc0>0004>00@0 ,(0  (KLccAcc blc/=A`cLc@c - 0LS0S 7P p-0LM R  00R&(0T@TP0 &00 KB"fuQKpc`c b 0-0L@MK@!@@@l0 K0`0 T6P0@H 0@@@0P00S 3/TK0 b btcpclcc? -1L(M\A10PT@@-p1lq 0h 6&40 < 8 `HTD1 04  0 ,K8 0,` QP& T 60 R  0  @0 6@0406,0  i6 00 0gt,@< 0PEJU(00V,(K踩Ac`ctcpcDc[=Alcc=A -L Mfp0@:0 0&R*600tp6@PP 0KX6X0 R Pt4Z600 P KG?c`cpctclc0 0039c - LM@ 4 P0 ,0 R Q` ``` 0p@55Up@ P p@ ($0@#6ip4 < f< V08` < ,0  R0@@55,02 0080 U! @Q,0" "F U  ,202202 V ,0 P0  ($0#6E,2@ @02,>,0"  "! !" "V 0S8 R 5,0,K\55 Y0V4 Nt55hI5 UX0XX  X 5U U    0$! B$!(K褠c`c\c -$0LM KI KG? -pL@Gv `1 00M0 PP, Z, 0U 0 4oQ?5(K 0-3L@P P  0 0  $0( #6 0P  20200 0-PL Bt0 P@ @ TL0,0S@@0<@2PP,P0@@ &D0`c0+bxc 0-LMP|4x0\!t00R h00S\X0@A@H0H  r0 0(0r0頠cAc`cm=AԨAccpc -L0L  <R@0RPP hr`cc -L03/ 0-(@LPN40 PP0h4ꠠc`c p-`L@V (UQ e U 40 ! !  0 000p`c -@LL4H0 @d,0@R,rr0 hW4ꠠc`ccc p- `L@V0PP4PP V3"03 B"p -5LM\!5E 3  t*4 n `3\50S 0S ڌ0S 0540,%0q000 43 PQ4 0R 400 33P ,3@00 0  0S00S0 P `31`` 011|` p0 h 00| 0@ SW LP  vPP `V3 0qp3`2 3101Z1100113d3$  000 *`P`!4pgL''Q18 0 VQ 0 R `H8,`pX!V`1pgL'0  @\0 X >Y\0X `Lp 8 ba`` @T  P YY 0 dP0p p4.W Q ,D(K蠠c`chc bc=A -@LP$M8@ 4P @P`@P,Kp(d(, 2.0 p 0A?cE9 -@L`e 0p0c 0c0 00C 0 0S0/ |i~0S   R 0 0S0v (S~L00CL0i&cc 0 孖c -p1LMP\1威0@Q@ `P  0b PV ?6%:VZT  [ 4,0 !,0P !Z  !@ !p ,0406 00 0.+0T  T t+PPP 000\!00R00pp0FbUPO P Z 0+~G0M+ 鸩Ac3cA!Ce9 p-0L@P`0 V0 PUR  `S   R   p00S  0 X00Pss080 ` <  R0@8@0@H  H pc`c -P0LT000 SsP  0 @Rc p-,Q,1LM@H@BsS e*a1 ,PKP i _@Pa00!0@@@ @@4P 0`0 0@@ `7z\0 0 0@@ `-zKpc`c\c3c=+>AO>A?j>A>A>A>A>A -LM0P S@! ,P 9H00Z ` r t S RCX9HX!XPC H , r8)0$ `pH A~R p P"&$+ $ $ 1 8` 1 V ZP,  1  1P,rRP PP0 PP0 S(0@(nEP7`E-KP GP0S*',0KP" 0K#P0S0L'>", 0L0 T0H0 00p0 D pK"`P 0P0``00CS񟗣\N9LR9T9T9M9T9M90SP0 ^P6 _6  Ep r@h\),PP  ]8)Un jPq@q004`0pS 00 0   HVV1)P v)HVPqq 'dg),q,  0 P 454p0  W 0!A^PZ ZBK`p0K!_^P}d0А<0 @0S0D0 ?4န;)0SI 00Z` 1 RT0 1 T$ 1 W$ dL T$B‚ƒH Xţ0 TX h hD #00KKP0S p#0S    HH#0劓P<<00(0,}(00002L  L P PX0P T20W 0!]t_(/\(HUqPpPq,M(@P(Pf0(P_001pP  gP ((,zP (,ʴP $0RPP Pt(00081P pPpPb(7l1HX4=F140P 0!Q]'0L TpgLp$  bT 4Pۄ87(0(, 卐0SH~UPpP FP4)Q$p(K400S`ccc+b`cx3c#?A>A\c!@>Ac>A?A,?AL?A f?A0 bs?AD9{?A̺??AԺ? -H1LMH0pSI,'(P7`@10-  0 R'0FSp0" 8 <R<< 8R88` <  R @8@@   p TT`,0 '(,08@T PU0SY'`c\cc -P@PPLQ'Xd0c80 0PPUPP'\c`c0 b p-@PL@`5',$0X  fX $0`$`phu'\c`c pp-L`P L'(@ 0aR 0 0e 00T PeTPphX'p\c`c00  0-d@LM\0q 0\0P @0K6 PP$&X00CX03'0`c\c -LM q@`DP&@ N@N@T  @0bp$P 0S:pTppW  ' p*0. &. T 0 00 K bpppP & 0@c0$F d1 0@d0$FC@&pK@-D 0S061cQ*@0X`p0@0^a@?Q#Ơ$Q%Vʌ UP/R/>0 . 0 M-LM 0] K -LM,0 0@S@ P @ 0 IJ060 0B0,0  @ Pp(Ko]YDGB -LM0 , 0@`SNpP0 K0PU>00 KPPH0P1W4J&XZ/" W+ "0 00c%  40 塙P40"" " " "0 (K?A?A -LMP4 80 @p 0`P4J@0 , q` 40 K0P|P@X" 0K00 , `pG 0fS4 0< bP<@U `p V8`(K -` LMp 00@Ppb%D0S @0S 000 0\Q%@PD`8P<` Ki% p-@LP`?%@PD`ph%H0 /H0 /H    P//^."D1"."t/"0"0"($0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩AP/0S0d0/ 0P-L P  P @-LPQj?A -@L0 0 hAwc 0(0c0 0 0#c` -QLM 0 |  Dm Qe p ` R00hV 1h #  v 3XXY 0 (R l "$0 0@_Y  X 3R@R      $ / | /x t /p l , dp h 0 ` \ 8 X T  Lp P @ Dp p0P00 YP\!0R+ ` 0R B!x40S ,U 1 !,P J00P0,0,1,Pf P PU (40 ^Pܐ܀Pp0 R:0R0c @00\J a""R(#R !R0!SXPP 9  ,00蘥cc p-(@LP`Bph꘥c 0-@L5   {0,   :PU 00j5/00 b0hK0hY@A 0-L@P J0080P  @@ 0;V0h,0h긩Ac p-`QL@P 0U P`fV` 0S 00&phph p 0-L

0d04 00 0 00K @@ @$p(`(KxAA4%cAAd bAAAAAA p-@PL+ 0S` P %0S  0 h QPU`0PS  0 hQ0 0000 b p8&cd b p-PL@U L`  04R00 0 h00p4%c4'c<%c p-@LPT g @0 0 Sx` 0S 0R00 0 @08 000 R0@0 @p<%c4%c 0-$@PL00C00h4'c -LMp0@S0i `01 R R RX 0S0 S 0S 00S  0 'hQQ 0 R0 ,0 F,000 P 0 0R0,0 ,0 0 Rzt{f Pp0 000000<0   0!` R1  Qa`8&cd b4%c4'c -L@p``VdKf P` `p00S0  0P00000   8&cd b -L@ pP100`1 R R R R 0000C0,0  B  0h0Sqd bAA p-`0@LSP001 R R0p0S0p0S0S5:/P/ -LBM PQ 1@8 011 0,0 00 PU4P00t5X000 T0pW 0G00 /00G !  0 !IpP !  P d0`2V ^05pP  Pf2L``,K0 K0@pP w  Pc2@,` ,P'KD5G20S 0X11 K wIpP  PE2<!p0 2`l h0 ,K0t Kd0 t` `` \` Hp12W  P,` l,0X1 j P@  U\ A $! \ 0! 1 @`<0KXKT ( X0 < >K 8P P L0 HP D` A!40KXK4` ``iJP0K TP! 1 ( 0@!  1 $ P)H0 0c R ^ A^$A^  0@p@bT"p 0@ 0bS@40S ppp *\W  P@!00S C0 /  C ,@0 B TR,0  pp @ Pp P@p Pp PY000,P 1T 1|1(Kc-@ -< ML000 00 00 00,00 @@ @$`(@0p[0 0 0@@ @@@`g\0P#D @W$KmM$@<'c@QBA:YBA bdBA c@?9%@ 0-$@PL#\00C\00hic 0-L@0PP `PUX003/D00S` `0d ,0@d00\0@@C0cp b -@L|\0Sp00 S ` Rddd `00803/X@`0S@@cp b -dL\0@40S \0<0\0403/$\00C\0`@Thcp b -Lt b p-L`@s PTV @0V000P6p0 Ch<@pt bD'c -LMP P`p@,@ 0 R @ T)R @ T" @t| X Z uv pWpW0@,@  \Z\V((PZ0 p SRT\F RS V9U7t|3 XW uv, t| \ %T " X!Wt| RS \Tt| 4l(KlBA p-L M$0@KP `K0$ 0S 0 R ( 0`?PKp -@0PSL 0S 0  0 0(@0\ 0\ 00 0(0(0`ppr@ Xi0  0 00,p000 R0 0(0(0(`(Pt b 0-L@P 4 80R8000804 (P,P0 -L@<q 0 hEgD'c -L M$0@pZU (PK0%,`KG,JZ I꼶9ض9<9\99,0( 00 ,=,0 R  0R@ 0@0@+ Z( ,0( $,0( 00 ,(,0   ( 0 ( @ 0@, 0@  0`oP(K -P7L4M0`@0 1p@SSS @ TS  R 0S S S L P P, LP 0,0 P P P 0 s00P0SL P L@P L P P L@Ty @L P }PLP U 0S`a\ $p0,(000 0 0S! Sz S PD0#P@D 0@A \0S CP 0 1`1`E 0P C0S C`,t ,@ 00 000S000@00t0< 00 0 00C0 0/S S0@  p lp ,d@Tplp(@@@l0`(K@P `!` 40  bR C0 b /R4 4 /Q l0c0 0c007l `070400S099l0S09900900S 0 .R0.S0: 0:0l,, K00Ka@P bplp,h(``0?@00-0 Rx  0SMl0 ;0Sb p0 0p0l 00 0c00S8l ,0| 0 ;\q 0 S /xd040 0 J?@P'L[ a< Kd@Kd ;\ X < `80 P T0 `` 80x @@P  plpaTx  plp@aQ:0S q p iap夠 /P`@0@@S0m0{S@}P /U 0S 0S*0S  FP )pWh @/U@ /U0S 0S*0S  *Pl9pWLh@/U@ ~`/Pp-/U0S 0S*0S  P  0S*/U@@]({/U 0S 0S*0S P h8p W  @/U@d/U0S 0S*0S4 P1 7p W@/U@/U 0S 0S*0S P qhp W @/U@p}/U 0S 0S*0S@ P,7 0S/U @ @&0`^/U0S 0S*0S lP 2l6p W@/U@>/U0S 0S *0SX NP&/U0S 0S *0S  :P1/U0S 0S*0S &P 0 %HKKd@p W@@/U0S 0S*0SL P0$%HK ,d4p W!@/U@HK@}U`{  `T:W㤠  CD4 ` 80S4  plp?@ `TR00ɗ(   "3  _0 x 0 ?00/S#|:& 0S|0 0 .R  .R0/S0 0| |$|(P) 0 000C0 0/Q | 0, &t000 00S @plp@plp>@plp,&0%000, plp0 t ,0 090-t0 ,x plpP%%0%0000@00t0 p ,0 0x0P%%00,0 000 plp00SU S,P P%%0,0 0%0 #0D(t0S ,P 0 dd Q %0%000 00000t 0S[ :S43d R 0CS,0S 0P }%j%0,0 0w%0000@00;t003>t 0*,P' 00P!M% cABA`c@ c bx@BAB@BA@ac`c@(@c @CAd@.@acac}@ @CA CACABa@CACA<%0,0 ,0@0000@ 0S 0 0000000i0 R 0(K 0SS0plp,%000000@ -LM$0 0 0$    0 0$K0m K -$0LM 0 00 0 0 0$ 00$K0Z K -L(M0@`P P?P\/PPPVp$0P0P<0 8P 4P @@ 0P 080 (0K P!<0PC@2HAZHA -LM0  K -LPMp`$KIP6T0<0 $0@ d0 +8 dK P $ (TP$ d@,- 0׼P 40 L0" g K -餠LM(`K@$P |~4P @040!@40@040 5(@ T $K cc -L -45L M`, KtpPB,0d0 S9:::`:::<:d:::@:::4:p@K, PpP, p@K P pP >p p@K$ P pP$ pp@K( PK` pP pP( @K PpPp`K( pP @K pPp@K@ P@K@ ͔pPP@K@ `pP }0@KT3 0T@ X3 0`\3 `c 嬔pPT@#T !nK Z5^K( T 8>`(3>PK0K  0pP00 XpP00( \pP  ` ㉕pP T@ フp!>KV >5>KUF (>APNK@ TpP80`K tpP1  _ PNK@ @pP$npP@  |` L@+*pP bp Mep,B(K`? c 0-LM,@KP PK0 -LM !pS@8`D !PX0SDT!XK D1 L? 0(K0(P  4 <00 0?4  X 0 L(, 5P`  cP 00/S Sl ` 0S @ +〻(0 L4080(K ccBA -`\0L MP@ KpP 00 0 d0sp K`? p-`PLH=@ 0`P r`<p -L M@ KP`pP  0 0 d 0\!0;pqK踩A p-`PLH<@ 0`P :`<p -L$M@ !8 P<0 @ <po4 1@`0,KD0 / P)4 UT *8 <0H HP  03/P 0 5 DPaP@ ,`0V Y@ 800S  d8 <0PU  03/P @4 UT 0  @ G<(Kc cBA -0  MLu Kt  -L M 1p0K 40 PPG00@0S`!(`P,K / PU( dP U,@嘠ZY*408P 20S   Pm`i@P o(K - `@LPpP QP PH5Ph` -LM0 aP00@ )P$KP$0hpf0S!M()X8  K p-LHM@ KPd`P T040 08` \0 10 \K`P L000S`!(`P )Kp -LM0 Q00@` ȸpP  K0pP8  fK p-LM0 A K`P 8@ Pl00Kp -p0LMP`P @P P (0p \0oP鸩A -L M0`P0@p KpP $0K0  Rp $00KN/ -LMP @`R@dp @ 0BT 0  0  KM 00S03PP3#0K -LMp(PK% d3P,@@T@3:`P  0   P` : (K 00-0LP@B0P 0(0S  0hF0-0 0 Q-Lp@`0!Qk:PP  ÐPZ3ZP TZW: @Q: _ p- XML  @0ặ`P: K`P5T0@0 0D` h0 < hK`P 'XP Ke`V(K v`P0K0 0S03 0 傑`P$ (0S`3:x`Kp -1LM\1A `0,  fpPa]  [0K4KtpPW 8 K0P\pPD8,KApP?,0S:  -pP6  ,'(pK,] 0 0 , &pP", E&pP ,0,0X  X C, 40pP,'4 0  r-p 4  ,P "8p(K踩A -LM0  0x -LMP  `@0pP KpP $K p oW$p$K 0-LM@PK 0P| 㳐K0 -LMP  @`p0᪶P$ KP(K$$5X 00(0 d0p( K p-LM@`P9 0P0 0`P m`8pN/ M-LM@ a  0P0\P( KP(PP(t 0@0 (0D h0 傴< hKaPyXpW0 0K[8010:#:J T0 0   T00    T  T '0  T00  000  0 0@0 @  00 r3SR r r&Q& S 'S S/D@KT G'P T&Th KT$ 0K$PX h KT$ 0K$TDK|&TP W  (Q($K -L M0   D K -LM q`$K@P70@0 0<0 $0dKd0 ٳ8 @P(T0$PS P;&PT0P T $@@K00 80 P1*0":0  0y$@PT $ KN/  0dr dr +N/ -1LM\1p a1P FX@ +07pPM$KpP GtP$ p? 1 0S '0@0 0<0 $0dKd0 Z8 9pP&T0$pS P%PT0P & T pPK%00 80 P1@0;;0 0h%pPT $0 F K踩A c`cHA N/ p-LHMK*PP20`8` 40 0\@K\0 0 PP#L0S40H8Kj%HL0P LP P $@H &PP HQ%H KpN/ p-LHM KPP0 @P P(080 040 0\`K\0 0 PPLP$ L0 H"%HP}  PH$PKp -LM܁` ᏿@P 09 (0PS.0S+ 0S S S %p K ~#00 %0Sp0K `pp0'$0P00 0 .0(K -LM`PpE@P% 0(0S0S  0$ (0 #P (0K0 p]e  K -LM 0K#e K -LM`Pp@P% 0վ(0S0S  0$ (0 #P (0K0 pfᵾ  K -LM 0K#nf K -LHM0`@ p: KpP5T080 0PP0080 040 0\`K\0 0 PP!L@0SPHP L0 0S$ .PPPH8KnHPKp -LMpP K`'@P  0 @ $0K 0 @ @p @@ $0Q @E $00夸K`c - 1L@8Pp `C100:1 p-LMP`lK @LTዪ0P  HP@#Kp 0-D0LM@ K?PPPJK0`? -0LP 2p 0S 0S 0WSpP`W <@ >p` `22Pt'c 0-L @P >Q0t'c -\@MLT1 <00 0 <Kt'cW:HA p-L@_/PP `` `80P080p p -@LPT  p0 09/`Vr//80`080 -`PL@p' 800& _0PS  TRP pQC00TTW EP 00@HA -@PL 80 X0Q1 0S00CS0 P 0Rhzt'c -@PL 8 T0010S P@T Pt'c p-QL`P@ :Q yP0S q000S600CS00 BpHAD?0/ Q-L@ PWP <8@P #@|'c@c -L h@c|'c -80L@p ` E.PP @ @p00P -80L@% ` ph0P R R PU S000 R   .U -0LP .0S+ R0d@0@T# 80 , p`0Q 0 $@0 3/P@T 00CS 0 tZ0;0 --LM A 0-PL@@T  DTP00 -0M@L0 0@@ @@@;P0 0@@D00@0唀0@`0   ᵭ Ჭ`0p 0@H0p] (0p KHA@DbDbHAHA#?p:l: 0-t0LP j<@ jH 0y,8倭U 009dPH0x 0Db(?jCA 0-H0L@  LPs 20C2m,]0 0hj<@DbDb -pQL@` P<Pb0  Z 90000@0@0XPh`@0D@80<@ 9H07H0)W 80 L0 0L00P@DbA -@L8l p0(Rt p00p0l 0t0h]@Db 0-H0L P@ @T  SP0000 0-H@L @R4&,,2S @2U 0h+@DbEb@Eb) -\0L@ S\ 0S\l p0LRt p00p0l 0t00l00p0@t0l@@h@Db -\0L@Sʌ 0\00CS\00Sdl p0TRt p00p0l @0t00l0D0p0@t0l@@hHAX?@Db -@LT T00CST0$$ 0ZT0S,h説IAd? p-L@`,P匬H0p -P2LM\QH0@p  : H0 a(%H0`03 0(2,005(0H C> 0S)˭P 1 01 00 \#p#1`0$0D`@0 0L`H00(00,0@UD! L0S ( @0 P 10 `L0V<0 8 <00 400|tpP <800 pP<0@ @0D@p(K[LAc(cdLA(caLBAW -Hp@LP 0 a0S 0S `V00C00S   <i%i5(c 0-@,LP P,PP04 0h0 -@PLP LwThs -LPMpd @`TP W:{{40K0 ,0Kp `PQPEp 4K˙4$; , `Pt5Q .O`lU 0 TRP1,0,p@040K  0(00,00@0  0H0 $0 0(080H 0 0BW0᪰,0 0RPS4000048P3h l \0 ` `f;  P8P3gP  0 0 00q404 `@0@0$0 $ (0 0?0 0 0?00,0,000 0 4080 8 <000000HP0 100P08p圀 f,0T00 06S 0Ӽ(8  T0(媫 0Q6R808@80808 08 403/P P P$0$ `0iU!:ԨAX:JPA p-LPdo@ephY -HP@L$ !::#!@ 0`, S, R   "R 000000 0S 0, 00 00 4080 08 <02P( 000(pᲥ᭤404hPA 0-L@PP 0\ P 4V0C44S0 -$@L!::#!40PT`S (pPP06 P0 0; 0S8 $00Sm> 6   P%(  R:$00Ġ 0 㼪04 1#$Q b 08 <0`\i 00i$PA -e/P@L<(00 `0`p,p@0 0 m?V48`l`ហP000 ] ]&6R0<0( >4<040X000$08(0 00sPA"@WEV p-LMTP@ -X嗡0 040S 14 `hX0&jj0 0P! 40S 4 `hX0&jj0h 0 P Lph40S 4 X0 php:f@ p-@Ln4Ph `d0V\``UHD@U4 4!,@T ph ??yPAPA &@@@ZYA=@ -p2LM R :p:@#v'@P~ TP(`ᓩ0Py $᝟Qsᔩ/0 , 0 p 0S`cR`r01pW  4t03/4p046 㘐圠 ( 0 KZ&Y( (@808(00`0403/P P PQ:x:d:l:\:xEhd(K0 D bPAPAPAPAPAQAQA)QA2QA@ -LMT@Uz 000SNL:t::\:h:t::`q `q 0S 0 `qq`403/lq`0`0T0 006S<8V 6S061!`0Kh8@6Sx0 0 0S 0S 000  c&2 70 n p0R40404KhiKQA]QAPQA#QAlQAo@E@@ԨAX:zQA: -4L@0P3/P` P_ P Z( 6l[@00;000000e664  N$Q` vP !  Am> PpT,~ u~ q~6@ 0 m? 090 \~| ᵋ` `P <sPAx@D@b#@s#@4@4@4@A#@QA -p :P:L#Vt%@PV PQ @`zD0PUSUD0S403/P<0S6 , 0-6 IxX T0(U 2S  W  W 0 UP0 UP 000儿 0S403/w PA -LM`PB@`PE \;0|#|404 0`4 4$ L P0\0K Q Q P (R \pK  gb$K _P `QV000S /`K `p"@d H*5TS0Ӑ0 Z@20 6<6,20 6@066  V2Ÿ 8Lp1 ` 0C0 8@ 91 0C08 11!0 ! /&66Ɣ 4;0K!6@410 ,1 !m0 ?᪜0 `  , m.  0 KM dT00C 0P| x0)Plj K:@QA@,?QAQARAx.)RAF00 0KRASA -@ :`: #&L$M4 B"< 8 46Pn   0@ 'p@b5VM 5V |5V- t5V< l5VN`5V 0CVF{D5V 0V?m,5V 0CV3*5V 5V25V 4V*4Vx 4V#" X,@⮛T0X  X Te/㣛T04 00T 2000 @pu6T06 X0P40S 4 3V8 2#0 6 X#::#T0606哻6Y00  6Y0 0660w0 WP`0SE B  S *0S   n<P02 0P000 1D0000000 H00 00 06000602000<0j0p03U0Sp  ZpR 0040(0 0, 00 1H0:p C@ <Ⴛ 6 2  M)`\> Ⴡ$ 0S0,K P\@`,%,0\0 (KPAhdrdA}d(@edAtd@udvdgd~d({dЀ|dndQyd:At;`:$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A 0- @LP1 01H1  0S $3/0h,H -RL 0 R!+!+!h OKTAvTA -LM( \` @4 ,0 !`P4 ,!4 p! !5  !  P  ,$0 3/  $0 3/  $0 3/ $0 3/ 0 ,  $0 3/4 8 <0 <K00K  0 , $0  3/(00K 0  $$0 3/!  P !40 TT 8080 $0R S( (  ( $ $( P$PP PU1 `V P $> K1 P$040 3/ $P(0U(00 $ (0 $040 3/QKpԨACUA -,0( \``pL@P @D(0 3/TT  $0 3/0S 0SS0Ө0///0S Rʬ  R 0%!/!// -LMP,0`( `0\p7' U@1K#X  @0$LD@0 HD 002 mꕰ@4;5;'@JUAeUAH5;5;yUAL?L7;ԨAUA7;>~@$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A 0R0/ RD-+D-/0 0RD-+“D-//Q9 )R4)=09/ -04ML0,pK0$0 lP@0`P  (@ Pd0  0X0  00$0 0`P(@ P  (K?@m2@SVA`@? -L@`Pp4-8R(00 ` <3/$=S+pW4-8R(0  <3/x0Wh 0y <4-8=<RX4 h 00 30 yWAWA?$-R/- B-- BR-.#+#/ -=L@SP` spPU$=Sp 0刃 x=pS蠆 -@LP =pS= 4 3/=S$mV4-8=<RX2 d 0 =00:-P0`n`0Cn`3Wb=3 =3/ mi -`0?L0 M02KP $0Kp@KPP  0`P  p K! -L 0KM c 0 0-LM(=PS00CS@t 0Aӑ0CS\ @0DӑP0 R 3 440 0( @0h0?\ WA,? p-=L@S 3/`$]U&Ƃ !PP `VxV4-8=<R2 d X0 (=S {Sy*9  UpPp2 NpPi\PK@ らn `@ 2 pωW @0pN) S0-l1R` $X1T =(=  S9S    pP'P pP 0 S # Q 3kV` ` `P#.? $ 0pPPUp3@ > GWD=;D=K !^ *(#,=00D- /d'/ -R/$-R/E - SL(MP@`7DpK"  ⴄK6 "0x K -L`MⴣP  @K` 㴣ƈ `0 8B儀KpT`` pWP V@`p@T0㴣 K@$K -ML MCK@`$GpP*4$(KP$0A0UR $ BU!  U  Up$U]  U B$T$Up   BU N0$UK  U  BU,An` 㰈 0 V 0#(K S R -R B.K BP3(KBK  A d-⊈H3UD=H3UD=  43UD= 3UD=  =S B.K B0P2(K"0S( # BS'  S  BS"S  S V BS `"t2T"l2(K <"X2(K (">"<2"42",21( KQ0 C. 0Q: =Sd 0Sp^1:S0;ӥP =SP 9SM (=S S Sh!92KKL, K0@0( K0b04P,0>* =S2p& 9S#p"  0pxP p p9S9  09 -R B.K B pP  `pp(K%F-*V X b Z ^ T \  -L MP! @`o P)p$0Kp P!"[R-  2[S  h  B \  < 0   0  KWAWA -LM@0K@#P0SK p-LMP@ =S  09 00009SD=00 K0P (=[S Q Q  Q `e8``9SW;W;W;W;W;W;W;W;W;dllk`KpD -L8M0@pdXQ񟗌X;DX;DX;DX;XX;p7S 4\7<\7D=0D={t~D=㠅0`K0D=  8K0 u ׆ ӆ* K0h2[!6 Q""[l010,1p7S( ⴆ,7qF 㪆 10?0?\70?\ K"05\0[ZK S0 00Ņ 咆,7qF ㈆p7S 0 ]p 0p7SdY  .l= 3/(KBXAAԨAD; -LAM`BKP@A#AEP3K00C0S 0  S; 0 `3 KT3Q: '0CQ>  Q  QnG$3Q 0Qg 3Q >0CQ <0Q\.?;A0CSWBK@T  0SST0z =S D=I"l =S D= At"^ =S D= 9.\ =S D=18"N =SH D= E (9Sc >S$u1 0P$0 nL 0P*@+$ $0L`B~KpG0$K  0 ΅ > =S B.K B 0KPL9X1Q #0CQ 0Q+01Q 0Q$!!!1 K !0 K 0 0 d- 0Q!: 0 0?K00BK@≅ !] H0K /BK  (@"(   xEK- b R Z *T V X ^ -L M@P }W =3/`P0 = I(=pwp3S00S `P989D=0D=9S)\_;L_;_;_;_;_;_;_;_;? 6? 989? ? (=S? z< (-R9 ;S g5 l` `땯 ; 4("(R ;1An`0 ل0| 9  9`   5P5P 0D5@ +D=  ,5( #D= 5 D=  > D= 4 4  :S0;ӥ .d= D9S (=S44 p (=S `C:  0D 0 AQё `S  3 9S 3   9 : 3 A0======(=S  RK S\3\#6m`-=>040 初  P  8 `04-8R(00 ` <3/ |2X"<`4-8R(0" D <3/4-8=<R4 h X0>0:->0S> 3@0;3099SS S S r4-8=<RX2 d 0S 0CS>02 `l@0 @l0p@0h>S 0CS>(=S$ >S020h|208@ -LM@`PpP PP2U 0CU;*<2U] 42U^(2U* 2UV=2U" 0UO1 ԑP[# = SR 9S    +HSF B. 0 : m4P43@2 w. @) 1 \1 0hP  4P3@ (=S )=09 ]94P4= =S m(PR-00CS0 0,,kᒢ F$K2iii6i(9i5iA -LxM@p =/t S $=SDdPK< =dKp0 >00 a=(00 ;(0 0 =S >S3;3r9S YU 0S990090C9dK.0 c02K ` 0E9STPUQ 0S000dK0C0d0  0d h0 .0A(P 4003/t!n`P 2 0t Ⴡ t yPP ol0  0l p0 P <4003/9 %KS.05K0@ t 7P5[05K  l0  0l p0X2(}/9S0 D=00 0 l X 0F0 0 徇@9Sㅭ/X0S lU@ P 0!2 :",,!2 202 0P 0 f@XZ@x`|P@x`|Pl0 l0  0l p0:7@10=00  =0C== S-hp  > p 0>`V m(K,c124*̝XAh? -L0M]@ (`]|,`i4-8=<RX2 d 0C6&Q0[/c&P0[ g'N0[s'0}(=S% S% (=S ,]pdd`0 0]dpTdd`P0 Dm (5 )05+)05,@05Xr040430994 , K0 P :2K `0F,PK!0R3 >1 0:.00`VH\* K0P"[0RBQ10CB>A>A0BQ3.! *:S (=S3  D=  * K0P3"[ 3d D= D-(-R R9 RB D-0-Rb?D= lRژ0D=\3R98<ø9Ÿ9 <983(0-0?D=R;D=3R2R9;998<99 <92  < H00-D=2R9 <ø9Ő2 * K0iP2[S909 0HK00 \ 00K`P_00S\ڸT[CUP ~2 ,:T "0P  B0C 0P0P0P 땏,.4=4!=141:1:141<1<1<1<010X 5=0}/0ࢂPE%0=X(,%c0[= -0 `FV$=0=00`h0.0~pp-~3;3 4-8`R  (0<3/p 00K`2[t$Sn  SD\$Sg S00*0K 2[_0CS񟗹ꔆ;$;;Ԇ;Ȇ;$;D=0D=9S9S4D=0(=S >S#P 9SD=0D=9S4 3/갣[^JZ#*K 0 :2[ 02K0"[`00 X.>0.0x00|0` lKS[z(-R R R  l0K >`XDD2`PfE,2P1#> Kz K^ P>X1># & 0K 6[ 0z:[ ` 0*[ :[00c09[@0:[D07[H09[!S 0#0 zLP Z0>4-8>RX4 h 0< R701Su@T 0sk040000!00 0h20 40 R |Q XQ@ 0 0 <0 00 0A;;+r -L@0`L0!00QU p0W <0;00x`xې 0px0  _A -Lpp@ `P0S  PPUC]Z Q-L Q_A p-L`@@P 8|P gP@0TpA Q-L Q_A -LMd@ 0P`p0 0 00pY pW 0$ 0+ R U0(03/ 0S 0 K3/P 0(0PE 3/UK0 -Lp@Pw` WF01SD  l40S 0 W Swy0 s00pm4Q00 0000S  | R p  R  P 0 Q 0///)c Q-L@0 0Q 0Q <Q %QAQ BQ0 .0 0. 1/0 .00 .00 .0!//5Q0 .0!//0S 0S 0Ҡ0 /0Q:9Q;Q h0 S0! 0 Bh00h0 /h00 Sh0 0h0$Q  / /tQl0S0000 / -LM3A@Qo(;(;;(;H;;``d0SP`a` 0 0ASh0 S0! 0 Bh00h0h00 Sh0 0h0ŪXT 0bQ  R 5` R  R  d    BQ / d / -LM,0 <0@@` d0 3QhEQj HQl_Q ]Q*OQw 03v:PQ [QsoQi cQ nQk_}Q_ ~QX |Qd_PhPl( kPP0<0<<00000@00D00H00L00P0001010 1010001;< u 00000@00D00H00L00P01010 1010001<00<00<000\ 0 00 000000000T  bR` 0C0R 0S 0d00 00CR0"d0h( lk 00(A0,A00 000 Q-L@ :Qhh0<   @0 QO Q ASB SYBS5 SR9S8 @S< @S, SC0PS5 S<58S AS S1S S* 000/0 0 0000000/00 0000000//|?+-_A_A_A_A_A_A_A_A)c`A`A`A`A`A`A"`A'`A,`A1`A6`A:`A>`AB`AF`AJ`AN`AR`A 0-QL@<0Q?Q Q9Q Q *Q+ 1!R0 ,R0!R0 ,R0!!R 0 ,R 0 !R@P ,RP @PU 0@ 0b.>b.> d0D3  bQQ01D.>l0S8 l0S\ 0 S \eHPh @=0S3 S, S S1$SP- SP* S(%S SP#pC"!*SP S(0CS RP$p 40HPLp@0D0PP PPPPP R00 K 0`` 0J?u&l?p$?h?`AaA &@BAt@aA aAaAaA$aA-aA4aA;aA 0-PL@U' U  \d0 /Q :9Q00C0S\0PC0 RS\ 0  C000DaA p-t0`PL@ P @cP000 PU,PcP @Tpbb00 0 P  B /0S/b - @L<5|00,0@ 0S 0 0 0Ab\0 0 P  R  R   00/0S//b$0H 0!0  0 0/ḩAlcc+c -0L@ !@0 !! 0-D0LHAT ʀ0P !P0 !!0踩A 0-HPL@0S000 R  0h0@-H0 R @R%5" b$ ( @0(P$S00T% $( 00 S-L S0h iaA? 0-80LPS @,㖴0hd0.b 0-<0L@SP0@000 <i,P 00; -<0L@S Z<00<0h -LM@0@XppSP(3O:S `Y <#D4  ! 0, P, .70Z 0 S0%j2j "@ l <0Z ``p0 0 j000S0 P 0fW``V Z S` `< 0P` aA -LP@pAP` 0 RP p-`L@VP (0H@000Ppp? - @L40S 04080S 0h艻 -LM0p @PR 5 %<"0bS3:,`KQ < 0 0000RP: KP Q @0Q 00 @ ///$0H 0!0  0 0/ḩAlcc+c,00  R 0S/)c - P`LBzV0@P0&  (8z( b0` 0+z$ pb0$pA_X zP`9_ I0`000   @@A)c"/ 0-00LP@05/@T0)c0@-t P0 `0  @P @BP@@@@P@U00 @0)cb p-`PL@V S \R V T UQ `p3p ppp -l0LM`Pp @ 0P 00@T$K)c p-00L`P@ 6/@Tp)c p-0 MPL@0PP`P ,  0< 0 0"00Kp)c -LM@( MyPPh _^`x P0UP@@P:d0dtphjԨA p-L MP K "@hP`&P ,00 PR,P V4 , 40UV0,0 P8 KKpRW SW : :-,L#@=LP hx0A 0-P ::L,#@)LP  0hM00A -` ::L# P 0ph00A p-` ::L#\P0@S0L00 00CS0pp0A : :-8L#L@T  L T0A : :-L#Pʠ@Pp pWpPU T0S L`Vp0P NLP`)pP L`_0AR Q 0"/ Q000/ -LMQ@p` P 0q<0 0g U \  0  P  PP  Pa0E8S0E8S00U0S PEX%XP; S$< S!  S S!S  S1U;  00  R; 00Q UwF`V 0f`F0VP`<P ;hb; S% 00 @ E( U:R  P2UP 3 E(RPEX%X8UP /UP 001QPX%XQ$K1%#($'* -0LMP2 0S P, P@(pK,K40 CS4 ,0 0,0<@8oS: S >; S  00 3/(0` Q00, , ,4$K)c!b Q-L bA -H0D@L     $    00)c <|;; 0-@PLP PPP0)c -LM`Pp*0@S 00\ӟ0S& ` `P0P0S P`0P0PUP! P`P@:La0Ea%LP 0K 0P ,p P  KԨAbA 0-L@+ R/P/ #8S/? 0-L@Q)d  P = P Q Q Q0 PP@lDhoVJ T UQ8 ih#SP:0S bA p-0L`P@P S|n `h n0,     0QpA -L(M`T@K 0p W 0PU XUu0\PKpH03 @@ \@XoUZ U \TSN@8 PD   P = P Q Q Q0 L oY  \ PP:QP "f 00U:pGW(KbA cA $0H 0!0  0 0/ḩAlcc+c p-PL`Ld@003/X@Tp p-PLd@`003/L`X@Tp -@L@L -LMp勩Pd@` 0\  0a 0@7a 0@0a 0@)a|0x(0 t0( K 0 h0$@ 匕P H0<0VKcA@/0CS)<:0<:0  '.  ""'. Q 0' P`0PoQ`Ÿ`"0 XR!BP"P``0 0S0R("0B"0 , 0B00K )}<:0<:@Z䰡 S#`0 p `ZWPU R0<: 0<:R 0&" - 101 pW *0ZR0)n<: 0<:R `%"p - 1P01)-0 0 Sؼ S 0 00 K<:0<:`VPUp `D C< (K?SeA j2?f'CeAeA?eA@fA 0-@0L<@8PEL()L 0P 0P@0@)bAR0*\ c/@-Q*@@ l -0BL MR"S4 `0@P pE UW0pp-UPp +U@P v 3VV 0U0xSXSP`@ R 0U ``ɯ 0A 0 , 0AH D 8  00E PPAEP7aEP&WP`U",S0R0K"# 8 UQ DH , ? P 0 r04Z 4QD(KfA? 0-L@P00 00  b" 2 /UUUU33330 R 0R/Q1/Q!/Q1/Q!/Q/Q/Q/Q/ 0-L@\0 PLU@` RL?0R BP\a0 -pL@W `5?P@0S S _P@@-0P pP@` V\  @ @VQA-D3 B,, R @`3  `F, Ġ ̌ q Ƞ ̌ Q̌  ,,,,, q, Q  ,̠ (   Ġ ̌ q Ƞ ̌ Q̌  ,,,,, q, Q  ,̠ (   Ġ ̌ q Ƞ ̌ Q̌  , ,,,, q, Q  ,̠ (   Ġ ̌P q\ Ƞ Q ̌P% P%P% P%% q%̠  %TP\,,,V @k0  P@PE, Ƞ ̌ a | ̌q   ',,U   00@0R@,@A,$ ?0@-@0 PQ 8VP% %'Qp p CA@@$ $0 R9 (1!04& "000"90߰( 0!!1!0'Sel0A-P00@$O$4$0'S@'RP!'^30@㴀p`'''\p'paPE```@0`T@0U'.T@ "!!!l'\00 R10A+el feX]@- 0A$à !Ǡ !! !pRcc'Q'A"A  A@$ $V,n߰ 0-9L@ 009Y PepU0 "0  0 / 0- LPNI@ ;I0P0   0/*c p-L@`PPU:p p-PbLM PR 8`U0BFK㦆)1S 0Sp FK♆E`CʆE`fFK ㎆P_4Q`aU nN FK@N <@OlA1SO01Ep`X I['L1C_10 Q41zE`<0 K RF/K0 S 1PFK@00``  R10@@@c T0K 0@` x1|AL0  @00S 4u`,0 !00S KpD)bTc*cfAfAfAp<(P88 />(8 *>0(0(P  `}>%(pP(K 0 c(#("$c4" (0 k>P`U:h >$K -PRL@`S ? @p`U(: N> 0  0 $0Pg`1p(#p  0 0 $0@H@p?X@ #>  0  0 $0@H@p?X??PU ( Q > 0  0 $0 M -@PL , =@ (= 0 $0? 6 -@PL 4@ = P= 0H L0@ D0(? -LM@P0 ``8 40 (0 PP L` ``\ X 0@ <0 80 H D T 0 ,0 ǟ@ H@K@K00 ,@ H D P K@P <` \`K`\ X 80K P L0 8p 4 AK T@ 000K  00 ,0 0K 0&97`0 %97d0 &79x0 %79|0 0 , |@Kd K!;40 ;40  "@K! "0@K0@00 ,@ H K@@K00# @0K@$80K 0 , PK "0#  8@KP K @K! " ! ' ( ( ' 0K K !    @KK !A?K 0! 1 \K0@K0@\0 X@ A/K0@K Z ! Q@00p ,  d \K\P X` @ @PK0H@ DP \`K`\ X @P <` 8pKP` Lp 0K8p 4 0 ,0 |0K TP A@Q$dl` %dl` `o` `o` pK褠KS)*| x | PCPlp h@ A@Qan` an` if` if` pK贐K%S() 倐 }dTtp p$C`Lpp@ q0`d a蔀 吐 唀K p p 吀 |KlK)*K p p 吀 tK脠K)*K p p 吀 HK!ig` ig` !gi` gi@` pK PĠK)kd` kd` *ԀK)* @@KH D HpK P\K ) * @K P@P0pK8K`& p'H D 8pK0K` pHK `& p'|` xp o"a` o#a` #nb` "nb` KpK`& p'H` Dp HKlc` lc` pK)*|K p |p x PK|KpP\| x @` P ````8KP`P `0 0`K` 0 00 @`K` 0 0 0  0 $0(0 0( ,0\K00 00 4080  08 <0(Kh?? p-@@LDQ@DHPUHL  0P  pRPp b R P b:;PP~ 2;Pp -;0P0H@` ; |;PPph -LMPR@` @" p`UP0i: c;@0  0Z@ D0 QH0  0H L0Pg`rpP<ppe@+0Q@D  P H0HL倀HpX  ; E@0  0S@ D0  RH0  0H L0倀HpXPU P Q:@0  0Q@ D0 UH0  0H L0(K -pPLP !`@@[@T s: -@PL 4@ : Pe: 0H L0@ D0@= -pPLP `@@.0T F: -L|M@@ hK:h0 cc4800l0 l?P`! 捈deQ`̠`p`| % pfllldl`%``& \`}hff$(  (` *P `XP͌gqeeTXPP'pP P* PTmljjt P, jj]x faLp & pjj午 eQH % jj} hD`( `jj͌ gqP'  P@ml`` , <吠 ]hh fap & (p8唠 hh eQ %(4嘠 }hh `` (`0͌gqhhက P' (P,mlhhᄀ l,( !]fa ( (菠l |p & (p " eQ (} (菠|  %(p吠`( !t!` (` *l "͌ "gq/'0 (PpPxml 0(|]0# 0#?p0 p:,(tfa午  t p & xpeQ}   x  % h͌  p  `( `gqm*l*t*ꯠP' Pl |] ,x ,* fa午 ** *ꯠጠ p &*eQP P p)*P *ꯠᐠ P}%*P h͌*pP**Pꯠᔠ `(* `tPgq *)m )韠 夐 P' * Pll] *x * *ꯠဠ ,* |儠fa午 ) ) )韠ᄐ lp &* p !eQ} * *ꯠl | %* "*h *ꯠ| `(* `p匐͌* !gq !tP' * P )l "m "/l,* px]fa*坉*|*ꯠp &(p pt圀eQ} ( ((菠t  % (xi͌ ( ((菠ᜠx `)(` gqm (p (菠0P0圀 ' (P #l0tl(5 (菠ሀ  ᐠ]*|xfa( (菠ࠀ p p坉eQ'p**ꯠp p pp匠 (*i*ꯠ ` `吠 },p堀` **ꯠ P P唠 m,t匀gq **ꯠ  ᘠ l]fa )x吠͌ ( (菠က  |儠eQ )唠 ( (菠ᄀ  p pl刐l! *}*ꯠl   ` |`ࠀ ")` )韠 PPp匠m( !gq!|  tl * " "/]faxp͌*eQ ! ! p pt圀l} ( (| (菠p  ` `x`m***菠t  PPࠠ圀gq]***菠x  刀fa͌*l*p*ꯠ  ࠠ吀eQ (t ( (菠ሀ  p p唀l} (| (x (菠ጀ  ` `吀`m***ꯠ0 P00P0吠 gq#0*]*0ꯠᔠ  '(fa͌ (p ( (菠ᘀ &(leQ *t**ꯠyZnܼbʀ 儠p% (p )xl} ( " (菠ᄀ `,(l|``獈 `& `& `&o l` `*P PmP )gq)韠Pࠐ |P'P%P歌 !,h ,ϠPP(P%pPfa % lP))韠 p & "pt Pj" !}!P * "| Ppx`] ( " "/p  `  "`t gqm! ' "( (菠 t xeQ (| " "/x   % " fa "l p( (菠 &*p pa- p'ࠠ p't p'P!*p Pp唠`]* *xp ,Ϡ` * `b!m p' '*菠p唐"*  '|p刐eQ* p*%* fa *p * *σ&) l a- *t ,,σ!P* Px, )`0p) ],` `m`0b! 0PP0 (K000,00(00$0 0 00000/#EgܺvT2 -PLp1S005?02>0050?S`@@@` M5@@?0S:P di;5 0-LMP@0S   2 K0Slh 0~? SK U 0#  !1" 0SK0gA(@0@-@0@$00 00000 000#EgܺvT2 -L\M@@ hK4ah p%d0p'epz 0)`ˠl (`h P'0\P%p g{PXp (0X`,h lʂ%0T e[ 0,0#P plˠpg| 0 0#L ` 茅0'0#PPH0g{[0(0#D`hʀ0% 0#@e[ 0,0#< plˠpgy 0 0#8` 舅0'0#4 Pg{Pe]0(0#00h̀0%,  0#e[ 0,0#pLp?g|lˠ```X`l` P4Pe]g{ dl̀fk  @ e[p Ppzlˠ``k` P\P\g{ Ȁfk  h e[p Dpgzlˠ`T`h` P`P[g{ 0ʀfk  < e[p Hpylˠ0` 00`\=fj` PtP P@tP%g{PZ0 (ɀXfk(` Dp e[(p|`lˠ (`fiHP` (P[d g{(ɀ`fk(Lp e[(pgyh`lˠ (`flPP` (PY4 g{(l̀<fk( Tp e[(pgz`lˠ (`l0` dP;(P]g{ Dʀfk <` e[p@pgylˠ`  h`h` PHPeYg{ Ȁfk X e[p4pg|lˠ`  \`k` PLPeYg{ ̀fk 0` e[pTpg|lˠ`  P`fm` PP`]g{0 00XX9fklʀh,e[ Tp lˠpxD` '` `荅LP```(g{`Pj PPP&hPl̀`PPP,fkPe\@p%pl y0 'e[ lʆd`,g{`m\&lˠ` HP  fkPY<p%` pgy 'e[tP PtʆP` PPP,g{`Pfl0Plˠx` P& `$7 T|p pl P , 0Lp` ` Pp ` `khPPP&` PˉDp PPP,fkP隈Pp`pp)lˠ<Pp Y%pixX` 'e[`h4 &g{P͉, fk P lˠP\Hp %` pg| '` de[芌` @```(g{`lɀ\```,h`` P``` lˠ0P `eZPp`4`%pg}` ```<`ke[ \ɀg{ LfkPhP\lˠp  4pgz` `T`fle[ @ˀg{ 0 fkPP\lˠ p Hp|` ``fje[ X̀g{ D` fkPPdXlˠp  `pꩆ` 0` 02芌 `pe[``& pT{j` , `dlhP P\Xg{ Lʈfk * 0` e[pP (pg}D`lˠ (`fm<P` (PeYH g{(lʀfk( `p e[(p}@`lˠ (`fihP` (PYX g{(ɀfk(4 e[0 Hpd0(p}lˠ`P`h` PXyZnܼ拢P$M\>pmvmzNSP]g{ dl̀fk  \ e[p <pgylˠ``fi` PhPe]g{ Tlɀfk  ` e[p `p{lˠ`4`fj` PDP[g{ Llʀfk  @ e[p p0xlˠ0`00` 0c<`'`&Pg{Pe\#!@c;̀ % "X e[`  , "ppd lˠ{0  "T`` 0c: ' "HPg{P] # "Lc;lɀ% ! Pe[`  , "pp` lˠg|0  "4`` 09'!0Pg{Pe]#!hc;̀ %\ " e[D p,!lˠ`xp0  "` 0 g+ 儀|    :! <  pPPʌ4`Sp0P`x倠tp l`P`*Pae= 0(K -P@0 L? @``0Up 0`3:P`  C/MI`@G@XV*@ fm-/ 0-LM0 @#K#K0K#"<0K"80K K"4!? @ bR@ PK| B0KK U  0!!! 0S\ .K0,@0 @,Ġ@,Ƞ@0,̠@S:/G- LM@@  0 `phdp`pQl` pH @ @@(L 0 0(c:    ǃ$P h(Pa(` @P   DH,P@0@@@(8dJP0 000 ȟ7P  ,PlŃ0 P '4 P@   )KJb*O@DP0@@@8P7G<0 P000hǟc5P  @ H̃ P  a DP ' @   H@'  000ܦc5   $Ɵꭃ  8Ɵ   pƟb)  0 0 PƟc6  40Ɵꭃ   Ɵ   %lɁ 0   05b&0 00ἅ0=  嘅 ,xlɁ   @Xb&008=   ` 0p3: !,@<@p?0S:@ gi, 0-LM@PK  L!? 7R8 bx bK  X +K0l@0 @,Ġ@,Ƞ@0,̠@S:/G- DM@P 0 @ `phdp`pQl`  P  .P  @@ LP0P0:PPƠ `  `  @  @,`0@@ @J`0 00$`6 (Π   , @   0@*0@4@膠0080>  <̠   @   & 00 00t>  P͠ ,    ) 0 0܃>  (崃͠ 8匃    d) 0 0<>  ,͠ <삟    Ă) 0 0 圂>  0t͠ P    0), p!p'00r>p`"`& aˠ`P# P%QP@,@$  PA(@0 P!AP%0>@P"P% AP<ˠ@hAP# P%@ PLA`,`&@ (( P!0$AP%0>@P"P% APˠ8@P#@ P%@P,P%  @P(0@0 P!@P%0>@P"P% @ Pˠ@P#d@ P%P, 000@P%  (0 @  0 DЍG)yZn0000000000 0/#EgܺvT2 -P 1@ R05?@p`02050UL>` 0p3: *$ @p?0S:@ gi) 0-LM@PK  L!? 7R8 bx bK  X x)K0@a8!`( 8a#!(`00@-"D  -`x Px't0L`t'0`. 10E 1@EPP 10d 1P0d`VPDD't+cA-0Pp0 C Rr0S@ `0xSXS0@`@`  0C XV8@CT]2"0 BVP0C XACXaCX a0CSA0a00c"0@.SRU:* 0S P2 C S\1T. 0`PU U UR05,1:R*0<8R0<84 Q b8"8#4b$# "40"8",0  -LMK{P K/"#/Q:P:///cb PA//`aPA/ (0@-H!8 Ƞ$H RPl Pb0#3T@c @d0,2\#H8%Ƞ @dlT00A@ 0Ȅ \2"0Q -LpPppPS`@ r0`@(UT0@U0#03pg pe0V`d `f00#2SP`fP@0X 0s@R/R B 0b0//QP:///R/R0 B 0bQQ/// RC/A 0\R#R! B/00?@/0 /!!  0!!  0!!  0!!  0!  /`o `/` `! / // -pLM@P`0p 00 , , 00P PR 0!R0`0` VX:U00ZpS(Kyaratcid0S/0S/ 0-L@ PP 000@00 p-L` @P ,$PP -$PUP @000p  / 0-0L@0CS0 0SP$q 0h0 -HL}@P 00b -@PL 0S@  C 0QP/0S    00/P/0Q27#050205// -`PL@P PP  pP @T: 0-PLZ@PP P0 0-PLY@PP Ps0 0-@PL 0S@ 0Q0S@ -P@ 00X0 0-@PL 0S@ 0Q0S@ "P@ 00=0 0-L@NP0  0PPP  S: 0 -LM0@S(0((0$ $0 000Kn@ &@ gAgA p-LM0@S`0``0\ \0 PPEUP` P0U:tHph pWn@ &@ gAgA -LMpP4 `@N 8 K00KWPX 00SE ,0K4 KLP80840 0040XS SAX P4 < U0044 X P4 * U004b 4 tPX 4#4P@TV uW 40S04P  (K -LM@SP`p P 0 PP XOP 0mP - ML0 0-LM0K@0 K0KPP0 R0 R R     P K0 0-L@P0 0-@LPD 0h 0-P@L 0h 0-P@L 0h 0-P@L 0h 0-@LP  0h -0L M@0 K0KOP 0 R R   P K -LM@RP` P 0 )PP pWOP P' 0-@MLP0 @ P U 000 0-L@PPPO0 0-L M@ K0K@P 0PU U K0 p-LM` 0P@ P ePphpOp0N -LM@ p`0P P IP hO0loob0rbmn0rbmn0atad0gnts# p-@L`P:0 ph 0-@LP- 0h> 0-LM@,0 KkPPT ?K0loob loob p-LP@`0 phX 0-P@L 0h p-LMP@ K<08`P U )T Kpatad p-LMP@ K<0`P U T Kpatad :atad Mp-L0P@`+0 Kph 0-P@L 0h 0-LM@@0 KPP >POPT sK0atad rbmn p-@L`Pd 0 ph 0-@LPW  0h 0-LM@,0 KPPT  K0gnts 0-LM@,0 KPPT  K0gnts gnts Mp-L0P@`0 Kph 0-P@L 0h= 0-LM@@0 KjPP POP T K0atad rbmn -1L M\1 a@0P 0PV`4P3P@ `* D 1P ~pL0 3/ (K!  0 0 @ `  D `P, B`P,0P0:(K踩AyaratcidA -PL`p o:@P !  P l:0\0V T0VV,P l:UPXAyaratcid -LMDPD`@@p 0@ p @  0ᩒU:K$jADjAa yara tcidQ/yaraQ/tcidJI E/ ?/ -,@L 9P0000 @A:A/// / 0-0L@P` 0p W 0 0P S 0003/P00`0S 0-L@tPP  0PP000tcid 0-L@aP 0P00loob p-PL`@PP  tP&p 0-LP<@`0PcP Q P\P000rbmn p-L`@`0PAPPyQ <Ppppprbmn, p-`B PL@PP  P p p-PL`@PP  P p 0-LP@@`0PP =Q  P*P$000rbmn p-L`@`0PPP Q Ppppprbmn( p-`BPL@PP  P` p( p-PL`"~@PP  PK p 0-LPa@ `0PP Q p P000rbmn p-L`?@ `0PfPPQ a Ppppprbmn p-PL`@PP  AP p p-PL`@PP  -P p 0-LP@f X0PP cQ@PL000rbmn p-L`@F `0PPP4Q @P;pppprbmn p-@LP`P@  @ p p-@LP`P@  @u p 0-L@P $0PP00gnts p-PL`@PP  PO p 0-L@eP $0PwP00gnts p-PL`@PP  wP) p 0-@RLP kP 0 0-L@YP 0P00loob p-PL`@PP  WP p 0-LP4@ `0P5P |Q P.Pc000rbmn p-L`@] `0PPPKQ PRpppprbmn, p-`B PL @PP  P p p-PL` @PP  P p 0-PA L @PP Px 0 0-PL @PP Pf 0 0-LP@ `0P P  Q  P* P 000rbmn p-L`@ `0P PP Q | P pppprbmn( p-`BPL/ @PP  lP p( p-PL`"+ @PP  WP p 0-PAL @PP qP 0 0-PL! @PP ^P 0 0-LP@Y `0P P V Q p P= 000rbmn p-L`@7 `0P PP% Q  P, pppprbmn p-PL` @PP  Pz p p-PL` @PP  Pf p 0-PLu @PP PT 0 0-PLc @PP PB 0 0-LP~@ X0P P  Qz @P 000rbmn p-L`^@ `0P_ PP Q Z @P pppprbmn p-@LP `P@  K@ p p-@LP `P@  7@ p 0-@L PP@ R@ 0 0-@L PP@ @@ 0 0-L@P; $0PP00gnts p-PL` @PP  P p 0-L@P $0PP00gnts p-PL`@PP  Ph p 0-@QLP P\ 0P0/@ &@@-@\T\Z \ \O0\)Nt\\ \t@TT@ T@@ \: \ \8 @\4: T0:  ( 0 \% @0\!S TQ@0\S TQ x x0R  M-L8MPp 0@8p `V8 008  S S S< %,< <<0 0YPE< 堘P\0E" @0@ 0V0ppWS T P  B< `,0 4 D0 @0 L  < 0@ ` ,p  4 @ A8  @q P S3"Q0 ! R``c`@,pV>3`4V * 0 f< \ F\0`V< 3@ 4W P:0@,`<YQ8 V, 04)0 R 4S:W ``c`@,pV>3`4V *  0f0< 0\ \W`@00`V4p \ p, Q@ < 0p@ 8 8QoN8 0H0 FP :P =P HbQ fQ \ \8 0 0SZ030"S& Y D@ ``j @0 , `V>03`04V *0f< \ 壗\ `V<03 @04,Q:4D 8<Q00S@0` 0VD @0 4(Z! L S:Y D@ @``c0 `V> 3` 4V*000f< gY`@00`Vp4 0 0pW0 , ,p 4 0p0  \ X0 X0p s0 T P0 0\SZ030"S) Y D@ ``j @0 , `V>03`04V *0f< \ \ `V<03 @04,4 Q, 4 4D 8<Q00S@0` 0VD @0 4,, 4 H0FSQ ,P 0 ( JZ! LS:Y D  @``c@000 `V>3`4V* 0 f< ɖY`@00`Vp40pW0  X0 < p 4 L Z%:Y D0 @@``j0 p`V>3`4V * 0 f< \ 吖\W ` @`V=0304`V=0304`V@0 ZX LZ':Y D @0 @``j00 , `V>3`4V * 0 f< \ V\,0 ` @S`V#0204,`V#0304TSvH=Qy R/ L0Z,:Y D@ ``j @0 , `V>03`04V *0f< \ \, ` @QE`V=0304, 0 p0K`V:*=00 , p 00 P$ LS!:R D@ `@`c`V>3`4V* 0 f< ߕZ`@7`V04 Z`V04U<0 40  0, p0 00, pX0 ,  R00 < , 4 0< ,0 4 <, 0 4 08 8  RH \>030400 Y0 (KP T0 f< \ ~P\gA@A M-LM0 K/ p-L@`P kPp -L`p@P ]P p-LP`@ OPp 0-LP@ DCP0 -L`p@P 5P p-LP`@ 'Pp -L`p@P P p-LP`@ PpR0@-0  R0@ PPU@ 0  RR  P00㜁꜁ --(0LM0S ] K(cR/R0 B 0b11/R/R B 0b0/ -0L@P 00 00lch@ P-L 0R 00PQ9p3 &@ 0- 0L@SP<0h"0fP P 0h>0gA -@L0P /HP)blc -L`@P <P /pPe@p PP)b 0-LP@P P0 000 p-PPL@ |0R@o@P 00  00</`P.@0Q`ph@P)b &@ p-PPL@ d0R@D@P H n/`P @0Q`ph@P)b &@P/ 0R /h@P/ 0R0//h@ 0-@PLP @0RP  0 6/PP 0QT0h@A &@P/ 0R0P//h@ &@ -@PLp% 0 S%Q! R    ` 0`/PP  l0R S 0X库 `PP 4/h@P)b &@@@ -@PLp 0RPP ` t`.PP  \0\R 0ᅓ `PP ,.h@P)b &@@@ P/ , R/Q/0S,/h@ P-L ,0R0Pp3h@ &@ -L M$0pPS K/`V- 0K`P%  l.@P 00 $0KP $0 S `H &P #P 0@ 0j.KP)bgA0 -R  -R >R00/ R/0 // 0-P0L@Q 8 0G.P 0<00 P000A 0-LP@P Q0 0-L@P<Q >Q &Q `P0LP 08P0P Q0gAgAgA p-L@`P P P 0U:<P P /P >P  php 0-LP<@yP /tP P >jP  0hd0 p-L@`P YP P 0U:<PP gP >phEp -8L@ZP  P  h3@gA -$L@P h$hA 0-LX J-@P  @ D-PP Z-@0, 00AO-A -QL@Pp Ep` 0 S S S S S <S 0S !S0-S0-SU P/SPEU0S0(0}UUPPz(P 0P0 P PP n P P Ph /P >P0aX`0 W[ PV0/S0$0(PN0$0P0>SJ0 >R    9P=  0 R R R R R 0  P PP P P P =P0c00"QP  0"Pa  0>S00p@-@PPX <PL &P@B`aV `mV`pV`;V@4lVtP=;P:@)gVtP2;P/@pP)oP&sP#;P @'qVuPoPtP;P@"Q U *PSP\ @ppp Q-L p3 -LGM@ Kb,K0`K8K 0P Rp]K,p 0  3/P P 408SS @X P@@.P @@ +PAhAhA$hA+A9 -LFMM_K< OK@<00S 3/`0p>P W7 7/50 03/W 7/X* X X$<1,0 ,p00S 3/0`P0,K03/PV 6/V 6/ 0 03/  0@P(K p-LPO@PP(  P $0SPP t 0P  PP PP 0 `PxPPnphA@P0/ -LJMD  K@H (T00,pK0KD1H!P,P 0P  Q?mKQKRK04 K 8 K DH 0 ? P7 `pGWW, P*PK+PK,PK ,0K PU,[`+p[(1 *[P '2 P Up*q` ={P =vP (Ko(Kh3AH@ -@L0P "}0*bpc -LMp@P` p Qx Q Q0 Q Q <QWd =Qn , ' P,g WG=G= H=XH=T VY*jT 0SP* j " `pT 0SB* j ! `pT V5*0j`pW!@I=@I=H=I=0P& P P P P<P=P P P P P P<P C Y`\ Ph@ -LPpPU@ 8 !`P~@ ` P0*b 0-L@PP0@ P000 p-PPL@ |0R@@P 00  00 0S 4!`PG@ X `pH@0*bP/ 0R /H@ 0-@PLP @0RP  PP $ !PP  3 0H@AP/ 0R/H@ P/ , R/Q/0S/H@ P-L @4 T \ep3H@ -LM$P`@ULQ 0 !%PB 0S?  (K 0 0( R4 0K P,  !PP% 00 $0KP 0$ Rh P @P@! $pWP !p 0 0@K =@0*bh3A/P/08 S/Q/ RP//@0 Q)hA.hA 0-0@0PL0 00+c@ -@8L0S (t$0$ T@@H*bM=+c+c -@PL 0R@7@P/ 0R/@ P/ , R/Q/0S /@ -0L@S $0S  0 Z)hA00C0/0 P/ R   / -LM`pP@ P \ 0.P (P @4 0@P00H@,Z= -L@ Rh R P-`LP@`* pWP*Q  QQ0 S`W 000 0`!0 0!0 `QQ 0-P@LPfQ0  0 00hQ 0-@L@PUQhPQ0 0-@PL h0R\ PP L00D00P0@00 00000@AQ=Q= -`pL@Q0S~QhPP/  YPP* PP 00 0 "0 03/pPP pP 00C 0 7PP p 0W:PPPCQH@ p-LM@P Q R ldP`zpAPa`p 0 P00C0`p*bXc - @LPpT `P T  !T `p .*b 0-0L@P0QP 0 Q0000000 -@PL` x `P hxPP XppPP0 `@000V P*bXc@ -@PL` t0R`P6P`Pp 0C 0p0W:000P@ -LP000 0-@PL ,0R@PP@hP0@ 0-@PL ,0R@PO@TP0@ p-@PL` H0R@ PO0V@&@8Pp@ 0-@LPOxP(P0 0-P@LO0000hP 0-@LPO0PP P0 p-@PL` <0R@ PO0V 05@#A7Op@ -PPL@`" 0RPpzO0P0TP 0 0a000|PO@ p-@PL` 80R@ PNO@Op@ -L`P@Vp PNK hRD00 -@PL`# 0RPO0 1q htO    `0V:0 B0 0dOh@ P/ , R/Q/0S/@ 0-LP @PP P 0 03/P P$gPP0A p-0L@S`P sP $0S php!H@ p-L`@P ᬕPp 0-LP@ ⟕P0 p-L`@PD ᒕPp@-@1 !@@1ARA@@  @, @,@00,00001S  Q    1   0    p-0L@`N P& R   R       R6 @``@*0 P   R    R  00000p1S 01   phv!R   p000 0/ -`Lp@ P  Pe7/P ATP -`L@p Pe  :/P pATPPe -`L@p Pe  :/P pATPPe -Pp L@ `  `f9/PS  qW 0PR0 0 R1Q 1+ ``pPpp'!R  0000S  0 0!S0   `@-Q0Q  0c@" 1S0  TlS0!Rl - LP`0@  \R  R 0  1000aV\ 0P00xR"|3 1`  !1V,  1    Q10000  p  `V"1 1S  pVpp ppRpppppppV 1 1 1  1 1 00,0 0#00 000000\0W00 i0 Q`/0 R 0/ -0BL MR"S4 `0I@P pE UW0pp-UPp +U@P v 3VV 0U0xSXSP`@ R 0U ``ɯ 0u 0 , 0cH D 8  00E PPAEP7aEP&WP`U",S0R0K"# 8 UQ DH , ? P 0 r04Z 4QD(KfA@ -0BLMR"S4 8 `40xx@P E UX0-UP +U@P v 3VV 0U0xSXSP`@ R 0U ``X0 , 00K 00K p  X W 0pfpg 0<` 0E Y PAEY7aEY?WPi<`U:X Q/P,"# U \",0` ,  Y?SR"# U \,0` , ?P 1 18Z \@D4@ 48(KfA@0B R"S-0LP`@LLp H XZ0-X +Xp t 3TT 0X0xSXS@p R 0X @@n \ 00H QAHQ7aHQWaX S X  S R㔃#  0 0cV RPGPfA@ 0R R0/ -L MK K -LM -QL MpP ` 0@pw@\ u0(KT (@K0s@(0 $@ ($ K -QLMpP ` 0@pw@\ u0@$T 0 r0 0RR! B/P/0@ 0A0S|*Q:/@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/ R.0 \ B BѴ Bôr- B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@@t@P B@@P B@@P R@/ R/ R Ѥ ä/-\{F ,DP`pL%T\&dl't |@P`p B RR,DP`pL%T\&dl't |@P`p R/ RAn,D R L@Af,HP`pH%XX&hh'x x@P`p B RR,HP`pH%XX&hh'x x@P`p R/ RA:,H R H@A2,LP`pD%\T&ld'| t@P`p B RR,LP`pD%\T&ld'| t@P`p R/ RA,L R D@A /R Ѥ ä// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/ -1L@S`PpT P `P p10"0 pP1A 0-QL@U' P QRS t T00tQERPRS"  T Œ 00000Ap@-0Pb@`0B6E@S0" p -LTMP`@ X4$TP` SRTP`0@&%Kh#X8x&h%X#8"'xQ㲣KcKᾒKRKK3KẃKsK.S/X0  T h   h XT  T0(P@KP>KPZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B/0QA 0 / pAAAДAAA0APApAAAЕAAA0APApAAAЖAAA0APApAAAЗAAA0APApAAAИAAA0APApAAAЙAAA0APApAAAКAAA0APApAAAЛAAA0APApAAAМAAA0APApAA @`=o(@h= @p= @x= @= @= @= @= @= @=$ @=, @=2 @=8 @ȟ=> @П= @؟=D @=K @=R @=X @=^ @=d @=k @=r @=m2@ =G@(=X @0=x @<=@D=@L=@T=k @\=t @d=@l=@t=| @|=v@=@=o@=! @= @= @= @= @= @Ġ= @̠= @Ԡ= @ܠ= @= @=A@= @= @= @ = @= @= @$= @,= @4=R @<= @D= @L= @X=@`= @h= @p= @x= @= @= @= @=y@= @=%=С=== = =4=H====Ȣ=ܢ==4=T=h=|====ģ=أ==<=== = ==С=С=С=С= @ @! @! @ @R @R @ @ @i3Ax @ @ @ @ @ @ @ @ @t @t @E@ @@@| @| @ @@ @ @ @ @ @ @ @ @ @ @ @ @ @k @ @ @ @ @ @ @ @ @ȱAAA @U0@ @@U0@D @*A @K @U0@V @U0@ @ @ @ @@U0@G @*A @R @@U0@ @ @@U0@] @U0@@U0@k @U0@r @U0@@U0@ @@U0@] @U0@@U0@k @U0@r @U0@@U0@ @z @U0@E@ @U0@! @ @! @- @M @P  +X7j @ x + @@@  ** *d *P 3 7 **0 *%4*^)= h";42;|*;( = = . N K 4@ B4@>4@F4@>4@ K4@>4@eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0daiadbibedeafdfasdeppmz!!d3dkdump!h!!!\!!!h!P!!!*%4*^)""@ ""@zerofill8copyiscsi-crc32cxor2xor3xor4xor5xor6xor7xor8vG7@vt7@n`G7@"" +NetBSDPaX,G#1"L8@,G#0A"Z8@lL"d74L"M"&;@DO"7;@M"I;@DO"\;@O"n;@;@O";@;@O";@;@O"<@'<@O"8<@X<@O"m<@<@data_abort_handlerbadaddr_readffs_vallocffs_blkallocffs_blkfreeffs_blkfree_snapffs_snapremove?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@====\G# 6x#6L","D""" "* ffs_syncffs_unmountffs_mountP==X=,G# "B@ffs_readffs_writeffs_spec_fsyncffs_reclaimffs_full_fsyncffs_fsync? 9?@6?6?_6?68?XP6T?P6p?P6?Q6? T6ľ?-#?2#?#?X#4?0#P?P#l?#?#?C#?<#ܿ?\6?]6?pa60?xo6L?lt6h?P6?v6?Lz6?P#?)6?@#?#,?8#H?%6d?z6?|6?`#?6?P6Ƚ?\9 ?@}#(?4#?-#D?-#`?-#?-#|?-#?-# 1c=? 9?J2?l#?l#8?lU2T?L~6p?P6?Q6? T6ľ?}6?}6?O2?X#4?LO2P?O2l?#?N2??#?#ܿ?l#?l#?l#0?l#L?l#h?l#?l#?l#?l#?)6?@#?#,?8#H?J2d? N2?|6?`#?J2?XK2Ƚ?\9 ?@}#(?4#?-#D?-#`?-#?-#|?-#?-#1cX=? 9?0:?0:?0:8?0:T?@6p?P6?Q6? T6ľ?~6?~6?0:?X#4?0:P?0:l?0:?0:?C#?0:ܿ?0:?0:?0:0?0:L?0:h?0:?0:?0:?0:?)6?@#?#,?8#H?0:d?0:?|6?`#?0:?0:Ƚ?\9(?0:?-#D?-#`?-#?-#|?-#?-#1c=wapbl_allocate_log_filewapbl_find_log_startffs_wapbl_replay_finishffs_wapbl_stopffs_wapbl_startH_#^#T^#]#? 9?x[#?l#?l#8?c#T?a#p?#?#?#ľ?,a#?`#?`#4?_#P?\#l?#?l#?#?l#ܿ?l#?l#?l#0?l#L?l#h?l#?l#?l#?l#?\#?#?#,?8#H?[#d?l#?<\#?`#?[#?#Ƚ?#(?#1c=ر#(#ر##{ G@{ G@Ի## +}G@G@G@\####L#**#*%4*^),G#T# @M@M@N@=N@$,$l)$+$ieee80211_setmode@P ,    $ 0H`l     $ 0H`lieee80211_media_status , $0H`lieee80211_media_change $0H`l    $0H`l_ieee80211_crypto_delkeyieee80211_crypto_registerieee80211_crypto_unregisterieee80211_crypto_newkeyJS@SS@]S@jS@tS@ieee80211_crypto_setkeyieee80211_crypto_encapieee80211_crypto_decapBT@V$|V$U$Q$V$N$N$ieee80211_hdrsizeccmp_setkeyT@p[$t[$x[$\$[$[$[$Ƅ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,^U@8g$(g$8d$g$d$jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_setkeytkip_decapieee80211_hdrsizetkip_encapU@w$w$o$v$r$o$o$0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsizeieee80211_hdrsize ieee80211_sysctl_treetopsysctl_ieee80211ieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_locked_ieee80211_find_nodeieee80211_setup_nodeieee80211_reset_scanieee80211_node_table_cleanupieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_ibss_mergeieee80211_create_ibssieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_node_leave_11gieee80211_node_join_11gieee80211_timeout_stationsieee80211_node_table_resetieee80211_node_lateattachieee80211_node_table_initPPPPPPPPPieee80211_encapieee80211_mbuf_adjust  ieee80211_compute_durationieee80211_send_probereqieee80211_send_mgmtPieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_updateVr@Vr@Vr@Vr@dr@Vr@dr@ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamssysctl_ieee80211_rssadapts@if_attachifaddrpref_ioctlarp_rtrequest#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^d/////////////////////#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T5C =D$E =F$cde@B`Sا@BO[@T6nQ%l7J a~@@V.@HTh~@t~@z}~@~@z~@~@ ~@~@ a~@~@~@~@~@~@~@~@@~@~@@ @@ @@@VA/@4@lO@@a@Hu@@V.@~@@a~@@@@IeII@@I0I0E~@@@@@&II  I@@~@@@"I0@@&@-/@@@!@@4@@H@@\@@q@@@@@@@@ˀ@@@@")@ @uE o@o @o @a~@%@.@1@2AA@@V.@@& 3BI@E@N@ @(#0F hF  P@9WPurl_int_miibus_writeregurl_int_miibus_readreg@@@'@4@8@P@W@VVh@s@@@@@@@@Ȃ@т@'@ڂ@@P8soo P q q sMklt@'@tt3@@ hC!@4@ h&FILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!Z^A)'u# t#Du#AH6O'O'O'5A,4O'O'O'Ax0\0O'O'O'A:C$\0O'O'O'#A<!A++1A,i#ACx(\0O'O'O'x(A)Cx(\0O'O'O'x(AgCB(\0O'O'@*(ACx0\0O'O'T0AP(( ((P(A 6$}' }'}'6Ay4}'}'}'44 544A00 }'}'}'ACl(0 }'}'}'(ACȀ(0 }'}'}'x(A)CȀ(0 }'}'}'x(AC&0 }'}'}'&(&@&AC00 }'}'}'0@]@i@Uď@U@U2@U3@U1=@'' +@U5@8'' +(@AAA==(A*}E#(D(@AAA==A*deadcv,G#) @****#)*%4*^)&)*****%4*^)@L)K)**TY)J)X)W)[)xK)I)J)J)o V)V)J)U)K)R)T)S)J)exec_init@2@N@@@@assert_sleepablemutex_vector_enterselfx!?!?!?!?"? "?systemdrvctl!?!?x!?.b.b@@ @@ rw_vector_enterAD 0  pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) *L**\؞+,+X+h++d+؞+,+T+ +h+*%4*^)A+ܬ+ x@{ @+d7++++@0A @0H@P`@p @p@ @ @ @ @ !ܱ@ @ $@ )@$++\+4+X+8+p+*+4+X++T+p+*%4*^)(?,G#D+@B@? 9?l#?l#?l#8?+T?+p?l#?l#?l#ľ?l#?l#?#4?l#l?#?l#?N2?l#ܿ?l#?l#?l#0?l#L?l#h?l#?l#?l#?l#?+?T+?#,?#H?+d?d+?+?#?l#?l#Ƚ?\9(?#fcd'?     !A  !@@@@** , , ,*%4< ,^)???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ4,,#<,x#P,U\.?,G#X,:@. .. ? 9?`C,?,?#8?#T?,p?,?h,?,ľ?Ѕ,?\,?X#?#4?0#P?P#l?#?#?,?<#ܿ?Hz,?#?z,0?,L?4y,h?#? p,?#?P#?+,?,),?#,?8#H?m,d?n,?//8!/$-/$/A/6/T/"/(//!/`(///XG/D/A/P>/T/!/     xM/d8//'/&/&/p/5:?:?5?X??/@4@d@?@?A@@V.@A?@B?PLC?C?g@@D?(E?4F?F?c0' c'g0 'w'/ # ! !!@!  @8%  @````` ```bX9@// +===pxa2x0_i2c_intr_sub!H30d303030303040040@l0i0|l0????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @0@$0@H0A0@h0@P0 @6cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IXq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث XXXXEEEE,,,,????kkkk::::AAAAOOOOggggꗗ𴴴sssstttt""""筭55557777uuuunnnnGGGGqqqq))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<@@*@@ @q  1D1411T111D1|1411*%4*^) &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@1 1L1 d' #(-27<FPSpectecSDIO WLAN CardSDW-820 #(-27<FPd'`0a`0P``,`P,G#*2VAeA,G#.2wA,G#`>2A,G#E2Adevopndeviodevwaitdevindevoutdeviocdevcls? 9?J2?l#?l#8?lU2T?K2p?#?#?#ľ??@ABCDEOMPJQNRK Ԃ7\7?}7|7|}7L?p?O|??4?p?O? $?Z8?p?F?x?J?P? ? ? ? ,? N8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm 9axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8zaAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ 2"#6&$7'%8(&9)'0--=.^~/@`0[{2]}3;+4:*5\_\|mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ .'`|0^~2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|-+?\02'*345d<>| .'`|0^~.\02,*345|d<>.\`0^~1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ -'?.^`~0!]/[34{bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* `7d7 +/A/A/A@/A/A/A/A،7h7777H774787ġ77<7D7H7uisdata_bio1W 1 Q  Щ7 p7  % L D7Lm L    o4! o! o ! qj! A! A A A @ 3t Q % Q B Q $ Q , 0 De 3 f N K 5AN5AW5A`5Ah5Aw5A5A5A5Ap@l.8@83898uao_putB8ubc_uiomoveX8W84W8DU8uvm_km_suballoc088,8uvm_unmap_removevmmapbsy88??(?ȹ?swstrategysw_reg_strategyuvm_swap_initswap_onswap_off** A9****$@9?9**%4*^)Z9Z9LZ9Z9X=(=Ж??L'cP'cT'cX'cROOTSYSTEMISTTYMAPPEDMPSAFELOCKSWORK TEXT EXECMAP WRMAP WRMAPDIRTY XLOCKONWORKLSTMARKERLAYERCLEANINACTPENDINACTREDOINACTNOWDIROPF@FAFAFAFAFAGA GAGAGA%GA-GA7GAAGAHGAQGAZGAdGAnGAvGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAHAHA HAHA@HAHA!HA'HA-HA @` B@HA@:@$@HAHAHA fstrans_setstateholdrelelvwakeupvcleanvrelelH}: |:0z:r:r:y::s:I)wapbl_flush,G#:IA&MA?1MA? ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!V`A\`Ab`Ah`An`At`Az`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`Awsevent_copyout_events;;@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?b&xb&b& ? ? ?2?)D?ap????oL??                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~p<<<*D<*<*<ABCDEFGHIJKLMNOPQRSTUVWXYZd"<$<<*0"<*<*@<<d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !     ["$&'X4gklr:;<=>?@ABCDEFGHIJKLM?t? 1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY]  m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT] C(.}(bzssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846   } j Zgg%#(K(sFstrtoumax0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGYgAN@`gAcgAfgAkgApgAB@:@gAsgAygA$@{@~gAgAgAgAgAgAu@gA9C@gAgAgAgAgAy@gA &@gntsx===lcgA H@(\=)hA8O=.hA8O=h3AL=1@C=4hAT/=gA =rbmn+=+=)=)=*='=p(=dc AhA<3=03= tcid<7=0=5=0B=3=2=2=yekd|2=1=40=hc ZhA`cchAXc<lhA\c,thAatadF=D=D=ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/pchAloobtM=M=|M=yaraS=O=R=P=P=Xc hAstrtoullstrtollstrtoulNetBSD6.0.3@(#)NetBSD 6.0.3 (INSTALL) NetBSD 6.0.3 (INSTALL) INSTALLCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. cryptofssppsptmatabusdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmbioaltmemtwacpuctlpadzfstprofisvvideohdaudiouhsorumpblknpfdtvfilemoniscsitpmswapcttyphysconptcqmsofconswdfdccdcgdbpftunfiledescvidcconsoleopmsiplofromscrrndfcomjoymidisequencervcodawsdisplaywskbdwsmouseuhidulptscsibusraidugenwsmuxucomuriouscanneropenfirmbiconsdevisdnisdnctlisdnrchanisdntrcisdntelsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomsysmondmoverioapmdevsscomksymsisdnbchanepcomtslcdtwensmbacphyamhphybmtphybrgphytlphynsphynsphyterglxtphygphyterqsphyinphyiophyexphymakphyicsphysqphytqphydmphypnaphyurlphyukphywdcatapibuspxaippxaintcpxagpiosaostpxadmacpxapcicpxartcpxamciziicioexpzsspw100lcdlcdctlzkbdzapmzusbuhubuhidevukbdumassauecdcecuekueurludavld_sdmmcwi_pcmciane_pcmciapxauartcom_pcmciawdc_pcmciawsdisplay_emulpxaohcicpu_mainbuszlcdpxapcic_scoopzmcipxaiicuroothubi2cbusmiiwsemuldisplaydevwskbddevatapiata_hlsdmmcbusapmdevifpcmciabususbususbroothubifusbdevifusbififuhidbuschanneldrivebasedackirqlunindexkbdmuxcontrollersocketconfigurationvendorproductreportid: Media interface : %s, rev. %d 100baseFX, 100baseFX-FDX, no media presentAC101 10/100 media interfaceAC101L 10/100 media interfaceAm79C874 10/100 media interfaceAm79C875 10/100 media interfaceACXXX 10/100 media interfaceAm79C901 10BASE-T interfaceapmsuspendpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentunknown error codeAPM ioctl get power statusreservedAPM: %s event code %x get eventapmstandbyapmevapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedbooted_devicebooted_kernelconsole_devicepowersaveWarning IRQ's disabled during boot() %s%stotal memory = %s avail memory = %s single-skdb-k-aquiet-q-v%s: unknown child %patadownwd at %s drive %databus at %s channel %datasplatainitqqidlataactatdrnunable to create kernel thread: error %d couldn't establish power handler %scnfunable to create config thread: error %d atathata_thread: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xfer%s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: not ready, st=0x%02x, err=0x%02x recalpiomodesetmulti%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) soft error (corrected)ATA illegal length indicationATA volume overflowATA command abortedreadonly deviceunit attentionillegal requestnon-media hardware failuremedium errornot readyunknown error code %d %s(%s:%d:%d): wdc_atapi_get_params: drive %d not present wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: driver failed wdc_atapi_get_paramswdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d: error 0x%x unable to allocate periph for drive %d wdc_atapi_scsipi_request %s:%d:%d wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x wdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: PIO mode %d rejected, falling back to PIO mode 3 wdc_atapi_start: not ready, st = %02x error (0x%x) : %d targets removablefixed drive %d: <%s, %s, %s> %s %satapibus at %sALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25match_bootdisk: can't get label for dev %s (%d) no mainbus foundWARNING: double match for boot device (%s, %s) boot device: %s Broadcom 3c905B internal PHYBroadcom 3c905C internal PHYBCM5201 10/100 media interfaceBCM5214 Quad 10/100 media interfaceBCM5221 10/100 media interfaceBCM5222 Dual 10/100 media interfaceBCM4401 10/100 media interfacebpf_mcpybpf_change_type%s: ifpromisc failed: %d%s: descriptor not in listbpfattachmaxbufsizepeers%s: bpf_setdlt: ifpromisc failed (%d) bpfopsbgebnxphyflagsfailed to get phyflags chipidfailed to get chipid 2500baseSX-FDX, BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5714 1000BASE-T media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacedisksortfcfs_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_sync_bus_dmamem_map: size botchoptical mediafictitiouscd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct sectors-per-unitsector-sizedisk-infoMMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d NEC CD-ROM DRIVE:260cd9660noplcd9660_reclaim: pushing activeIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect flags?RRIP with incorrect NM flags? RRIP without PX field? SPvfscd9660utf8_jolietCD001%/@%/C%/Eroot_devicefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] ISOFS mounttag VT_ISOFS, isofs vnode cd9660_strategy: specorg.netbsd.kauth.system%s: %d silo overflow%s, %d ibuf flood%s device enable failed 'ns16550, broken fifons8250 or ns16450, no fifons16550a, working fifoAu1X00 UART, working fifons16650, no ERS, working fifoOMAP UART, working fifocan't re-init serial console @%lx txfifo disabled unable to allocate ring buffer couldn't establish interrupt configure failed, error=%d MEGAHERTZMODEM XJ2288config_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_hook: malloc failedconfig_connect: malloc failedconfig_connect: can't connect with shared hook, type=%d id=%ldcnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference  %s@%dNetBSD-COREELFProcessor failed probe - no CPU ID %s%s%s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB/%dB %d-way Instruction cache %s: %dKB/%dB %d-way %s Data cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)arm700swibug%s: SA-110 with bugged STM^ instruction ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TSheeva 88SV131Sheeva 88FR571-vdARM1020EARM1022E-SARM1026EJ-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1FA526CPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXwrite-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13**write-back-locking-C**unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step 0*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcachetag VT_NON, dead vnode dead_write: lockdead_read: lockm_pulldown malfunction, rrx, %s r%d, %s #%dthumb insn #0x%08x[r%d][r%d#0x%03x#0x%02x{r%d-r%d}^f%d#%sspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x imbimbrangeswiblxSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsmsrpFmpF2bxclzbkptSdn2eorsubadcsbcrsctstDn2teqcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabssqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfsrfswfcrfccmfPRghcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpmcrr#&mrrcldc2L#vldcstc2stc%s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu) dkdrn%s at %s (%s) deleted %s%u: unable to attach pseudo-device sectors-per-tracktracks-per-cylindercylinders-per-unit%s at %s: %s %s: %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) dkwedgedmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interface: failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbufEthernet address %s %s: device timeout %s: NIC memory corrupt - invalid packet length %d exec_elf32#!exec_scriptvmcmdkillsextendscalls: 3Com internal media interface ignoring this PHY, non-zero instance no media present exphy_service: can't isolate 3Com PHYFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%lu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)uid %d, pid %d, command %s, on %s: %s dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s %s: bad sizebad block %lld, ino %llu bad blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapstart = %d, len = %d, fs = %s offset=%d %ld cg %d ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapifree: dev = 0x%llx, ino = %llu, fs = %s ifree: freeing free inodedev = 0x%llx, block = %lld, fs = %s blkfree: freeing free blockblkfree: freeing free fragfile system full %s: write failed, file system is full dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevbad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%llx, optim = %d, fs = %s ffs_realloccg: bad optimifree: range: dev = 0x%llx, ino = %llu, fs = %sdmode %x mode %x dgen %x gen %x size %llx blocks %llx ino %llu ipref %llu ffs_valloc: dup allocfree inode %s/%llu had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on listffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dffsdoclusterreaddoclusterwritedoreallocblkslog_changeoptffsinoffsdino1ffsdino2, not mountingffs_reload: dirty1appleufs%s: unknown ufs flags: 0x%08x%s ffs_reload: dirty2ffs_mountfs: block size (%d) > MAXBSIZE (%d) %s: replaying log to disk %s: replaying log to memory %s: options QUOTA2 not enabled%s update: rofs mod%s: file system not clean (fs_clean=%#x); please fsck(8) %s: lost blocks %lld files %d %s: `-o softdep' is no longer supported, consider `-o log' %s: nonsync dir writeffs_write%s: typeffs_wapbl: unknown journal type %d %s: file size (%lld) non zero %s: ufs_getlbns failed, error %d! %s: unexpected numlevels %d from ufs_getlbns ffs_wapbl: cylinder group size of %lld MB is not big enough for journal %s: log not allocated, largest extent is %lldMB %s: GOP_ALLOC error %d ffs_wapbl_replay_finish: unable to cleanup inode %u ffs_wapbl: vget failed %d ffs_wapbl: try to clear non-log inode %lld %s fs superblock in old format, not journaling tag VT_NON, fifo with %d readers and %d writersfifordfifowr/usr/src/sys/miscfs/genfs/genfs_io.cgenputgenfs: bad opLXT1000 1000BASE-T media interfacemasterslavestrapped to %s mode, pre-C5 BCM5400 compat enabledDP83861 1000BASE-T media interfaceDP83865 1000BASE-T media interfaceDP83891 1000BASE-T media interfaceBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d addr 0x%x%s at %s addr 0x%02x: I2C bus unable to create intr thread i2c-child-devicescookiecompatibleWARNING: ignoring bad device address @ 0x%02x iicintrWARNING: intr handler list not empty WARNING: proc handler list not empty iic at %s(src=%s dst=%s tgt=%s)icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeoutinet6icmp6rediracceptredirtimeoutnd6_prunend6_delaynd6_umaxtriesnd6_mmaxtriesnd6_useloopbacknodeinfoerrppslimitnd6_maxnudhintmtudisc_hiwatmtudisc_lowatnd6_debugnd6_drlistnd6_prlistmaxqueuelenicmp6_mtudisc_callback_registersanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ENOBUFS in icmp6_error %d ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceinvalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full%s: no 802.11 instance! .5%s: %s rates: %s%d%sMbps11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: WEP data frame too short, len %u [%s] unable to pullup %s header wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: control frame%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher not enough data in following buffer, m_len %u need %u [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt [%s] Discard frame due to countermeasures (%s) TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, WMEtoo short, len %u[%s] discard %s frame, ssid mismatch: [%s] shared key challenge alloc failed [%s] extended rate set too large; only using %u of %u rates reassocWPARSN, protection, QoSie too shortERPbad len %uunhandledid %u, len %uno scan.ratesbad scan.rates len %dno scan.ssidbad scan.ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) mgtsubtype 0x%x not handledtoo short (1): len %uwrong version %xnot to bsstoo short (2): len %uduplicateseqno <%u,%u> fragno <%u,%u> tid %udata too short: expecting %uunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %u%s: unable to allocate VLAN tag too short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s link-layer statistics and controlsieee80211IEEE 802.11 WLAN statistics and controls%s: sysctl_createv failed, rc = %d client/peer stations%s: sysctl_createv failed (rc = %d) vap%uparentinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %s: %snode %s join %s: %snode %s leave %s: notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry %s: free all nodes in %s table 0x%p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set:%s%u start chan %u %s %s table %s: %s[%u] still active [%s] scan candidate purged from cache (refcnt %u) passive%s: end %s scan refcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entrynew [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xneighbor%s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: creating ibss %s: no scan candidate %s macaddr bssid chan rssi rate flag wep essid%s: chan %d->%d begin %s scan in %s mode, scangen %u key map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble [%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s %s table, inact %u Cannot allocate key index map with %u entries scan80211nodeno WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!%s: cannot expand storage not enough room, need %u got %zu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x ieee80211_ref_node (%s:%u) %p<%s> refcnt %d rcvif not null[%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %d (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon missreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthreserved#13reserved#14reserved#15reserved#0reserved#1reserved#2reserved#3reserved#5reserved#8reserved#9ps_pollrtscf_endcf_end_ackINITSCANAUTHASSOCRUNWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDwlan_internalwlan_xauthrssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%s: warning: unable to delete rtentry @ %p, error = %d ifqmaxlendropsinetip6org.netbsd.kauth.network%s%d%s: ifioctl_attach() failedtoo many interfacessndq%s: could not attach sysctl nodes if_detach: WARNING: AF %d not purged invalid argument to %sifaddrether_multihost is not on local networkcould not allocate llinfogateway route is not oursarplookup: unable to enter address for %s@%s on %s (%s) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arp from %s: new addr len %d, was %d arp from %s: addr len: new %d, i/f %d (ignored) keeprefreshlog_movementslog_permanent_modifylog_wrong_ifacearp_rtrequest: bad gateway value arp_rtrequest: malloc failed %s(%s): sockaddr_dl_init cannot failarpresolve: can't allocate llinfo on %s for %s arpintrrevarp%s: reset failed %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s getting interface handle failed auemcauemccl%s-mccreating multicast configuration thread couldn't get endpoint descriptor %d missing endpoint %s: EEPROM read timed out %s: MII read timed out %u usb errors on intr: %s open intr pipe failed: %s aue_send error=%s couldn't get ep %d media change failed write PHY failed read PHY failed if_axe%s: watchdog timeout no union descriptor no data interface setting alternate interface failed could not read endpoint descriptor unexpected endpoint could not find data bulk in could not find data bulk out faking address %s: no memory for rx list -- packet dropped! %s: usb error on rx: %s %s: tx list init failed %s: rx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: usb error on tx: %s %s: read MAC address failed %s: %u usb errors on rx: %s %s: cue_send error=%s %s: can't handle af%d %s: discarding oversize frame (len=%d) setting config no failed %s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s loading firmware failed could not read Ethernet descriptor no memory for multicast filter buffer %s: kue_send error=%s looutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedifmediacan't alloc mem for enet addr can't map mem for enet addr can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSVECFD605 PCMCIA EtherNet CardSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-EthernetNDCDYNALINKL10Cfailed to get interface, err=%s couldn't get endpoint %d %s: udav_send error=%s %s: %s: bad register %04x %s: url_send error=%s wiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterigmpigmppl%d.%d.%d.%dinvalid argument to in_lifaddr_ioctlin_controlin4_cksum: offset too short for IP headerin4_cksum: mbuf too short for IP headerCouldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: in6_setscope failed in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix in6_control: failed to create a temporary address, errno=%d invalid argument to in6_lifaddr_ioctlin6_if2idlen: unknown link type (%d) ip6_optionsin6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 headergenerate_tmp_ifid: never found a good ID %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: cannot assign link-local address %s: didn't unlink in6ifaddr from list in6pcbplinternet6inpcbplinternet/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d Detecting hardware...fork initcannot mount root, error = %d pgdaemonfork pagedaemonioflushfork syncerfork aiodoned%s %s (%s)/sbin/oinit/sbin/init.bakkernostypeosreleaseosrevisionmaxvnodesmaxprocmaxfilesargmaxhostnamehostidclockratehardclock_ticksprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimedomainnamemaxpartitionsrawpartitiontimexrtc_offsetmsgbufsizeipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemsgbufmaxphyssbmaxmonotonic_clockurandomarandomlabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportposixsemmaxhwmachinemodelncpubyteorderphysmemusermempagesizemachine_archalignbytescnmagicphysmem64usermem64ncpuonlineddbsecurityi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interface: GPIO controller unable to acquire bus. error=%d output write failed. error=%d i82553 10/100 media interfaceip6flowplcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s forwardingredirectmaxfragpacketsaccept_rtadvrtadv_maxroutesrtadv_numrouteskeepfaithlog_intervalhdrnestlimitdad_countauto_flowlabeldefmcasthlimkame_versionNetBSD-currentuse_deprecatedrr_prunev6onlyanonportminanonportmaxlowportminlowportmaxuse_tempaddrtemppltimetempvltimemaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxifprefixesmaxifdefroutersmaxdynroutesip6_initip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s pim6register_mifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not spliticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeouticmpmaskreplreturndatabytesbmcastechoicmp_mtudisc_callback_registerICMP: redirect failed to register timeout for route to %x, code %d icmp_erroricmp lenttlforwsrcrtdirected-broadcastallowsrcrtsubnetsarelocalmtudiscmtudisctimeouthostzerobroadcastcheckinterfacerandom_iddo_loopback_cksuminmltplip_initipfrenplAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockinterruptCondition variable%.*spid %d (%s): %s write of %zu@%p at %lld failed: %d cpu%dfdcloseincrease kern.maxfiles or MAXFILESfdfilefile2dup2EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMERexecargsshould not happenpspawnlwpwaitkernel mapping failed %d netbsdinit died (signal %d, exit %d)orphaned traced processincrease kern.maxproc or NPROCforkmxforkulim%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbyidle/%ucreate_idle_lwp: error %dkthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx softint%s: %s caller=%pKernel locklwpplsigwait(zombie)swappermalloc_type_attach: bad magicdevbufDMA mappcbroutetblfragtblUFS mountExport Hostip_moptionsin_multimrtbwmeterWARNING: module error: link_set_modules`link_set_modules' section not present`link_set_modules' section wrong sizecan't find builtin dependency `%s'too many required modulesbuiltin module `%s' failed to initDEBUG: module: module `%s' not foundmodule `%s' busycannot unload module `%s' error=%dunloaded module `%s'builtin module "%s" init failed: %dmod_unld/stand/%s/%d.%d/modulesbuiltin %s failed: %d modulemodunloadmodule_init: %dmodule_rele: goneunable to load object pushed by boot loaderuse -f to reinstate builtin module "%s"out of memory for `%s'cannot fetch module info for `%s'module built for `%d', system `%d'forced load, system may be unstableincompatible module class for `%s' (%d != %d)dependency name mismatch (`%s' != `%s')module `%s' already loadedcircular dependency detected for `%s'required module name `%s' too longtoo many required modules (%d)self-dependency detected for `%s'unable to affix module `%s'module properties failedmodcmd function returned error %d for `%s'%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistplist load returned error %d for `%s'noautoloadautoloading is disallowed for %sowner field : %#018lx wait/spin: %16d/%d locking against myselfmutex_init: impossible typeMutexmutexphysiodphysio%s: %s suspension %s (delegator %s) removed by %s %s: %s is suspended by %s (delegator %s) %s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed Devices without power management support:classPowering devices:(failed)Shutting down devices: shutting down %s, skipped.success.%s-self%s: class suspend %s: driver suspend %s: bus suspend %s: suspend enter %s: suspend exit Flushing disk caches: Suspending devices:%s: bus resume %s: driver resume %s: class resume %s: resume enter %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuepmfprocplproc2proc_args%s (pid %d) changing logname from %.*s to %s rasplimitplpstatsplcurprocrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcould not extract estimated entropy from poolrndreadrndsamplernd: source "%s" failed continuous-output test. rnd: source "%s" failed statistical test.rnd: detaching source "%s".rnd: bad seed length %d rnd: bad seed checksum cacheht_timebalance_periodmin_catchtimesoftintskpreempt_priupreempt_prisched_cpuattach: could not allocate the runqueuerunqueue pullrunqueue pushrunqueue stayrunqueue localizeowner/count : %#018lx flags : %#018x Reader / writer lockrwlocksigactsksiginfosorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d WARNING: softint_establish: table full, increase softint_bytes softdissoft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorysoftint_picklwpwedge:parsediskuse one of: %s[a-%c] none halt reboot md0Cannot open "md0" (root) (default %sdump device (default %sb)file system (default %s): use one of: genericunknown device major 0x%llx %s%lludevice %s (0x%llx) not configured root on %scan't determine root device dumps on %ssched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesetrunnable: lwp %p state was %dWARNING: negative runtime; monotonic clock has gone backwards pid %d is killed: %s exceeded RLIMIT_CPUpid %d, command %s, is killed: %s kernel %sassertion "%s" failed: file "%s", line %d p->sysctl_child == NULL/usr/src/sys/kern/kern_sysctl.csysctl_lookup: rnode %p wrong version sysctl_destroy: rnode %p wrong version sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_query: rnode %p wrong version sysctlsysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl_create succeeded but node not found?! sysctl: log %p root mismatch (%p) sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! sysctlnodesysctldatatimecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummyptimerplptimersplnanoslppid %d attempted to set the (obsolete) kernel time zone callout_init_cpu (1)callout_init_cpu (2)late/%ucalloutwait/%utodr_attach: TOD already configured WARNING: preposterous time in file system WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time tstilepltstileturnstile_unsleep%08x-%04x-%04x-%04x-%04x%04x%04xbind failed couldn't register event handler %s: unable to flush cache %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors lddrnlddtch%s: not drained : <%s> %sattachcouldn't create thread %d-bit width, bus clock %u.%03u MHz %u KHz LXT970 10/100 media interfaceLXT971/2 10/100 media interfacezaurus_restart() for C7x0 is not implemented yet. The operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directory base 0x%x-0x%x irq %d drq 0x%08xmainbus_bs_free(): Help!mainbus_bs_alloc(): Help!Marvell 88E1000 Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1116 Gigabit PHYMarvell 88E1145 Quad Gigabit PHYMarvell 88E1116R Gigabit PHYmdidle%s: cfattach_attach failed md%d: internal %s image area mfs_initminiroot() called more than oncemfsmfsidlmfs_roottag VT_MFS, pid %d, base %p, size %ld mfs_ioctl not VBLKmfs_inactive: not inactive (mfs_buflist %p)mfs_closemfs_strategy: bad devwarning: mfs read during shutdown mii_attach: phyloc and offloc specifiedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverbosemiiautmii_phy_setmedia: MASTER on wrong mediaHomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXcouldn't establish power handlerin6_savemkludge: no kludge spacedos2unixtime(): month value out of range (%ld) msdosnoplmsdosfhpldeget(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld msdosfs_reclaim(): pushing activeextendfile(): attempt to extend root directory . .. doscheckpath(): .. not a directory? msdosfsmsdosfs_sync: rofs modRRaArrAamsdosMSDOSFS mountMSDOSFS fatMSDOSFS temptag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu msdosfs_strategy: specrename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typeregen_tmpaddr: failed to create a new tmp addr, errno=%d nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) from == NULL in nd6_cache_lladdr%s.%d: sockaddr_dl_setaddr(, %d, ) failed on %s %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) %s: something odd happens %s: sdl_alen == %u, dst=%s, if=%s scope error in router list (%s) scope error in prefix list (%s) NDPnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required %s: possible hardware address duplication detected, disable IPv6 nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_ns_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rtpref: impossible RA flag %x nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d pfxlist_onlink_check: failed to make %s/%d onlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) in6_tmpifadd: failed to find a good random IFID in6_tmpifadd: failed to find a unique random IFID in6_tmpifadd: ifa update succeeded, but we got no ifaddr defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p prelist_update: IFID undefined (%s) prelist_update: invalid prefixlen %d for %s, ignored in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: %s is already configured in6_ifadd: failed to make ifaddr %s on %s (errno=%d) prelist_update: failed to create a temporary address, errno=%d nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected %s: del route, error=%d setaddress: socreate, error=%d setaddress, error=%d nfsbtdifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s %s (%d) from nfs server %s impossible packet lengthshort receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs_reclaim: pushing activenfs send error %d for %s nfsd send error %d timertimer starttimer stopnfscon sotypenfscn2nfs server %s: %s not respondingnfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfsrvdescplbuild > MLENnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for roottag VT_NFS, fileid %lld fsid 0x%llxnfs physio/asyncnfs_readdir: lost in spacewriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad v_usecountDP83840 10/100 media interfaceDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815 10/100 media interface%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted ohci_device_isoc_abort: early return ohci_rem_ed: ED not found%s: isoc TD alloc failed OHCI root hubWARNING: addr 0x%08lx not found ohci_abort_xfer: not in process contextohciawohciabohci_setintr: 0 interval , legacy supportOHCI version %d.%d%s unsupported OHCI revision SMM does not respond, resetting reset timeout pcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! Cannot allocate cfe entry CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for pcmcia_check_cis_quirks: malloc pfpcmcia_check_cis_quirks: malloc cfePCMCIA MBH10302UNKNOWNCASIOCompaqHPHP Jornadakmpagespmap_bootstrap: No L2 for L2 @ va %p pmap_alloc_specials: no l2b for 0x%lxpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxxscale_setup_minidata: can't find L2 table for VA 0x%08lxAm79C901 HomePNA 1.0 interface addr 0x%lx-0x%lx intr %dPXA270: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrapped: can't map registers : DMA Controller Can't map registers! dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load faileddmac_dmover_attach: bus_dmamap_create faileddmac_dmover_attach: bus_dmamem_alloc faileddmac_dmover_attach: bus_dmamem_map failedStray DMAC interrupt for unallocated channel %d pxa2x0_dmac_abort_xfer: channel %d failed to abortpxagpio_reg_write: not bootstrapped: GPIO Controller failed to hook main GPIO interrupt pxagpio_reg_read: not bootstrappedunhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %dunable to map register %s: Bus Error Detected Interrupt not handled 0x%x stray interrupt %d : Interrupt Controller intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dNot supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d unable to create new screen (errno=%d)lcd_free on active screen pxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus couldn't map memory space unable to establish interrupt init failed, error=%d pxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxa2x0_io_bs_free(): not implemented pxa2x0_io_bs_alloc(): not implemented QS6612 10/100 media interfaceMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find us rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find our annotation radix already initializedrn_init: radix functions require max_keylen be set rn_initrn_init 2delayed rn_inithead failedrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!pcblistrip_usrreqraw6rip6_attachrip6_detachrip6_usrreqraw_usrreqrandom_startrandom_pickdoublehashrandinc%d%llud%d%s-shortNULL rng! rndtemprndctxrtentplrttmrplrt_init_done == 0/usr/src/sys/net/route.crt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rtfreertfree: %p not freed (neg refs) rt_timer_queue_remove_all: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtfree 210base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT routertable%s: message too long%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countrtts: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerscoop_pcic_read: bogus registersa6_recoverscope: assumption failure (non 0 ID): %s%%%d %s(%s:%d:%d:%d): : SCSI bus : %d target%s, %d lun%s per target failed to init channel scsinitq target %d lun %d: <%s, %s, %s> %s %sscsibus at %swaiting %d seconds for devices to settle... scsidlyCHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X GENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA scxsplWARNING: not enough memory for scsipi_xfer_pool unable to create completion thread for channel %d scsipi_channel_initscshutURGENT getxsunable to allocate %sscsipi_xfer polling command but no adapter resourcesWARNING: tag %d greater than available openings %d sxdrn DEFERRED ERROR, key = 0x%x , requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data =Sense Error Code 0x%x at block no. %d (decimal)sync (%d.%02dns offset %d), 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueingtagged queueing request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done xscmdsccompscsizzzno data foundvendor uniquecopy abortedsearch returned equalverify miscompareunknown error keyscsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter scsiverbosetapeprinterprocessorwormcdromopticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storagescsipi_dtype: impossible device typecache synchronization failed preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectorsdrive offlineunformatted mediacouldn't create dma map. (error=%d) mmctaskqcouldn't create task thread %s(manufacturer 0x%x%sproduct 0x%x%sat %s function %d "couldn't alloc memory (sdmmc function) couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short unknown tuple code %#x, length %d %s: CIS version %u.%u couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d couldn't read CIS can't change bus clock can't read EXT_CSD unrecognised future version (%d) unknwon CARD_TYPE: 0x%x can't change high speed can't re-read EXT_CSD HS_TIMING set failed unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x SD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed switch func mode 1 failed: group 1 function %d(0x%2x) write-protected copy-cred-on-forkmodelsTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsorg.netbsd.secmodel.suseris-rootorg.netbsd.secmodel.securelevelis-securelevel-aboveorg.netbsd.secmodel.extensionsTraditional NetBSD: Extensionsextensions_modcmd::init: secmodel_register returned %d curtainusermountuser_set_cpu_affinityextensions_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: Securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: Superusersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlspec_write typespec_read typespec_node_init: unable to allocate memoryspec_node_destroy: corrupt hashusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interface dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded %s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x configure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfgmiscdetachallconfigconfig_devalloc: %s (%zu < %zu)config_devalloc: memory allocation for device softc failedconfig_devalloc: memory allocation for device_t failed%s: could not expand cd_devsconfig_devalloc: device name too longpmfsuspdevice-driverdevice-unitattribute-nameloc-namelocatorsinterface-attributesconfig_detach: forced detach of %s failed (%d)detached %s: unable to allocate callbackconfig_interrupts: unable to allocate callbackconfig_defer: can't defer config of a root deviceconfig_defer: unable to allocate callbackconfig_attach: allocation of device softc failedFound %s (root)%s at %sWARNING: power management not supported root device %s not configured done. WARNING: %d error%s while detecting hardware; check system log. detaching %s, unable to detach instance finiconfig_cfdata fini rollback failedfini rollbackinit rollback unsupported blst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_alloc: no strategyureadc: non-positive residureadc: non-positive iovcntcprng %s: nist_ctr_drbg_reseed failed.cprng %s: bad reseed state %dcprng %s: instantiation failed.cprng %s: WARNING pseudorandom rekeying. bdevsw_attach: block majors exhaustedcdevsw_attach: character majors exhaustedwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)disk_attach: can't allocate storage for disklabelno raw partition and disk reports bad geometryno raw partition and partition table is fulldos partition I/O errormbr partition exceeds disk sizedisk label read faileddisk label corrupteddisk label write failedBEA01NSR0iso partitionbad sector table I/O errorbad sector table corrupted%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashinit: bad cnthashinit: invalid table typehashdone: invalid table type KMGTPE kMGTPE%qu%s%c%sdisknamesiostatnamesiostatsiostat_alloc: cannot allocate memory for stats bufferiostat_free: iostat_count == 0%s: busy < 0 iostat_unbusykcpusetkcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-8kmem-16kmem-24kmem-32kmem-40kmem-48kmem-56kmem-64kmem-80kmem-96kmem-112kmem-128kmem-160kmem-192kmem-224kmem-256kmem-320kmem-384kmem-448kmem-512kmem-768kmem-1024kmem-2048kmem-4096kmem-8192kmem-16384not modular%s error: %s: %s lock address : %#018lx current cpu : %18d current lwp : %#018lx lock errorklogrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) page %p, nmissing %d, time %u POOL CACHEPOOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p no log cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer entry uncontended %llu contended %llu cache layer empty groups %u full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p empty cache groups: %s: too large itemsperpage(%d) for PR_NOTOUCHpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpupool_get: %s: page emptypool_put: %s: page header missingMust specify a pool to print. (null)Skipping crash dump on recursive panic panic: %s: table is full - %s %s: table is full pserializeexclusive accesspsrlzspecificdata_domain_delete: not implementedspecificdata_setspecificvmem%s-%zuvmem-vavmem-metavmem_sizevmem_rehash%s: workqueue_create %d vmemevbt_pagesbt_countbt_inusexclocvxchicvcrosscallunicastxcallxcall/%ufiledelaydirdelaymetadelaysyncer vnode aio_jobs_poolaio_lio_poolposix_aioaio_listio_maxaio_maxaioworkaiodoneaio_process: invalid operation code sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s parkedmqmsgplposix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqsendcvmqrecvcvpsetpsets_max%d:1,%d:2posix_schedpri_minpri_maxdirect_selectpollsockcompatnewrenotcpcongctlTCP: invalid wscale %d, assuming %d tcpipqepltcp_pulloutofbandsynplConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULLtcp_outputsackholepltcpcbpltcp_inittcp_new_issrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackavailableselectedwin_scaletimestampscompat_42cwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtw%s: af %dtcp_usrreqtcp6%s: could not allocate %zu bytes for hash anchors%s: could not allocate %zu bytes for fatp_t array%s: could not allocate %zu bytes for vtw_t array10base210base5%s: AUI selected with no matching media ! ThunderLAN 10BASE-T media interface78Q2120 10/100 media interfacettyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%#lx%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutftkstatninnoutcanccrawccqsize0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXXpqrstuvwxyzPQRSTttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc udp6_output: IPV6_V6ONLY option was set for a connected socket udp6rfc6056udp6_usrrequdpchecksumudp_usrrequfs_reclaim: pushing active%s: bad dir ino %llu at offset %d: %s bad dirFirst bad, reclen=%#x, DIRSIZ=%lu, namlen=%d, flags=%#x, entryoffsetinblock=%d, dirblksiz = %d Second bad checkpath: .. not a directory ufs_readdotdot: directory %llu contains garbage instead of .. ufs_parentcheck: inode %llu reached via .. of inode %llu is not a directory ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_size too smallufsdirufs_whiteout: unknown oprename: EXDEVrename: same fileufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qduhidrea: input=%d, output=%d, feature=%d uhidev_intr: bad repid %d uhid at %s reportid %d%s, iclass %d/%d endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids no memory uhidevwihub not fully initialised, but child deleted?multiple%s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint ehcicannot open interrupt pipe port %d power on failed, %s illegal enable change, port %d port error, restarting port %d port error, giving up port %d strange, connected port %d has no power port %d reset failed device problem, disabling port %d accfaccf_streamseqpacketdgram%s: source too long, %d < %d bytessockaddrmsizemclbytesnmbclustersmblowatmcllowatmbplmclplm_copydata: off %d, len %dm_copydata: m == NULL, off %dm_copydata: m == NULL, len %dm_copym: off %d, len %dm_copym: m == 0, off %dm_copym: m == 0, len %d [!COPYALL]m == NULL in m_pulldown()packet tagsunixsomaxkvasokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dsoaccept: !NOFDREFsoclose: NOFDREFsooptsnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdropsbcreatecontrol: message too large %d msgcontrolmsghdrsocknamembfreembdatambheadermbsonamembsoptsmbftablembcontrolmboobdataunp_threadunpgcuipc_init %dunp_attachunp_connect2unp_disconnectuipc 1uipc 2uipc_usrrequipc 4piusrreq%s: was console keyboard bad modifier sizetoo many modifier keyskey code size != 8key codes not on byte boundarymultiple key code arrays attach failed, %s This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). : %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d %s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Get Max Lun failed: %s using %s over %s quirk init failed endpoint not found %u/%u/%u unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) Out of memory no buffer memory command protocol=0x%x not supported bus attach failed Bulk-OnlyCBICBI with CCIATAPIUFIRBCISD-ATAuisdata_exec_command: large datalen %d uisdata_exec_command: bad command 0x%02x uisdataex%s: ATA_NOSLEEP not supported %s: multiple uisdata_bio uisdatablumass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cbcan't allocate link for drive %d undefined instruction in kernel: Realtek RTL8150L internal media interface usbtskusbdet: USB revision %s, not supported usb_doattach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d %s: unable to create event thread for usb_create_event_threadunable to create task thread: %s usb_create_event_thread taskusbevtusbreausb at %spre 1.01.1usbtask-hcusbtask-drusb_reserve_allocm of size %u failed (error %d) port %d configuration %d interface %dvendor 0x%04xproduct 0x%04xusbverbose%x.%02x, class %d/%d, rev , addr %d%s, %susbdlyout of data0 lengthiface descusbd_fill_iface_data: bad descriptor(s): %s usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port %s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected USBUSB deviceUSB HCNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDusbd_transfer: not doneusbsynusbd_start_next: error=%d usb_desc_iter_next: bad descriptor usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_detach_wait: %s didn't detach amapplcownowcownowpageanonpllivelockuao_set_swslot: uobj = %p uao_set_swslot: NOSWAP objectuao_getpageuao_getuao_create: hashinit swhash faileduao_create: swslots allocation faileduaoeltpluao_flush: strange, got an out of range flush (fixed) uao_put%s: impossibleuao_detubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to allocate inactive queue headsubc_init: failed to map ubc_objectubc_alloc%s: error=%d udv_faultudv_detachudv_attachflt_noram5flt_pmfail1flt_pmfail2anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2fltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpgloanagainloanzeroloanuopguser_va0_disablevmmpeplvmspplvm_map%s: kernel object %p %p vmmeterloadavguvmexpuvmexp2maxslpuspaceidlezerouobjwirepguvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_physload: page size not set!uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_initWARNING: unable to allocate %ld page color buckets uvm_pagealloc_strat: bad strat %duvm_page_bootstrap: no memory pre-allocatedemergvapager_mappagedaemon: deadlock detected! anonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactexecreactfilereactanonpglallocractx%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failed%s: swapdev not in listuvn_fp1uvn_fp2buf mem pool index %dforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbioplbuf%umbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbflushbiolockbiowaitallocbuf: buffer larger than MAXBSIZE requestedbiodone2 alreadycachegcncachenchinit %dnamecacheentries scannedentries collectedover scan targetunder scan targetforced reclaimscwdidirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkspnbufpllf_findoverlap: defaultlockfnamei_simple_convert_flags: bogus sflags chrooted pid %d uid %d (%s) detected outside of its chroot /../armzauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotunmount: dangling vnode%sunmounted %s on %s type %s forcefully unmount of %s failed with error %d WARNING: some file systems would not unmount unmounting file systems...syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mount%s: failed to start extattr: error = %d Unmounting fresh file system failedvnode @ %p, flags (%s) tag %s(%d), type %s(%d), usecount %d, writecount %d, holdcount %d freelisthd %p, mount %p, data %p lock %p vflushbuf: not dirty, bp %pvflushbuf: dirtyVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBAD%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsymlink-targetfdesckernfsafsfstransfstrans_start: cannot upgrade lock%s: illegal state %dvnodeplvdrainvrele%s: holdcnt vp %p%s: neg numoutput, vp %p%s: cannot reclaimdead but not clean%s: bad ref count%s: unable to lock %pvndsbusywapblentryplwapblflush_disk_cacheverbose_commitwapbl_cache_sync: %s: dev 0x%jx %ju.%09lu wapbl_write_commit: error writing duplicate log header: %d %s: %lld.%09ld this transaction = %zu bytes wapbl_flush: current transaction too big to flush wapbl %p logvp = %p, devvp = %p, logpbn = %lld circ = %zu, header = %zu, head = %lld tail = %lld fs_dev_bshift = %d, log_dev_bshift = %d bufcount = %zu, bufbytes = %zu bcount = %zu reclaimable = %zu reserved = %zu errcnt = %d dealloccnt = %d, dealloclim = %d inohashcnt = %d, inohashmask = 0x%08x entries: bufcount = %zu, reclaimable = %zu, error = %d bufs = %p, %p,dealloced blks = %lld:%d,registered inodes = %d/0%06o,wapbl_register_deallocation: out of resourceswapblrecwapblinoplUnrecognized wapbl magic: 0x%08x Unrecognized wapbl type: 0x%08x wapbl_replay: corrupted records system.user.security.trusted.xattr-namexattr-listxattr-valvmapbufvunmapbufvop_bwritevop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_fcntlvop_pollvop_kqfiltervop_revokevop_mmapvop_fsyncvop_seekvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_strategyvop_printvop_islockedvop_pathconfvop_advlockvop_whiteoutvop_getpagesvop_putpagesvop_closeextattrvop_getextattrvop_listextattrvop_openextattrvop_deleteextattrvop_setextattr: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) Sharp Zaurus frame bufferSharp Zaurus LCDstdstandby immediate command didn't complete wd_standby: status=%s wdstart1: bad return code from ata_bio()ST506%s: (error not notifiedwddump: try againwddump: polled command has been queuedwddump: unknown atacmd code %dwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %ddevice faultdevice timeoutchannel resetsoft error (corrected) wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEFORCE_LBA48quirks %s drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing wd_setcache command not complete wd_setcache: status=%s flush cache command didn't complete wd_flushcache: status=%s wdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed obsolete (address mark not found)no media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedST3120023ASST380023ASST360015AS__wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xferatarst%s:%d: %s %s:%d:%d: %s lost interrupt type: %s tc_bcount: %d tc_skip: %d missing untimeout%s channel %d: reset failed for drive 0 drive 1atapollatadrdyatacnfwdccmdatardlcan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDLucent/Prism/Symbol 802.11 controlscommand timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again %s: cleaning outstanding rssadapt descriptor for %s wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: tx rate %d -> %d (%d) record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s write fid %x failed LucentSymbol could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI) added (%s, %s emulation%s: emergency X server detach wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_common_attach: no memory kbdmux %d: console (%s, %s emulation), using %swsswscreen %d deleted wsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulEDIDdumbwsemul_vt100_output_c0c1: ESC in kernel output ignored vt100OIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOC[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOy[>24;20;0cP2$uP0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d%s: unknown version %dwsevent_readccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfaceconnecting to %s wskdetwskbd_detach: %s didn't detach mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device wskbd at %s%s: event queue overflow wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmux: attach out of memory %s: disconnecting from %s : pseudo power management module : I2C controller unable to attach PXA I2C controller unable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) %s: not configured. can't map bus space %s: not configured zssp: zssp_ic_send: invalid IC %d : USB Mode detection %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%sKernel RNG "%s" monobit test FAILURE: %d ones Kernel RNG "%s" poker test failure: parameter X = %lld.%lld Kernel RNG "%s" long run test FAILURE: Run of %d %ds found Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d < %d) Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d > %d) %s: invalid base %darc4random: WARNING, hit 2^29 bytes, forcibly rekeying. arc4_randrekey: rekey callback bad lengtharc4randomp->p_refcnt != 0/usr/src/sys/lib/libkern/../../../common/lib/libppath/ppath.cunusedv6v7sysvv71kv8otherhpfsadoshfsfilecoreext2fsntfsraidframejfs2vinumudfsysvbfsefsnilfsminixfs30%lloprop stringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s deletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl %s %s SIOCGIFADDRPREF preference %dvalid only with vlan(4) interfacesvlantagSIOCSETVLAN%s: getvlan [ vlan n vlanif i ] vlan: %d parent: %s VLAN tag-vlaniffatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %d Unable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatkern.driversusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1scosolarissunossvr3svr4ultrix@^ks HzQ@Xdl _ Ȓޒ &@2CQh@*}3q&q *}œ%s,%sasprintfgetargsunionpuffs|%s on %s type %.*s: %s already mountedforcemount_puffsrumprump_%smount_%sexec:Cannot create pipeCannot open fd to mount program%s not found for %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]usage: mount %s mount %s mount %s [-Aadfruvw] [-t type][-dfruvw] special | node[-dfruvw] [-o options] [-t type] special nodeAadfo:rwt:uvfrom_mountunknown file system %s.unknown special file or file system %s.%s: unknown special file or file system.:@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfsysvbfsefsnilfsstrdup(;|#n s ƏOw@$+ bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:ruserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.(;|#n s Ə @ O=&Z@ w@ko:mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %ssoftdep(;|#n s Ə @ Ow@bshortnameblongnamebnowin95bgemdosfsbmntversionedbronlybwaitonfatbfatmirrorusage: %s [-9Gls] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9u:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, flags=%s unknown %s id: %sinvalid file mode: %s(;|#n s ƏOw@V$)3 9@BIQW\ )@}b @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacusage: %s %s %s %s %s %s [-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-I readdirsize] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path nodeconflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssoftnfsv2maxgrpsUnsupported socket family %drecvrpc: reject, astat=%d, errno=%d getport: %scallrpc: error = %d sendrecv: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s7eժLcyɫ$Zmݬ#Uѭ%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directoryfree space %number of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %%-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namegetrlimitsetrlimitrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfirst cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). setblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2 Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%uCan't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.3f/%.3f/%.3f/%.3f ms %.1f packets/sec sent, %.1f packets/sec received %d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.3f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packetsBad/invalid interval %sBad/invalid preload value %sOnly one of -P and -p allowedBad/invalid packet size %spacket size is too largebad tos value: %sttl out of range-gBad/invalid maxwait time %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lSorry, no audible output for flood pings"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry cannot move ROOTnot marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s seek error extracting inode %llu, name %s lseek: %s Warning: %s %s End-of-input encountered while extractingwrite error extracting inode %llu, name %s write: %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump corebad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s removeleaf: not a leafwarning: %s: %s Remove leaf %s removenode: not a noderemovenode: non-empty directoryRemove node %s newnode: not a nodeMake node %s not on ino list%s%ld%lluRSTTMPmktempname: called with TMPNAMEsymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). who are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d 0123456789abcdefDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG7Ox *Pz.VvUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1 pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtu#UGHRD M@dmCXLSB c1@2p%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad valuebotched keyword: %sUsage: %s [ -fnqSsv ] cmd [[ - ] args ] Internal Errordefault0.0.0.0/%s%s&%saf %d: %s(%d) %s sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: metric %d, flags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s dfnqSstvCannot allocate memory%s, %sold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gateway-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_CHGADDR: address being changed on iface %02xunspecsysctl of routing tableRouting table%s Protocol Family %d: %-*.*s %-*.*s %-6.6s GatewayFlags%-6.6s InternetAppleTalkatalkexpirehopcountinet6isollinfolockrestnostaticosiproto1proto2recvpiperttrttvarsendpipeshowssthreshx25xnsxresolveflushallnoclonednocloningnoblackholenorejectmpls23Ldf/a2VRs@j'T3X{      0 < i/H_|    ;a{ 8X&NHo9Yu !'!J"b$%&&&&'(6(n)***+,,5,P-y/000 0- 1J 1b 2x 2 3 6 7 9 : ;;+ ;V ;{ ; ; ; ; ; ;  ; ' ; D ; ` ; ; = > ? ?1 ?G ?d @} A B C D E F% G= HO Iy J K L N P P P P(QIRWSgSSTUWXY+Z>ZsZZ[[[[\*\<\R`layaabcdWk {)usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun invalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCBUSIORESETSCIOCRESETSCIOCDEBUGnot %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %13u unable to allocate defect descriptorinvalid block number: %s%s: scsibus%d target %d lun %d <%s, %s, %s> failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %8u %4u entire track defective%10u unable to allocate defect listgrownphysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : nonebusunknown %s command: %s[primary] [grown] [block|byte|physical][blocksize [immediate]]identifyreassignblkno [blkno [...]]resetpreventallowturgetcachesetcachenone|r|w|rw [save]flushcachesetspeed[speed]target lundetachDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB:No Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Begining Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x PFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'hw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)%-*s %*s %8s %8s %8s %s DeviceUsedAvailCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated = %s used, %s available. total: %ld %s allocated = %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedfRfetch_url889sendrequestrecvrequestȝq>u>y>}>>>***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20100605%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (ftp_debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %sarguments to SITE commandSITE command line to sendSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicaccountbyecdupdisconnecteditepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenamerestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottleusageanonpassftp_proxyhttp_proxyno_proxyrprompt'%s' macro not found. parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s' HTTP fetch aborted. Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'fetch_ftp: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'proxy URLMalformed proxy URL `%s'Scoped address notation `%s' disallowed via web proxyCan't lookup `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%s (GET %s HTTP/1.0 Pragma: no-cache GET %s HTTP/1.1 Host: [%s]Host: %s:%uAccept: */* Connection: close Range: bytes=%lld- restarting at %lldCache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s Writing HTTP requestReceiving HTTP reply: %sContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving filealready done Size of `%s' differs from save file `%s'/usr/src/usr.bin/ftp/fetch.crcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. PASVEPSVCan't create socket for data connectionwrong server: return code must be 229 Passive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. /usr/src/usr.bin/ftp/ftp.csndbuf_size > 0Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N netrc] [-o outfile] [-P port] [-q quittime] [-r retry] [-s srcaddr] [-T dir,max[,inc]] [[user@]host [port]] [host:path[/]] [file:///file] [ftp://[user[:pass]@]host[:port]/path[/]] [http://[user[:pass]@]host[:port]/path] [...] %s -u URL file [...] Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' rprompt: no such option `rprompt'ftp> prompt: no such option `prompt'Sorry, input line is too long. anonymoushttpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'46AadefginN:o:pP:q:r:Rs:tT:u:vVCan't lookup `%s': %s/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)xsignal_restart: called with signal %d %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFSRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. ftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) %s; %s aborted. operationCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamNetBSD gzip 20101018malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.3failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintf compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%can't read stdin(stdin): unexpected end of file(stdin)can't stat: %s%s is a directory%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzD"D#D%D'`YYxY SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- Search patterns may be modified by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceeded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Forward search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Forward search always skips target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop long lines. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. --no-keypad Don't use termcap keypad init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send keypad init/deinit sequence. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. CNTL-RightArrow ESC-RightArrow ESC-w Move cursor right one word. CNTL-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. CNTL-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. CNTL-DELETE ESC-DELETE ESC-X Delete word under cursor. CNTL-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. CNTL-L Complete filename, list all. H---More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESlikrklkukdkPkNkh@7kDhcxndaticmvbbc|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%c8bcccbcc18b95.b8bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bANSI_X3.4-1968US-ASCIIISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.syslessLESSKEY_SYSTEM/etc/syslessLESSKEY.lessWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s""%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSCLOSE...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpNumber is required after %s--%s-%c (--%s)Value is required after %sNo such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)LESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namesearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filequit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollwindowquotestildeno-keypadold-botfollow-namesilentInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressiontransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'usage: %s [-aEnr] script [file ...] %s [-aEnr] [-e script] ... [-f script_file] ... [file ...] ae:f:nrEstdout: %s ..."sed: %lu: %s: first RE may not be empty\ \%d not defined in the RE\abfnrtv disconnecting...unknown ACU typecan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c Local command? can't fork! can't find `%s' away for %d timed out at eol chars transferred in lines transferred in write error can't establish pipe List command for remote system? can't execl! [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" [put] usage: from [to] %s: cannot open cat>%s stty -echo;cat>%s;stty echo Local file name? [take] usage: from [to] %s: cannot create cat %s;echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specified/dev/%smore than one parity specifiedE:F:P:a:p:c:l:s:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec %s: missing phone number tbhfprdldvcupndipausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected %s: must be interactive %s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dlink down PHONESbad baud rate %d%s [EOT] can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-iw S%?c%$D%1ȝY%9ȝL%ENU%]eV%}F%E%W%ȝW%ȝX%ȝ]%B%R%R% ȝhU%}]%C%'8|B%DQ]%V_Y%fNH%owI%G%J%ȝJ%ȝK%N^%ȝ_%M%`%ȝa%ȝb%}  t"$+:AGNS[K"`ity~hw.disknames      !"#  /bin/ksh/bin/cshmdnsd+nsswitchNo%c: <: page up, >: page down/sbin/halt -q/sbin/reboot -q%-25s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfFFSv140968192163843276851210242048Config menugoogle-public-dns-a.google.comgoogle-public-dns-b.google.comrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsd [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed usage: sysinst [-r release] [-f definition-file] Installation messages in Englishen_US.ISO8859-1YesSomeNoneOnOffunchangedDelete?reinstall sets forupgradeNetBSD/zaurus 6.0.3 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto an pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksaverage file size (bytes)mount point (or 'none')secMBNetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk into multiple BSD partitions. You must now set up your BSD disklabel. You can use a simple editor to set the sizes of the NetBSD partitions, or keep the existing partition sizes and contents. You will then be given the opportunity to change any of the disklabel fields. The NetBSD part of your disk is %d Megabytes. A full installation requires at least %d Megabytes without X and at least %d Megabytes if the X sets are included. Choosing megabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On modern ZBR disks, actual cylinder size varies across the disk and there is little real gain from cylinder alignment. On older disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system, however you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories). Free space will be added to the partition marked with a '+'. MB Cylinders Sectors Filesystem Mount point?Size for %s in %s?Change input units (sectors/cylinders/MB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionAccept partition sizes. Free space %d %s, %d free partitions.Reduce partition sizes by %d %s (%u sectors).The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated to %d %s. Type enter to continue This disk is too large for a disklabel partition table to be used and hence cannot be used as a bootable disk or to hold the root partition. We now have your BSD-disklabel partitions as: This is your last chance to change them. Start %3s End %3s Size %3s FS type Newfs Mount Mount point --------- --------- --------- ---------- ----- ----- ----------- %9lu %9lu %9lu %-10s %-5s %-5s %sShow all unused partitionsPartition sizes okThe current values for partition `%c' are, Select the field you wish to change: MB cylinders sectors ------- --------- --------- FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9sToggleRestore original valuesSelect the typeother types%s Special values that can be entered for the size value: -1: use until the end of the NetBSD part of the disk a-%c: end this partition where partition X starts size (%s)%s Special values that can be entered for the offset value: -1: start at the beginning of the NetBSD part of the disk a-%c: start at the end of previous partition (a, b, ..., %c) start (%s)Badly formed sector number Select file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Okay, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Okay, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device /dev/%s%c on %s failed. The extraction of the selected sets for NetBSD-6.0.3 is complete. The system is now able to boot from the selected harddisk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-6.0.3 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. The afterboot(8) manpage is another recommended reading; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-6.0.3 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. At a minimum, you must edit rc.conf for your local environment and change rc_configured=NO to rc_configured=YES or reboots will stop at single-user, and copy back the password files (taking into account new system accounts that may have been created for this release) if you were using local password files. Unpacking additional release sets of NetBSD-6.0.3 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. At a minimum, you must edit rc.conf for your local environment and change rc_configured=NO to rc_configured=YES or reboots will stop at single-user. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are not needed by all installations. You may choose to install a core set (Minimal installation), all of them (Full installation) or you select from the optional distribution sets. The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. Available CDs Multiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?I have found the following network interfaces: %s Which device shall I use?You did not choose one of the listed network devices. Please try again. The following network devices are available: %s Which device shall I use?To be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 numberServer IPv4 numberIPv4 NetmaskIPv6 name serverIPv4 name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Primary Interface: %s Host IP: %s Netmask: %s IPv4 Nameserver: %s IPv4 Gateway: %s Media type: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Primary Interface: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Nameserver: %s IPv4 Gateway: %s Media type: %s IPv6 autoconf: %s IPv6 Nameserver: %s Are they OK?Please reenter the information about your network. Your last answers will be your default. Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory %s: %s. Install aborted. Delete after installRelease set %s does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. The installation is aborted. Please recheck your distribution source and consider reinstalling sets from the main menu.Your choices have made it impossible to install NetBSD. Install aborted. The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? (No allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? (No aborts the install process.) Making device nodes ... It appears that /dev/%s%c is not a BSD file system or the fsck was not successful. Try mounting it anyway? (Error number %d.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set's has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseSystem (/etc)Compiler ToolsGamesOnline Manual PagesMiscellaneousKernel ModulesTest programsText Processing ToolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sources%-27s %3sSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions %c and %c overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file %s Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-6.0.3 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuBack to main menuNetBSD-6.0.3 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemyes or no?Hit enter to continueChoose your installationSet sizes of NetBSD partitionsUse existing partition sizesMegabytesCylindersSectorsInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select IPv6 DNS serverother Perform IPv6 autoconfiguration?Perform DHCP autoconfiguration?Root shellSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryFetch and unpack pkgsrc for building from sourceNetwork configuration failed. Retry?Quit without installing pkgsrcInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)We are now going to install NetBSD on the disk %s. NetBSD requires a single partition in the disk's MBR partition table, this is split further by the NetBSD disklabel. NetBSD can also access file systems in other MBR partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single MBR partition used to cover the entire disk. If you want to install more than one operating system then edit the MBR partition table and create a partition for NetBSD. A few hundred MB is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least 5GB if you want to build NetBSD itself. Which would you like to do?Edit the MBR partition tableUse the entire disk Total disk size %lu %s. Start(%3s) Size(%3s) Flg Kind ---------- ---------- --- ---------------- %10d %10d %c%c%cYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s%ssize (maximum %d %s)Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s) %s%sStart (in %s)Partition kind (0..255)There can only be one extended partitionThe Current MBR partition table is shown below. Flgs: a => Active partition, I => Install here. Select the partition you wish to change: Partition table OKDelete partitionDon't changeOther, input number Do you want to re-edit the MBR table (or abandon the installation)? There is no NetBSD partition in the MBR partition table.There are multiple NetBSD partitions in the MBR partition table. You should set the 'install' flag on the one you want to use.Setting up the DOS partition table ... Rewrite of MBR failed. I can't continue.Log ended at: %s # Script ended at: %s sysinst terminated. sysinst: environment variable TERM not set. Dr:f:sysinst: screen too small sysinstmsgs.zaurusxfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgftp dirpub/NetBSD/NetBSD-6.0.3ftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfix.tgzdisknamemydiskpkg hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/6.0.3/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s ------------------------------sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/tmp/dhcpcd-leaseCould not open %s/sbin/ifconfig -a 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.lo0:%s%.*s iwiipwhw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo $gateway; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver -a "${address#*:}" = "${address}" ] && { echo $address; break; }; donedomain-namehost-name0xff0000000xffff00000xffffff00/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig lo0 127.0.0.1/sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ping -v -c 5 -w 5 -o -n %s-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" ifconfig_%sifconfig_%s=dhcp eongreipipgiffaithnsipppptun/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSE%s -p -b 16 -c 4 /dev/r%s%c%s -p -c 3 /dev/r%s%c/sbin/fsck_%s%s -p -q /dev/r%s%c:no_mbr%s (%s, %s)%s (%s, %s %s)%s -f /tmp/disktab %s '%s'disklabel -w -r -i -tffs -o async-tlfs-tmsdos-tffs -o log/sbin/newfs %s%.0d/sbin/newfs -V2 -O %d -b %d -f %d%s%.0d/sbin/newfs_lfs -b %d%s /dev/r%s%c/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etcCreating %s/etc/fstab. cat <%s/etc/fstab Failed to make /etc/fstab! # NetBSD %s/etc/fstab # See /usr/share/examples/fstab/ for more examples. /dev/%s%c none swap sw%s 0 0 %s/dev/%s%c %s %s rw%s%s%s%s%s%s%s%s %d %d /dev/%s%c /tmp mfs rw,-s=%lli swap /tmp mfs rw,-s=%lli kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto /kern/proc/dev/pts/cdrom/dev/%s%c/dev/%s %s ffs %s/dev/%s %s ufs %sraidcd0a/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/dev/rcd%d%cCD001aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/etc/rc.confcat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES//sbin/fsck_lfs/sbin/mount_lfs/sbin/newfs_lfs/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xhepf -rm %smkdir -m 755 /mnt2 /usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fixkern-GENERICkern-C700modulesgamesmantestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrc/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs -async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s /dev/%s%c %s%s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD60s,^%s$,%s=%s,adding %s=%s replacement pattern is %s source for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y updatepasswd -l rootchpass -s %s root%-50s %-10schroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu XXX Help Stringntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s %s. %scan't delete extendedmain-extended mixupUser answered no to destroy other data, aborting. Unknown (%d)%*s %*s (%s)Extended partition, LBAFreeBSD/386BSDLinux swapDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32Windows FAT32, LBANTFS volume setPReP BootUnknown(%lli)%6lli%8s%10lli%10lli %c %s%lli%s/tmp/disktabCreating disklabel %s cat <>/etc/disktab Could not open /etc/disktabFailed to open /etc/disktab for appending. %s|NetBSD installation generated:\ :dt=%s:ty=winchester:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:%s\ nparts limited to %d. :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:***************************************************************************************************************************************************************************************************************************************ȝq>u>y>}>>>usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipe+u$W++Q-%uusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host sendmsgping6: wrote %s %d chars, ret=%d nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) \%03oinvalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmaprefusedunknown qtype truncated no address %s(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsff02::2:0000:0000getaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified IPv6 addressSuccessRefusedrtsol_timer_updateifconfigmake_packetmainrtsol_check_timersockopensendpacketrtsol_inputinterface_upget_llflaginterface_statuslladdropt_fill")probe_initdefrouter_probesendprobertsock_input_ifannouncertsock_input\ usage: rtsol [-Dd] interface ... usage: rtsol [-Dd] -a usage: rtsold [-1Ddfm] interface ... usage: rtsold [-1Ddfm] -a <%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %smultiple interfaces foundprobing %sadDfm1adDkernel is configured not to accept RAskernel is configured as a router, not a hostfailed to open a socketfailed to initilizatoin interfacesfailed to initialize %sfailed to setup for probing routersfailed to open a pid log file: %stimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldpoll: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %ssend RS on %s, whose state is %dsendmsg on %s: %srecvmsg: %sfailed to get receiving interfacepacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sunsupported link type(%d)shutdown: %slo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %sinterface %s insertedinterface %s removedbring interface %s to DOWN statertmsg type %d, len=%lurtmsg type %d too short!A DyLDID!AVDA.dD@pD@}D@D@D@D @D @D @D D E EE@!E-E7EGEUE@nE|EEEEEEA!DEFF @$F"@F#VF$hF%F&F'F(F)@F*@F+F,@F-@G.#G/5G0@CG1@PG2@bG3yG4G5G6@G7G8G9G:H;H@,HA@;HBKHC\HD@jHE@HF@HG@HH@HI@HJ@HK@HL@HMHQ IU@IV IW.IX:IY@PI[hI\@IbIp@IqIrIv@IwIxI IUO UUU}O.M>Copyright (c) 2006-2012 Roy Marples=bcd&Xeqf*Xg h6XikDXlJmJNn%oNXp2qf/rYXsOJt`XujXvqXwSxxXzyXAXBXC-UDXEV$FXGXHXIjJXKXLXOXQ_STXUXVXWYXYZ!Y|΁~(Y}1Y ( ((( 0(EHD) %s: found %s on hardware address %s%s: hardware address %s claims %s%s: sending ARP announce (%d of %d), next in %d.00 seconds%s: sending ARP announce (%d of %d)send_arp: %m%s: searching for %s%s: checking for %s%s: sending ARP probe (%d of %d), next in %0.2f secondspipe: %mforking to backgroundfailed to notify parent: %mfailed to read child: %mforked to background, child pid %d%s: using static address %sSTATIC%s: using IPv4LL address %sIPV4LL%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUNDfcntl: %mhost does not support a monotonic clock - timing can skewmemory exhausted (xalloc %zu bytes)%s_%s=%smemory exhausted (xrealloc %zu bytes)memory exhausted (xstrdup)/var/run/dhcpcd.sock%s: deleting IP address %s/%ddel_address: %m%s: %s route to %s/%d%s: %s host route to %s%s: %s default route via %s%s: %s route to %s/%d via %s%s_%sROUTERADVERTinterface=%sreason=%spid=%difmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=trueif_down=falseif_up=falseif_down=trueprofile=%snew_ssid=%sNOCARRIERold_ssid=%svfork: %m%s: executing `%s', reason %sPATH=%sPATH=/usr/bin:/usr/sbin:/bin:/sbinwaitpid: %mwritev: %mremoving%s: forcing router %s through interface%s: router %s requires a host routechanging%s: add_route: %maddingdeleting%s: del_route: %m%s: adding IP address %s/%dadd_address: %mwrite_lease: %m - %s %s 0.0.0.0/0%d %d %02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x %d.%d.%d.%d%s: using Classless Static Routes (RFC3442)Duplicate address detected%s: writing lease `%s'%s: open `%s': %m%s: reading lease `%s'ip_addresssubnet_masksubnet_cidrbroadcast_addressnetwork_number%s_%s=ms_classless_static_routestime_offsettime_serversien116_name_serversdomain_name_serverslog_serverscookie_serverslpr_serversimpress_serversresource_location_servershost_nameboot_sizemerit_dumpdomain_nameswap_serverroot_pathextensions_pathip_forwardingnon_local_source_routingpolicy_filtermax_dgram_reassemblydefault_ip_ttlpath_mtu_aging_timeoutpath_mtu_plateau_tableinterface_mtuall_subnets_localperform_mask_discoverymask_supplierrouter_discoveryrouter_solicitation_addresstrailer_encapsulationarp_cache_timeoutieee802_3_encapsulationdefault_tcp_ttltcp_keepalive_intervaltcp_keepalive_garbagenis_domainnis_serversntp_serversvendor_encapsulated_optionsnetbios_name_serversnetbios_dd_servernetbios_node_typenetbios_scopefont_serversx_display_managerdhcp_requested_addressdhcp_lease_timedhcp_option_overloaddhcp_message_typedhcp_server_identifierdhcp_parameter_request_listdhcp_messagedhcp_max_message_sizedhcp_renewal_timedhcp_rebinding_timenisplus_domainnisplus_serverstftp_server_namebootfile_namemobile_ip_home_agentsmtp_serverpop_servernntp_serverwww_serverfinger_serverirc_serverstreettalk_serverstreettalk_directory_assistance_serveruser_classfqdn_namends_serversnds_tree_namends_contextbcms_controller_namesbcms_controller_addressclient_last_transaction_timeassociated_ipuap_serversnetinfo_server_addressnetinfo_server_tagdefault_urlsubnet_selectiondomain_searchsip_serversixrdreasonifmetricifwirelessinterface_orderallowing %d seconds for IPv4LL timeoutusage: dhcpcd [-dgknpqwxyADEGHJKLOTV] [-c script] [-f file] [-e var=val] [-h hostname] [-i classID ] [-l leasetime] [-m metric] [-o option] [-r ipaddr] [-s ipaddr] [-t timeout] [-u userclass] [-F none|ptr|both] [-I clientID] [-C hookscript] [-Q option] [-X ipaddr] get_duid: %m%s: using ClientID %s%s: using hwaddr %smanage_link: %mstop_control: %mviaNAK:%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s%s: no profile %s%s: selected profile %sPREINIT%s: open_socket: %m%s: open_udp_socket: %m%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.2f seconds%s: send_packet: %m%s: send_raw_packet: %mFAIL%s: releasing lease of %sRELEASE%s: broadcasting for a lease (requesting %s)%s: broadcasting for a lease%s: removing IP address %s/%d%s: waiting for 3rd party to configure IP address3RDPARTY%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: failed to renew, attempting to rebind%s: renewing lease of %s%s: removing interface%s: invalid UDP packet from %s%s: blacklisted DHCP packet from %s%s: server %s is not destination%s: packet greater than DHCP size from %s%s: bogus cookie from %s%s: wrong xid 0x%x (expecting 0x%x) from %s%s: xid 0x%x is not for hwaddr %sreject NAKreject DHCPreject invalid addressofferedignoring offer ofnot ACK or OFFERacknowledged%s: non whitelisted DHCP packet from %s%s: needs a clientid to configure%s: discarding expired leaseEXPIREreceived SIGINT, stoppingreceived SIGTERM, stoppingreceived SIGALRM, rebindingreceived SIGHUP, releasingreceived SIGUSR, reconfiguringreceived SIGPIPEreceived signal %d, but don't know what to do with it/etc/dhcpcd.conf--version5.5.4--getconfigfile--getinterfaces--listencontrol command: %sbc:de:f:gh:i:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLO:Q:S:TUVW:X:Z:handle_args: no interface%s: expiring for new hardware address%s: carrier_status: %m%s: carrier lost%s: carrier acquired%s: lease expired--helpdhcpcd 5.5.4 %s /var/run/dhcpcd%s%s.pidchdir `/': %mdumplease requires an interface/var/db/dhcpcd-%s.lease%s: no lease to dumpDUMPsending commands to master dhcpcd processsend OKfailed to send commandsopen_control: %mdhcpcd will not work correctly unless run as rootsending signal %d to pid %ddhcpcd not runningkill: %mwaiting for pid %d to exitpid %d failed to exitdhcpcd already running on pid %d (%s)/var/runmkdir `%s': %m/var/dbflock `%s': %mversion 5.5.4 startingstart_control: %minit_socket: %mopen_link_socket: %mipv6rs: %mno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: interface not found or invalidDISCOVERREQUESTDECLINEACK/etc/dhcpcd.duidnothing to dopoll: %m`%s' out of range`%s' is not a valid CIDR`%s' is not a valid IP addresshostname: %mhostname cannot begin with .vendorclassid: %mleasetime must be a positive valuemetric must be a positive valuetimeout must be a positive valueuserclass: %minvalid vendor formatvendor: %mvendor option should be between 1 and 254 inclusivereboot must be a positive valueskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientid: %mstatic assignment requiredip_address=subnet_mask=ms_classless_static_routes=all routes need a gatewayrouters=option `%s' does not take an IPv4 address/libexec/dhcpcd-run-hooks%s-%s:%s-%s:%s%s%s%s-%sfopen `%s': %mdhcpcd: option requires an argument -- %s dhcpcd: unknown option -- %s envreconfigurevendorclassidleasetimepersistentinformuserclassvendorwaitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionrequiredumpleasevariableswhitelistblacklistdenyinterfacesarpingfallbacknoipv6rs%s: probing for an IPv4LL address%s: IPv4LL %d second defence failed%s: defended IPv4LL address%s: failed to acquire an IPv4LL address%s: sending IPv6 Router Solicitation%s: sendmsg: %m%s: no IPv6 Routers available%s: %s: expired Router Advertisement%s: %s: expired option %drecvmsg: %mIPv6 RA packet too short from %sIPv6 RA did not contain index or hop limit from %sinvalid IPv6 type or code from %sRA recieved from non local IPv6 address %s%s: Router Advertisement from %s%s: Short option%s: zero length option%s: Option length exceeds message%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: invalid RDNSS address%s: invalid DNSSL optionreceived RA for unexpected interface from %srdnssdnsslra%d_fromra%d_%sra%d_prefix_lenra%d_prefix_vltimera%d_prefix_pltimera_count%.2x%s: up_interface: %m%s: unknown hardware family%s: if_init: %mfailed to write signal %d: %m/dev/bpfBPF version mismatch - recompileKernel is not configured to accept IPv6 RAsKernel is configured as a router, not a hostBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>jBjdaliKjdetiTjZj`jfjMljEjautoselectauto11a11b11gfh11na11ngEthernetetherTokenRingtokenFDDIIEEE802.11CARPmanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000baseT1000T1000BASE-THomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SXDB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27Mbpsfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmesh-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format stringssssssssssssssssssstttt(t0t4t?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkadd_new_key: bad type passed unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9<@DHLTX\`TdhlhtT|tcbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo dataseunknown error%s: generic terminal%s: hardcopy terminaltd9$;` ansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Z3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1h F[?4l{ OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4@BC'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN bsfwsvt25 $P @Pc[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4@BC'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN bsfxterm P @1 [%p1%dS[3;2~[2;2~[6;2~[5;2~zOE}ODOBOC OAOFOMOH[2~[6~[5~7 [%p1%dTOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>{@BC* N8ESMS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\R%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd[?1;2c [%i%d;%dR8kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~bsfAXfmemlslmemusm%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtffmodfmodfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check #+3;CScs@@ !1Aa  0@` inflate 1.2.3 Copyright 1995-2005 Mark Adler T<< <          deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly DT,b`l|,b1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@` L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c          0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfagnts`D8EDprop_string_append_cstring/usr/src/common/lib/libprop/prop_string.csrc != ((void *)0)_prop_object_externalize_append_char _prop_object_internalize_find_taglxdd܏poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist