R>R>R>R >R UX
0 U
; SR * K2[#$40I UG
0 D
; SA 0@00 Rk!: 0 0k13
U1 4 8
0
; S 0 <00l1 0p1 U
0
; S
0 S0
<0
0 e` V X (K~j]x
-40ML 00 0 ,0 % K ]
0-L @ 効 P M 0
0-L Pp @ 0h>
-L$M, @ R R
( Q@
040 000
08 0 p W#
$ 00 X 4 (0 0$ (0 , 00 0 S 0P R 01 0 M 0c S 40 ` V
4 0 R
40 p< $04p8 0$0(0 0(0, , 00 0 S 0P R 01 0 P$ 0 SD (08 , 8 00 0 S , S J b ^ h Q# b \
0 !$1 )
, R U
> Q 0b S 0 0 C Q Y'
, \ 0 , 0 u 00 0 S 04 ,0 $0 i4
i6 Q ^
Pe e, > 04
e e0 4 0 S $08 (0
0 00!411 d, 80 W $(0 0 0 S0PP0P0 0 S 0PP Pp 00 0!0 R!1 00Q 0; S0 P U-
0$! S) $ 0$1(`T ` R00 0 R 01 0 0@p0C 01
D @ R - W@ + R ` (Kx
p- PL U @
Un E ,P x10 00 ST
S
S, ` U0 $ 0
P@ H (P0"( 8#( $,$$!("(8#8"8S 0!1 A Kx
-L$M PY0 S
S
Q
[ 0 ( 0 pJp Wpp@ @ P
H `Pr
00pp40 5
0*8p 0 Si E X PD
0<00+8`40 400 0@0H0 0 P L00 M E 0 S 0 S
(0,0 0 0
@0 >Y @0 R
R@p5 \ @ @ @0 x Z [ v w @0p p` @0 j |f Z (@ [ v ( w @0 4 0 8 0 4 0 8
0 8 01 00 00
0D08#,#40#400000:#40:0 0 R
` 0 *
D < T< @0 a@0 P @0 < @0 0*
: 00 Y 00 S:
14!0b S5
0園@0
0 &? 0H"L2 $Y0 S000
S 04 8 <:#$ 0 #(#< 0 ? 0X"\2 Y0 S
S 4 00
a 000
0b 40
c 00 000
0b Y0 S
S 00$1 00 00`0 04 00
`Y00@ S
S!
0 0 , S ; 0N K PD ,0 0 0 C4 7 / (K(0 ( 0 尐 Y,
xx^^
-LM@ P` 0 0 < K<2 0 !@ SD H L" PB p G p X
4 0(K S0 0p1 4 K
0 P p , KW P,
HDP ` >? 0" 2 ? W
P
p0 P0 P CP ` #0 0 00 0 0 0T2 彲T2 @ T W
^ m0 @2 W X t 벊p 04 8 <00 S
S 0 0 # Y
" DH2
L cP 0a R L2 RD D0@2 00CT00P0p1=
S:0:p1`0` S0 [0 200001 00 0
S P 00000p1
1 0 S:0:
0
d1 0 S:0:<" G P Q` p r0 0 00 0 0 m <) *0 P@1 ` S0000 S000 0?00 P@* ?P!> 0"2 ? (K~x x ~~ ~|\R$^
-L M p @, K * PP 0 $
0( 0,00 R 04 8 < b Q D 0 S d ` Pn
00 0 S ` @
S @` @ `0 S
S: - V
%05ᲀẄEd d0 S d 0& TE
` 80 * & l ~벀 庄80 0 0P0 P099P0 T&
0` 貀Ẅ z T
0 0 S 0 S
P 50P 5P 0 S
律 00 0 * V04 04 E E ( P
0 0 2 V
t$ T
0 S 0 80 4
80 4 ! O P
ᙋ ᖋ V p T pp 0 0000 Q
""k! `0 j! ""h! 0 i!: 0=0T0t1 P 7 G 01 11141 100$1012,!尛 0` ? 0z 4 0 0 04 :
|2 0 S0;0:
\2 0 S080 ᾛ : S; $2 V
` P 2 T
p ^ P1 ; X 1 R 1 R0181 ! 0 100(10110 141h1 0?0!D0 S $!00! b R01$1,A x1 0+; 劫` > p 0!1 剫 @ c - 0 4
8 <000 0Q Z
Ɵ
M 0 哔 @ B L@ VP< ` 0 "2 U
(K ^$^x~ ~~~ 8
--LbM1[ O01KP 0 p00 .P0 ` 0 0 -D K 0
P 0#2 S
S
' P 0 R@
* P 40K P
40 Q@%@ : T
0 `ha 4#$4P!8#8b,0 P0T1 Q PtQ y P 0 R@
* P 40Kڏ P
40 Q@%@ : T
hQ 04
8 <
$( $(,r
$( $ ( ! $"(#,r
S
04 8 , 04 8 , 04 8 ,j
0 Sg
(0P0i,0 0 4 8
(T t 0, #21d1 d S 00 ^0 S
LP ` `< 0 !1 a8
d P `, x1 p1 C
P 0 R@@ Pd!40K= P
40dQ Q@@ 傺 T
KP ` 1> 0!1 2+
dap `F Vxa
0 S pL; R
PP 0D0 p@ mpQ <
T KdK P Hq T! R
Rd 0 4 0O?K0 0
`0
$0 d0h0 T K! Ku d K Kk 0 O K$H TKd0K`# pP 1[ D 卩j? 0!1 助0 dK$0 p pX! W R 1[嘁 圑 Hq h h> 0!1 id8 0 S
a0 S
0 `K4 8 U 0 4 8 I0K 1 1 Ă `$, ā"$ Ƞ("( ,8{ hqhpXq 0 `O K$<0 pPw 1[ @ j? 0!1 0 $0 pPZ 1[嘁 圑 Hq_ 6 1 ఁ崑1 l6 0 S2
!0 S. h1K S0K
X1 J1 . g C . ^ . Z 0 4 $#4K "$8("( #8 KD ]- XQ U
p0 R{ :Xa P(`a W
( P X z Hq嘁 圑 1[ y
d,0 T P1 P` T Q 0 00 0 S
' 0Q,`4
8 <Pc Ut
0#0##<00 4 S0C0ą#40ą ȓ ĕ ĕPE U ) T BF?
0! 1> ? !$1 =P0!
0 $0(0,1 R J?
0(!,1> ?0!41 0 `e$(, " "", $ RPeP%TP 0 V
R V?
0X!\1 ! j
b $(, Z@ LR ϧ R? 0H!L1 ͧ § ɧ
04 8 <!0b S[ 1 S5 0 $0(0,1 R+ P ` 堧> 0`!d1 `j 垧 0
0 $0(0,1 R
5 c S ^ OKA8 Z 0 > PR
0 4 8 <` ` 04
8 <000 0@ ; P7
P 04
8 <00" ]
腀 x]]] ~ ^x H? x$^~ ~~~ x 0 `4 P8 P<` `00 0 p S p U Hq嘁 圑 P ; S
,0daT0H P1 `
P 0 h4$l! l W
P 81 0 S
P
# 00 h!H11 7
KJ K FT P
P, T0 K| K 0K1 1 K$'KT!0K K hTa 0 x K0K1 `K{ 1h$'K0K`K K o0 49K1 ?
Ht!0 S H0` P 1 㘈 P,
t1H 0 0嬄 0 b ,
3S 80< R D P0 0 c00c S 00 S
ᢅ 0 ta00 '1
0 S8
KK ᜑ Hq+ 0 S
,0H 0 K K P1 P
p
00 0 S
S p X P !X p P U}
lah1cla v Hqa嘁 0圑 T X
X h0 S 0 00 0 S
P 5 P U h $ P
0 0 $4 R. T ^
^ 0
00 04 8 < P h
p 3 P
E P ` ĥn? 0!1 ť $4 R x1p! K 0D0K 0K ,0 + P p T6 0H1; S h6 ` 0?0 pa V
D0K 0 x!0 Ph 0
03
700 S
S 0 70 v 0% PT$7 0g g 0 X\ e@
10c S 1 03/D0 S`1
< R`!
t a b `! `a' V ``a + RL RI S
l!@ b RB $l$(, ^ R Q3
^0 4 P, S
x1 c R8 0p1@0l1,0 S
( ,n ^ 410c S 81 Q :; S `aHq P㜑 `! B
L1 S
P l R X) c0 X
0 00 cդ f 0圡^ = ?!1x| Ǥ !1X 0c X 0ð1 10h10
$
( , a R901 Sā5 04
8 < !01 c R 1ǃ 41 R 8 P : 0?0 0 SI
F Q R~ b a R Sr $!\ `0$1 圑 HqW.
!
0 , ? 0 I n; Q&
<0 S"
D S a Q 0!@ Q T S * Q! 0D1@1 @!,0 0@11
F Q
T P1;1d!P1 V G $
U0
Q U Pda `$! a01 |a 0b `? Q S 1 0D1@1; S
S dq aHq嘁 圑 H
04
8 <! b RL 4!0b SH ʘ
H! R
=| 1 S
H X(
0 4
8 < !0 c R ! 1 c R 1&똑@
> 0 S
0堮 80 刣 / HL" 刣 0 [4 8 <,10$101000 0 ; X@? Y
` _ PX? d \
p Px? ; Z 1 R 1 R01 81& H ^ &
į @0 0 0 A 0 `0` Sk1h1j1i1o ,0K [L1 S
/ c 04 8 <0#$0 #(#< 0, 1 Z
c j^ 1,0 p1 c> Pl) n嘁 圑 Hq尢F? 0! 1> , ? !$1 唡 堢 0 4 8 , 048<pc W ڄ! R
0#0##<00 4 S0C0ą#40ą ȓ ĕ ĕpG,0 W # ! ; l p 1 Y`F/ !. 1h|/ $! 1 O1X p"
0 $0(0,$1 R ` 1 0J > ?0!41(,; (Xa 0 4 8
|| 04 8 <0#0##<0,0 0g,0 04 S0g0#40 X 1
; S ,0 S
ᘁ 圑 Hq j P ܡ V? 0X!\1 ܡb 1$! 0c0b , $(,0 p W 4 忡R? 0H!L1 弡,0 Wr ) 孡,> ?P!T19 嬡 ?
;
S< 0 $0(0,$10c S1 0 P 4 8 40 8 00 4
8 4 0 8
00 4 #$40#4 004#$40#40b 1aPq S㘁 圑 Hq 0 $0(0,$1 R 000\8 1 H `d1 (嘁 a 圑 Pq Hq5P> ?P!T1 4P l~ ,0P 0n,0 Hqa嘁 圑 D0 S
04 8 } !@ 2
; S/ S
S S ;0C S% $RR0RRR 0 00 0 S4
P0
0 0 04
8 <00 ꘑ ,00,0 04 8 <, 0 0 0000 0
뜡 Z
+ ꜑ p Hq圑 \
V| T| L P P T0 $0(0,$1 R ᳑ 000$10$1(K
p- L0
0' S ( } P
T@P ` > 0!1 0q3 px
-a @L P zp
q ? 0(",2 *h R : S3
00@!0 S+ *$a 墜"> 0 "$2 壜 e: 08#8:1 S0000 S000 0?00 t`p vv? 0!1 w j P
{ 0 5 ᑢ0 k݅8xP~|\R$^`8 8#4`# /$0H 0 ! 0 0 0 /ᰠ^qq
-0L @ !@0 !!
0-D0LHA T ʀ0 P ! P0 !! 0谠^ 0 R 0 S
4 0
D R 0 /
p-LTaXQ @ P
l KFQ\1Q+ UP1P0a U
P x UxP408 q+; R0Ҳ;p]|\$^
-LMP @ U4 (p 0 S(p400 P p Qx
Q/P U 0 SP 0 S
x ` R
R
? ` r ( < U `P
V(0`0 V
(` 0? P \
1D S
\ `
V
Q ROi223K :iF # A U
S<
i? ` 0 z P<0
i6 V3
p0 S t0 S x0s 0 K| 01 S 0 _ P
1 S
10 Z
@ R <
R
Z
@0 S <0
S <
i U P
9 P V
0 S
S f& PZ@ J;`0e Z
01 Q
` S0!t0 ;t Pe
U
P!P \ P.
8+t P8%85<#t P<% R0 p 0p0 0`0 <
P
0 S
L1 Px 1D
` % 0X0K 0 W0KV KUK
@
j1 T ` `0 0 S
`X K 0 ` 0 R# !
R
` $X0KP (4 t1 0c 0 r lo ` 0 ` D! R ! D1h0 SH
h `XK! P 0!
@h 0 I 0PD0 !0 !Q
@h` 1 $ `F ( ( P V@`
@`0` 90:0&` p V2
` V 00 R 0 S
0 0 0/ !410c S/h d 0 0 0 0 hK 0 0 0 0 0 0 hK 0 0l1 $ "z PP
T1 00 S 1 X 0 &D P0
< 0$ $ 8P @ PH L00
0 X 00 0
1 S
1! R!0 1&
0崁1" 1 S $ ~~\\~~ ~
+]?] ~(~ x$^f `~ Rx4\ Q b 01 Qʸa0
3S 80< R
D P0 b00l 0 b,0c 0 V 0 0u 000 0Vy P [ \ 傗0
0
0 !00c S 0 0 1 Z Xy PP
1 00 Sn X ] PD
0<00+8P40 400 0@0H0 0 P L00 R `v x 0 0 P
Ph h0 0 h (0 S X p R p ; S 3 0 S
0
1 C S! P3 0108p0 +
V !410c S p 00s 03 V0 S
ۖ? 0X"\2 ؖ p 0p0 0800倠@0| 5
d 4 0 8 0 000 V 8 P4
N 4 0 8 0 $E 4 0 8
0 ` Q
` XKV` 0 10 0 0
0#\ \ i!8 20 Q$1 0c QQ28 #,#40#40! 10c S01
ڜ
S0!8#,#40#40x R
R5 0000 S<4 ` 0,00'
8#,#4 8$0 #( R 000 R
040<,0 `,00
8#,#4 8 $#( R,B B "$ 0 S
8 1 PE !| 0 1 Q 140a Q 1 41L1 S 7 P! 0 L100 00 40
P" | Q
!41 R !0 R
8 P
j +7
0?0U 14!0 b R41Ő0x \(
\> (<((( Q
X000pQ0001 P.
p00( h00Р Z
~ PD
h p
00"42 U P
P P
/PA U2 U ; S 4: P P| Q0`f`0 C
\: `* 0< 1 X|: ȁ 0 0 00
@0 0@ D0: R $100! b R01$1x10
00 0 S
!4; RX
\ T P (P (KP`41 S 00 U0 0 XP; 0 00
-p0`! 0L @ RP' 0 0 R " f P
1 W01 0P`0 0 P
0 R01 p p101 01 ~$~ ~
-40ML 00 0 0 K J]0 /101 /
-L,M P
AB A AB S @@ Q@ T H Q
< Q
`
P J4 i \ 1 QT0 `p , K 0 K,00 c#!c!b8"8#4b4# f R, 00 i R c RP K! T @D BT
@ P
2j \( K( $0 T0@ TpALK w p10c S1q S\ $
( & @Pf
q_ 0a SL `0b S @D 0a S0b S 1T @0C1 0 0C 00 R0010 , 0 p g Rpp% S 0` f R`` @ f Q 0g S 0 P#
0c Q000` f R`` @ T 0b S 0 @P
0! c R1T Y(K ~ ~$~
- 0@L4
P`8 < d R@! 00d S ʜ1 px 0C1 0 0C 00 R010 吙
00d S 0 @0d S @ Q$~
0-L @PP 1H 0C1 0 0C 00 R010 h Q0$~ 0 / l \ l \
0 0c / l P /
-LM+; @ R 0`;H $
( ,a Q& 0 p PK; p%Lq0
0 0 0 c P `` 1 0c !0,6&08a00 41 b<1 R<181% 0 0; 08!5; 04
8 U
0 0#2 S
S < (0<0 q @P
g X PD
0<00+8@40 400 0@0H0 0 P L00 o } ` pPD p `(P P n k 0 `"" R
Rp `"
n ` p < , D
H ( X< R P < 0H R n P1 X wq PPX'
5< 000 SH l5 X T0 yD PT0X
< 0$ $ 8P @ PH L00 ) zn xn Y
Y P. `0 00 0P0(4
0(8(0 p8K 0 X T0 T0 X 0(P0 0 4 0#4$ "$ 0 0D0 P g 4 0 8 0 L ^ 4 0 8
0 0 0 0 D , Z@ i1R#@ @ L3 S08#,#40#40 00P0 0< Y0D 0(0
Y] " T0 X %X Ƞ,x,̠Č
,Ġ T0 <0px'<'tp2p'tp 009 0 ( X X Z Ƞ,<,ă,Ġ
P U
4 ( PD 1 00 P 00P0%<01 P 0 S
o
P%4 P0%8%\0P Z
R( P( R
4 Y
Y
Z
0
1 S; 0 (Koc. 0 (Ko 7 / (K0 0 X 0 Yn
Y Pp` nL0 0 000< wr < H0rr @m @ ^^^~0 ,,," R
"2 R S 0 "`"d!!B! R T0 R D <0 !8 !0 , !!< " /~P~T~X~\~
-0ML z0 00 0~ 0 0 ; R< p0 0<0 S ` \ X !! E &00 K h' ~腀U]0 ]]RxRx
-L pPX1 @PP
H~/G `0`00a1$0a p1a( ` i V` W
W P(p 0 @ 0X00P 0 4 PD g @_ 0P1h0 d 00Ct1 P U b @ ~\^^xw
0- PL R00 0 R 01 0 Jl 8 @ T @0
-p @` WL(4 V(4 04!20b!0? P 00 Sh
PPe
0 08`
@ T0 T儠
Q
⪠iᄐ删倐
X,匠
Q
⪠iጐ吠
0 < P
| 00 t0 0b S R
|0 P (
|
00b | 0 ' Y0:0 , u P
k 000 W:0
0 0& , V
p P` p Y(0 0( ,0 Zlp P( `` P U40P i = z x8
-P0L U(P S(P @p U(
;` S
0;: 0 0 0 0 0 $0 < W (00 SxGx tk xf 0 /
-0帠L u` @p 0 S
S P U
P
P
Ջ0 0 0 ]0:0J@
T0 mAu8腀x
- @L0 S
00
-L(M0 @` SPc 0 S` P^ P\
0@ S|1\ P
PW
h1 0 SP
UQ
0 Sp?
( 0 R * T @ 0 0 0\>' 0000 0 (p @@ @$`,4Pݵ>Ο 0 0 0 0 (p D @@ @$`,04PƵD= 0 0 0 0 0D (p @@ @$`,4P孵d= 0X= (p0 0 0@= 00 @ @$`,0`4P啵= 0 0 0< 00000(p @@ @$`,4P~< 0 0 0< 0"0000(p @@ @$`,4Pgh< 0 0 0P< 00000(p @@ @$`,4PP< 0 0 0; 00(p @@ @$`,04P:; 0 0 0; 00000(p @@ @$`,4P#p; 0 0 0X; 0 0000(p @@ @$`,4P < 0; 0 0
000 ,0K (p @@ @ @$`,4P00:, 0 0 0000 80K (p @@ @ @$`,4P۴`:, 0 0 0D:D 00$08 K0 @@ @(PĴ :D 0 :0 0 00 $08 K0 D @ @(P嬴9 0 0 09 0 0000(p @@ @$`,4P啴`9 D0 0 0H9 0 00(p @@ @$`,4P~ 9 0 0 08 0
0000(p @@ @$`,4Pg8 0 0 08 00000(p @@ @$`,4PPd8 0 0 0L8 00000(p @@ @$`,4P98 0 0 07 00000(p @@ @$`,4P"7 07 (p0 0 07 00000 @ @$`,4P d7 0L7 (p0 0 0<7 00000 @ @$`,4P7 06 (p0 0 06 00000 @ @$`,4P׳
< 06 0 0 0000 0 (p @@ @ @$`,4P忳P6 0 0 086 00000(p @@ @$`,4P娳5 0 0 05 00000(p @@ @$`,4P味5 0 0 05 00000(p @@ @$`,4PzT5 0 0 0<5 00000(p @@ @$`,4Pc00%4 0 0 0000 0 (p @ @ `$`,4PJ4 0 0 04 0 0000(p @@ @$`,4P3< 0D4 <4 0 0 0$4 00000(p @ @$`,4P3#0 0 03 00000(p @ @$`,4P3 0 0 03 00000(p @@ @$`,4PD3 0 0 0,3 00000(p @@ @$`,4PӲ2 0 0 02 00000(p @@ @$`,4P弲2 0 0 02 00000(p @@ @$`,4P奲H2 0 0 002 00000(p @@ @$`,4P厲1 0 0 01 00000(p @@ @$`,4Pw001, 0 04K 0000 0 (pD @@ @ @$`,4P\! 0Dr I]r]~z]d~]]S~]~]~]D~]H~]~]~]b]]w]S]~]~]~ ]~]~ ]~*]ST~3]X~=]\~E]L] xX]~d]`~q]~ ] d]~"]S腀]P~]~]~]~]~]~]~] ~](~~] ~] ~]$~D]R]~*]R]~]~ ]~)]~& ]~z]~.]~5],~F]0~4~ XS]=b]<~ 00 00$0 0 @@ @(Pӱ0 D0 0 0 1 00$0 0 @@ @(P徱 0 0P1 4 0
000 ,0K (p @@ @$`,8P奱1 0 0 01 4 0
000 ,0K (p @@ @$`,8P匱1 0 0 02 4 0
000 ,0K (p @@ @$`,8Ps< 0T2 0 0 0l2 4 0
000 ,0K (p @@ @$`,8PX< 02 2 0 0 0 000 0 (p @ @ @$`,4P? 3 0 0 0$3 00000(p @@ @$`,4P(`3 h3 0 0 0!000 0 (p @ @ @$`,4P3 0 0 03 00000(p @@ `$`,4P004 , 0 00K 0000 0 (pD @@ @ @$`,4Pް0$ 0D 04 00$0 0 @@ @(Pɰ4 D0 0 04 00$0 0 @@ @(P崰005 , 0 0 0000 <0K (p @@ @ @$`,4P困<% 0 05 < K 00$00 @@ @(P凰5 0 0 05 < K 00$00 @@ @(Ps6 0 0 0 6 < K 00$00 @@ @(P_L6 0 0 0d6 < K 00$00 @@ @(PK6 0 0 06 < K 00$00 @@ @(P7006 , 0 0@K 0000 0 (pD @@ @ @$`,4P D7 D'
WppP7 P' D0 0 00$0 0 @ p @(P7 , 0 0 07 D 00$0 0 @@ @(P(K
-LM 0 `P0 @ W Z p
Z 0 0 ;LL
k S R 06` T
Z
Z`{ p k R @ S @@ VU
V `e I Y ` #SL#S#S$S#S#S$S 0Km `PU 00 S0000N 0Km `PI 00 SC ڼ+ S;B > ,K m `P; ,0 S14
,K m `P0 ,0 S1)
,K m `P% ,0 S1
,K m `P ,0 S
1 Y
Y
00 ;(K0! l ` ` *` (KJ]ĕ\
- 0L @0 P0 S
0 S 1 }s `P= 1 U;10;0
U/`2 `P, Xp
嗼 `P" p W
p P 0; ` 1 XP01
W
17`PQ d~腀
-;L @ S 0&S0&S0&SD&SD&SL&S 0; @ 0 0; T5
; S2 0 S 0 S
( P
o ; S
1 S"
S 0 S
\0 0
M P @ 0 S
,0 0
@ P @ $^0~4~
0-0L @ S(P P U(P; S 0h1
Q 0h o r @P
0
-LM 0 \0 @ 0 S
S
0(Ko
0(KoI40 0 8 0, 8 \40! HF c40 S
S $ \ ᄤ9 c 5 c \ 8 40 0 s 8K
S
S p ` ` p , uV V W \ \H W PP V P \ < )S,S$*S*S*Sd.S,S,S,S,S -S.S -S,-S-S8.Sd.S.S W V8/ P+ 1 (
1 Sx01# S
S.
'
᮹ P `0 S d0 S h0s0
0 0 W
Q P V
Q ፹ P 0; W
Q P
V
Q n P
P p0 S t0 S x0s0
0 0 X z P 3#
W
V
ᆸ~ 0j1j1
S Q Bm y` p 0 y0;2` 0?0 4 Dn N P z 궁w
X
0 S X p i 5>t, e X
0 S
8 X 8 X P T0 S 1@ J
1 G d1 D #F
000e d10#d1<
8 0 c0 0c R00 s qX 7, X p 0 0100I 0 0 W
V
Ḳ" W
V
òP [- , / (K8腀 ~ x$^T]
-LM Q `@f R
Ra ! p! P! |! x! pt! Pp! l!匀K ` 0 0 ( K"\ 0 0r 03 P0 S/ ,0S+ *
B R& h0Sp0S0S0S0S0S0S0S0S0S0S0S0S0S0S0S0S0Sh0Sp0S0S0S S W S
S Y S S0 0 (Kh^\^l^p^H^<^L^P^
- L hI] \ ]_] / Q / 0 S b 0B# 887 00 0000C0 /!0 0
P / /%0 $0
0 S Q 0cC1D
0 S Q 0cC1 / / /Nk(%0 0$ 0"̃ \ s
4## R / L## R S / / /$ 0 4 L P / P P P
40 P< /$0 P /0 P /~~~
- PLM
P/ $0
L 4 `, s P*+
0
0 s 0P
s| , 80 s `P p80
s80 s ,0, I v "@H 4 0 0 00 @H0 X*1 $0p 4 0@L s# 0$0|00$0 0 0 #! B? 01$0 0 S$0
#! ? 01$0 P @l 0@ (Pp,0 %0 `00%0` 0 R! ! 80 .80 `, Y ` %p W `(P (K<@<~d]ԕ\]] ~4l
0-0L @ T
0 0 S0 Q@ ڴ0 0 S 0 Q@@ P
P P
x0 R d0
T cP P0$ ( P 00 P@: 00!0 [ P1 0 % 0C0 0 }n0 0 `ᱪ ? 0/T0# 0 =9C =C0 0 0 S0 S@ @ ?B
-LDM S0 0 @q0P`l0 , Y
X
l H0I 00 0 W88 0090
00q 0pcGsp 0887 00p0 W
6[ 776K6[0"8
088S2 R*0 7880 0 $!Q `%`&a(Koԕ\
-LM@ `|p 0 P, 20 0 @x {0 @o!0 0!0Ԇ
-LM@ `p 0 2"@ P <0 @0!D0#H0#,0#00#40#80# 0B E0 @9!0 0!0Ԇ
p-L@ ` PPe
Pd
1 V 0$10
VT % 0 ` 0 \ , $"$"( ! ! ! ( ! ! ! ! ! (0810$0f- <`p0 ,``0 4 2$"(01 !0 00!0(01 !0 00!0P0 !0 00!0(0810$0` 9 3 p p p
-LdM PP
$0 }
8@7
! $ 100 100 | 2" 0 # ,p0 `7 @P]
< 80 2!0" 01!0!0 001!0!0,p 0!0|0$0? L t K! $ 100 100 20 0 | 帒b p @P"
< 8X<80K ,H0K !0 b01!0!0 帒01!0!0 02!0|0$0$00$0(K
-L|M@pK `P` h00 (0K #\0 0
0 0py 300 00 P Y 00T S
L S
,
, S P 00, (K0~4~
- L ŵ g $00$00$$LLLLtttt H0 0
d P ,0
h[ NS40~4~$0H 0 ! 0 0 0 /ᰠ^qq
-0L @ !@0 !!
0-D0LHA T ʀ0 P ! P0 !! 0谠^ Q 0@ /; / / Q0
!88 S0 00C0C0C Q0C 0C3+C? R 0 /
-L|MpK@ `P` ,0K\0 0 ,0 0
0 0py 300 00 P Y ,(K~
p-dL PH@ d V0 c?$ (0 1 R @ 0 @ L1B @@ V W pT
0-HP @L< V 1 S0 1 0 R 0hVT
0-HP @L< V0 S00 0 R 0hVT
- -L M0 0 0 0yy K
-H1L P @ 4` p 0 000P1~ x P Pz P U D
P1 A b/PPPe x 1P` / 000b? PPP P PW U "
Q
U
<` p 0 000P1
xy P
;
U
P
b?0 S/
` p 0 000P1 x[ P b?0 ? R _S_S_S_S_S_S_S S0C H!B 0 0 00 0b/0 P X^]h\
0-0L @
P1P5P1P1
P R @
0 S 00 T 0 S
T 0 S @^ < T@@?@ 0h50
0-L P@ + ( %@D T0
0-L@W P
0 SPL0
S @0^@0H 4 U 0( 0 @U 0 0 0h\x\TU ꈗ\
-x1L S
3/
0-,P @L jU0 <0 0hUT
- 1L @ R ʘ $0 P
-LM @Z P
_@` PK
r S = P p` c D . P p0!:00 0 K
-LMP1! P@ Rl PW
!` V
B/E B R !P ? RE n ; @ J
7F 0hFS C b?* c/ P$pK`P
$ P P15P10:0b? `a V` 8`VZ ` .{ W
0
:0\ ' 0 B K h\] S / 0 s /
-
@Ll} B1 Q 2 Q00 1?0~0B?0 P !?0~ B Q?0 P 00? ~0B0Q?01
-LMDKp @ `K |K
RT0 S0
T
, KP @ K `Kx ` @P p x $ jT K K K (KT
p- P@L` ` T0P`@P @00 ;P$ JT 0 0 S
pT~
-LMp 0 0@` T7
@ T6
P U@% 3 T
0 S * S S S Q
0 S
P
T 0 S
T
@|P U X
H03
$ @3dP 夠K ⩕ 0 0 w "0
y
. T
x =0
"y
~S Pp6 S0 0 tS0 R$0 S
S 0
0d H0"ty 0
d0!H0ly
0 S 1 Q 0 0 SQ U0@ K 4K0 P q S,0l!N=0 S,0
4 K
=9C4 0 =C,0 80$!N=0 S80
@ K
=9C@ < =C80 0t0⨅ S
S S PP
SD0 0DTV%U P, @0 8 0d @K d T 40Px ᄈ(K ];]X]x]]-]]]]e]?B ' ]
p-jL @P ` R0 L1B @
T
A > A @ V S pT
0- @ 0 fP QL D D0 S
0 $ P f?0 U 0]T
-a L0 R @PpL
U
0 P P0 S $^
0-LP @ P
0 0;]
-1LM YRWRؑe P21 `c`oo S `f ``
0 0a0?o Q 0c 0 sY
!` F12g0 "!10C S1 !1 R10!1 VPq 0 0p0 fR K0! R K
XR U
: U
X X
Z ^ Z
P
l< Q@ T( 6R 0 3R(K RP T~
p-0@L P` Q ? P R pT
p- @Lx QP 6/ 0 `P 0 S ``
0 LaBi
xa V Q pT
p-PL @ `Q U
0P @ R00 ` V(P
0 00 00 `P0C0 0 ` L1B
`` ` ` Q pT
-0L # P
-LtM␡p Px @ ` \XQ0 L!B @
4Q < ( 3\0 ! Q) l0 &
R#
P!
# P 1 0 S ptQ roQ !Q 傁 gQ`Qd2 D^Qb^ P! p
Rd U d S`1d`#pK I 0PR P`P> H1 p
!?0㵅 pU 1p f P! P1`PE 0
S$ d&Q6 l s 0Pp`00 ? 0`Pg Ppp Q댠J P1 0
S U 8 P0 U S p p0PP | P #0
S ` P= <
H pP# 0 0 P0 S*
(KT^ $^h\ X
0-HP @L sP 0 000 @@0 0hPT~@
- @L8 [P40, B R 00 hPT@~
0-LvcP @ h
0 ( 4 @ { ` l x q
0 0 ⡧⟧ 0111111111111 0aS~]]]]]]
0-1 @L OO 01111111111111 S
!1 R 101! "P0P P E 7
A @ ? x = ( 4 ` l HF v 0hb T~
-LHM O x ㈆B 2 (`K @ @&0 0P p 0 0 P$P @@ @ @(p2 ;0 0 0 0 P$P( @@ @ @,p<2 0 0 0$2 0 0$P(,P @@ @0p˙1 0 0 01 0 0,< $P( @@ @0p崙1 0 0 01 00,00$P( @@ @0p垙H1 0 0 001 00$P( @@ @,0p剙0(`K@&,K0 0 0P$PP
0 @@ @ @(P,pq'> 00 <00 0 0 0t0
000K @ @$P(pZ(KT8,nSDZS"e][]]]L]X]D]0\]|[S~ B12 "g0 / !1 S! 1 0 ! 0 ~D
- @L $ㆥ0
( h
0-L @P
T Q
@ Q
t0 0 0>;0
0 <0SP Q
x $0hM0
0-L P @P eN N 0T
-L @
$ UN N T
0- @Lp ENl0 R f? P< f?C000~N U
0 -N W 0T@^
0- PL\ @ N0 T00 LA00BI B [N 0 WN 0T
0- @PL N U0
@
LQBY " N0 8N 0 00 2 .N 0T
-PL p@
'
xP ` 0 \00\0 PP ` 0 $00$0,P ` 0 $DQ)
00t Q
`
S
0p
@ W <0 S `H <> L14
0 T` S` 0000? V$ 0 ! P1
T0 S D1
a P
x P 0 00L1
1 S
3/ P0000 p 9|0 /
b1 W W
^ ?09 c1 W W
P15 v -T 00 S
P15P1N ,
\1 W W ]1 W W
X W \1 W W ^1 W
W
X @
a1 W W
0l <0 N `1 W `1 W W
W
p
p
W @
p
p < S W1 W W
0 S
Y1 W( W&
3 0 R `
v 0 S
Q
43 0>;0 I
X1 W4 W` / Q P 0
P
p
F p 0
P P
r @
7 p 0
P P
X
@
R
t Z1 W W
l f1 W W
]b 0T 0 R
1 RV R xN ` c PH Z [ $@
W
T1 W
U1 W
V1 W
W
$1 @q @ !0 Sb/ c? 0
:0/ `bo ᶠT1 W W
`
JhF V`# K`F V0
k `!a1 R P15P10<0 m; ` D0L h\
0-L MP10K2P10 @0PK90 0 0 00
P090K0
-P1L @
P1T 0 d1 P e1 S
p-dL @HP H mK V $ ( $ K(/0$ R0pT
-`L @ pRKAP
P P
1 RP
0 L1B P
U Q
X
{K T
0-L1 @L;P@
!K > @ gK 0T
-L@M @T X\ T
0@ <0 T5Tu P\!8P PP aHP 8JP
L1 Q- l *
S'
\y P l0 1 0 S ,K$ (K$ J :{4 K|J [ dK X
X [ e1d! SL 0 SW y R 0D !
SN So H Q @ Kݛ DPH 5 P S @ KԛDP. 4 KЛ4K @0K
P R0D% SO H R @ K⽛0DPH0 4 Kⷛ4K @0K
P R0D %80, d cj g P UP ,
_ P T0 S@ L " 0 LB
H 0 U0
\
J# 0( \Jd1# X S
# X X?
4J- `
0 D XPT`D _ Y Y
`
P P
`$J Q Z
dJ X
0 _J- T1 Y Y
U% hB P 0 S
U0
Y
T1 Y
U1 Y
V1 Y0 D QD0
Y 0L d h0 w Pd h0 I0 !
0 S D1
` P
x! P 0 00OL1
1 S
3/ P000( J (K@ V
갠^$^T
-LKM< Z
Q @Pp 0C Q. *< Q+
< Q'
0C <0 S < Q
0C < QJ0 t< Q
l0C QF :0 Q0 H< Q
<< U: 0<0 S5 $ kI I, eI y; I \I+ `P
I +\1 !1 P l
S
1 0 S
l0
-x P
T I\; U
8 P; U
D; U
Q0C U~
0 U
0C U : U
0 U
0C U : U
: U
0 UR
0C Uy T : U
0C Uq : U
0 Uj D: UV
t: U
h: U
: U
T: UX H: U
:9 UP ; 9 U?
0C U
0 U
0C UB 7 9 U1
9 U: 90 S5 H 0 S0000d Ik X H * @ H0 0 H 00c 0 H0; P UPPH 0 S 9)
0 S
S
0H0H S`
PP `
0d0 D0`0 P \ K `P
!x `x Vh8 @ 0 T P8 ` ` Q , 00 0 { 0 0 ` 7 IH0 S
! Rh l0 e
0 S0 0c \7 7H1 0 RX l0 U
0 S0 0 7 'H1 0 SH l E
$0 0X HL19L1XH0;R060 S
; `P 6 U H _lIH0, |1 S
3/ `P{ 0L1$0h1(0l1(0 S QG46 U#
P1#
2P1 P@` H HK HK P1 2P1 0UD10H1P1 0;; 0P1 20P1 9G, GQ 0 0 P P`%
0 P
܀D0, 0 3/0 3/ `P
0 0 3/, P, ,mG0 P!
P!<0%P! P
1 0 R l0
0 (03/GG0 <0 Ip3 D p ~T
-`L!p : : #6QL, CA@
0@ @
R
0
P R 0@
Q0 S @
0@
0T 0
0r 03
A P0 R P1 000 S@
0 @
T Q
c X
,^ C ~T
-LxMP ** "& < @
( x
`pK 0 \zC0@ o
0 g
T0 Sh X d Q1d#0b X!C ]< Pw ]C0@ U
X`
` PH Q
T 0 R@ ` } V X0 d Y 1d#XC 1< PK 81C0@ )
` P!T0 b P " S00 S
T bC0 (03/ CH X Y 0 0 0 S
0 Z# @4 0 ;C Yp
0 3C (K ~T
-@"LhM :: #6q0 ` SPt
B ⤠0@ *
P
P X
0P0 C ; PP^ @ \
Q , Q,#;U
Q X
0Q0DB ; PG R
P>
Y;
PP
6 P%
B : P B U 0@ PP d Rd # : PP ڌ B r; Pp sB U 0@ PP xpK 0u 03 R 0 S P #P B (K ~T
p- ` PQ": :P#6p L A00000P0 0P0
, $4 s
$ phj p ~
- @L": :#6H 0 0 $ 000P0 hL ~
0-X0 PQL 0 A
D B T
0 S
xA@t @3 @ U
CB 0 ~`
-!L @0 P6 P P kk 0 S SPP
`a T pHA410 U TP $B T a U !Q pP B
TP 0a V& T T p ,5
3Y x A 0 X
` A (
& ThT 0 qA ~]]` :
:p-@ #FL PP p0p 0a @qAx1 S
P AP D0< x1A0 003/P1;P1PPPQP p ~TS
0-8P Q @L@
$ LA0 T@ @A 0 ~`
- @L( A T@
T0 ` ~
p-0L @ s` r
#*0*` "&\0 QA
$ N
, $4 F
phTApT ~
-`,$LMp :: #6Q4 V @ 0 S
0
P0 @0P0P1;
P1
0
P0 @0P0P1;P1 ? Pr
d3 Rn \3 V<
;1 V
@3 VH
83 V` X ,3 V9
K0 VY 3 V 0C V/ * 3 VO 20 SJ & 0 S0 0 0 Y
0
0 0 S0
00 00 0t S0 0 00@ H}@x 4@ P0E> Sz q@P1 S 0 00 a@0 0@0 $
0A>A0BQ3 \ 0 0 0 0 S 00 000C S00 0p 0
-L @pv` " Q P%Pa UP Ķ0pe`0e0 0P 0 P U0 0 W 0 S0
S0 0D h
p- @L`K QP2
V 0 PPc U PPc) \ P0l P S
e R 0 Sࠡ ! BB.A.A B^"
0P S
e R
p
0- @LP 0 U 00 0 S % c R 0bPb 0 S0 0 U Q0 S 0 00h
p-L@ `0 P S
S 0 S d P
p00 00 ` Q
c 1
R S0C>! >0 3
R S0C>! >0 300 0000 S000 p]
-LM `Q @ `Z ڎ0 , SR
S
0 S @c PE 00 0p< 0 P SP`P` UP Ƶ0 S
A A \!A"!' *J
" b 00 \:0 `e0000 S000 V 0 R, % ]@- 0 P P Q
@ P
P \
0 0c S@@ 10CB>A>A0B\3
L@-0l S 0
0 \
@0d S@@ 10CB>A>A0B\3 , L
0- @L R P
B Q A Q P
0c S 10CB>A>A0BQ3 \ R 0
0-L P@ p040\1 1l
10 P
6 /ᰠ^@- l@
\ @ @
-L@ 0l
P
x Q
Q d0 << 1! Rl @@ l 00 {< h @ @ at
p-`h0PL\1 1l
10 @ T
4h 0 P P p谠^
p-`h0PL\1 1l
10 @ T
4G 0a P P p谠^
0-L0P 1l
10 @ T
,(
P P 0
-LM @( pRP0 , 0 "
0 S0 `0 S
/000 pK X0 S p 8 ppw p38p`K P0 ` Q
0 0܀K 1 P0
V
Q 10
p0 S t0 S x0 S |0 S
80 0 S 0 S 0s P0 `0 S d0 S h0 S l0 S s `0 0,0K000K0 40⤔, ` Q pp W8
9 P0 1 d0 S- h0 S* lp W' 4 K⻳0S0K40T`K P0 TKuKU(0 4!00K 00ᦝ 0P
D`K 0 E0 #K 㘳 `` V 00 S10
j 4 S; (0KpK 00@ K P0 U ו P0 "
5`@ I p0 S t0 S x0 S |0 S90
s P0
l(d0 4``p0 0 X(
3S 8 <0 S0D 0 8 0b 0 S : 00i0000 00 53 P U
0 (00 0(0 70 (" "$ "$ X
X L " "", ` D 4 P R
4D 0 D
0c(#("$c4" R R R R
Q Q Q Q
!#8< 0 `00000 8#8"8S 03 0 0 02 0 0$`4 @@ @(p,04P'> 02 40 0 02 0 0$`0 @@ @(p,4P'> 0T2 40 0 0<2 0 0 04 $` @@ @(p,4P001 01 $`0 0 01 00000 @ @(p,4Pǂ1 1 0 0 0 0$`0` @ @ @(p,4P専H1 0 0 0000 ,0K $` @@ @ @(p,4P噂04 00 `0 0 00$0, K0 @ @ `(P僂0'. 004 0 0 00$0 , K0 @ @ `(Pl(KI] ][]z]T^]X^ d](~"]ShD]@S`]]=O]=O
-L M0 @` SPQ 0 SN PL 0@ S@qL PI
P
,1 0 S$q > q U?
0 R ,
( Q * T. * 0K 8 40 40 0, T8 3["[ 0 000p 0 P 83["[ 0 8
0 p (Kp E (\Sh<#\
-LM 0 @p0` & X P
X/`" 0 S
0 S
` T`
0 @ S*` $K)@ `P $ K
-LM Q @P ` 0o} Q
B *7劈 w᪈ l7 Q CG V
Q SXSSS8SSS SS$STSSSSSdStSSSSSS Vu ` Xn 1 1 E P 0 c @
; Y p0 SU t0 SR x0 SO |0 SL
ᢍ q XB lB ? p0 S t0 S x0 S |0 S92
m K ` U1 01O )B Y @ 0 @ B T ]- 8 W
, U
, - 8hT^X^h]
p-4@ PL 7MP ` 0 ph6Md$0H 0 ! 0 0 0 /ᰠ^qq
-0L @ !@0 !!
0-D0LHA T ʀ0 P ! P0 !! 0谠^ 8#8 8#!8#8!Q A"A"! /1M / gA
-(0 @L( ( 0M
X hWA
-LMp @S `$ <
00 0 S7 Y- PP2
X
P 00 S (01
$K 0Y + $0 B P + $ P
+ 1P `0 1<@ L80 08 <0 L K d
- P PL$M PP @p`@0 P 0 S 0 S 8K0 H P 0岐ᲀ0<0 0 S
T] 00 SY 2 P @Q 0 SM 4 SJ `0 S d0 S h0 S l0 S
`
j P8 0 S 0 S 0s P0 + p0 S t0 S x0 S |0 S
p 8K K P 4 S 80 S 40 S 00s P0 (0@ < 9(0P1*
@0 T% 0`00 8K 0 冈 PP p@ K80
08 <0 K04 PP
(0@ <
P (Kh
-LM @S`p$ >
00 0 S
S7 [, PP1
X
L 00 S 1
$K 0` * $0#A P * $ P
* 1P `0 1<@ K00 00 40 K K
-L M00 00 0 0 000000 0 K 萈
p-L@ 1
\)
, @P ` _K0 0 0 ,x Q
$ Q
f P
X@P ` EK0 0 0 FK p p p Q(~d
Qp-LF
,@x Q/
Q
Q ; T0 0
8 #,#$ ("( 0 R
p Q
t P
P@P ` J0 0 0 J p p pp (~
-4DML @ 0 0p ` 0 0 @@ @ @$p(`k~d4 P0 0 0 0 (P @@ @ @$p,`V~4 0 0 0 0 (P @@ @ @$p,0`@~'> 03 0 0 0# P0 0 0(P @@ @$p,04`'~'> 0\3 0 0 0<# P0 0 0(P0P @@ @$p,4`~'> 02 0 0 0" P 0 0000 0(P @@ @$p,4`}2'. 0 0 0t2 0 0P(P @@ @$p,0p4`}D2 082 0 0 0 2 0 0 0(P4 @ @$p,4`}14 01 0 0 0 0(P0 @ @ @$p,4`}1 ,K0 0 0000 0 (P4 @@ @ @$p,4`},14 0 1 0 0 00 P$00 @ @ P(`x}0004'.00 0 0 00 $00 @ @ P(``}D X lH I`0 P IT0 (KI]I]t]x](~z]] d]"]ShD]S`]]=O]D=Od @- \@ 0
\ @Q@
-- ELtM0 ,0 sI` p 0 tI0p S
@ *
00KY. P
00 Q@%@ *Y T
|DP ` NI0 0 0 OI 0 $
0`4 $"dd#$4h8&h#8
S
S V R
C` p $I0 0 0 cp' 0
0 P 0`4 < K3K?`K@K˪ 8 Km 0L K4 4KO`KPK彪H K _L 0 S
pm P*
`# 0 S $4[ R \0 S
L S `0 S
< S $3[ R (0 @ K (01-
` V) 4[ #[ 0 <L0C P b H80 08 <0 HL$[᎑ P
0 p0 R 3 :(0 @ K00 S XX l0K 0 0 ` kK lKY`KZ`KE K $&K K ㈐Ku`Kv`K1 0$(K 0 P# @`L
TH(@ 0@(0,@ SH GHp 0 0 $0 FH 0 @ l' (K萈]h
-LLMxS ` p @%H 0 &H 0( RP%P * ,0K
- P
,0 QP%P *PX U
BP ` G0 0 0 H 0 g$"4$(X R#"80
X
lBp G 0 0 $0 v
$
(
$( $(,rm
$( $ ( ! $"(#,rT
1 PN H0K p0 @ KGKHKY dK $$K l
\ KcKdKI p0l$&K
0 p P" @PL
mG0@ 0@004@ lG `Gp(0 0( ,0 _G 0 & (Kd]
0-L M0 S0 0 S- P+ 0 0@ S0 P&
\!
R0
PP@Q 0
0P 4 $ 8 << * ( k K00(\$2FPSh
-LM 0 @p0` X P
X/`+ 0 S
! 0 S
x T` 0 @d S
S*` $K8 P `` $K8 `P $Y ` K
--LMP 0(0 0(p`
3S 8 <0 SD00c 08 0b S 00 S
0 0C00 00 k( P Ui
0 (0 0(0 0S(@#a *@0\ 0 L ` HJ0x0K0'w0H00I00'<'t41p'tp04p S00
0
0(0""$4( 8"( [0 ,0000 (<((X00Q00l@ =F@0 0@ D0 >F( h 1 d 00Q @ 7@ _% $K(~
-L M Q @Pp 0(Kol Z4
B =/} |j / Z ` T? V
Z
XSSShSSXSS8ShSDSXSXSShS S4SDShS V8 0 S
0 S 2 = Pt % P! 0 X k ጏa Ð b P\ : Y 1 01ᯏ\ l u E a: B X
0 S
$ $ < , K W1
\ 8, Ბ P 9
W #
|,0 \0岎 U
$ 4 S $ $ K _ 4 U -4 < (K8h(~^ ]
p-4@ PL JEP ` 0 phIEꐈM@-00
L0 @ ! "0 @Ѝ /
-LMd0 8 4 P 0 04Dp?@8K P#`#PU`0P ,` 0 K @@ PP ߍ Q` 0 P `@TP Ѝ Q 0 P `@TP Q I PG p p p 00K R0 0 0 , 0g 0 0 008 Q ,04 S"
D0 `c ~0 K @0p 0C W
ᆍ 0 R00K 0 , Q (K
-LM @p d T|0 ` P@
0 0 P囮 @ Z Y V 0 S 0
1 x t 01p x t H xK ;| ` t吀x0K
K X P
t 0L S x R | 0 @ `
X
L0H ! |0 T
0 S! 0 0 0 0 Y Zw
0 Su 0
1
< 0 @ ɯ@ < ! 0 0 , r 8 4 " d0 0
0@K Q
8K
@K
0 d (K 2^<~1]?] /
-LM0@ $0K p0 `0 ⠕0 000 0 ? ` d \ `0 P 0 70 m , Cd d ~ (K\ W]
-LMp0,0 0LKX00 d 0 0X`K 0 0 , P P
0 , @0@ P
,@ d d0 R@& 0
" d@
R . R
d R . R
d 000 W 00$ 0 00 v @ LK0 K 0 @P 0 P @ T,0 ,0 S
0 S=
0 9 40K 0 80Ks @P 80LK`K S0 K,0K
d 00 0 @ 0 d0 A @ f P @4
P
P P
00 S H F ,0 S
+ R + R 0 R) 0 S
d W
, & (@K, # 4! 0 40 000 0 0㾯 @P
" 0 @ `@*0 Q @U * RM * RH Qh R . R>
S<
9 d@
5 ( 2 ( h 4@80 t0 ,dP Z ᨠ 4 Tp l t0 S p l p K 00@t@
d0 @P S
,0 W h ^@B@ 00d 0| (x0 8P @P 8 08#880(00 0(0d0 0000K20K$K0 < . = K10K0 @K4T D 48 | Q> K20K1pK=pKd0 00 , K L0<
p6 X x P" 080 (00(0d0 0003/d0) R
0 0 0K0 p" 2 00 S
(0 S P U
1b S 00 0 S pp 0 P "b Y 00 R 0 S
` m00 0000P S00 00
-K `咈 0 " b 0R r 2 <0r 2 1lr dr 2 0p2 0h2 0 S`K_"K
0B/`2K 00_2K o0 S
0 S
0B/ 00 0000 0000 o 200 P L0 0Dp
-H0 0- T"0 l0 H0 3-D0 (Ko--[]2]$ZX](Z^]g]TP^s]T^{]X^D]`T] T ]PTh\
0-t0tP Q @ L X - PD
0<00+8@40 400 0@0H0 0 P L00
- @ LP Z 2 T
\ ` @ b \ T L 2p pl Wp! z @Pg` U]]] P@-C
Q 0 @ \ c@ 000l 0 R S ,
( a0(0 a 0 0 @ T \ a0
(0a(0a (0 S 0 P
c0 Pp@- ` P@ 0 00800000p
-L @Pp 0 Q @c Q
`0 `a V`! 7/ P @Pf U
\ / 0l S Q / Q / /
0- @8 L<0 P PP S 0<0
< } P
U% U 80< < 8 8@ 080
L DX B, H \
DP L08 R 0 Q! @
0t 03 P R 0 S
P 8@ U
U 0rH 1
0 S
L0 0 Q U
WH 0 RD * R :@ ?
S< ` 0 R 00 S4
4 S
U/ T ! 0
U& 0 Q!
0 S 00 m 0 Sm
j B
h D D ` P8
8 궁L RH20H20p S
T0 S
0T P4 C 0 T0c00 p0c00 00p00 0I0(00 @ @ @p$`,AE d0d@d Ty P
< !4 4̿$ (K[]d]T8 ~m]s]|]I]T
-@0 ML040 0 $0 P
! K ]T] P / P /
p-LM @P`h 0H 0 P U.
1P
PP QP
!00 S` 1 O PP QP P 0 S
0 01 ⦽ h
-1 @L0801 ◽ h
0-1$@L?0 T P1
( ,0 R 1 r X 0hvD!: $D!!1( !0A 010 >00 0 pp 0
Q
U8
Q3 ,0U3UD0UT0Ul0U0U0U0U 1U1U3U4U3U4U4U4U4U|0U U8' # Z X Z
P1
d 0 4 n 1 S
S
S$ ! Z
`, 0 0c 000(,00 c 0 8 5 8 0h0! R
R R 0h0 0 @ 00 0 @ 0@ 0@4 D 8048 H0<0(, 00@ 0@
8 = - 9
]]] ]< ] /
-LM Pp @ `r\ $1 ? ( 03/ P
0 D
0> p(0 00$`00 008 0(0^$0 4` 6/00 ,0
$0 4P 5/0 L ,0 00
0 B_ o ,~%]O]\$\+\4\]
p-@ BL P0 R/ <7U6U6Ud7U 0"S, & 0"S
$0 4@T 4/$0 ` 8@L ;4/ 03
^ 0 #R
\^ p ^ ^ ^ p
-$@` 0,`00$0 PL 4p 8/$0 4 8/
,00,0$0 4` 6/
00000 0,0 00300
000_
00000$0 4` 6/$0 4` 6/ p( @
0
$0 4` 6/$0 ` 4
8/ `
006
000
p 006 000
000 @ 006 00 0
00000
<000`
_ 0 p@- \A S !60 S xPj V H00H0pP CYZ U 1000H0 0H0p p p谠^p P
p-L0M @ \a
t Q h h Q Q S HPK 0 eW0 H0 < 80 0@ Kp谠^ $0 ! R 1 0 /H
p- L @P l `P p ^ 0 S y ^\0
0-HL S<@<0 0T 0C0 0
A = 4 2A020 X: (Ko ]]܌
0- @ LP P$ 0$00 0q0$ 0e0hj
-@L P `"v$0 S 000 0p p hG- Rp P@P p@ / U
`! R % X # 3 X # R` L` @! @AJ
T
A@@D@@@D@ T @@ @ T:
-LM p `<0 $P@,K 00K 000 S
pd , 000 0f, 00p 00p@ T T 040 8@ :
4 K80K4 00K 000 S
`d , 000 0h, 00` , <08 0 T, 40 R00 0
00 ,0 S
0 0Z00@ ,K T(K
-L M` 0$0 $0 @P Sp X 0 R
000$00C s X$0K 0 0 0j $ K
-L MHP U` @ h0 "& R P#x\Px%X WX W * o( U : 0 U 0 U * ' % Pq 0 D c
PH d f 0 S`
"v
N `P\
e0 S 0 00000 0 0C0K D !! ! R
1 0 S : g!qS00C S0 0 00 0,0 $00C s ,0K 0 D 00 S
, Q 0D0H`00000(K
-L0MH@ H pDP 4 H0*p 0< c(
0
0 80
0 << 8 0e
h W,
08 S $00C s1 ,0K 0 < S
< H0bD$00C s! ,0K 0 0v 08 ST W$
A q Q ,0K 0 a0a8$ 0ao8 , 0A s
!Q<0$
`c 0[$ <0V a
q Q
Pe ! R Q 0 0 S< 0H
l0D 80 S M$0 D 0C s 4* D4 a $4@ 4L L @04 S R
P Y
@ \
L R
40 S
&D0 W 0c h WT0 P 0
@ P!R @ e
0 Q@ 0 W @0
4 !R 4T0 ! @ 4
a !R4 &R 40 W4 L 040
L ! !qRL Y$` .
W
!eR T0 !R
!ZR W$
Q> ,0K 0 a0m7 D8 Pb0 x8 0hr V 0$0 W
8 <0HD
cDD0 P 0 ,A P h4 e@ b0F s \ (K8 0aB
-ALhM `K XpKn( @ P( [ ,00@ ,0 ,0 p(0, S`0 (0 , 0(`\0 P
PxDP00 S`@5
S@@1 2 0 S 0 = R Z 0 00 0 0 / 0 R 0P S 0 S l 00`@ S
, , , 0`0 S\ , \ 0 T
U
R (KP L 0!& / ! !Q
p- P L`@!V
01 P
0
8 0! 0Q000 0ap !& ! @ R
! B /
-LM @ p`P 0 00 00 0 0
-LM @ p`P0 S 0 0hB S 0 00 0 p /
-: ML 040 0 0,0 00 8 K ] UU
-L H P00 v
p-L @' 0 S
L 0 S`
`P` V 0l 0 S 3 D 238 0320C2v P U
2 S p܌]
p- 0@L
P
P$
p$ ! P P ` J 0 02p 023 S 8 L F2
02 m = V
9 p p p܌
- @ L P
J 0 0
p-@L P T&
2 S
x @P
` V
2 0C2 0 0
0 72
02 pT 9 D 0 S 4 00( X BX @ p܌
p-LM@K P$ P0@ 0 ` V @ `` " @ 0 Sp
p-LP`L @ q 8 C 0 0ph܌
-0L @ s
X0 s00h
M-L0M000 `q S @, g @ Qe @0,0B"40 &2>, G"H` Dp 0
` pO <0@
QH0L P@ 0<0 @ 0, Q8 8 Y5 0 S2 R/ R , S@@
@ R 0 S<0
0
P T I 00
B T@ T0 S 0 S 8P ULP@4 Z" WP V P ` 0
8 P T X0 }I X0T `p Z U X
, (0 X hX(Ko(K@
-@`0 2
0 3 pE 2 S p
@ Dp R p
w P0 0 K3 * @0 S 002 0 S4 OF P0
00 0H0 0 H0
0`- p 0 2 00 W" "
0 &3 X 6 sZ8 U: 0 3 (Kꐋd~ $^]܌\
0-1LM A|Q R p 0 , 0< P0 H
00A S 0 0 (1 " ! P<
0 0<P ?0,< <0 0 < < , @ \ 80 04 4!08 SL0 0 D# < 0 4 P, K0d~P\]]' ~]
-p4L0#60)1D0
00M 0@K @ < HL 0
0 01 - D IH 0 @ K 00>0 0<0 @ (0 Q S /l~H^
-< LM 0 $ $0 0K P K 0
-L Pp` @ }* 0 N*@Z T:0 h-TO\
-L*0 h-TO\
0- PPL
L@000 0 R
00 000 0蘋 P / Q
R0-L @P
U
0h
- 0L @ 00P`0 0 ( U
f x pP 0 b R 50
U$p
p 0 00
-LM00 0 pQ `, HP rPP
U @ T 0 0 @P
0 U 033 0 0 * P( T @, K=-
2 Px0
` 0
|, 0D c 0W0H00 @(K Uꘋn]
-LM0PHp 0 @ 0`,0 ) Q,0 0& P
52 P
| G0 `l V
, 202 + < @ V
0 , (Ky]܌
-LM@0 PH 0 ` pC) 2 0 0 Q
& P
+ 2
2 2 C02 42 P.
/ ` V
+ c`2`02 + l V
$0( #62
2C02 0 2, ܌]
-X3LM` D p 0 P0 S(3\1\10"4" 0"4"@ T,
2 S
@P%
2
02000 Y
0 s 0 0" 0 0H 06 e 0 0\" 0;, * U30 0
0O) @P
0
I0001 Pq
Y/ ,
0
;x0 0x0 < 0 p,0 P ,0 SZ
,0 S6
2
p W
P < 0 0异 0 9+ 0 Y
(6 2
Y
V Wp( * 2C02 Y ,0 S
U
0D c V
0 000Fp p p (K蘋^]]]܌
-LAMP `@l K pA=\pK[pKZpKp lP PX- 0*@ H= 0 S
X0 , NlK@:H@ L` D0 L
! LpK P
!80 R84l 0 S
L K p
80@4 \[K[[X \
l Y K P K0 +
Y [ R $ RX X " L b P
800
H0@ i8000
6 T. 0000H$ Z X PP L K " \ [ RH \ L P!Pe %V U P! `h b"& B R d `P \ K h d `P 0h X`0c0
8 `KD d080L 0U0 R 0 S
X
0` a `P0 S
Y
2 <
3 S )
P UPa Z
80 ( 0 ! F/K 6 /0 0F/K
0 0P 0$00 (00 @ P ,0 0 @P K0N]`U~
-L|MpK@ `P` 5,0K\0 0 ,0 0
0 0py 300 00. P Y , R 0 S
0 0I P , 0 R (K~
-04L S @P
$ Rpp p0 S
$ R`` `$ K10 S
b V W W
0$ R0 00 W
H Q
C V V
0$ R0 00 V
i4 0T U5 0 H bD"&
0-0@ P 0L0c0 004 $ S b a0 0 S0h
-L` @P
0 Q" 0#6 Q
R 0a
V0` V 0006 0 V
0F
R `f @ R= 0P * R : S 3 # 蘋
-L 9 P 0T0
- 0L @
iBp`Pp )0 S
\! S
3 0 S
U u000谠^
p- `L @`
⩼ P pP P
0 S
^ p0 00p 0
L P
0-P @L 0 0. 0h< =0\10 /ᰠ^
- 0L
] P P 㫻Ќ
0-x0xP M @L 0 0X @@ @@@@<0
0 0 @@ @@@@}K0_] g]
-L8M`P &40L0 00#2P0 50 <0 &60H T0 0D @@0 0 8 40 D0 0S0,0
0,0 0,0 0@ SN 4 TK
0 , RG T D $pD W@ 4 H R< 8 L R8 < P R4 L T R2 @ R/ W
a(0 8 0 R$ 4 S! H0 S
0 S <0
9 P W
00 S
3/ 0
0 0 0p0j 0 p p @ 0 Q 40 PX0
00, S T0 $0D 00 S 40H S 80L S| <0P Sx L0T St @0 Sq 00 S
80K
0` \0 (0 Se ,0\ Sa H0 S
R[ W
H R W
H` V
0 a<0 P S
0 < a P
< P: 0 Q
00 S
3/ W`
0 000C00 0 H0 SD0 D H0 0H0Z 0X 0j T 0
0 0j 000 S0`J
08 K (, X WV U . PPA
@ Y p0 0D0 8 K $0T0(, 0T0H0, L40T00 P L088< @p
%
`PDpH` D0H00 00@00P0P0 S 0 RP% P`0 @
` @ ; U
q V
m (K `@-04 S0 @ Q : S
@ T 0 @ T $0
@ Q @5 01 : Q :@0 S @ T Q : 0 00 0 S0 0 00
-LM80 T0 4 QP p * 40 4P Q h@p Q 0 W,0 2
, , K @P
V W,00,0 $ V,0
04 0P S : U 04 K
0 p# p
P
W ,04 0 S,0
,00 00e ,0 0( K 0 ,0 0
0 p p
P
$@ T
0 S40% `# 7 * R * V
Q R 5 : R : V
R
* R * R
R`! ` Q : R R
* W
R
P :@ W R * S * W
e S4 S4 54 K
0 p@ po
P?
0 S> * Vk
W0 04 K 0 0e40
0 p` pY
P,` N
0 S' * W @@ W0 0 S
R@!* 0 S * W @@
W0 04 K 0 0e40
0 p@i p/
P ,@ # 4`K4@ W,00 00e ,0 040 ,0 0
0 pP p
P
W,0
S
0,0 0 S,0 ,`408 ` 0 ` ` ` (K
-L$M`p0&$ R @, P
h %00 4 80 P 0 Q
0 W
_ 0 , 0 ,0K ` P 0 < 0堐 ᖸ 4 Q ܸ 8 08 吁 0
0 S
0 0 T @, 0 S *d Z
@ t q `0, 0T00c 0 ,0` 0@ # (K$^~
-L4Mp @`
0 S 0 0 R
0 0 S
( 0 0 T P PP
0 0 T 0w p0 @pK
0pQ P l<0 0 U
E $KTO\~
p-L @P H P
0 D c"& 0U0S00
$ 00 S
3/ ` @ Tp
-LM00 A: 0. 0 0 p 3 K
-L M @`PT0 $ K V`1P0 UP! U`1 P" 00H $ R 00 S
P
V(! ! *0f 0np S *0cpW 0 $ $00$0 $ ^: K
-LMp @: WLP4`
@0 S
@p _P U 0 0 0l 00 0pv
LP 4`0 4 Q
@ Q a 0 S1D0" Q X$
0H4& R E pV 40 S
@0 S 00
80 $0 S 0 0 0@00@0P U0 \10 LP @0 S 0 80P pP P U$ 40 S@00C@0P ULP `
40 S
@00C S@0
@` P U pꘋ^
-L `D` ph
0-P @L γ0 000h
p- ` H0L @ SP`f
D D 00
$ ph
(0 0( ,0$ 0 S
0 S
3/p
- `L Pp> @ 0 00P00@0@h
-LMP( K @`pD PT
( 0 U * 0 U ( ZE 0 SB $ P? H0 S= W
0p R0 ` 0>(000p00C00 p` W V 0 S000 S0000C00 0 0( 0
PeP 0P $K
- `L Pp @ M G0 0000 @0@hH
-L M P@ ` TpP0 Tp! V`! Vp1, K P Z,@4
0 W 0 W *
@0 Sn
0 S * Rh
Re @ 4p T
0 S:,@ V 0 V * @0 S
@ @ T
0 S:p @0 S 00
80 $0 S 0 ` 0 W 0 W * c 0 V 0 V * @00@040 S
0 S *
R
R @00C@0@
T
0 S N WK @
T
0 S:,1 \10K,@
@0 S 0 80| pP @
T5
Q:1 : @00C@0@
T
0 S:,@ @00C S@0 @ T p p p (Kp갠^
-LM @P`TpP0 Up! V`! Vp1$ K$P PP
0 W 0 W * V 0 V * 9 X LP 4p U
0 S: K
- SLM @P` 0 nTpP0 Up! V`! Vp1$ Kz$P PP
0 W 0 W * V 0 V * <P 4p U
0 S: K
-LM @`Pp3T0 K V`1P0 UP! U`1? P
0 V 0 V * F 0 U 0 U * 0 S
R R $ R H R 0 P 0 $p(, l P 8 K 0
T0P c""00 R # 3 / /
-H0L @ S
"00
$0 h
-00L @
$0 \H0 S
hV
-LMp P@`4 T0 , K T@1P0 Wp! W@1, P0,0
0 T 0 T * ,@40 0 d 8 \b
$ \ Q
d 4 V 0 S
R: D W 0 W * 404 S
0404`408`
S
,04 00 00 0 00
$ 0 S 40
7k 0
,0@ V R
0 P @ T
0 S: $
k (K谜\
-LMTpP` @ Qp! R`1 Vp1, K40 ', PP
0P W 0 W * ,0 S0004
S
0 S0%0%4 , 04<0 R V 0 V * 0 p 80 @0 S
@ < R! 0 T0 ~ 00
$00 s 0 H0 S
q
0 S0ph000C00 0 됀,0,P pgp08P
U
0 S: 0 ,04 0 0
P ӯ 0 < 0 y (Ku]\
-L M @`Ppr 0K pK P
K
p-L MP @ ᨯ` `F` V! 0 0 00 S
` TP 0K `$ P
ᇯ Ⅿ t hx Kp@
- L pD@`P0 S 0 0 0 TP 0T`PP P DPo i
-LPM`P 0H 40 P 0 @,0
T (0K # 0P0H S P,0 0w
HH ,0 0@ \0 0 K P
0 ppg 0 V 0 V * 00 p00 p`< : 00000 0 4 0T L D < ` X d0 h X ^ @ R 0 R * S000
@0
009000
W ppg00 0l0 Pl0
, D 00f0 0 0 g ` \ P P *\0 0$ P$
00 S
3/00(0 0( ,0 (, 00 0 0 d R8 4 4 8 8 < @< H R H D
D0X 'v ^Dp00 L L X RT T Dh \< ^
@ R *` \
\ L 0 a L 00 pD 0@ 0 S *` Qe< QD T
: pP
L0,H 040K0 <0 Pp Ts
Dp D
T4 000 S
0 S0%0%T 4 0
0 ` D \ 0
l0 0 0 0 0 B
l0
0 @ R * P T 00 S
p Y 00 S
W L40K0 H0, <0d @ T`
4 P `
` ` ` ` < \
4 P
P Q H0, P0 ` (K0p
m
-20ML @ 0 0P ` 0 0 p @@ @ @$P(`x2 0l2 0 0 000 0 0 @ @$P(,`(2 0 0 02 00 00 @@$P(P,`1 01 0 0 01 0N? 00(00 @$P,`1 0|1 0 0 0 0 @ @ @$P(,`<1 0 0 0$1 0 0(00 P @@ @$P,`
< 00*0 0 0
0(0 0 P @@ @ @$P,`'> 0000 0 0 0p0 00(00 @@ @$P,`v(Kos ]] V]] V]V]~]]~
-LM/K `P$ K(Kp@ / %4 / " / " / " / " / " $/ " (/ " / " / " $/ " (/ " ,/ " </ " @/ " D/x t" H/p l" L/h d" T/` \" X/X T" \/P L" # 0 , ( $ " x K/ ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / ! / |! /x t! /p l! /h d! /` \! /X T! /P L! /H D! /@ 0ML 00P0$00 (00 @ P ,0 0 @P K0 V
P 3 /1 Q R / P R T / /N /N /
-L$M @4 8 D
( >0>0 Y #6<0
0 `P
|
, K4 Pn
b R *D Qf
Qc Y 1@ 0
$ R q<JP@ T:? H`$p V
A W(
=% V
, D a5 P
Q 0q 03 W 0 S
,0 (0 a P =<JP H L @ T: WHL
W V
S,00,0 4 D ,0D S
R: ` `
8 40D < ` (Kt\
-LM@ q `0 1 /
0 S,
S:^#:PP^`cP @( P UDp $ K P$0 ` PPf X
0 0 0 K
-L MH Qzn'z``n` V@
pg @P DP A 0K @ P
w K
-LM P@ q:N#:@@NPc@` P D 0X
- P@L:N#:@@NPc@ q` P D 0h~
- P@L:N#:@@NPc@ ap P W VVV,V@VlVTVD 0hD hID 0 D 0h%
p-LM P@ a:N#:@@NPc@ Y P l0 D0$& R D 0H$@0&d Q `0 S# 3 : 0 0 P p# pp阋
p-LM P@ a:N#:@@NPc@ & P D 0 P p ! Q
0 @0D ` # /
- 1 LD
- RL,MD `00 @DP
h 00 S
P ,P :#: Dp , L
Y 0
Y :P0 Y * U
0I 3 0 R
3D\1 1D @0 p @p < p R : 0 S :
P , 0, p 0k ,0 P 8 ,0 p a 0
d040
P 0 S
2 0\1!x PP ,^ XpP
b PD p ` V0 PE0p 03 U 0 S P `D P pz
H 0,nj, 0 S
00L 0
S
80 =c L L 80 S
ݧH0 ;H0$ x @, 00 0 $V00 0
D 0p PP
W:
0 03/5 0 \2
0 ,
`0D D0!& R R
0H46 S D0 0 D@0 0 0 PP
0 P P (K TO\^
-LM P PP 0 0 0 S, `@0
: #:0
c *, 0P
P
D 1 L0 3/,0 S
D @ P, %,0 5 P, ,0 `
` x P 0
(0 S `0pSp S S
S
]x0 K P
Px W
K P P @xT0w ! \ Q
2x `Zp F R SPP S PP 0 p p" $
0 %b 0K ! v 0 0 w 0 S 5 0P 0 S
w0-
w
0& p t! 0 0 `pK p` @0 ,K`00D 0 0P, Z
0 w0 0 (K萿Z & 0 /^
-L,M@4 pp P`0: 0: 0 S80 0 S DL
T 0D
T :4 P0 T * W
@D 0
W@
P @* 40 U T
0D X
* 8 0f 8 (0K # 0 80i0: P, W
W D 1
L0 3/ @(K *x 0 p P
0 X 1 !04 0,p @P u Xv p
0 K P@X
00
RQ
i RL $ RI H RF 4 RC @40 T?
0
S< $ Y!
(0
@ <0 0Q <0 R - @0 Q* 0 H L D0 嶥D0 y 00$HL (, 000 000 000T00T040408080<0<0L0 @@@L0 @ @ T
4 W U 00
0 40 S V
8 0 p @ p @ @ (K
p-LM0P@ P TP 0 P >.D 0 >0.0 `K 0 ` P P PKp
p-L @P`
( 0 0 P (00`ph\
0-PL @ U
0h0
0- @ LP P
U ե P P0
M-L @ P0pX ` P
` W X 7 (Ko3܌
M-LtM | 0 @ K R0"V pZCfҤ K x t lKn 0V U , @ 0, K x K 00>0 00>00000 P0 U
N@N@0e S *
p` 0 S * @ P * bp0 pK @ @N@N@
PL
0| J T:(0 K~R]{]]TO\
-LM40 `1 p, 00 SH
X <+, W :(&$1 P U 1 @ , 0 0| (Kox 0 R @ T P0
" W :P U0`Db @@ I Y `FP00 @rR,0 040 0 000 @(K蘋]]]~4]o]]]0@-\0 PX@ 0 P
:RP P * Q l 0P0C0 S 0~
-LMK p 0 0L 0 K 蠍4 /
-RLM 0 ` P xr0 S
Bဠ P X4 @
4q V 帡 ?~ 0F p 0 28p q젓 `a@` ` 04 , K, 100 00 K. N P P 4 , ,Ơ ^
4. 14 , ,Ơ 0 ^
4. 1 4, 0 0< 01 S R Q!< ,0` V0000@0DP4 `@; V
8 (K蘋]،^܌ 0 J , 0
-LM4 < 8 ʠp28 @d20 0"6,0 1 H2\1 S
p h ? R P Ql t R _ RP , R r
( R ! Sj P U pp`` X
X ,K 0 t P 0 l PM
,0K 0 0b P X
@ $1, U `
" ` 0 ` R00ӵ0ĵ80< Z$040( I 0 "
0 3 4 R
03@ 剠 U
2 V02
4 } (K،^&]~ȋ
- @ `L @p$0 P$ (0 i 0 S 0 S V 0 R Pl h d S \ 0 R0 00P0202000h6개\Ћ̋0\ȋ
- @ LP P`p
X U
P$`(phZ
-2L MP0 S
Ԣ 0 R 00 I P
000 0,0 ap4 g P
,0 S ` P 0X S 0 0 S 0 00C000C0 03ٟ4 C P( 凟0311 R @1100100 S1 0 1@1``000d1 K 2D<2 P ,W0,0 03 00 R @ 00000000 S0 00 00@0000000000$00$0 x00@ Typ Wq 04 R 0 00 Yb 00 (Ko\(K谠^،
-L 0KM # w K 3 S / 3
-0C8L#8 S3 0 B 蘋
-L @ hS 3
- SL @ 0 303蘋3 S / 2024 N2024 4e
- L
-4 L 02 蠍
-"L @ R*
P
!202 0 S
3 B"
03 00 02
2:#022 S
0 SZ h P
0 S
4 3 S
031 B 2 PP04p ` 0 'vV030q 10! R! A!0 U $ $ |0 0( $0!p! R!!A P! ! Q$ ҵ õhnȋ،^~
-Lp ` P @0D s
2
2 02
02 UP U
-2"LM 0"0 4 0% ǝ Ý2 QB 0 $0l S \2Xb P R Lp80H 0 R EP, p P0 A 8 <0 , X8 <0 @Pphp16 L P jR% `, P
% 4 8p 0>0 004 >0 0 @0 , (0 (K^܌،~H]L ܌
- 0L S 0 S
寝 P
p-0LM R
0 0 R & (0 T@TP0 &00 KB " QKp~
0-0L @MK@! @@@ l0 K 0`0 T P0 @H 0@@@ 0P0 0 S
3/ TK0~~\
-1L(M\A1 0P T @@-p1 lq 0h 6&40 < 8 `H TD1 0 4 0 ,K8 0,` Q P&
T
圜0 R
0 @0 ٜ@04 06,0
僜 0 0 0,@ < 0 PEJ U(0 0 , (K谠^ D t]|]
-L Mf p0@ 0 0& R D 0 0 劜 @ P P 0K X 1X0 R
P 4 t00 P
KTO\0 00 vJV
- LM@ 4 P 0 ,0 R
Q`
``` 0p @ Up@
P p @
($0 @#6i p4 < f < V08` < ,0
R 0 @ @ ̛ʛ,02 0080 U!
@ Q,0" "F
U
, 2 02202 V
,0 P 0
($0#6E, 2@
@02, ,0"
"! !" " V
0 S 8 R
˛,0 , K\
Y 0 V 4
Nt 崛 Მ h c UX0X X X U
U
0$! B$!(K܌
-$0LM K K TO\
- pL @Gv `1
00M0
PP ,
Z, 0 U
0
oQ Y (K
0-3L @ P
P
0 0
$0( #6 0P
2 0200
0-PL t0 P @ @ TL 0,0 S@@0<@ P P, P @ @ D 0蘋t
0-LM P| 嶚x0\!t00 R h00 S \ &X0 @A @H0H 0 0( 00،^]$^ 쌀
-L0L < R @0 R P P
h 蘋쌀
-L03/
0-(@L P h0 PP0h譚،
p- `L @ V
( U Q
e
U
40 ! ! 0
0 00p蘋
- @LL 8H 0 @d,0@ R , 0 hq،쌀
p- `L @ V 0 P P ᥚ P P
V 3 "03 B" p
-5LM\!5E tD n `\5 0 S
0 S
ڌ0 S
054 0,%0000 'ٙ P Q 4 0 R
4 00 ˙P , ę@00 0 0 S 00 S0 P
` 1 `` 0 11|` p0 h 00| 0@ S W
L P
v PP
` Vݙ 0劙`2
Й 10 1 Z1100113 d$ 00 0
[]]Б
p-BL P@ @ f `P@
2 v @ ɘ p
-LM P
H0 KK8@4 0@@c 0 @ P T K蘋
p-\`L @ PP
C ` TP
0 =,0 P T
7 P_ U p ,8
-H1L ,8p 0 0P`D \ AUP 0 @@AV @\ BUHGtP T P Q PP VP0 Q 0 T 00 \@ P @ T@@ S@
T0
U @0P
P00@ r00qPs@p0
0-3L @
0 Rx 000 3<3T0 B S\ >00 P @ #,# 0
-0L `P @pPb S
3
P`F U P
(1
PE0(1@ T
V 00 V U3
0 R| 000 3<3X0 B / / 0 R0 0 0 0 3<3 0 B /
-L @ 0 0,0 @ #,#
-Q威aLM p0 S @p t@ TT
3 @ TN
0 t0 10 1 pP
<0
1 01qo p 0 W,0 !
0 S2 P.
s0 S+
0
@ P r0 S
@ 0
@ 0$@,0 S 0` S q0 S
@@ 0
@@0D@ 0 S~\0\v /3 / P00 0 Q00 0 /
p-@` P0PLd ! 0 P@
(
4 @ PL 2X ph8VV /0 0 P /00 h A@ Q /
-t@Lp ( ` 4 T @ H L < X 0 (d h]]]]]]]
0- @LP 2 0 S 0 0 S0 d0A $A$$0A02 03 0 0 0 00 0 @ @ @0蘋
-LM T"P1PPP 0B Q " # ``,0 R p v $P,0 !(0 Q A! ! ! ! R! !! V A! $ ` $ ! ! @ T0 R 0 0ӵ0ŵo،^~
-L *` P `!4pgL '' Q1 8 0 V Q
0 R
`H8 ,` p X! V `1pgL '0
@\0 X >Y\0X
`Lp 8 ba`` @T
P Y Y
0 dP0p p4 Ĕ W
Q
, D (K،~ ]
-@L P$M8@ 4P @ P `@P,K p ( d(, L0 p 0 , 0L0 T0H0 00p0 TD p K" `P
0 P 0 `` 00C S zV~VVVyVVXyV0 SP 0 b P6
6 Ou pM @hv , PP
]8嶏 U n
j P 6 @ 1004`0 p S 00 0 H ♆K P
吏H P 'd偏, ,
0 a P
4=54p 0 W
0 !A^ P Z
Z B K b p 0 K!_^ P} d0 А<0 @0 S0D0 ?4န; )0 SI 0 0 Z` 1 啄0 1
ۄ$ 1 W $ dL T$BH
Xţ0 2 X
h=
:h D #00K⎿ P0 S
p# 0 S HH#0 P<< 00 (0,嗎00002L L P PX 0 P
T2 0 W
0 !] ty /\忎H 6 D PAPq ,g @P 嬎Pf 0 奎P_ 001 pP gP 嚎( ,z P ( ,ʴ P $0 RP P Pt900081P pPpP|7 l1 H X $4 =F 14 0 P
0!Q] 0L TpgLp$ bT 4 P 8 Q0(, 0 H PϠ P F P4 C $Ġ (K400 Sꘋ `M <]]:\]8] ]E]e] ]~]pV]T\]\\
-H1LMH0 p SI ,忍( P7 `@1 0 -
0 R' 0 剃 p 0"
8 < R<< 8 R88` < R @8@@ p TT` ,0 ( ,0 8@ T P U 0 S Y ō 阋
-P@PPL kX d0c80 0 PP U PP ᨍ 蔋~
p-@PL @ `O ,$0X fX $0`$` ph菍ꔋ
pp-L `P
L 8 ( @ 0 a) 0 0e 00T PeTPphrp蔋 0 0
0-d@LM\0 q 0\0P
@0 K6 PP $ X0 0CX0M 0阋
-LM q@` DP @ N@N@ T
@0bp$ P 0 S : p T pp W
$ p* 0. &. T
0 0 0 K bpp pP
0@c0$F d 1 0@d0$FC@ p K @-D 0 S 061c Q *@0X` p0@ 0^a@ ?Q#Ơ$Q%Vʌ U P / R />0 . 0
M -LM 0 ] K
-LM,0 0 @ S@ P
@ 0 IJ 0 60
0 B0,0
@ Pp(Ko] YD GB
-LM0 , 0 @` SN pP 0 K 0P U> 0 0 K PPH 0P1 W4 d X Z/ "
W+ " 0 00
40 ` P40 " " "
" " 0
(K]]
-LMP4 80 @p 0`P4 J @0 ,
q` 4 0 K 0 P| P@ X" 0K 0 0 , `pG
0f S 4 0 < b P<@ U
`p
V8 `(K
-` LMp 00 @ Pp|D0 S @0 S
00 0 0\ k @PD`8P<` Ki诋
p- @L P`Y @PD`ph蠋H0 /H0 /H
P / /^ pAAA4AĸAPA,G $0H 0 ! 0 0 0 /ᰠ^qq
-0L @ !@0 !!
0-D0LHA T ʀ0 P ! P0 !! 0谠^ P /0 S0d 0 /
0P -L
P
P
@ -L P Q 孱 ]
- @L 0 0 h脧 0(00 0 0# `
- QLM 0 | ^ Q e p ` R0 0h V 1h # v 3 X X Y 0 (R <0
0 @_ Y X 3 R@R
$ / | /x t /p l , dp h 0 ` \ 8 X T Lp P @ Dp 0Б
p-(@L P` \ ph袄Б
0- @L O
`0, : P U
0 0億 5/00
| 0h eM 0hs]
0-L @8] P
J 0 080 P @@ 0U 0h, 0h갠^
p- `QL @P
0 U P`f V` 0 S 00@ ph ph:p
0-L
0d04 0 0 0
00K @@ @$p((K]t]L~]]]
p- @PL+
0 S` P % 0 S 0 QPU` 0P S 0 Q 0 00 00 b pxL~
p- PL @ U
L` { 04 R00 0 :| 0 0ptt|
p- @L P T
T @ 0 0 Sx` { 0 S
0 R00 0 @08 000 R0 @ 0 { @p|t
0-$@ PL {0 0C00h{t
-LMp0 @ S 0 i
` 0 1 R
R RX
0 S 0
S 0 S 00 S 0 j QQ 0 R 0 ,0 `{,000 P
0 0 R 0 ,0 ,0 0 R {t 徖 P { p0 0000 00<0 0!` R1 Qa`xL~tt
-L @p` ` Vd 厖 PK ` `p00 S0 0P00 000 xL~
-L @
pP1 0 0`1 R R R R 0 00 0C0,0 B 0h0 S L~]
p-` 0 @L SP 0 01 R R 0 p0 S 0 p 0 S 0 S 5 : / P /
-LBM PQ 1 @8 011 0,0 00 P U4 P 0 0 t5 X 000 T 0p W
0G00 /00G ! 0
!I pP !
P
d0`2 V
^0 5 pP
Pf2 L``,K0 K0 @ pP
w
Pc2 @,` ,P 'K D5 G2 0 S 0 X11
K wI pP
PE2 <!p0 2 `l h0 ,K0t K d0 t` `` \` H p 12 W
P,` l ,0 X 1 j
P@ U\ A $! ƌ 0! 1 @`<0KX KT ( X0 < >K 8P P L0 HP D` 7r!40K XK4` ``iJ P0K T P! 1 ( 0@! 1 $
P) H0 0c R ^
A ^ $A ^ 0@ p@b T"p
= 0@ 0b S @40 S
p p p m W
P @! 00 S C0 / C ,@ 0 B
T R,0 pp
@
P p
P@p
Pp
P Y00 0, P
1 T
1 |1 (K8 ]
-< ML 0 00 0 0 00 00,0 0 @@ @$`(@0p0 0 0@@ @@@壗\0 P #D @ q< $Kmgu\|u]j],Wr]l~}]XwȜ\V\
0-$@ PL =w\0 0C\00hw4
0-L @ 0w0 P 4 P
`P UX 003/D0 0 S` `0d ,0 @d0 0\0@ @ ]w 04X~
- @L| w\0 Sp0 0
S ` Rddd `0 0803/X @ `0 S@ @ 6w 4X~
-d Lv\0 @ 40 S
\0< 0\0"w403/$ v\00C\0`@ T hw4X~ ?
- L? \~
p-L ` ;: @ P i T V
@0 V000 P p0 冘<@p\~
-LM P
P `p@,@ 0 R @ T) R @ T"
@ t |
X
Z
u v
p W p W 0@,@
\Z \V ( ( P Z 0
p
S R T \F
R S
V 9 U7 t |3
X W
u v,
t |
\ % T " X ! W t |
R S
\ T t |
4 (K]
p-L M$0@K P `K 0$ 0 S
0 R ( 0 `? PKp
- @0P SL 0 S 0 0 0(@0 \ 0 \ 00 0(0(0 ` p p >@ 9 X>0 0 00,p000 R0 0(0(0(`(P\~
0-L @ P 4 80 R8000804 (P>, P0
-L @< 0 h舗
-L M$0 @p ZU
(PK0%,`K G , J Z
I xVVVVDV,0( 00 , = , 0 R 0 R @ 0@0@+ Z( ,0( $ ,0( 00 , ( ,0 ( 0 ( @ 0@, 0@
0 `o P (K
-P7L4M0 `@0 1p@ S S S @
T S
R 0 S
S
S L P P, LP 0,0 P
P
P
0 s 00P0 S L P L @P L P P L @ Ty
@ L P t PLP U 0 S`a\ $p0 ,(00 0 0 0 S!
Sz
S
PD 0 #P @ D
0@ A
> \ 0 S
P
0 1 `1` 0 P
᭩ 0 S
` , t ,@ 00 00 0 S 000@ 00t0< 00 0 00C0 0/ S
S0@
p lp , d@ T plp( @@@ l0 `(K@ P `!` 40 b R C 0 b / R 4 4 / Q
l0c0 0c007 l `07040 0 S099 l0 S09900900 S 0 . R 0. S0:
0:0l ,, K00Ka @P
b plp, h( ``0?@00- 0 Rx
0 SM l0 ;0 Sb
p0 0p0l 00 0c 00 S8 l ,0 | 0 ;\q 0 S / xd040
0 J? @P' L[ < K d@Kd ;\ X < ` 80 P T0 `` Eh0x @ @P
plp Tx plp@ Q : 0 S
q p 嬑p夠 /P`@ 0@@ S0m 0{ S@}P
/ U 0 S
0 S *0 S P
)p Wh @/ U@ / U 0 S
0 S *0 S 㻿 P l9p WL h@/ U@ `/Pp- / U 0 S
0 S *0 S 㛿 P
0 S* / U@ @ ({ / U 0 S
0 S *0 S | P B h8p W
@/ U@ d/ U 0 S
0 S *0 S 4 ^ P 1 7p W @/ U@ / U 0 S
0 S *0 S < P hp W @/ U@ p}/ U
0 S
0 S *0 S @
P ,7 0 S / U
@ @q & 0`^/ U 0 S
0 S *0 S P l6p W @/ U@ >/ U 0 S
0 S *0 S X ߾ P 31& / U 0 S
0 S *0 S ˾ P 211 / U 0 S
0 S *0 S 㷾 P
21 0 %H K⎔@p W@ @ / U 0 S
0 S *0 S L 㘾 P 21 0$%H K o4p W! @/ U@ HK@} U` { ` T: W㤠
D4 Y 80 S 4 plp?@LT R 00ɗ 3 90 x 0
? 0 0/ S# | :& 0 S|0
0 . R . R 0/ S 0 0| | $ | (P) 0 000C0 0 / Q
| 0 , & t 000 0 0 S
@plp@ plp>@ plp, & 0 % 000 , plp0 t ,0 090- t0
, x plp P % % 0 % 0000@00 t0 p , 0 0x0 P % % 00,0 000 plp00 SU
S , P
P % % 0,0 0 % 0 # 0 D( t 0 S
, P
0 dd Q
% 0 % 000 00000t 0 S[
: S 4v R
0C S ,0 S
0 P
}% j% 0,0 0 w% 0000 @00; t0 0 3> t 0 * , P'
00 P! M% 8^ ]L @ Xwl~^] ]i^]][] NM[]\g\]\U\]N,N[]\']&],]n6]+]0]<% 0,0 ,0 @0000 @ 0 S
0
000000 0 0 R
0 (K 0 S S0plp, % 000000@
-LM$0 0 0 $ 0 0$ K0m K
-$0LM 0 0 0 0 0 0$ 00$ K0Z K
-L(M 0 @` P P?P\ /> PPPV p $0 P0P<0 8P 4P @@ 0P 0 80 (0 K P!< 0 P@ @2 P P
PP
<0 SO@
3/ @\00C\0Q ThP2 P <0 S
\000\0h<03/ @h\0 T0C\0 F `P Uh U/ h1 0 `0P Sh U
vh1 @ `@ T`hp$A e \ߎ ze P 1D 0Վ6 T
0 le P, P 7 d $ 0P 409400\ \ 0 @P
N ` = '9 @` 080 080 1 080@g KO@<2]T U]] ]]]h 9]4X~8]S]]M]]]]D8]h^ 0 E0 r 0 厓
p-L P` z @P%
0P,0 P0P 0$ Ð ( g gTP [ ` g 00 0 h p
-LM ` P p 0- P @ T
a0 " K! 6 8 X 01 *1 S
- P
D
? @P 6 *4 l 0
40 pg 0 I 40 PM840 ,K P T0H0 ,0L p0 +D p K , X ` P
z 0 S
s !0 P
` f 800801g3 0 R0 @ @2@pg40A ᕟ P @ ` D X 0 S]
0K P g|" 0: 8p W6
R
R0 Fg 0 S 0 00 00 S 0 0 ! 000 !0 ! 1 1 !1 R
1 S
fp 0 S
` Rp g W\q 0 S 0 00 00 g `D P
0 P
0 0 f 0 p 80080f m P
X 响 p pf % (K 0D] 8] ]
-L @ `^f0 p ㊶ PP
`p W \0 0\0f U @P
040 /0O 0PX 0 0m @ |f 4X~ 0 ˑ0 0
0-0L P S@( 00 0 S@" f0 0
? A P
P P Q @ T @ 0f 00wt
-LM 0 P@ 0 I P. 0 S
S) 0 p d PP!
e p q
0K P
(` 0 d `P` P V T 0 0 P K 0 1" R /
p-PLM @ e0 0 $ 0001, S01pP1#0: `0 R `K 00 0 101 P 0 00eKp D
-LM 0 $K$0 S K
-LM0 $K$0 G K
-LM0 $K$0 ; K
-LM0 $K$0 / K
-LM0 $K$0 # K
-LM0 $K$0 K
-LM0 $K$0
K
-LM0 $K$0 K
-LM0 $K$0 K
-LM0 0 0 0$K$ 0 K
-LM
0 $K$0 K
-LM 0 $K$0 K
-LM 0 $K$0 K
-LM
0 $K$0 K
- pL M `P@ q
(0K 0d0 0 P 0 0
(p L0 ᜠ0L0
cH p $Kt
-L⛛q h
-LMlQ ` P@p{d 0 ( 6 PPH X
0 0 Pd4 P P: cd@ 0 pZ 0P
@ T@" 0 pJ 0P
s
| ,0 d,0P 0
X
0L 300d 3 (
@ T vd (K Б
-L Md0 Pp `< <1< @ 0@
d
00 0 05 P9 d@ 0p S
0 S : 0
0P @ T@ 0p S 0 S : 0
0P
s
D ,0 d,0 ,e @ T d (K Б 00
0- @PL @00C S 00 0 $ (00p0 S0p t 0Pt0 000
0- p0L @ SP
St t t0p P0p00 S H0
R ;H0 O0 0 000h !Ceؑ
0- @p0 L S
St t t0p 0p00
0P S# H0
R ;H0% H0P 0 Sp0
S 00 0 ST0 P0d 0 R
4 @ 0p0 S 0p t @tP0!Ce~~~
- @L Pp(c"-0 ? a 0 X 0 R 0 S
0 ` V c0 Zc k P ` Pc 0wt
-aLM @ DP, `b䀟/ v0'zzpp᧢?
" bH0 0 Y 0 R Q
#c0 @ d 0 c 0. P 2 0 b
A TP,0 U (Koc 0wt
-L(ML0 0P SL QI L0p -b1H`K @0P0 2 W P P* X 0H0K P 0 )0K Z :\0 0\0b H \ tb\0 Y0C\0 pP
h `@ T bL0 P (K4X~
- QLM@-`| 0 S`x R 1 ` 0<0 0m 000 ƪC @P ?
0 S
u, dPX0 0` $ @P` L0
o P | ` ]40 M8540 040 @ M840 ^` ~ T T R
D @ 0
,0dPL04 T
20 S
80 -@
X0 p` 0# @P~ ' P , X ]40M( M8040040 800804"2 0040 0_ P V @
p @8 40 8 040 TT04040MA 40 S ٕ @ S
"X ] T0 T tC W*
0 @n P"
ῃ404
0 @_ P
ᰃ40040 00X ,K 0 p`g @ @\0 S
, P
5
V
o (K \ @ W\\] K]s]
-LM0 K
-LPM p` $KI P6 T0<0 $0@ d0 E!8 d K
P
$
( TP$ d@, - 0 " P
40 L0 " g K
-餠LM \(`K @ $ P | \4P @040 !@ 40@040 \ 5(@
T \$KD0
-L
-45L
M`, K t pPB ,0d 0
S9 PFWFWFW GW|GWGWGW HWLHWHWIWPJWJWJWp@K, P pP , p@K P{ pP B p
p@K $ Ph pP $ pp@K ( PK`V RA pP pP ( @K P@A pP p`K ( 9A pP @K -A pP p@K @ P! @K @ A pP P@K @ ` A pP } 0@ KT3 0T@ X3 0`\3 `c @ pP T@# T !nK 5^K( {n `( vn PK0K 0 pP 00 XA pP 00( \A pP
` A pP T@ A p!>K V
Jn5>K UF
( CnA PNK @ @ pP8 0`K t pP1
A
PNK @ @ pP$ n pP @
|` (} @ +u@ pP b p O} ep, B (K\Xw
0-LM,@K P S@ P K0
-LM ! p S@ 8`D
! ; PX 0 S D T! XK
D1 |? 0(K0( P 4 σ< 00 0 ?4 & X
0 |( , P `
P 00/ S
Sl
`
0 S
@
+ (0 |408 0 (K Xw8 ]
-`\0L M P@ K pP
0 0 0 d 0s p K\
p- `PLH Km @ 0 `P @ ` =m p
-L M @ KP`+ pP 0 0 d 0\!0; p + K谠^
p- `PLH m @ 0 `P @ ` m p
-L$M@ !8 P<0 @ l p 4 Z1 @ `0,KD0 /
P) 4 U T * 8 <0 H H P 03/ P
0 5 D P P@
,`0 V 'Z Y @ 800 S
d 8 <0 P U
03/ P
@4 U T 0 @ l (K 0D ]
-0 ML u K P@
-L M 1 p0K 40 8+ PPG 00@ 0 S` !( `P,K
/
P U(
d P
U ,@嘠 Z Y* 408P L0 S
P m ` i @ គP * (K
- ` @L Pp) P
Q P P H 5 P hz
-LM 0 a P 00 @ C P $K* P $0hp f 0 S !M( ) X 8 9* K
p-LHM@ KPd `P T040 08` \0 K 0 \ K `P
L0 0 0 S` !( `P
) Kp
-LM 0 Q 00 @` pP
K0 pP 8 f K
p-LM 0 A K `P
8@ P ᆁ 0 0 Kp
-p0LM P`P
@P P
(0 p \0o P 鰠^
-L M0 `P0 @p
K pP
$0K 0 R p $0 0 KN /
-LMP @ ` R @dp @ 0B T 0
x 0 KM 00 S 03 P P 3 # 0 K
-LMp(PK % d3 P ,@@ T @3 j `P
0 P `
j (K
00- 0L P@B 0P
0(0 S
0hF 0- 0
0 Q-L p@` 0! Q j PP
= P Z 3 Z P
T Z j
@ j _
p- XML @0 `P: K `P5 T0@0 0D` h0 < h K `P
' XP K e ` V (K < `P 0 K0 0 S 03 0 = `P $ (0 S`3 : = ` Kp
-1LM\1A ` 0, pPa ]
[ 0 K4K* pPW 8 K0P\ pPD 8 ,KA pP? , 0 S:
- pP6
, '( pK , ] 0 0 , & pP" , E& pP
,0 W,0X X ]W , 40 pP , ' 4 0
) -p
4 #*, P
" 8 p (K谠^
-LM0 0x
-LMP `@0 pP K pP
$K p o W $ p$ K
0-LM@PK 0 P | <K0
-LMP @`p0 P $ K P (K$ $ 5 X
0 0(0 d 0p ( K
p-LM@ `P Hi 0 P 0 0 `P < ` 8i p N /
M-LM@ a 0P0v P ( K P ( PP ( t 0@0 (0D h0 < h Ka Py Xp W0 0 K[8010:#:J T0 0
T00
T
T '0
T 00 0 00 0 0 @0 @ 0 0 r 3 S R r r & Q&
S
' S
S/ D@KT G' P
T & T h KT $ 0K$ P X
h KT $ 0K$ T DK|& T P
W
( Q( $K
-L M0 D K
-LM q` $K @P7 0@0 0<0 $0dKd0 8 @P( T0$P S
P ;& P T0 P
T
$ @ @K 00 80 P 1*0":0 0y$ @P T
$ KN / 0d r d r +N /
-1LM\1 p a1P w X @ +0xy pPM $K pP
G * t P$ p?
1 0 S
0@0 0<0 $0dKd0 t8 9 pP& T0$p S
P % P T0 P
&
T
p PK %00 80 P 1 @0;;0 0h% pP T
$ 0 v K谠^XwL] N /
p-LHM K* PP2 0`8` 40 0\@K\0 $0 PP# L0 S 40 H 8Kj% H L0 P L P
P
$@H & PP
H Q% H Kp N /
p-LHM K PP0
@P P( 080 040 0\`K\0 0 PP LP$ L0
H "% H P } P H $ P Kp
-LM ܁`
% @P 09
(0P S. 0 S+
0 S
S
S
% p K ~# 0 0 % 0 S p 0K `p p 0 '$ 0P 0 0
0 H%0 (K
-LM `Pp _% @P%
0 3% (0 S 0 S
0$ (0 # P
(0K 0 p堕 % K
-LM 0K # K
-LM `Pp % @P%
0 $ (0 S 0 S
0$ (0 # P
(0K 0 p] $ K
-LM 0K # 豖 K
-LHM0 `@ p: K pP5 T080 0 PP0 080 040 0\`K\0 80 PP! L@0 SP H P
L0 0 S $ . P P PH 8Kn H P Kp
-LM pP K`A @P 0 @
$0K 0
@ @p
@ @ $0 Q
@_$0 0 KL
- 1L@8Pp ` ]v1 0 0:1v
p-LM P`l K @ L T 0 P
b P @ # Kp
0-D0LM @ K ? PP P J K0\
-0L P cb p
0 S
0 S 0 W S p P `W
<@ n p` ` Hb SbP
0- L @ P o Q0
-\@MLT b L<0 0 0 m KW]
p-L @ _ PP
` `u u `u80 P 080p p
- @L P T
u p u u 0 0|_` V u u r_80 `080
- `PL@p'
800&
_0 P S T R P
p s00 T T W
_u v P
00@ ]
- @PL
80
X0 a 0 S 00C S0
P 0 R hu
- @PL
8
T0 sa 0 S
P@ T
P
p- QL `P @
: Q y P 0 S q t0 0 0 S Pu 00C S 0 0 s p]̞\ 0 /
Q-L @
P qL P
< K8 K @P
L L #@ xw
-L L hLxw
-80L@ p
` ^ PP
@ @ pt0 0Pt
-80L@ %
` p t0P R R
P U
S 00 0 R O^ t U
-0L P . 0 S+
R0d@0 @ T#
80
, p `0 Q 0 >t@ 0 3/ P @ T 00C S 0 t Z 0 ;0
- -LM q
0- PL@ @ T
D P 0 0
-0M @L 0 0 @@ @@@IkP0 J0@@D00@0唀0@`0 J
`0p 0 @H0p ]!: (0p : K]22] ]+\WW
0-t0L P l @ H 0y, 8 U
009dPH0 s 02\]
0-H0L @ LP s J 2 0C 2J m, w0 0hl22
- pQL @`
P< P |J0
i Z
S J 00 00@0 @ 0 X Ph`@0D@80<@
3K 9H07H0 ) W
80 L0 0L00 P28^
- @L8 9Jl p0( Rt p00p0l 0t0hwJ2
0-H0L
P@
@ T
P 0 0 0 0
0-H@L J@R 4 @, ,,2 S
@2 U
0hEJ2@43 ⺼
-\0L @ S\ 0 S \ Il p0L Rt p00p0l 0t0 0l00p0 @t0l@@h J2
-\0L @ S ʌ 0\00C S\0 0 S d Il p0T Rt p00p0l @0t0 0l0D0p0 @t0l@@hI]\2
-@L T
T00C ST0 $$ 0ZT0 S , h!]\
p-L @`,P H0 p
-P2LM\QH0 @p
: H0
a 嶨 H0` 80 0 P
Y0 E
0 P` V`e hP" * d> 0Q =x0 S t0 S:tP 0 U03 0# R48p | UPb $ U Q ` p ` p Q P `V p Z Y ` p 00 +>00 S , R 0
pL 0P 048`00 (K
M -LMƠ0 K
-LM @P0 Pp` S ` p f X *0 ,0 嶍 p ,0 / $4 ;
P( Php ᜍ 0 $4 ;
P ` p @ 0@ T S `p (K
-L M0@C d P`p0K4 P
0 0 ,0
0 P 40 p 0` W (K
- QL@M @\ H` =\P i= U
L X f0P 03 0(2, 005(0H场 L L 0S lG \ P
1 01 00 Sp fL1 ` 0$0D`@0 0L`H00(00,0@ SL UD !
L0 S
( @0 P 10 `L0 V<0 8 <00 400| t pP
< 800 pP<0 @
@0D L@ L L L L p (Kt]ԑ}]~LBAW
-Hp @L P$9 0 a 0 S 0 S
` V 0 0C0 0 S V9 iV iO9
0- @, L P
PK ,P P0 4 0hF0
- @P L P
LK ThK
-LPMpd @ ` T P W :{{ 40K 0 ,0Kp `P KPE p 4K \ 4$; , `Pt 5 Q
%_O`l U 0 T RPtK ,0,p @040K 0(00,00@0 0H0 $0 0(08 0H 0
0B W 0; ,0 0R PS 405F00 048P3 h l \0 `]0 /\ /$ R /b P / /
-L M 0 `P Sp @( $ K! @P# $ d@ 0 010 S 01 0 0T0 Ⓖ0$ 00
`f; P8 オ P3 g P 0 0 0 0q404 `@0@0$0 $ (0 0?0 0 0?0 0,0,000 0 4080 8 <000000HP0 100 P08p圀 f ,0T0 0 06 S 0Ӽ(8
T0(; 0 Q6 R 808@ 8 0808 08c,403/ P
P
P $0$ ` 0io APHX$^X]
p-L Pdo @ e phY
-HP @L$ !::#! 0 `, S,
R " R 000000 0 S 0, 00 00 4080 08 <02 P ( 000( p Ქ ᭤4 04hꐗ^
0-L @ & P P
0\ c P
4V 0C44 S0
-$ @L!::#! 40 PT` S (p v P P 0 6
% P 0 0; 0 S8
$00 S m> + 6 + P% ( R :$ 00 U 0 M 04 1#$ Q
b 08 <0 `\ i 0 0i$ꐗ^
-e/ P@ L { <(00 `0`p,p@ 0
0 m ? 4 8`l` / P000 [ [ &6 R 0<0( >4<04 0X000$08(0 00B* ]~]WEV
p-LMTP @ - X ( 0 040 S
14 $ ` $hX0&j j 0 0!. P!
40 S
4 $ ` $hX0&j j 0h 0. P
LphP40 S
4 X0
phpX;]
p- @L $4Ph `d0 V\ ``M U H MD @U4
4 !M,@ T phMꔧ\t\]]+\\^\
-p2LM R :p :@#v' @P~
TP (`$ 0Py
$. Q s % /0 , 0 p
0 S `c R` r01 p W 4t03/4p 046 㘐圠 (
0 K Z& Y ( (@ 808(00`0403/ P
P
P N Q X4 X X( X X [M x XM E h Md QM (K0 ,~^ ]]]*]C]W]i]r]]
-LM$T @ Uz
000 SN X0 XH X X$ X0 Xt X `q
`q
0 S
0
`q q`403/ lq `0 ` 0T0 0 0(6 S <L8L V
6 S 061!` 0 Kh諄8@ 6 S N 0 0 0 S
0 S 000 c&u) 70 nK p0 R 404 0 4 Khi K_]]]c]]\]]$^X]HX
-4L @0P3/ P `
P_
P
Z ( 6 lY @00;00000 0e664 ߏ $Q ` P ! :~ ҏ m> Pp} , w} } } 6@
0 m ?ᓜ 0 } 0 | | ᓐ F #` ጐ ` P
< < L ]
]]
]
] ]+ ]? ] ]{~]]
-p :P :L#Vt% @PV
" PQ
@` %D0PU S UD 0 S 403/ P< 0 S6
,
0-6 I x X
T0( U
2 S
W
W 0 UP 0 UP 0 0 0% 0 S 4 03/ %
萗^
-LM `P" @`P_ \ ~ 0|#|404 0`4 4$ 9MLM P 0 \0K Q
Q
P ( R \pK Mb$K ] P
` Q V000 S
/`K `p" у d M*5 T S0Ӑ0 L@20 6<6,20 6@066
L2 8Lp1 ` 0C0 8 @
|L1 0C08 tL1!0 ! /&66Ɣ 4;0 K ! 36@ 410
,1 !m 0 ?; 0 ` , m. 0 KM ! ' ;'T00! 0 jH -Y | x0C) P l L K X]]~]\!]A]L]x . t] F ]] @~]4~ ,X)X\
-LM@!.K P T0 K0 C(r (0 K 0 00 00 0K
0-LMP).K @ P4 0 K0 C(r/ -
00 S) ( < K0 000K0 (0 02K03K4#K0<K3/ P
` 0 0 0 K"]]]
-@ :`: #&L$M4 B"< 8 w6 P n
0@ j& p @b 5 VM
5 V
|5 V-
t5 V<
l5 VN `5 V
0C VF { D5 V
0 V? m ,5 V 0C V3 *5 V
5 V2 5 V
4 V* 4 Vx
4 V# "
X ,@ ? T0 X X Te/4 T04 00T 2000
@p !6T 06 X0( P 40 S
4 3 V 8 2#0
6 X#: : #T0
) 6 06! 6 Y00
6 Y0
066 0 w 0
WP ` 0 SE
B
S
*0 S
< P 0 u 0 P000 1D0000000 H0 0 0 0
060 006 02000<0"0p 03 U 0 S p
= p l 0 040(0 0, 00 1 H0:p C @
͕ R
6
Õ CT T ) `\ $
0 S 0, K P \@ `, h,0 \0 U (K萗^hdrdA}d(@edAtd@udvdgd~d({dЀ|dnd Q yd X ^0-X X$0H 0 ! 0 0 0 /ᰠ^qq
-0L @ !@0 !!
0-D0LHA T ʀ0 P ! P0 !! 0谠^
0- @L P1 011
^ 0 S
$ 3/ 0h}
- RL 0
R !+ !+! h F *G ^ ^
-LM( \` @4 ,0 !`P4 ,!4 p ! !5
!
- P
,$0 3/ $0 3/
$0 3/ $0 3/ 0 , $0 3/ 4 8 <0 <K 00K 0 , $0 3/ ( 00K 0 $$0 3/!
P
!40 TT 8080^^^g^]
-L MP@( ,0\`p `( 0
$ +
S
@0$! l D S
@0$ l D0 $0 R
S( ( ( $ $( P$P P P U1 ` V
P
$F jt1 P$0 40 3/ $P(0 U(0 0 $ (0 $0 40 3/ QKp$^^
-,0( \``pL@P @D(0 3/ T T
$0 3/0 S 0 S S 0Ө0 / / /0 S R ʬ R 0% ! /! / /
-LMP,0`( `0\p7' U@1K# X
@0$ L D @0 H D 00
30 ^^L\$- R /- B-- B R- .#+# /
-=L @ SP` s pP U $= Sp 0 * x= p S 蠆
- @L P =p S=
4 3/ = S$m V 4-8=< R X2 d 0 =00:-P0 `n`0Cn`3 Wb=3
= 3/ m i
-`0?L0 M02KP $0K p@K P P 0 ` P p K!
-L 0KM c 0
0-LM(= P S0 0C S@t 0Aӑ 0C S\ @0DӑP0 R
3
4 406 0( @0h 0@\\
^\
p-=L @ S
3/`$] U& h ! PP
`V x8 4-8=< R2 d X 0 (= S
{ Sy * 9 U pPp 2 N pPi \PK @ n `@ 2 pe W @0 pN )
S 0-l1 R ` $X1 T =(= S 9 S pP' P pP 0 S
# Q
3k V`
`
` P#.? $ 0 pP P U p3@
> G WD= ;D= K ! ^
* ( # ,Z0 0D- /d' / - R /$- R / E
- SL(M P@`7 DpK " w ⴄK̇ "0x K
-L`Mⴣ P
@K ` 㴣 \ `0 8B儀K p T`` W P 㟇 V@`p@ T0 㴣 K@$K
-ML MCK @ `$$ pP* 4$( KP$0A0 UR
$ B U!
U
U p$ U]
U B $ T$ Up
B U N 0$ UK
U
B U , An` F
0 ( 0 #(K S R - R
B.K B P 3( KB K
A d- H3 U D= H3 U D=
43 U D= 3 U D=
= S
B.K B0 P 2(K"0 S(
# B S'
S
B S " S
S
V B S
`"t2 T"l2(K <"X2( K ("> "<2"42",21( K Q 0
C.
0 Q : = Sd
0 Sp^ 1 : S0;ӥ P = SP
9 SM
(= S
S
S h! 92KK L, K0 @0( K0b 04 P, 0 >* = S2p&
9 S#p"
0 p P p
p9 S 9 09 - R
B.K B pP p p (K % F - * V
X
b
Z
^
T
\
-L MP! @`o P) p $0K p P! "[ R-
2[ S
h5 B \ < 05 0 K^-^
-LM@0K@# P 0 S K
p-LM P@ = S 09
000 09 S D= 00 K0 P (=[ S
Q Q
Q `"` `9 S PXhXhXLXhXhXXXhX`Xdl l k `KpD
-L8M0 @ pdX Q 꼃XXXX Xp7 S
Sk\7<\7D=0D={ t ~ D=㠅0`K0D=
8 Kv 0 u
m i * K0 h2[!6 Q" "[ l3010,1p7 S ( J , q F @ 10?0?\7 0? \ K"0 5\0[ZK S0 00Ņ ( , s q F p7 S
0
] w p 0 jp7 S d Y = 3/(KB b^ A $^oX
-LAM`B K P@ A# P 3 K00C0 S 0 S; 0 `3 KT3 Q:
'0C Q>
Q
Qn G $3 Q
0 Qg 3 Q
>0C Q
<0 Q\ . ?;A0C SW BK @ T 㱄 0S ST0z = S
D= I "l = S
D= A t"^ = S
D= 9 .\ = S
D= 1 8"N = SH
D= E
( 9 Sc
> S$ u 1 0 P$0 n L 0 P * @ $ $0L`B~KpG0$K 0 d > = S
B.K B 0K PL 9 X1 Q
#0C Q
0 Q+ 01 Q
0 Q$ ! ! !1 K !0 K 0 0 d- 0 Q! : 0 0? K00 BK @ H0 K /BK ( @"( K - b
R
Z
* T
V
X
^
-L M @ P } W = 3/ `P0 =
I(=pw p3 S00 S
`P 989D=0D=9 S) XXxX(XxXxX D=
4 4 : S0;ӥ .d= D9 S (= S 44 p (= S `C:
0D
0 A Qё ` S 3 9 S
3 9
: 3 A 0======(= S RK
S\3\#6m`-=>040 初
P
2 `0 4-8 R(0 0 ` < 3/
02 X j2<` 4-8 R(0" D < 3/ 4-8=< R4 h X 0>0:- >0 S> 3@0;3 099 S S
S
S
b4-8=< RX 2 d 0 S
0C S>02
/l@ 0 @ l0p@0h> S
0C S> (= S $ > S020h90L]
-LM @ `P p8 P
P P2 U 0C U; *<2 U]
42 U^ (2 U*
2 UV = 2 U"
0 UO 1 $ P[ # =
SR
9 S
+H SF
B . 08: 64 P4 3@ 2
w. @) 1 \1 0 P 4 P 3@
(= S
)=09 94 P4= = S
m (P q-00C S0 0, K
F $K2iii6i(9i5i ^
-LxM @ p =/t S
$= S D dPK < } =dKp0 >00 a=(00 ;(0 0 = S
> S 3;3r 9 S
Y U
0 S99 0090C9dK.0 02K ` 0E 9 ST P UQ
0 S000 dK0C0d0 0d h0 .0( P
4 003/t `P
2
0 t @ t e PP
l0 0l p0
P
<4 003/9 %K S .05K0@
t P5[05K
l0 0l p0 X2(}/ 9 S 0
D= 00 0 l X 0F 0 0 {@9 Sㅭ/ X 0 S
l U@
P
0!2 :",,!2 2 02 0 P
0
f@ X Z@x`|P @x`|P l0 A/l0 0l p0 @10=00 =0C== S- hp ⡇ >
p 0>` V
(K1 2 4 * ^\
-L0M] @ ( `| , 4-8=< RX2 d 0C6&Q0[/c&P0[
g'N0[s'0} (= S%
S% ;,(= S
,] ᭆ p ᑆ d㧆 d ` 0 %,0]dp ᙆ T } d㓆 d ` w P 0 D, "~ (5 )0 5+)05,@05Xr 04043 0994 , K0 P
.:2K
`0F,PK!0R3
>1
0: O0 0`VH \* K0 P "[0RBQ 10CB>A>A0BQ3 .!
*: S
(= S3
D=
* K0 P3"[
3d D= D-(- R
R9
RB D-0- Rb?D=
l R ژ0D=\3 R98<ø9Ÿ9 <983( 0-0?D= R ;D=3 R 2R 9;998<99 <92 <
H00-D=2 R9 <ø9Ő2 * K0i P 2[ S909
0HK00 \
00K `P_ 00 S\ ڸT[C UP I} 2 ,:T "0P B0C 0P0P0P
b땏 4 =4!=141:1:141<1<1<10}/0_ PE% 0= X (,%c0[ * = -0 `F V $)=0=00 ` 0.0~pp-~3;3
4-8 ` R (0 < 3/ p 00K `2[t$ Sn
S D \$ Sg
S 0 0 *0K 2[_0C S S # P
9 S D=0D= 9 S 4 3/ 갣[^ J Z#*K 0 :2[
02K 0"[`00
X.>0.0x0 0|0` l K S[>y (- R
R
R l0K >` XK)D D 2`P fہ ,2 P 1 #> K y K^ P > X1># & 0K 6[ 0Zy :[ ` 0*[ :[00c09[@0:[D07[H09[! S 0# 0 By LP Z 0>4-8 > RX 4 h 0< R %01 S &@ T
0 s & 040000! 0 0 0h20 40 R
| Q
X Q @ 0 0 <0 00 0 ^(XX+ r
-L @0 `L 0!K00Q U
p0 W
<0 ; 00 x`x ᧾ 0 px0 p Y
p W
0 $ 0+
R
U 0 (03/ 0 S
0 K3/ P 0 (0PE 3/ UK0
-Lp @P& w `
WF 01 SD
l40 S
0 W
S w y 0
s 00pm4 Q 00
0000 S
| R
p R
P 0
Q
0 / / /
Q-L @ 0 0 Q
0 Q
< Q
% Q A Q
B Q 0 .0 0. 1 /0 .0 0 .0 0 .0! / /5 Q0 .0! / /0 S
0 S 0Ҡ0 /0 Q :9 Q ; Q
h0 S 0!
0 B h00h0 /h00
Sh0
0h0$ Q / /t Q l0 S 0000 /
-LM3A @ Qo XXPXXXHX `` d0 S P` a ` 0 0A S h0 S 0!
0 B h00h0 h00
Sh0
0h0Ū XT 0b Q R 5` R
R
d B Q / d /
-LM,0 <0 @@ `
d0 3 Q h E Qj
H Q l _ Q
] Q *O Qw
03v :P Q
[ Qs o Qi
c Q
n Qk _ } Q_
~ QX
| Qd _ PhPl ( j PP 0<0<<00000@00D00H00L00P0001010 101000 1; < u
00000@00D00H00L00P01010 101000 1 <00 <00<0 00 \ 0
00
0 000 000 00T b R ` 0C0 R
0 S
0d00 00C R0" d 0 h( l i 0 0(A 0,A 0 0 0 0 0
Q-L @
: Q hh 0< @0
QO
Q
A SB
SY B S5
SR 9 S8
@ S<
@ S,
SC 0 P S5
S< 5 8 S
A S
S1 S
S* 0 0 0 /0 0
0 0 0 0 0 0 0 / 00
00 00 00 0 / /\+ - = ^- ^1 ^5 ^9 ^A ^E ^I ^ M ^S ^Y ^^ ^c ^h ^m ^r ^w ^| ^ ^ ^ ^ ^ ^ ^ ^ ^
0- QL @<0 Q ? Q
Q 9 Q
Q
* Q+
1 ! R0
, R0 ! R0
, R0 ! ! R 0
, R 0 ! R@P
, RP @P U
0 @ 0b .>b .>
d0D 3 b Q Q01D. >l0 S 8 l0 S\ 0
S \ d HPh @= 0 S3
S,
S
S1 $ SP-
SP*
S( % S SP# pC"! * SP
S (0C S R P$p 40HPLp@0D0P P P P P P P R00 K 0`` 0 J ? u& l ? p$? h ? E
^Q
^+\ ]0I]^
^W
^a
^j
^o
^x
^
^
^
0-PL @ U'
U \ c 0
/ Q
:9 Q00C0 S\0PC 0 R S\ 0 C @ 000
^
p-t0 `PL @ P
@ #b P000
P U,P b P
@ T p~~00 0 P B /0 S /~
- @L< T 00,0 @ 0 S 0 0 0 ^~\0 0 P R
R 0 0 /0 S / /~$0H 0 ! 0 0 0 /ᰠ^qq
-0L @ !@0 !!
0-D0LHA T ʀ0 P ! P0 !! 0谠^
0-HPL @0 S00 0 R 0h0@-H0 R
@ R%5 " b$ ( @0(P$ S00 T% $( 0 0
S -L
S 0 hK a
^\
0-80L P S
@ =, 0h0
0-<0L @ SP 0@00 0 < A,P !0 0 Y
-<0L @ S
A< 0 0<0h#!
-LM@0 @ Xpp SP(3O :S ` Y
<#D 4 ! 0, ' P,
.7 0 Z
0
S0%j2j " @ j <0 Z
` ` p 0 0 j 0 00 S 0 P 0f W`` V Z
S`
`< 0P `
^
-LP @pAP `
0 R X@ P
p-`L @ VP (0H @000P p p褮\
- @L O@40 S
040 '80 S
0 h!
-LM 0p @P R 5 %<"0b S 3 :,`K p: < 0 0000 RP: K P
Q @0 Q
00 @ / / /$0H 0 ! 0 0 0 /ᰠ^qq,0 0 R
0 S /
- P`L a V0 @P0&
( W( a 0` 0 J$ pra 0$p ] X > P ` ] 4H 0 ` 0 0 0 @@^" /
0-00L P @ 0 5/ @ T00@-t P 0
`0 @ P @ BP@@@@ P@ U0 0 @0~
p-`PL@ V
S
\ R
V T
U Q
u_ p 3p p p p
-l0LM `Pp @ 0 P
00 @ T $K
p-00L `P @ 6/ @ Tp
p-0 M PL @0 PP` P
, 0< 0 0"00 Kp
-LM @( l PPh
\ ` x [ p UG X p0 `< `a H pP - ^P= 0 $02 0, ,
\
@⑊* b 0 R:0 S *\Á 0 0 Q$p`0 000q P
" P (K^
^
-LM @( PPt
|\ ` p F p0 `l `a pP 0F 40 7 4PG 0 $02, 0, ,
Q
4 .0 R:80 S
* " S ȁ 0 h 8 0 Q$p`0 000 P
P (K^
^
-0L MHQ `@ U ʀ0 p ! p0 !! 0 ` p ! p0 !! T
T M 0P
q K谠^
- L @P
0 R
0d$ A0T = D: R4 ,0 1 ^
-LM p PR P R
0PER S@
0 `000 P@ 0 U
0 U
$ 0!!0 Q0 P T
0 T
R
$
@ P `` P @ Q \*0 @p 0 0 00 0$K
^\
0- L @$ P
P U < D
PE U P
U 0 0 0^@- \2 0 A$<#A R+ R' 1@d R 1 \!
S
P P b R 0
R0
R0 0q 03 P 0 S 贮\$0H 0 ! 0 0 0 /ᰠ^qq
-0L @ !@0 !!
0-D0LHA T ʀ0 P ! P0 !! 0谠^ 0 p
P / P
/ /
-@0L Q
0 S
0 S
0 03/
-4L P
\
00 8 @ C^^
- @LL@ 0 R /L R L /
-L9 00 FC
-L M`p@*t$ X 10 W P
X4 W
L4 W
D4 W
<4 W + 04 W^
$4 W 4 WX
4 W $ W
3 W_
0 Wu
3 W y # W+
3 W # WD
3 W
d0 h t
0p x | 0 0 00 0d0 h tP S 0 000 0 000 0 0 0 00! tP R0000 0 00] S
l `P
P 0 000 0 0000 0j P @R00000; L `PR
n i
0Sh
p \ `P \ `0 , tF 0 R 0 0
R4 0 0# 3
@< S 0< S- < 0 S
( `0( K 0 ( $0 $@ `P `0@ `
` L d0 h 0P0 U P@@P : 1c 0 *c @ phj$^
p-L MP K " @hP `& P
,00 P R,P V4 , 40 U V0,0 P 8 KKpRW SW :
: -, L#@L P
hx ^
0-P : :L, #@qL P
0hM 0^
-` : :L# P A 0ph0^
p-` : :L#\ PI0 @ S 0L 00 00C S0 9 pp^ :
: -8 L#)L@ T
L T ^ :
: - L#P @Pp
p Wp P U
T0 S
L` Vp 0P NLP` ) pP
L` _ ^ R
Q 0" / Q00 0 /
-LM Q @p` P 0q<0 0g
U
\
0
P P P
Pa0E8S 0E8 S 00 U 0 S
PEX%X P;
S$ < S!
S
S ! S
S 1 U ; 00 R ; 00Q U wF ` V 0f`F0 VP`< P ;h b;
S%
00
@ E( U:R P 2 UP
3 E(RPEX%X 8 UP
/ U P
0 01Q PX%XQ $K 1 % # ( $ ' *
-0LM P2
0 S
P,
P@(pK,K 40 C S4 ,0 0,0<@8oS:
S
>;
S
0 0 3/(0`
Q 00,
, ,4 $K
Q -L
^
-H0D@L $ 0 049Y$!Yx!Y
0- @ PLP PP P0
-LM `Ppr0 @ S
00 {= 0 S&
` `P0 P0 S
P`0P 0P U P!
P`P@ : _ 0 _ D= L P
0K 0P ,p P
G K$^^
0-L @+
R / P / #8 S /x\
0-L@ Q) >Y >Y<>YX>Y>Y<000 PP P 0 000000000 0000000 0G-81 R/
`0P@00PP00AS#P PPPPPQPU :p Tppg0C
pg W0 Q5%0@ᶠ0 t0 `dP 0@σ R"p W p X
# 3 R0C? 0
-<000000L 0N P U 0` C
@ T@|DxoW9 z
W6 J$
Q3 0 A oP
P
>
P = P
Q
Q
Q 0 P P @lDhoV J
T
U Q 8 h# SP:0 S
^
p- 0L ` P@P
S |
` h 0,
0 Qp ^
-L(M`T@K 0 p W
0P U
X _ Uu 0 \PKpH0 3 @@ \@XoU Z
U
\ T S N @8
PD
P = P
Q
Q
Q 0 L oY
\
P P: Q P "f 00 U:pG W (K*^T^
$0H 0 ! 0 0 0 /ᰠ^qq
p- PL`Ld@ 0 03/X@ T p
p- PLd@ ` 0 03/L`X@ Tp
- @L@L
-LMp Pd@ ` 0 \
00CS ) <:0<:0
'. ""'. Q 0'
P`0Po Q``" 0 XR!B P" P `` 0 0 S 0 R (" 0 B "0 , 0 B 00K )} U<:0<:@Z䰡 S# `0 p `ZWP U
R 0;<: 0<: R 0&"
- 101 pW *0Z R 0 ) <: 0<: R `%"p
- 1 P01)-0 0 Sؼ S 0 00 <:0<:` V P Up
` D C <
(K\^ j 2?f'C ^^\0^u^
0-@0L< @8P EL ( )L 0P 0 P@ 0 A R0 * \
c /@- Q *@@
l
-0BL M R" S 4 ` 0 3@P pE U W0 pp- UPp
+ U@P v 3 V V
0 U 0x SX SP`@
R
0 U
``ɯ
0 A 0 ,
0 A H D 8 00 E P P A E P7 a E P& W P` U" , S 0 R 0K "#
8 U Q DH
, ?
P 0
r 04 Z
4 QD (K^@\
0-L @ P 00 00 b" 2 /UUUU3333 0 R 0 R / Q 1 / Q ! / Q 1 / Q ! / Q / Q / Q / Q /
0-L @ \0
PL U@` R L? 0 R B P \ a 0
- pL @ W
` 5? P @0 S
S _ P @ @- 0 P
pP@` V \ @ @ V QA- D3 B , , R
@`3 `F , Ġ ̌ q Ƞ ̌ Q ̌ , ,,,, q, Q ,̠ ( Ġ ̌ q Ƞ ̌ Q ̌ , ,,,, q, Q ,̠ ( Ġ ̌ q Ƞ ̌ Q ̌ , ,,,, q, Q ,̠ ( Ġ ̌P q\ Ƞ Q ̌ P% P%P% P%% q %̠ %TP\ , ,, V @k 0 P@ PE , Ƞ ̌ a | ̌ q ' ,, U
0 0@0 R@,@A,$ L\0@-@ 0 PQ 8VP% %'Qp p CA@@$ $0 R9 (1!04& "000"90 ߰( 0! !1!0'Sel0A-P0 0@$O$4$0'S@'RP!'^30 @㴀 p `'''\p' paPE`` `@ 0` T @0 U'.T@ " ! !!l'\ 00 R10A+el
f eX]@- 0A$à !Ǡ !! !p R c c 'Q' A" A A @$ $V, n ߰
0-9L @
0 09Y PepU 0 "0
0 /
0-
L PNI @
;I 0P0 0 /@
p-L @` P P U:p
p-PbLM P R
83 U0B FK/) 1 S
0Sp FK"E CSEef FK P _ 4Q `a U
N FK@ N <@ O lA1 SO 01EX I[' L1C_ 10 Q41E7< 0 K RF/K0 S 1PFK@00`` R1 0 @ @@c T0K 0@` x1|AL0 @0 0 S
4 ,0 !0 0 S
Kp@^^2^Y^
-`L p @P T ` iE eA@@@ T E0 h1p { ,0X PP0S
@ 40 | P x1 R h#@^
-LM K K
-LM PR@$PK0 p`? S
S
* SU
[ SR ) V p S VL M 0 S 0 R 0 F ` P
P<
P
- ` p0 S V ` / + 0^ Q Q@ ] R@
S0 - R T[ \
] X
V \ 00@ V 00 R S S p K
-LM @ 0K # i? K
- @PL
, _? @ ( ? 0 $0 L\G-$M ( Pp`
`@pP 0c(#("$c$"2 @ Q 0 g35#<# 0 "0$0 0#e!&" e+" 0 `@`@pP0
Lh ਠ* c**
*
威! !% !b
b
@ Q
P P@ @ 000p 0p` `$Ѝl\
-LM `P@C
$Q ?P U $
0( 8 R( 8 b
@ R
( @ b7> (P 8 8 /> ( 8 *> 0(0(P ` }> %(p P(K 0
c(#("$c4" (0 k> P` U: h > $K
- PRL @`S
?
@p` U( : N> 0 0 $0 Pg` 1 p(# p
0
0 $0@H@p? X @
#>
0 0 $0@H@p? X??P U
( Q > 0 0 $0 M
- @PL
, = @ ( = 0 $0 l\ 6
- @PL
4@ = P = 0H L0@ D0 \
-LM @P 0 `` 8 40 (0 PP L` `` \ X 0 @ <0 80 H D T 0 ,0 ǟ@ H@K @K 00 ,@ H D P K @P <` \`K` \ X 80K P L0 8p 4 AK T@
0 00K 00 ,0 0K
0 &97`0 %97d0 &79x0 %79|0 0 , |@K d K !;40 ;40 "@K ! "0@K 0@00 ,@ H K @@K 00# @0K @$ 80K 0 , PK "0# 8@K P K @K ! " ! ' ( ( ' 0K K ! @K K !A?K 0! 1 \K 0@K 0@\0 X@ A/K 0@K Z ! Q@00p , d \K \P X` @ @PK0 H@ DP \`K` \ X @P <` 8pK P` Lp 0K8p 4 0 ,0 |0K TP A@Q$dl` %dl` `o` `o` pK 褠K S)*| x |
PCPlp h@ A@Qan` an` if` if` pK 贐K %S() 倐 }dTtp p$C`Lpp@ q0 `d a 蔀 吐 唀K p
p 吀 |K lK)*K p
p 吀 tK脠K )*K p
p 吀 HK !i g` ig` !g i` gi@` pK PĠK )kd` kd` *ԀK)* @@K H D HpK
P\K )
* @K
P@P0pK 8K `& p'H D 8pK 0K ` pHK `&
p'|` xp o"a` o#a` #nb` "nb` K pK `& p'H` Dp HK lc` lc` pK )*|K p
|p x PK|K pP \| x @` P
`` `` 8K P`P `0 0`K` 0 00 @`K`
0 0 0 0 $0(0 0( ,0\K 00 00 4080 08 <0(K\L\
p- @@ LDQ @ DH P UH L
0P p RP p b
R
P b:; PP ~ 2; P p -; 0P0H@` ; |; PP ph
-LM PR @`
@ "
p` UP 0i : c; @0
0 Z@ D0 Q H0 0H L0 Pg`r pP< pp e@ + 0 Q@ D
P H 0 H L倀Hp X
;
E@0 0 S@ D0 R H0 0H L0倀Hp XP U
P Q: @0 0 Q@ D0 U H0 0H L0 (K
- pPLP
!` @ @[@ T s:
- @PL
4@ : P e: 0H L0@ D0 L\=
- pPLP
` @ @.0 T F:
-L|M @@ h K: h0 cc4800l0 l ?P ` ! 捈 d eQ`̠` p`| % pfllldl `%``& \`}hff$( (`
*P
`XP͌gqeeTXPP'pP
P*
PTmljj t P , jj ]x fa Lp & pjj 午 eQ H % jj } h D` ( `jj ͌ gq P ' P@ ml``
, <吠 ]hh
fap & (p8唠
hh
eQ % (4嘠 }hh `` (`0͌gqhhက P ' (P,mlhhᄀ l ,(
!]fa
( (菠l |p & (p
"
eQ
(}
(菠| % (p吠`(
!t! ` (` *l "͌
"gq/ '0 (PpPxml
0(|]0#
0#?p0 p: ,(t fa午
t p & x p eQ}
x % h͌
p
` ( ` gqm *l *t *ꯠ P ' P l
|]
,x ,*
fa午 ** *ꯠጠ p &*eQP P
p)*P *ꯠᐠ P}%*P
h͌*pP* *Pꯠᔠ `(*
`tPgq *)m
)韠 夐 P' *
Pll] *x * *ꯠဠ ,*
|儠fa午
)
)
)韠ᄐ lp &*
p !eQ} * *ꯠl | %*
" *h *ꯠ| `(*
`p匐͌* !gq
! tP' *
P )l
"m "/l,*
px]fa*坉*|*ꯠp &(p pt圀eQ}
(
((菠t % (xi͌
(
((菠ᜠx `)(`
gqm
(p
(菠0P0圀 ' (P
#l0tl(5
(菠ሀ
ᐠ] *| xfa (
(菠 ࠀ p p坉eQ'p**ꯠp p pp匠
(*i*ꯠ ` `吠 },p堀` **ꯠ P P唠 m,t匀gq **ꯠ ᘠ l]fa
)x吠͌ (
(菠က
|儠 eQ
)唠
(
(菠ᄀ
p pl刐l! *}*ꯠl
` |`ࠀ
")`
)韠
P Pp匠m(
!gq! | tl * " "/]fa xp ͌*eQ
! !
p pt圀l}
(
(|
(菠p
` `x`m***菠t
P Pࠠ圀gq]***菠x
刀fa͌*l*p*ꯠ
ࠠ吀eQ
(t (
(菠ሀ
p p唀l}
(|
(x
(菠ጀ
` `吀`m***ꯠ0 P 00P0吠 gq#0*]*0ꯠᔠ '(fa͌
(p
(
(菠ᘀ &(l eQ
*t**ꯠ yZnܼbʀ 儠p% (p
)xl}
( "
(菠ᄀ `, (l|``獈
`&
`&
`&o l` `*P
PmP
)gq)韠Pࠐ | P'P%P歌 !,h ,ϠP P(P% pPfa
% lP))韠 p &
"pt Pj" !}! P * "| Ppx`] ( " "/p `
"`t gqm! ' "( (菠
t xeQ
(| "
"/x % " fa
"l p(
(菠 &*p
pa-
p'ࠠ
p't
p'P! *p
Pp唠`]* *xp
,Ϡ` *
`b!m
p' '*菠p唐 "*
'|p刐eQ* p* %*
fa *p
* *σ&) l a- *t
,,σ!P *
Px,
)`0p) ],` `m `0b! 0PP 0 (K00 0,00(00$0 0 00 000 /#EgܺvT2
- P Lp1 S005? 02>005 0? S` @ @@` M5 @@?0 S: P di;5
0-LM P@ 0 S 2 K0 S l h 0~?
S K U
0# !1" 0 SK0=^\ 0@- @0@$0 0 00 000 000#EgܺvT2
-L\M @@ h K4 a h p%d0p'epz
0 )`ˠl (` h P' 0\P%p g{PXp (0X`,h lʂ %0T e[
0, 0#P
plˠpg| 0 0#L ` 茅 0'0#PPH0g{[0(0#D`hʀ0% 0#@ e[ 0, 0#<
plˠpgy 0 0#8` 舅 0'0#4 Pg{Pe]0(0#00h̀ 0%, 0#e[ 0, 0#pLp?g|lˠ` ``X`l` P4Pe]g{ dl̀fk @ e[ p Ppzlˠ` `k` P\P\g{ Ȁfk h e[ p Dpgzlˠ` T`h` P`P[g{ 0ʀfk < e[ p Hpylˠ0` 00`\=fj` PtP P@t P%g{PZ0 (ɀX fk( `
Dp e[(p|` lˠ (`fiHP` (P[d g{(ɀ` fk( Lp e[(pgyh` lˠ (`flPP` (PY4 g{(l̀< fk(
Tp e[(pgz` lˠ (`l0` dP; (P]g{ Dʀfk < `
e[p @pgylˠ` h`h` P HPeYg{ Ȁfk X e[p 4pg|lˠ` \`k` P LPeYg{ ̀fk 0 `
e[p Tpg|lˠ` P`fm` P P`]g{0 00XX9fklʀ h,e[ Tp lˠpxD` '` `荅LP ```(g{`Pj PPP&hPl̀` PPP,fkP e\@p % pl y0 'e[ lʆd`,g{`m\ &lˠ `
HP fkPY<p%` pgy 'e[tP PtʆP`
PPP,g{`Pfl0Plˠx` P& `$7 T|p pl
P , 0Lp` ` Pp
` `khPPP&` PˉDp PPP,fkP隈Pp`pp)lˠ<Pp Y% pi xX` 'e[ ` h4 &g{ P͉, fk P lˠP\Hp %` p g|
'`
de[芌` @```(g{`lɀ\ ```,h `` P``` lˠ0P `eZPp`4`%pg}` ` ``<`ke[ \ɀg{ L fkP hP\lˠp 4pgz` ` T`fle[ @ˀg{ 0
fkP P\lˠ p Hp|` ` `fje[ X̀g{ D `
fkP PdXlˠp
`pꩆ` 0`
02芌
`pe[``& pT{j`
, `dlh P P\ Xg{
Lʈfk
*
0` e[pP (pg}D` lˠ (`fm<P` (PeYH g{(lʀ fk( `p e[(p}@` lˠ (`fihP` (PYX g{(ɀ fk( 4 e[0 Hpd0(p}lˠ` P`h` PX yZnܼ拢P$M\>pmvmzNSP]g{ dl̀fk \
e[ p <pgylˠ` `fi` PhPe]g{ Tlɀfk `
e[ p `p{lˠ` 4`fj` PDP[g{ Llʀfk @
e[ p p0xlˠ0` 00` 0c< `'`&Pg{Pe\#!@c;̀ % "X
e[ `
, "ppd lˠ{0 "T`` 0c: ' "HPg{P] # "Lc;lɀ% !
Pe[`
, "pp` lˠg|0 "4`` 09 '!0Pg{Pe]#!hc;̀ %\ "
e[ D p, !lˠ`xp0 "` 0 g+ 儀| : ! < pP Pʌ4`S p0P`x倠tp l`P`*Pae=
0 (K
-P @0 L? @`` 0 Up 0 `3 : P `
C/ M I` @G@ X V * @ fm-/
0-LM0 @# K#K0K#"<0K"80K K"4!? @ b R@ PK | B0K K U
0! !! 0 S \ . K0\ 0 @,Ġ@,Ƞ@0,̠@ S : /G- LM@@ 0 `phd p`p Ql` pH @ @@(L 0 0(c: ǃ$P h( Pa(` @P DH,P@0@@@(8dJP0 000 ȟ7P ,PlŃ0 P ' 4 P@ )KJb*O@DP0@@@8P7G<0 P000hǟc5P @ H̃ P a DP ' @ H@'
000ܦc5
$Ɵꭃ
8Ɵ pƟb)
0
0 PƟc6
40Ɵꭃ
Ɵ %lɁ 0
05b&0
00ἅ0= 嘅 ,xlɁ @Xb&008= ` 0 p3 : !, @ <@p?0 S: @ gi,
0-LM@ P K L!? 7 R8 bx b K X + K0\ 0 @,Ġ@,Ƞ@0,̠@ S : /G- DM@P 0 @
`phd p`p Ql` P .P
@@ LP0P0:PPƠ ` `
@ @,`0@@ @J`0
00$`6 (Π , @ 0@*0@4@膠0080>
<̠ @
& 00
00t>
P͠
,
)
0 0܃>
(崃͠
8匃
d)
0 0 <>
,͠
<삟
Ă)
0 0 圂>
0t͠
P
0), p!p'00r>p`"`& aˠ`P# P%QP@,@$ PA(@0 P!AP%0>@P"P% A P<ˠ@hAP# P%@ PLA`,`&@ (( P!0$AP%0>@P"P% APˠ8@P#@ P%@P,P% @P(0@0 P!@P%0>@P"P% @ P ˠ@P#d@ P%P,
0 00@P% (0 @ 0 DЍG) yZn 000 0 000000 0 /#EgܺvT2
-P 1 @ R05? @p`02050 UL>` 0 p3 : * $ @p?0 S: @ gi)
0-LM@ P K L!? 7 R8 bx b K X x) K0\a8!`( 8a#!(` 00@-"D
-`x Px't 0L`t'0`.
1 0 E
1 @E PP
1 0 d
1 P0 d`VPDD't A- 0Pp0 C Rr 0 S @
` 0x SX S0 @`@`
0C X V 8@C T] 2"0 B V P 0C X AC X aC X
a0C SA0a0 0c"0@. S R U: * 0 S
P2 C S \1 T .
0`P U
U
U R05,1 : R *0 < 8 R 0 < 8 4 Q
b8"8#4b$# "40"8",0
-LMK{ P K / "# / Q : P : / / / c b PA / / ` a PA / (0@- H!8 Ƞ$H
RPl Pb0 #3 T@c @d0,2 \#H8%Ƞ
@dl T00A @ 0 Ȅ \2 "0 Q
-L pP p pP S`@ r 0`@( U T 0@ U 0#03pg pe0 V`d `f00#2 SP `fP@ 0 X
0s @ R / R B 0b0 / / Q P : / / / R / R0 B 0bQ Q / / / R C /A 0 \ R# R!
B / 0 0? @ / 0 / !! 0!! 0!! 0!! 0! / ` o ` /` `! / / /
- pLM@P `0 p 00 , , 00 P
P R 0! R 0 ` 0 ` V X: U 00 Z p S (Kyaratcid0 S /0 S /
0-L @ PP
000@ 0 0
p-L ` @P
,$ PP
-$ P UP @ 00 0 p /
0- 0L @0C S 0
0 S P $ q 0h 0
-H L} @P
0 0b
- @PL
0 S@
C 0 Q P /0 S 00 / P /0 Q27 # 0502 05 / /
- `PL@P
PP pP
@ T:
0- PL Z @PP
P 0
0- PL Y @PP
P s 0
0- @PL
0 S@
0Q0 S @ - P @
00 X 0
0- @PL
0 S@
0Q0 S @ " P @
00 = 0
0-L @N P 0 0 PP P S: 0
-LM 0 @ S (0( ( 0$ $0
0 0 0K Iw]+\?^P^
p-LM 0 @ S `0` ` 0\ \0
PPE U P`
P0 U:t Hph
pW Iw]+\?^P^
-LM pP4 ` @N 8 K00K W PX
00 SE
,0K 4 K L P808 40 0040 X S
SA X
P4 <
U00 4 4 X
P4 *
U00 4 b
4 t P X
4 # 4P @ T V
u W
40 S 0 4 P
(K
-LM @SP `p P
0 PP
XOP 0m P
- ML0
0-LM0K@ 0 K 0KP P 0 R 0 R
R
P K0
0-L@ P 0
0- @L PD 0h
0- P@L 0h
0- P@L 0h
0- P@L 0h
0- @L P 0h
- 0L M@ 0 K0KO P
0 R
R
P K
-LM @RP ` P
0 ) PP
p WOP P '
0- @MLP0 @ P
U
0 0 0
0-L@P P PO 0
0-L M @ K0K @ P
0P U
U
K0
p-LM` 0 P@ P
e P ph pO p 0N
-LM@ p`0 P P
I P h O 0loob 0rbmn 0rbmn 0atad 0gnts#
p- @L `P: 0 ph
0- @L P- 0h>
0-LM@,0 Kk PP T
? K0loob loob
p-L P@ ` 0 phX
0- P@L 0h
p-LMP@ K<08 `P U
) T
Kpatad
p-LMP@ K<0 `P U
T
Kpatad :atad
Mp-L0 P@ `+ 0 Kph
0- P@L 0h
0-LM@@0 K PP > POP T
s K0atad rbmn
p- @L `Pd 0 ph
0- @L PW 0h
0-LM@,0 K PP T
K0gnts
0-LM@,0 K PP T
K0gnts gnts
Mp-L0 P@ ` 0 Kph
0- P@L 0h=
0-LM@@0 Kj PP POP
T
K0atad rbmn
-1L M\1 a@ 0 P
0 PV`4 P 3 P @ `*
D 1P
~pL0 3/ (K ! 0 0 @ ` D `P , `P,0P 0 ( (K谠^yaratcid ^
- P L`p @P !
Ï P
l 0\0 V
T0 VV , P U P X ^yaratcid
-LMDPD` @@p 0 @ p @ 0[ U: KL^l^~ yara tcid Q /yara Q /tcidJI
E /
? /
-, @L ㈡ P 0 000 @ ^ 囡 ^ / / / /
0- 0L @P` 0 p W
0 0 P
S
0 0 0 3/ P 0 0`0 S
0-L@t PP
0 P P 0 0 0tcid
0-L@a P 0 P 0 0loob
p- PL ` @PP
t P & p
0-LP< @ `0 P c P
Q
P \ P 0 0 0rbmn
p-L` @ `0 P A PP y Q
< P p p p prbmn,
p- `B PL @PP
P
p
p-PL ` @PP
P
p
0-LP @@ `0 P P
= Q
P * P $ 0 0 0rbmn
p-L` @ `0 P PP Q
P p p p prbmn(
p- `BPL @PP
P `
p(
p-PL ` "~ @PP
P K
p
0-LPa @
`0 P P
Q
p P 0 0 0rbmn
p-L`? @
`0 P f PP Q
a P p p p prbmn
p-PL ` @PP
A P p
p-PL ` @PP
- P p
0-LP @f
X0 P P
c Q @ P L 0 0 0rbmn
p-L` @F
`0 P PP 4 Q
@ P ; p p p prbmn
p-@L P `P@
@ p
p-@L P `P@
@ u p
0-L@ P $0 P P 0 0gnts
p- PL ` @PP
P O p
0-L@e P $0 P w P 0 0gnts
p- PL ` @PP
w P ) p
0- @RLP
k P 0
0-L@Y P 0 P 0 0loob
p- PL ` @PP
W P p
0-LP4 @ `0 P 5 P
| Q
P . P c 0 0 0rbmn
p-L` @] `0 P PP K Q
P R p p p prbmn,
p- `B PL
@PP
P p
p-PL `
@PP
P p
0- PA L
@PP
P x 0
0- PL
@PP
P f 0
0-LP @ `0 P
P
Q
P *
P
0 0 0rbmn
p-L` @ `0 P
PP
Q
|
P
p p p prbmn(
p- `BPL /
@PP
l P
p(
p-PL ` "+
@PP
W P
p
0- PAL
@PP
q P
0
0- PL! @PP
^ P
0
0-LP @Y `0 P
P
V
Q
p
P =
0 0 0rbmn
p-L` @7 `0 P PP %
Q
P ,
p p p prbmn
p-PL ` @PP
P z
p
p-PL ` @PP
P f
p
0- PL u @PP
P T
0
0- PL c @PP
P B
0
0-LP~ @
X0 P P
Q z @ P 0 0 0rbmn
p-L`^ @
`0 P _ PP Q
Z @ P p p p prbmn
p-@L P `P@
K @ p
p-@L P `P@
7 @ p
0- @L PP@
R @ 0
0- @L PP@
@ @ 0
0-L@ P;
$0 P P 0 0gnts
p- PL ` @PP
P p
0-L@ P
$0 P P 0 0gnts
p- PL ` @PP
P h p
0- @QLP
P \ 0 P0 /P\+\@-@ \ T \Z
\
\ O 0 \) N t \ \
\ t@ T T@
T @@ \:
\
\8
@ \4 : T0 :
(
0
\%
@0 \! S T Q @0 \ S T Q
x x0 R
M-L8MPp 0 @ 8p ` V8 0 08
S
S
S < % ,< <<0 0 YPE < R P \0E" @0@ 0V0 pp W S T P B< `,0 4 D0 @0 L < 0 @ ` ,p 4 @ A8
@q
P S 3" Q0 !
R``c`@,p V> 3` 4 V
* 0 f< \ \0` V< 3@ 4 W P : 0@, `< Y Q8 V, 04) 0 R
4 S : W ``c`@,p V>3`4 V
* 0 f 0< 0\ \ W`@ 0 0` V4 p \ p, Q@ < 0p@ 8 8 QoN 8 0H 0 F P
: P
= P
Hb Q
f Q \ \ 8 0 0 S Z 030" S&
Y
D @ ``j @0 , ` V>03`04 V
* 0f < \ U\
` V<03 @04, Q : 4D 8 < Q 00 S@0`
0 VD @0 4( Z!
L S : Y
D @ @ ``c0 ` V> 3` 4 V * 00 0f < Y`@ 0 0` Vp4
0 0p W0 , ,p 4 0 p 0 \ X0 X0 p s 0 T P0 0\ S Z 030" S)
Y
D @ ``j @0 , ` V>03`04 V
* 0f < \ \
` V<03 @04,4 Q, 4 4D 8 < Q 00 S@0`
0 VD @0 4,, 4 H0F SQ
, P
0 (
J Z!
L S : Y
D @``c@000 ` V> 3` 4 V * 0 f< { Y`@ 0 0` Vp40 p W0
X0
<
p 4 L Z% : Y
D0 @@``j0 p` V> 3` 4 V
* 0 f< \ B\ W ` @ ` V=0304 ` V=0304 ` V @0 Z X
L Z' : Y
D @0 @``j00 , ` V> 3` 4 V
* 0 f< \ \,0 ` @ S ` V#0204, ` V#0304 T SvH= Qy R/
L0 Z, : Y
D @ ``j @0 , ` V>03`04 V
* 0f < \ \, ` @ QE ` V=0304,
0 p0K ` V: *=00 , p
00 P$
L S! : R
D@ `@`c` V> 3` 4 V * 0 f< Z`@7 ` V04
Z ` V04U <0 40
0, p0
00, p X0 , R00 < , 4 0< ,0 4 < , 0 4 08 8 RH \>0304 0 0 Y0 (KP T0 f< \ 0 P\ ^] ]
M -LM 0 K /
p-L @` P Pp
-L `p @ P P
p-L P` @ Pp
0-L P @ D P0
-L `p @ P P
p-L P` @ Pp
-L `p @ P P
p-L P` @ Pp R0@-0
R0 @
PP U @ 0
R R P0 0NN
- -(0LM 0 S K `w R / R0 B 0b1 1 / R / R B 0b0 /
-0 LŻ @P
00 00 褔\
P -L
0 R 00 P Q9 p 3 +\
0- 0L @ SP <0h" 0f P
P
0h> 0^
- @L0 P
冗
-L ` @P
< P S pP e @ p P
0-L P @P
P 0 00 0
p- PPL@
|0 R @ o @P
00 00 < `P . @ 0 Q ` p\+\
p- PPL@
d0 R @ D @P
H `P @ 0 Q ` p\+\ P / 0 R /\ P / 0 R 0 / /\
0- @PLP
@0 R P 0 PP
0 QT 0\ ^+\ P / 0 R 0 P / /\+\
- @PLp%
0 S% Q!
R ` 0` ⌖ PP
l0 R S 0Xl `P P
4嗖 \+\\
- @PLp
0 R PP ` t` U PP
\0\ R 07 `P P
,b \+\\ P / , R / Q / 0 S , /\
P -L
,0 R 0 P p 3 \+\
-L M$0pP S
K/ ` V- 0K ` P%
@P
0 0 $0K P
$0 S ` H & P
# P 0@ 0 K^ 0 - R - R > R 0 0 / R /0
/ /
0-P0L @ Q
8 0Е P
0 <00 P000 ^
0-L P@ P
Q 0
0-L @P < Q
> Q
& Q ` P 0 L P
0 8 P 0 P
Q 0 ^%^*^
p-L @` P P
P 0 U: < P
P
/ P
> P
php
0-LP< @y P
/t P
P
>j P
0hd0
p-L @` P Y P
P 0 U: <P P
g P
>phEp
-8L @Z P
P
h3\0^
-$L @ P
h$S^
0- LX Ӕ @P
@ ͔ P P @ 0, 0 0 ^ ؔ ^
- QL @Pp
E p` 0 S S
S
S
S
< S 0 S
! S 0- S 0- S U
P/ S PE U 0 S0(0 } U U PPz (P 0 P0 P P P
n
P
P
Ph
/ P
> P0a X`0
W[ PV 0/ S 0$0 ( PN 0$0P0> SJ 0 > R 9 P=
0 R R
R
R
R
0 P P P
P
P
P
= P0c00" Q P
0 " Pa 0> S 00 p@-@ P PX
< PL
& P@B `a V
`m V `p V `; V@ 4 l V t P= ; P: @ ) g V t P2 ; P/ @ p P) o P& s P# ; P @' q V u P o P t P ; P @" Q
U * P S P \
@ p p p
Q -L p 3
-LGM @
Kb ,K0`K8K 0 P R p]K,p 0
3/ P
P 408 S S
@ X P @@ . P
@@ P ^D^J^Y^ ^ 9
-LFMM_K< OK @< 00 S
3/`0 p> P
W7
7/5 0 03/ W
7/ X*
X
X$ <1 ,0 ,p 00 S
3/0 ` P 0,K03/ P V
6/ V
6/
0
03/ 0 @ P(K
p-LPO @PP(
P
$0 S P P
t 0 P
PP
PP
0 `P xP P n pS^ \] P 0 /
-LJMD
K@H ( T 0 0,pK0KD1H! P,P 0P Q? mKQKRK 04 K 8 K DH 0
? P7
`pG W W,
P*PK+PK,PK ,0K P U,[` +p[(1 *[ P
'2 P
Up*q` = { P
=v P
(Ko(K^\
- @L0 P
4 ᨯ t
-LM p@P ` p Qx
Q Q0
Q
Q
< Q Wd
= Qn
, ' P,g
WmZmZ nZXnZ T
VY * j T
0 SP * j " `p T
0 SB * j ! `p T
V5 *0 j ` p W! @oZ@oZnZoZ0 P&
P P
P
P < P = P
P
P P
P
P < P C Y ` \
P\
-LP p P U @
8 l `P ~@
` P t
0-L @P P0@ P000
p- PPL@
|0 R @ @P
00 00 0 S
45 `P G@ X
` p\t P / 0 R /\
0- @PLP
@0 R P P P
$ PP
3
0\ ^ P / 0 R /\ P / , R / Q / 0 S /\
P-L
@4 T \ e p 3 \
-LM$P`@ UL Q
0 !% PB
0 S?
(K 0 0( R4 0K P,
⤈ PP%
0 0 $0K P
0$ R h P
@P @奈
$p WP 坈p 0 0 @ KR]t^ / P / 08 S / Q / R P / / \0 Q^^c^
0-0@0PL 0 0 0 \
-@ 8 L 0 S
(8$0$ T@@ H sZ
- @PL
0 R @ 7 \ P / 0 R / \ P / , R / Q / 0 S / \
-0L@ S $0 S
0 Z ^^00C0 / 0 P / R /
-LM ` pP @ P
\ 0. P
( P
@ 4 0 @ P 0 0 ^,Z
- L@ᖹ h蓹
P-`L P@`*
p W P *
0 S ` W
0 0 0 0`!0 0!0 ` ` ^
0-P @LP 0 0 00hK
0-@L @ P h P = 0
0- @PL
h0 R \ D PP
L0 0D00P 0@0 0 00 0 0 0<\ ^wZwZ
-`pL @ ᨸ0 S h PP/
Y PP*
PP 00 0 " 0 03/ pP P pP 00C 0 7 PP
p 0 W: PPP ̸ ^
p-LM @P Q R
l S` _ pA Pa ` p 0 P0 0C0 `p
- @L PpT婆 `P
T
! T `p
巆
0-0L @ P 0 Q P
0 Q00 00 00 0
- @PL`
x k `P
h w PP
Xp pٷ 0 `@00 0 V
o P <\
- @PL`
t0 R ` P 㿷 `P p 0 C 0p0 W:000 <\
-L P000
0- @PL
,0 R @ P 㐷 @ 0<\
0- @PL
,0 R @ P | @ݷ 0<\
p- @PL`
H0 R @
P g0 V@ & @ p<\
0-@L P R x P ᱷ 0
0-P @L C0 000h蠷
0-@L P 40 PP 0
p- @PL`
<0 R @
P 0 V 05 @#A7z p<\
- PPL@`"
0 R P p 0 P 0 T P 0 0 a 00 0|P M <\
p- @PL`
80 R @ P @ 5 p<\
-L` P@ Vp
P N K hR D 0 0
- @PL`#
0 R P 㢶0 1q
h `0 V: 0 B 0 0 h<\ P / , R / Q / 0 S /<\
0-L P @PP
P
0 03/ P
P $ P P 0 ^
p-0L @ S`P s P
$0 S ph p !^
p-L ` @ P 7 P p
0-L P @ * P0
p-L ` @ PD P p@-@1 ! @@1A RA@@ @, @,@00,00001 S
Q
1 0
p- 0L@`N P& R
R
R6
@ ``@* 0
P
R
R
00000p1 S
0 1 phv! R
p 0 00 0 /
-`Lp @ P Pe7/ P
A TP
-`L @ p Pe :/ P
p A TPPe
-`L @ p Pe :/ P
p A TPPe
- P p L@
` `f9/ PS
q W
0 P R 0 0 R1 Q
1+
``p P pp'! R
000 0 S
0
0! S 0 ` @- Q0 Q
0 c@" 1 S 0 T l S 0! R l
- L P`0@
\ R R 0 10 00a V \ 0 P00x R" | 3 1 ` ! 1 V, 1
Q10000 p ` V"1 1 S
p Vp p
pp Rpppp p pp V
1 1 1 1 1 00,0 0#00 0 0 00 00 \ 0 W00
i 0 Q ` / 0 R 0 /
-0BL M R" S 4 ` 0 @P pE U W0 pp- UPp
+ U@P v 3 V V
0 U 0x SX SP`@
R
0 U
``ɯ
0 u 0 ,
0 c H D 8 00 E P P A E P7 a E P& W P` U" , S 0 R 0K "#
8 U Q DH
, ?
P 0
r 04 Z
4 QD (K^h\
-0BLM R" S4 8 `40 xxr@P E U X0 - UP
+ U@P v 3 V V
0 U 0x SX SP`@
R
0 U
`` X 0 , 00K
00K p
X
W 0 pf pg 0<` 0E Y P AE Y7 aE Y? WPi<` U: X
Q/ P, "#
U \" ,0` ,
Y? S R "#
U \ ,0` ,
?P 1 18 Z
\@D4@ 48 (K^t\0B
R" S- 0L P`@ LLŰp H X Z0 - X
+ Xp t 3 T T
0 X 0x SX S@p
R
0 X
@@ n
\
00H Q AH Q7 aH Q Wa X
S X S R㔃#
0
0c V
RPG P ^|\ 0 R
R0 /
-L MK K
-LM
- QL M pP ` 0 @ pw @ \ u 0(K T
(@K 0s @(0 $@ ( $ K
- QLM pP ` 0 @ pw @ \ u 0@$ T 0
r 0 0 R R!
B / P /0@ 0A0 S| * Q : /@- R ( 2 R R -PPPP R rPP B PP R R00 B R000Ѥ000l \000Ѥ000 R
\6
R B0 -.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0 -.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0 -.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R ' 0 R @- R P1P P1P R rP1P B P1P B@ R010 1 B / R0q0`0q0`0q0` / \0q0`0q0`0q0` R
0 \6
R B0@-81, Ġ%̌T$\D#L0P R0@ Ġ01#̌ R R B0@-81, Ƞ%ȌX$XH#H0P R0@ Ƞ01#Ȍ R R B0@-81, ̠%Č\$TL#D0P R0@ ̠01#Č R0 Q > 4 4 8A0 Q" Q Q ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ / Q ̠ ̠ ̠ ̠ / ̠ ̠ /Q0 / / Q00̤ 0 / b0 R0̤A0 Q Q /0 Q0̤ 0 / R. 0
\ B BѴ Bôr - B R5 @P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R @P`p@@P` R@ /@@t @P B@@P B@@P R@ / R / R Ѥ ä / - \{ F
,DP`pL%T\&dl't |@P`p B R R ,DP`pL%T\&dl't |@P`p R / RAn ,D R L@Af ,HP`pH%XX&hh'x x@P`p B R R ,HP`pH%XX&hh'x x@P`p R / RA: ,H R H@A2 ,LP`pD%\T&ld'| t@P`p B R R ,LP`pD%\T&ld'| t@P`p R / RA ,L R D@A / R Ѥ ä / /
0 R / ! 0O / 0 #4< 0 / 0 8 0 / 0 #<4 0 / "4" 0 / 0 0 / 0 "$$#4 0 / 0 0 / "80 / 0"",$ / 0 0 / 0 #4"<0 / "4" 0 / 0 0 / 0 "$$ #40 / 0 0 / ! 0O 0 0 / 0"$,#4 0 / 0 #( / 0",$# / 0 # 0#<4"$0 / 0 0 / !<0!40"440 / 0 0 / 0(#(0 / 0 #$#, / 0 0 / 0 4 "0 / "$,! / 0 0 / "$$! / 0 0 / ! 0O 0 0 / 0 #4< "$ 0 / 0(#88 0 / 0 4",$ 0 / 0 0" ##<40 / 0 0 / 0 !Ġ"ĠČ#4<0 / 0 0,8( / 0" (#8 0 / 0"" #< 40 / 0 0 / 0 #<"4$0 / 0 # # "$, / 0 0,80 ( / 0 "ĠČ!$ # / 0 0 / ! 0O 0 0 / 0,,$ ,#$! / 0( #8 8,0 / 0 $ #< 4, 0 / 0" " $# ,̠ / 0 0 / 0 "$$ #$ <,$,!0 / 0 0#8 8,ȠȌ!0 / 0 ,#88"(0 / 0"Ġ ",$#< 4, 0 / 0 0 / 0"Ġ ,#$<,4 0 / "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0 / 0 "$$#< 4,̠Č! 0 / 0 0 / R4
R0< / B$ 0A00 0 P / R / 0 P / R / 0 P / R / R
: 0 R P!
@ P /LA 0 R P!
@ / 0 P0 / S0 / P0 / S0 / P0 / C / 0 11 /
- 1L @ S`Pp T x P
`P p1 0 "0 pP 1 ^
0- QL@ U '
P
Q R S t T0 0w Q E R P R S " T
0 0 0 0 0 ^p@- 0Pb @`0B6E@ S0" p
-LTM P `@ X4 $ T P` S R T P` 0 @ &%Kh#X8x&h%X#8"'x Q㲣KcKᾒKRKK3KẃKsK. S/ X0
T
h h X T
T0( P@K P>K P Z J J J J J J J J J J J J J J J J J J } J x J
s J
n J i J d J _ J Z J
U J
P J K JF J A J= Q : Q : Q :Q : Q :Q : Q} :Qx : Qs :Qn : Qi :Qd : Q_ :QZ : QU :QP : QK :QF : QA : Q< :
Q7 :
Q2 : Q- : Q( : Q# : Q :
Q :
Q : Q :Q
: Q :Q A ? Q A ? Q A > Q A >
Q A =
Q A = Q A < Q A < QA ; Q A ;
QA :
Q A : QA 9 Q A 9 QA 8 Q A 8 QA 7 Q A 7 QA 6 Q A 6 QA 5 Q A 5 QA 4 Q A 4 QA 3 Q A 3 QA 2 Q A 2 QA 1 Q A 1 QA 0 Q A 0 \ aBC `B / 0 Q A 0 / p^^^Д^^^0^P^p^^^Е^^^0^P^p^^^Ж^^^0^P^p^^^З^^^0^P^p^^^И^^^0^P^p^^^Й^ \Z\Zl\Zs\ Zy\Z\Z\Z\ Z\(Z\0Z\8Z\@Z\HZ\PZ\XZ]`Zn^]hZ\pZ\|Z \ZK\ZU\Zp\Z.]]Z\Z%\Z\Z\Z\Z\Z\Z\Z\Z\Z\Z ]Z\ Z \Z\ Z\$Z:\,Z \4ZV\ ~ *&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ
@ !
!@ 8Z8Z 8Z 8Z BjT8#ClT NBOBSB` BX B)B$I ffs_sync ffs_unmount ffs_mount ZDZZ G# ̇B] ffs_read ffs_write ffs_spec_fsync ffs_reclaim ffs_full_fsync ffs_fsync t\Vl\#T\\jTx\BT\hT\03Tܟ\p3T\3T\4T0\6TL\Bh\B\HC\Pq^h ,`@ yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(y v;VdNt ے
lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa
B|qؐ _jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ {m:,*] CCCxCHCCC 0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z-tkip_setkey tkip_decap ieee80211_hdrsize tkip_encap *] `CPCdCC\CxCC 0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize ieee80211_hdrsize ieee80211_sysctl_treetop sysctl_ieee80211 ieee80211_sysctl_attach ieee80211_load_module _ieee80211_free_node node_reclaim ieee80211_free_allnodes_locked _ieee80211_find_node ieee80211_setup_node ieee80211_reset_scan ieee80211_node_table_cleanup ieee80211_cancel_scan ieee80211_get_rate ieee80211_tmp_node ieee80211_find_rxnode_withkey ieee80211_find_txnode ieee80211_find_node_with_channel ieee80211_find_node_with_ssid ieee80211_free_node ieee80211_ibss_merge ieee80211_create_ibss ieee80211_end_scan ieee80211_next_scan ieee80211_node_delucastkey ieee80211_node_leave_11g ieee80211_node_join_11g ieee80211_timeout_stations ieee80211_node_table_reset ieee80211_node_lateattach ieee80211_node_table_init P P P P P P P P P ieee80211_encap ieee80211_mbuf_adjust
ieee80211_compute_duration ieee80211_send_probereq ieee80211_send_mgmt P ieee80211_mgmt_output ieee80211_beacon_alloc ieee80211_beacon_update G] G]G]G]G]G]G]ieee80211_newstate 0 0 0
@
@
@
@
@
@
@ ieee80211_wme_updateparams_locked
^ ^ ^ ^ ^ ^ ^ ^ ^ ^ / / f / f / / / / f / f / /
ieee80211_wme_initparams sysctl_ieee80211_rssadapt H] if_attach ifaddrpref_ioctl arp_rtrequest L^ hGELE l9E d n;0&AvQkkXaMc dY `Av `>c`a` f `dXY `c`a` f
`dXY XO. XO 0D d ceXOA `x `|c`da`F܄ ́ d ` eD @^
c`XNpx>D @^
c`XNpx /X .X 0D d@@C `exDĘ 0D ` `@` q`>exDĘ
`cexDĘ`d`Av?`d`ddD+ P`d`dЀ`d`#dЀ`dѺ`EdЀcG `C`d`vA < wD`W@J*D D@@/ @@ D`A` daD@@ @@dD? dDd`d`d`d?uD&& &
& @& `e` d$g`\` d`d@E+ @E `XOxXOJ fPeRaQ
@g&E@F`dP R~q&\` dٶ `e` d$g`\` d`d@E+ @E XO< XO fPeRaQ
@g&E@F`dP R~q&\` d %F&ADcՁ c `FB aDŁcEŁ`E dԄeD/X%DЀЀ ЀЀH %Fg/X` q ̃eD` u?ga#X@DDEDFDG? $D g $D? ` dDXCaC`E$D?' `
d`du? `(b`4d$E'= `dga@ D ߴ@@` f `d`AcXY `&d`AcXY d@Pced@Pg` f`c`dЀۃ D@@d@Pce d@P `x` dȁ>c dY `Av#X~`d$Ega#%E+ `pca$D' ӣԀ́$dXa d"%DZ g
ӾԀ́$dXga#XbCdC`A܄"ZbDɁX g a#X"bC̄ dAՀdCeAFdXɁ g a#X` d@KK`A"%D#fEHcȄ+FXeFɁ g a#X d@E` d@Fw`
/`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU` g a#Xw` `XNx`XN{x~`XNx ~`XNx`XN{x~`XNx/`b` aa\`XNx`G`E`XNx́Z`XNx`XNxU` g a#X`` .X`` .X c?@& σ.Xc`@* ` ` `?@& d d .Xc?@&܄ ` ` .X t
c7 ~ @AA Ł@
A ρ@
ʁ@ AA ہ@ ށ@ A ԁ@AA с@01A 3@2 6@754A <@=?>A:;A 9@8 (@)+*A./A -@,$%A '@& "@#! A`aA c@b f@gedA l@monAjkA i@h x@y{zA~A }@|tuA w@v r@sqpA P@QSRAVWA U@T\]A _@^ Z@[YXAHIA K@J N@OMLA D@EGFABCA A@@ c
< t
8
\ "T$&j(* , . 0 246z8:$<> @ B DFHJL
NP R TVX Z\^&`[b , .,.,.,., ., .,$.,(.,.. ,4.
,8. ,<. ,?.
,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,. ,. ,. ,. ,.`_d`,d E`dG`d@ A B C D E
~
G ` d N` @99SA01000000 Primary F's F3.10-04 01/17/2002 ~ ~ &~ ~
~
~ ~ ~ FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54
~
`c܀ ` d `~d`d `#x`d$Ega#Xd@Pa "*2:BJRZbhpz ``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`x i h^ d@@ d@A@B@T@U@^@Z@[ `b`4dЀ `bU`dЀ `Pb`.d `RbƂ `Pb d `Rc d a`c `>a` f`dXY `c`~a` f`dXY J`c `a dY c `*c `@a`~dXY `a˃YYӤ `c` eEK`a` e`deFX+FY `c`Na`deFX+FY `c` a`deFX+FY i` d
`"b` eԀ ̄ eD eD̄|c`F܄Ѐ `F `F܄Ѐ d cD܄P3D `|a`XOxFE`XOx `bfD ed@* ``vc d ` e`cd`4b`~beD `0 `P `y````EĄ$`0d%`E)``d-1 `d&*`d.2 `d'+ `d/3 `d(, `d04$Ą57 d@Pc d@T@U@A@B@^ d@R`:e `@* & `b `zbdD> `\e`@ & `bdDL `bdDF d@A@F@G `c`d `fc dY `Av`_xu``*b`d``0`x 0D bcdefl@AC@I`x0D drD`Rd@@ ܀d@@H`@ : g`ed@ : dpmd@K d@M@G" d@L&D@Fe`@& : hh ddV`Tl@`DdFGg`\bdۜ d@&D@F'D" @Gd! d!=D@]D|@^=D @]`>D @^FG`d0D d@@@D@C@B@A`d@N<`jd@M`Vx0D ` d@@
d@K `ed d@\` x0D ` ` O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+ t@:\+ t@:\+ t@t@:\+1` ` :\' 1` ` g`d:\0` g`d:\:\@' ` ` ` 0` g`d;\;\@' g`d:\٘` d>@g`Lb d
d@H`d@Kg`Jb`d d@Li` q d@@`x0D (`edd d@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av ` |`dٮ0`x,E?A0D 4C)D" &: * Dt )D@I$A `eŔ A@d>D& Ad>D* b dg`Vb܄g`bd d@IrR2{MD )D@I e* `xd@; `_x`tDt@^E^@^ |`"bXO XO XO XO |XO XO
=D@]@]-`xe`Gc=D$@]4 @]`G`Ac=D$@]4 @]`G`Ac=D$@]4 @]d@& Dt@^|`FbƂXO `d`T2D+ D @^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN% dKt` x aFG`x>D@^F` }`>D @^FG&C*P CF*D# D d@@rE܄`UeR$܄'܄(*D܀X2@* ]`x-D &
&D@F6 ]'D* @G-DX67 d!& *$ @Gd! *D܀X'D* @G'D* @Gd! 'D* @Gd!`x&D* pDЀddP`xd"F)`dd d!`xdFG
d@L) : `d`E`dĄ܄? k>D @^=D@]>D@^=D@]d̄>Dw@^"c* c(D&
%D`Fa^+!F
(D6
cD|@^=D @]` }>D @^FG`xd `fFB` |E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@* fi hD `E|i hD `G e|i hD ЀdD`G%
6 676n6& |"5dW.DlC!~iÔg`^b܄d'D@G`xd@ 6 `x |@En65 76& 6
6 Z`d܄ڂ܄!c'D@G`t`xLH LH LHDžǃ DžメLHǃ'σ HCCLN |МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP* &D @F ЀlDąЀ a(D* @' alDąЀ2D*' (D6 : d8d`x@LlDlD a(D+ a`@@'ANlD(D6 6 6 `xa@"1 lD(D: Ha 6 (D: Ma IaAMFNd@L e-D*
-DI6 H: e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A & -D"2@* P@M d`d܄'D" @Gd!H'D@G .D$@AF p@MlD a(D+ a`@@+
`eC(D@H)d"#DAN &(@@'@C8lD#D+ d@C8#G?eEL!pEԀd`PlD.D"& #AlD4T lD.@ * lDlD.@& #AlD7? lD72D* bFEڂlDڂlD#Ax|eaCрFE7 dCс||; H #D Ѐ`C `xlDlD]>#A>||e%DՀaCE5 6 `x bрFEa@&a\ a dCсDZ # ՀaC7 bрFEDa@&a\ a dCDс Dz
lD |FE dlDZڷdA(D@+ 2D& lDD}@^d̄=D@] ` k=D@]>D@^(D@+> :D+ ` :\+ t@:\+ t@:\+ t@t@:\+1` ` :\' 1` ` dg`d:\0` ` }`>D @^FG/Xd? ;D@' @`@* `xA`@' d@* g`c ew + d@*
g`c0en @+ d@* g`cee ` `xd@* g`c UT`*e0/`AdC DaG D냓`eD`Ncǃe`@+ \aнPYЀYЀЀ eDT`Nc~e`@+ \aнPYЀYЀЀeD
=`LdăgD e""dD@[dG@[dD@[`G`AE 7 cBcd@:
cZ݁`Ea_@[eG݁a_@[ Z݁a_@[` ` d@: ` `3` d?8 (d@IFJd0D@Q`x@*F`@&e )C'D `A;@+ `Ww_Ɂ`Ww_% & c @J`F; =F8*F`@* c@& c `F+FJ `Ww_`G c@& c @JCIAG d0D@Q> |>=FDG`@& `x=F`edC`x`x`xL/~ =F>`x d0D@Q ` 0` ` d>>@:D;D=F` c`|`xwD`W@J*1 $D $F , @D`F`\` ddD:D& u ;D@[
-EԀ Z`pd܄ڂ܄*D* #D <`@d@GXOS FCfC`\`"ddD:D& u ;D@[*D"K "D `FF d@B@ <`Fd@GXO+ FB7"fC @* `$d:D& u$ ;D@[ * `$d:D& u ;D@[ 'B `F /X*D* !D `F<`pd@GXO FAfC`d:D& u ;D@[4@&;*D :D* ;D `U d@Z@[= d@J5@* $A @U,
GXO (FDf\` d:D& u ;D@[ 5@* #A @U`}x5@* "A @U`x5@& 4@* !A @U@T ?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`A d۾eC%D aD
aF%D %D'C`F fD.X(AXO .X(A@XO (AXO& XOV .X|c @E eeD܅ `F@E 3DT3D`|d d Ѐ/XfC%FaDg <~d d# acY /XL|aXO c,F%F,F %F dЀ
dFgXO .X'C %F %D
`F%D ܄/XLXO( GXO .XLXO GXO^ .XLXO G'D %C cF'C
fCdDX `F%D
.X%F @G
dC 'Bڂ$ ʂ `F cF(
%F d
'B̄/X%F # `F xgg%F d %DXO XO' .X'C %F %D `F%D
%F d
%D/X %D %F|d/X a %D `F fC ݁3EE3D/X%FЀdC`Fg d dFFEXO .X fFE)CfD%D dae<`cCI ́`Vx& Ԁ`EѽDGDHDE`dD3A @E`F`|dM3D d Ѐ/X
Xee
0DP@Q0D}@Q?* F\g`Xbd`.d@D0DA@Q?0D@Qg`Xb dB e`A #`E `A 6aDd@& d 89 89܄8dD$܄`\aD9da\Ad@& `@* g`c0 d@* `@* g`c' d@* `@* g`c F\"d `x`@* eG 6 `EąŅ=`NdăagD g`c ` ` 8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:a eG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z ` g`b*= d ` :\+ t@:\+ t@:\+ t@t@:\+1` ` :\' 1` ` :\+ dg`d:\0` :@@' g`\b dE` d@Z3` ?? `2xd8~ `G SQ`\ PQRS dT ) : SdD cc cUF\"`@&@ !`EELĄ!,D ) dd@:O ' Vc))`Gd@* . "bcL4L)`@:v `@ 6n !̄`A d́ SUdA6dE bá $Ƃ(ւ́(*Ƃ`C `e ddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ
dD 68 aEĄsEԀ.h`b` d
d@\"d` x& (E`@ : `dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nb dg`Zb `b* `dѕdA ) `@: q݁݁݁%`G`Ca@" #`XOJx `dݸ#`XOIx `d)`Eh`b``dh`beD"`dڎF\fD `x dhh`b`adF\`@* g`Xbd`id@D0DA@Q?0D@Qg`Xb dۙ:D+ P'
g`\b dE` d@Z3` `xL?~ )`@: Z`Zd܄ `e"d `x dD`A`G `EaD 脤 `AeGaE.XdD`A`G `EaD `AeGaE.X`G `E @M`G `A-D ́`EaG .X"`kx0D* G!XG?2D&W dEGS
2D&N ' `T `:d@B0D @Q?2D&6 dEG2
2D&- O :c >D@^@^ `dd@B0DD]@Q?2D& dEG
2D& !`;x `d@@ `d@A0D@Q?(``b g`bd"dڙ0DY@Q` d@@ `xg`bd"dڙ0DY@Q` d@@ `x!` d@@ `d@B0DD]@Q2D& d EG
2D& `e >D@^@^? 2D& dEG)
2D&$ g`bd"dڙ0DY@Q` d@@ `x `e ̄'% `x `ux (``b g`bd"dڙ0DY@Q` d@@ `x `x g`bd"dڙ0DY@Q` d@@ `x)`@@+% >`@& :\d@@' d@+ 3` `x:\d@+ & t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@& dh? d (``b d !*
!dN `e"``@& `@* ;D+ @' `x& g`bd `@* `x<`db `F d@ : pdg`bb d@>>=Fd@)@+ g`Xd F~ `CEeDF`@* #`xde k>Dp@^=D@]e `>c`"e dHdG `A`J׀h@g`b |`@* @eD @^$`x D @@d& dG?dD+ `HeD`J eI dh^`\`
d die@Q d D * 666 Dش@@ D@* $@@<`bڃ aۂZڃ aۂZڃ aۂZڃ a ۂZڃ a`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD %C CE D @@dCӽ@D+ `HdD `Jh@ dIhEԀ%C <`a c Y1Y c Y,Y c Y'Y c Y"Y c Y Y c YY c YY c YY c Y `x'`x'`xI`@6 6 6( : ZӜ۸ ` q ̄eD` usD `b
`b '`xf`b ̄:D@Z;n`G# ̄`G" dnh sAIՀ'pEą`XdĄ@M`AsEԀ
dD 60 aEĄsEԀ
g`|b d dh -DpEԀ
`P`Eh`b`1dh`beDdf`d ̄v`EwԀԀ(``bd d=`b ̄ =`c`dЄ2D*0 h`b;h`ā3 @@* d- dd`A D@@@$`daDd e
* `bЀ @@* g`|b ̄1/dA"D 1@* ^DB!DL!EԀXO ?<`4b `F@FH`bFg`rbd@7d@7 g a#X(`c d۽۽d## d"%D#$%&' g a#X"(`c $%۽۽d# g a#X8d8`G?(`G q 9+:,;-./0<1=2>3)R P<.Ѐ=/Ѐ>0Ѐ`AaDB= JCd@* (d@* d@& 8`\ dD`G@`G)9!9+:,;-123 1:2;3+,- /X d `eQd@* D c)s`d+c)d@@'CK!Vad@'ba8DM`@&" ÁрcE dCׅELӀe e c-D,E`AԄ߃aD)d`G),C -D
-D+Eāрd.X+L`@&9 +`AZ`AZ`AL:`XNx N
D @^
cXOv~ F =D@]
cXO> >Dw @^
cXO4 D`夅 @^ k`>D` `\`d٘ g#X<`bʂ"d;`x<`bd;`x<`bʂ d;`x<`bd;`xe e`Fce@* d;`x g#Xg`Pb g#X g#XCDw @^
cXOl m>D @^` k
cXO_ =D@]=D @]`\` dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M `CdD`L cFCO?`G`\e/FdC bڂɁ`L b`M /Xj` x `bр` d+ t` ` `b ` d dtu du `b `d
?Wg`b& eEHN `aAM@`XOx-A`XOxOd"` dZ(DZe<`b<`pdfDZ
dZ+ET;7Xa `FN `.aAM@`XOx-A`XOxO!a dX`.cd"` d#He dѽۥ́څ<`b<`pdfDZ
dZ+eET; 6E`dD d1D@Q `b ` d=`/x>`x`cӽѽѰ 1D@Q
|`
d>`x`Gā>`x1D@Q & `|b`@: ec `@: ec ce`@6e`lb `|b`@: ec `@: ec ce`@6eg`rb`Nb`A& e^a@& c^Z de`Dbd>`XNx & `c`xa`dXY `rc`@a`dXY `c` a dY `d<`bʂ d-
`d2@& `bӥ`A 6 ́`bNB`XO`xO=`/xfD W d@FNFE<`b dfDZ
dZ+`XOxO7X *4 `Db`E `b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb `Fb`G7: 6 6
`bF `d<`b dfDZ
dZ+ NFE<`b dfDZ
dZ+`XOxOY`d܄ڂ܄ۻ <`b<`FdfDZ
dZ+Y`d܄ڂ܄ۢ :=`/x `b ` d `e
a XOdX cZڅ ́ `b `e?`c dZրZZZ `e dZրZ /X `d@A `c dЀ áۣ `c dЀ
adD́ @BCD ACXO`X"D#A$C !C `e׀ѽ CA?`ddX@O)`@& @`.x`@6 `DdXOdD`" 12Ѐ Ѐ3ЀA`vx `eԀdЀ dЀ&F" g Ѐ&F"@g &F)`@ * \c`@+bcҽЀ\Ѐ҃XЀU d`XOZxA`Lx&F) &G cӀ`@: Z`d܄# : Z`d܄ 0: Z`d܄ : Z`d܄ : Z`d܄ `HdXO- `@:
h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO
@: Z`d܄ `JdXOA`rx: A`XN}x `RdXOZ`d܄ :n @@&2 )12ЀЀ3Ѐp܄p dq
`dnd@6P Z`d܄ `LdXO `NdXO= `PdXOA`rx`Bb) 1Ѐ2Ѐ3 Ѐp܄p dq
`dn Y` d`@" h`XNxN&Fg`XOxO&FV )=`e
dd@+h`b`0dA`XN}x^`EsDd@* Ԅ砖Z`d܄ `LdXO `NdXO f`b#A`XNx&Ff`bdۺ <`b<`jd&DZ
dZ+ d@F fD >`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ `b `dD`dZ/X `\(`~d<`b(`zddJ `b `dD`dZ/X `b d f`b܄ dd
e=`XN2x ` cd |̄g`ve`@"3 * `cf`e`EĄЀ%
g`ve`E D@@Y`d܄NR`XOxO `b` dE` dZ/X `b dD`IxdG dDJ `b d `b@` dE`-dZ/X<`b*Dʂ d- `b ` dE`SdZ/X `b d۾ `b@` ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dw d"8d(` dd)f`b`4erDf`c d۽ۣqpG`dӆf`cdds9`b d^h`b`df`cd(`c9`|e dGӀG`Dd[NR`XOxO `b` dE`dZ/X `b dY`d܄9`b K`XN+xF`x Y` bc`@ :n
af`b@` e c$́d(`~b<`b(`zddJ `b `dF`#dZ/X `b d dn9`b `Egf`b̄ۼY` b f`bs.dD :* eD &`bd@&`C(`~b<`b(`zddJ `b `dF`mdZ/X `b dE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&c a`E66 66eD̄`EaD a`E:`(ce@* d݁e@* d݁e@* d݁e@* d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeD e`@&e`@&e`@&eY`hbeD`c`cن d`dbvf`XN:x`b* d * d * d dw./0123f`cd dDJ `b d `b@` dG`bdZ/X<`b*Dʂ d- `b ` dG`dZ/X `b d۾ `b@` dddh`b`pd D& e=`XN2x D@@ `b `d `b `dG`dZ/X `b d=` ba c`EeD&߃́cD
=` b2db`@ 6 `b d=` b ̄=` b`be djkmod@& J`x `b `df`e" l^d `b`d `b` dH`0dZ/XI`x `b`dی `b`aZJۡZn`@&2 vd) c8" d!d `b d<`b<`.dfDZ
dZ+ `b `dH`rdZ/X `b`aZJۡZۆ /<`(b `F%@H d@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D `F
I`xdmI`x,D* (F+* <`b<`(dfDZdZ+<`(b `F+*1 K`XNx `b d<`b<`.dfDZ
dZ+ `b `dH`dZ/X `b`aZJۡZw"& dmdo<`(b `F@H `FI`xlЀ+w `Ck*c i`XNxji`XNxefDiK`XN
x `b d<`b<`.dfDZ
dZ+ `b `dI`RdZ/X `b`aZJۡZw"iFHi`XNx d! i`XNx#f`b܄ @H<`b<`LdfDZ
dZ+(D do i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ `b `dI`dZ/X `b dmm djdf`b < E@@f`d܄ی d* `b`d `b` dI`dZ/X `b`dی `b`aZJۡZE`xg`ve`@"= * `cf`e`EĄЀ&
g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO `b` dJ`JdZ/X `b d `Pbg`dqpddqf`b vDd* `b`d `b` dJ`dZ/X `b`dی `b`aZJۡZh`b`qdf`d d dpe=`XN2xf`e`ddC߃ЀHf`b d@|
e=`XN2x `PbV`Sd ` cd |̄E`x"f`b dpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)G c8" d!dd.X:`bC`A脐
aD dD * dG .XL`?xxQ`XN(xQ`XNxg)Q`XNxc8 d":`XNxfE a} dd@&dcY dYڧ(`~b<`b<`.d~ eDZ
dZ+d]<`b(`zddJ `b ` dK`dZ/X `b `d.<`b(`zddJ d] `b dZ&F8 `A L`0x}L`xe8ՀL`0xC &FQ`XN(x ~d(g@g)+..+,//,-00- d":`XNxfE adcYK`qx.&F>`XNx DL`xO`x `d d] `b dZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx `c'`da`cӽa`b `c`eӥЀ@GR`XNx `b dZf`e dD`x'C`XNx
`Fb`EՄ`E
e>`XNx g`bd `b d `b@` dL`wdZ/X'<`bʂ d- `b ` dL`dZ/X `b d۾ `b@` d D@@K`JxyQ`XN(x d)Q`XNxG b `dcaYP`XNxy-D8 d":`XNx<`b<`.dfDZ
dZ+d]<`b(`zddJ `b ` dM`$dZ/X `b `d!<`b(`zddJ c] `b dZ&F =&F>`XNxL`Yx `d<`b(`zddJ &F>`XNx d] `b dZL`x `d d] `b dZQ`XNxL`Yx `b `dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY` d́X&F>`XNxddgde=`XN2xR`XNtx `b `d `b `d d] `b `dM`dZ/X `b `da`bd `@da`b d `dIa`b
d^ `b `d `b` dN` dZ/X `b dZ d] `ba`b `ba`bN`XN]xde=`XN2xf`ed`Xb dۥD`x ` d
c] `b dZ M`x/X<`b(`zddJ d] `b dZd.XdGF `e `cӣۧ(`~bٌ eԀ `b` dN`dZ/X `b dZ `c'`dd`Zb da`cӽa`b `c`edAЀI@GXՀ`Ea`b eD:d@*7 Հ4 a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x `b d `b@` dO`dZ/XFG `c<`bʂ d- `b ` dO`/dZ/X `b d۾ `b@` dd`Zb<`(b `F `b `dc `b `dM`x'C<ЀN`x'C@`A>`XNx
`Fb`EՄ`E
e>`XNx `b d `b@` dO`odZ/X'<`bʂ d- `b ` dO`dZ/X `b d۾ `b@` dyQ`XN(x ` d)Q`XNxQ`XNx aGddYځYYYP`XNxy-D8 d":`XNx<`b<`.dfDZ
dZ+d]<`b(`zddJ `b ` dP` dZ/X `b `d d] `b dZQ`XNxd`ZbdN`x `d<`b(`zddJ d] `b dZP`x `d"<`b(`zddJ d] `b dZ&F &F>`XNxN`x `b `dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc `b `d `b `dM`x D@@K`Jx])dA`@:
1 `b `d' :
" `b `d : e : e 0: e
`b `d f/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G ~`E ́.Xg`Hb* d * d * d d.X`ef`c'B>|Ԁa ae\f`baDf`b.X'B2 a c $: :
`@+ e׀c :
`@+ e׀c ,: `@'c Y`hbY`jc`@* cd * cd * cd cdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``b d.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed ́a`c&F123.X'D`AC腔&& * `@* a\Ga`b P'Aa`cӽYЀYЀЀ d d .Xf`c ddۣg` c ddۣ'D'DЁ af`caDۣf`bс af`baD.XY`bf`*c d۽۽۽g`b d.X d]<`c!D d `b dZ `*c `@a`~dXY /X `b `d/Xz./0 `bg`cӣ e~ g`bd|d
(|`E-d`dxd `b d D& d'`d
@* `bӱ=`Lb deDq @@&n ` ez@~)`d[ `Ce @& |dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @& dD,A `G ~`E ́z-D8f`bf`b `Zcq\`G `VbeA`EaDԀԄ `E `TbĄ@J `Xb d `ddT`xdR`~ x `Xb `Zb *D܄d *D̄d@J `c @@& dD6 : `6c*DG `b d `b@` dS`dZ/X<`b*Dʂ d- `b ` dS`dZ/X `b@` d
dW D@* `b `d D@" T`rxz{ d":`XNx<`b<`.dfDZ
dZ+ `b dۯ(`fb<`b(`bddJ `b `dT`%dZ/X `b `d <`b(`bddJ g`b(``bd dS`|x `b d۱(`fb<`b(`bddJ `b `dT`fdZ/X `b dW .S`|x `b d۱(`fb<`b(`bddJ `b `dT`dZ/X `b dS`|xR`x(`fbٲ(`rb<`b(`bddJ <`b(`nddJ `b ` dT`dZ/X `b `d<`b(`nddJ S`|x `dW
d <`b(`bddJ S`|xW<`b(`nddJ `bg`cӣЅg`bԀeD g`bAd `bf`c Y`d܄ `b d `b@` dU`$dZ/X~<`bʂ d- `b ` dU`JdZ/X `b@` d D" e=`XN2xV`x ``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG
eЁG aaD,BZZD (BJJBHD (D'`cf`be eELDH(E׀6Z>`Edԅ,DdGcBeF(Eր bF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB `Cf`be eELDH(E׀6Z>`Edԅ,DdGcBeF(Eր bF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@ `b` d `b dZ/X<`b(`bddJ `b dZ/X `b `d/X `b `d/X @& ``c`d# =`Lc `EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dD dG 123`|8 D
`Bb`@: d@*; W`XNYx`dЀ2- 6 f`d `C X`XNx`deDЀ`>`CaD`dЀf`b dۇeă ddG`E ;F ܄dX́d@Mae@*dD -ZdG -́Z2cÃae@&Y Ȳ dYYYЀ2eă a`@" * `@: $ : : 6 `XNx `Va ` c `Tba ē dD|̄ eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx` dԀ9cD" `G eԀ*X`XNxe\X`XNxgAX`XNx-D EMX`XNxeAX`XNxf`beDX`XNxf`beD-E `|dA ef`b@N.Xf`b.Df`bZZ `C6ZdE`A cD" `G `\cD" `G `EdDɁՁaDǃ ߃X`XNx`dԀX`XNx ef`b@N.XcD" `G `EcD" `G `G.X/X `b `d/X(`b<`b(`ddJ `b ` dX`dZ/X `b `d Gg`Bbo` dXO) O `b`aZJۡZ`zb* Gg`Bbf` dXO g`Bbi` dXO O HNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:Y P[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&A g(F d d .+/,0-./0Cd@* `G@`G) c(":`XNx ~<`b<`(dfDZ
dZ+ d@FHo`_x+gDЀ8{ܠ x`e Ԁ` dpЀg`clg`
d܄Ѐ`Ѐ ]\` d c a&eҡСdDՀف&FC`Gd@&@`G) ~(d8 d"(+,-./0 `E&F3dD2eD1:`XNx<`b<`(dfDZ
dZ+g` d܄o`x&Fk`x `dfE FK FI0eF0/Ѐ)F/.ЀeF.Ѐ)F.X d h`b)`@ 64 : dD eԀ/+ dD DdD6& 6' 6( 6) @6* 6+ 6, 6- 6( 06) P6' 6( 6 6$ 6" h`bh`c dۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`c dۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`c dۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`c dۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`c daѥрp`xh`eh`c daѣрp`xh`bh`c dۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8( `DbdGЀ `Ac `Fd`EХЀeD́d@' H РdD `EdD Ԁ*Fp`xh`bh`c dۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`c dۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOx h`bdp`xh`bh`c dۣ)+: +Ѐ,Ѐ-Ѐ@h`bBh`b @G Veh`aeCPҡЀҡЀҡЀ 'D̄@G)' .Ѐ/Ѐ0Ѐ\es`XOx +& h`bdp`xh`bh`c dۣ8FJ`Ah`b6 h`b6 aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b @G"\eh`aeCPҡЀҡЀҡЀ'D̄@G
h`b: s`x8 s`xh`b6 `DbdG <9c`A`FdР́d@+* Р' `DbdGЀl`Ac `Fd`EХЀeD_́d@+
РdD `EdD ԀMe ~`GāaE& ~ `G ā& `G Ѐ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`b h`b@Gh`aeCPҡЀҡЀҡЀ'D̄@G H/X`*b`d`` c` f `{d̄`*b`d` `x ! Secondary F's ~ 8
$
F @ p 4 '' d d ' /
d
# + `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@ `xA `x %`-xC `x $`xE %`ux `x =`%x?`Gx y=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo
h0313DD031303132323 x==3F446 45" 45 46" 45 45 45" 45 4~7
45 45
45 45^ 45p 45 45: 45D 45F 45 407 44f 45j 45 45vg 45 499
45 45 45a !4 5a $57 %57 &57 '57 #45 (77 *45 +44x ,48f -48 .45f :45g )5<5^X 45 45 45 407 4 7 Y 45| 45z 454 45 45 4-8~ 47t 4r7 45 45 /45 04K8 148 44J 64L 64Z A64 448 44$ 44` 44\ 44v 44r 44> $44 %44 &64t '648 E44 G44N H64l I64n J44 K44 M64\ P44Y O64X 64` 44 64 64b 44
h64: !h64B
"h64
#h640
@44 A44 Y" B45 C64 D64 F44 L44 44 44 44f 64d 64f * 555 96^m Y0$\$Y$z#\$\$ b$b$b$ $%{# w$ HH
\ "t$&
(* , . 0 246z8
:$<> @ B D F&H[JL)NP R TVXZ\ ^`b , .,.,.,., ., .,$.,(.,.. ,4.
,8. ,<. ,?.
,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,. ,. ,. ,. ,. 8
\ "T$&j(* , . 0 246z8:$<> @ B DFHJL
NP R TVX Z\^&`[b , .,.,.,., ., .,$.,(.,.. ,4.
,8. ,<. ,?.
,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,. ,. ,. ,. ,. e g \ 2 e ~ Z ~ n * > R f z " 6 J z ;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z [>
[>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZ hYjY,28DJhn̘ a a ` $ P[ <_x bd a *g8 Y g 4UY Y Y Y Z Z Z BZ ZZ pZ tZ xZ |Z Z Z Z Z Z Y Y >g Y Y Y Y Y Y Y Y Y Y lY FY >g 8 Y Y Z Z Z Z Z Z f~ @
$ L~
F @ P X~ Z~ &~
8
č ~ ! Z ^ T^) 4FBBB T^ S HFDF@FS T^ R <F8F4F T^ O O0F,F(F T^: C LyC O0F$F(F8[C T^< cA T^+ O T^, xB T^ C FG O F,F(FDG T^) C FG O F,F(FDG T^g C G O ,F(FdF T^ C O O ,F(FO t^ tG mGDxGvGtxG t^ S FF|FFxFFhS t^ eR tFFpFFlFFRRtRR t^ O OhFFdFF`FF t^ C ZG OhFFdFF`FF PG t^ C DG OhFFdFF`FFDG t^) C DG OhFFdFF`FFDG t^ C E OhFFdFF`FF@EEE t^ C O OhFFdFF`FFlO Z][][] U ^] U _] U 2 +_] U 3 K_] U 1 k_] FpFJ _] U 5 _] \FFJ (@AAA==(A * } E # ( D ( @ A A A = = A * deadcv G# G0^] $I$I$I$IG$I RI"H GIIIII RI"H dHH I Ix HH, HH, HH H HH L@HH H H4HH 8HHHexec_init jg]
q]\fg]qg]}g]assert_sleepable mutex_vector_enter self 4*\p*\*\*\*\*\ system drvctl *\ p*\ 4*\ @ @ @ @ @ rw_vector_enter A D 0 pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d)
pid %d (%s), uid %d: exited on signal %d (core dumped)
bIpbI bI\ ioexp_set_backlight cJXbJ`J[JXJdJ cJXbJXJ8XJ[JI RI"H p^ HsJqJ x ]{ 5] 0{J7UzJ0{J xJzJ @ 0A @ 0 H @ P ` @ p @ p@ ̔JJВJJIJ ̔JJxJJJI RI"H 0\ G# ܗJ']]t\Vl\,;C\,;C\,;C\TJܟ\0J\,;C\,;C0\,;CL\,;Ch\,;C\H?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????
!"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ! #$%&'() + - 0123456789 @ABCDEFGHIJKLMNOPQRSTUVWXYZ ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{ }~ ϾǎԐѥ噞᷵ǎԐѥJJ =CJ8#CJ U 6\ G# <K] . .. t\Vl\K\4VK\T;C\D;Cܟ\UK\KK\ SK0\LHKL\hEKh\@K\;C\HC\P\@\ G# TL] t\Vl\ L\M\M\Lܟ\LM\xL\L0\lML\TLh\K\;C\H\ ] 0MMhM 0] O]
n] ] MhMM 5 B\hB\ 5 tC\C\ = B\hB\ = tC\C\ V D\PE\ V \F\F\N]N] G\8H\P]2O]t] DI\I\P J\ K\H]\ ,L\L\ M\N\ c 0 ' c ' g 0 ' w ' / # ! ! ! @ !
@ 8 %
@ ` ` ` ` ` ` ` ` {X 9 u] |XNVNJ Z (Z 0Z pxa2x0_i2c_intr_sub ] 8NdN N ? ? ? ? @ ` p x | ~ 0 8 < > ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ???????? @ ` p x | ~ 0 8 < > ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? @ ` p x | ~ 0 8 < > ? ? ? ? ? ? ? ? ? @ ` p x | ~ 0 8 < > ? f]|6Oi]5Ov]4O] :O]8O]3O @ 6cccc||||wwww{{{{kkkkoooo0000gggg++++vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWW iiiiَ UUUU((((ߌ
BBBBhhhhAAAA----TTTTQP~SeAä:^';k EXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk +pXhHElR{#srKW f*U(/µ{ӥ70(#j\+ ϧyNieվ b4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG
||B 2H+ plNrZV8= ծ6'9-
dh!\T[$:.6 g
WҖOa ZiKw
*h8,4$_@r %(IXq'Of ɴ:}Jc1`3QESbwdk +XhHpElޔ{R#sKrW *Uf(µ/{ņ7(0#j\+ ϊyiNeվ b4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG
|B| H+2p NrZlV8 ծ='9-6d
!\hT[:.6$g
WҖO aiKwZ
*C"<
Nj-ȩ WLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/ 0R
wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:,
xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL ,QeF^]5st.A Z gRے3VGmaךz 7Y<'5a h,4$8_@r %⼋I<(A
q9 ؐVda{p2t\lHBWЧQPeA~S^':k;E XK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk +hHpXElޔ{Rs#Kr WUf*(µ/{ņ7ӥ(0#j\ ϊ+yiNe;b4 ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y
|GB| +2Hp rZlN8Vծ= 9-6'
d\h!T[.6$:g
WґO aKwZi
*"4$8,@_ r% I<(
A9q Vd{a2p\lHtWBQPA~Seä':^;k EXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk +HpXhEޔl{Rs#Kr WUf*(/ņ{7ӥ(0#j\ϊ+ yiNeվ4 bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G
B| +2H pZlNrV8= -6'9
d\h![T6$:.
gWҖOa wZiK
*"$8,4_@ r %<(I
A9q Vd{a2plHt\BWccƄ||ww{{
kkֱooTőP00`gg}++Vb櫫MvvEʏ @ɉ}}YYGG 쭭AgԳ_E#Srr[·u ᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07
/ 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ ,` @ ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa
ppB>>|ĵqffHH aa_55jWWйiX' :'8볘+3"iip٩3-" < I·UUx((PzߥY
ڿe1BBhhAA)w--Z ˰{TTֻm:,ƥcc||ww{{
ֽkkޱooT`P00ΩggV}++bM櫫vvE @}}YYGG A쭭g_E#Srr[u· =Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7
/ $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh ,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88cwuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y^^ v;dV22tN::
II
Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$ WsǴQ#|tt>! KKaܽ
pp|B>>qĵ̪ffHH £aaj_55WWiйX:' '8+"3һiip3-<" IΪUUPx((zY
eڿ1BBиhhAA)Zw-- {˰TTmֻ,:ccƥ||ww{{
kkֽooޱőT00`PggΩ++V}bMvvʏE ɉ@}}YYGG AԳg_Eꜜ#Srr[u =&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7
/ $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh , @` y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋
pp>>|Bqff̪HH aa£55j_WWiІX :''8+"3iiһ٩p3- <" ·IUU((PxߥzY
e1BBhhиAAÙ)--Zw {TTm,:cƥc||ww{{
kֽkoޱoőT0`P0gΩg+V}+bMvvʏEʂ ɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u· =&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7
/ $6=&'Ni'Ͳuu ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh , @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP! KKaܽ
pp>|B>qĵf̪fHH a£a5j_5WWiйX :' '8+"3iһi٩pَ3- <" ·IUU(Px(ߥzߌY
eڿ1BBhиhAA)-Zw- {˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث
XXXXEEEE,,,, ????kkkk::::AAAAOOOOggggꗗsssstttt""""筭55557777 uuuunnnnGGGGqqqq ))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZ ݨ33331111YYYY''''____````QQQQJJJJ
----zzzzɜ;;;;MMMM****뻻<<<]F]P]Z]a]j]s]}]]]]]]]]]]]]]]] ]]]]!]&]+]p]0]5]:]@]F]
@ ` ]]']]\]] ]
fstrans_setstate holdrelel vwakeup vclean vrelel WܧWW|WtWW`WlW H wapbl_flush G# W] ?] \ J] \ U] \ `] \ j] \ s] \ }] \ ] Ȥ\ ] Ф\
] ؤ\ ] \ ] \
] \ ] \ ] \ ] \ ] \ ] \ ] \ ] (\ ] 4\ ] @\ #] T\ -] \\ 7] h\ C] p\ O] x\ \] \ h] \ u] \ ] \ ] \! ] \ " ] \# ] \$ ] \% ] ȥ\& ] Х\' ] إ\ ( ] \) ] \* ] \ + ] \ , "] \ - 2] \ . B] \ / T] \ ] t\P\l\\\\ܟ\\\0\L\h\\\\ؠ\\\,\H\d\\\\ԡ\\ \(\D\`\|\\\Т\\\$\@\\\x\\\̣\\\ \<\X\ DX`X|XXXXX,X (~ERROR TIMEOU
DF !X*XX`/X X,+X !X*XlX$X`/XI RI"H ]]]]]] ^$ ^8 ^O ^]]]] ^a ^t ^ ^ ^
^ - ^ e]^ 2 ' E "^)^0^ 3^K^ d^l^ N]^ w^^ ^^ N])^ N]^ sysctl_wi wi_push_packet wi_write_txrate wi_start wi_rx_intr wi_rssadapt_input wi_tx_intr wi_tx_ex_intr X\XX XXXXX0XXX ^XXXXX@X ' ^XXXX$XX @ [ \ ] ^ _ ` { | } ~ | ^ _ ` # @ _ ^ _ ` # _ # ^ _ ` ^ _ # @ ^ _ ` ~ # @ ^ _ ` ~ ^ _ ` ` # _ # @ [ \ ] ^ _ ` { | } ~
! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ %% $ $
$
$ $%% %%<%## %## %$%4%,%%d"e"`"
" %" #!#%#
# # #
"" *# d"`"e"+"4" " " ""<"C" !!a" """)"*"'"(" " !!!! ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^M ^S ^ ^ ^
^
^
^
^
^
^
^!
^%
^)
^-
^1
^5
^9
^=
^A
^wsevent_copyout_events t
Y
Y @ `P0pH(hX8xD$dT4t L,l \<|B"bR2r
J*jZ:zF&fV6vN.n ^>~A!aQ1q I)iY9yE%eU5u
M-m ]=}C#cS3s K+k[;{G'gW7wO/o _?~ & `~ & ~ & \ \ \ 2 \ ) ̳\ a \ \\ p\ \ o Ե\ D\
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ͳ ɿپ ̴ ް
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ 1Y0Y80YI/YI /YIL/Y ABCDEFGHIJKLMNOPQRSTUVWXYZ NYFYFYIMYI 0FYIEY < d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !
[ " $ & ' X 4 g k l r : ; < = > ? @ A B C D E F G H I J K L M \ \ 1 ! 2 "
q w W ^ a
z
'3 # &4 $ e E = s d D ` x 5 % r R + t T [ f F \ c - - @ 6 & !y Y ] "g G ; #v $b B _ % &
(7 ' )8 ( *u U { +h H : ,n -, / < .09 ) 1i I } 2j J * 3m 4. ? > 680 ~ 9o :k ;l L | =>@ Ap D
FPQSTXY]
m1 ! 2 "
q w W ^ a
z
'3 # &4 $ e E = s d D ` x 5 % r R + t T [ f F \ c - - @ 6 & !y Y ] "g G ; #v $b B _ % &
'(7 ' )8 ( *u U { +h H : ,n -, / < .09 ) 1i I } 2j J * 3m 4. ? > 680 ~ 9o :k ;l L | =>@ Ap D
FKT]
zssp_init zssp_ic_start zssp_ic_stop zssp_read_max1111 zssp_read_ads7846
}
j Z g g % #( K (sF strtoumax 0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z- A1b62S-+ldEw}ZVǖAOIъ OM~- QJ#SpxAaU.7 Y -6]]w ll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* , m8 6F߲]qTp0ek*1u 4yީ%8 S1bSWĔՖ k1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$ ,52F* sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL 8^#ܖ TZ1ObbSyOIV~P-{ b-R4 ٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ
?&~?$pi;FBzw[keZ~7 Sv8H 3?r$ 7jnԄYFܨ |OQ;օ
U d S
-
=G\ p& G w ) ` /a߫i5&LsZ<#0zMzFM8,9; :R:( q-v,.7/pXqY s3r %w+OQvrtEux܉~OK
}!b|ty Bxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HIN SKyuJcO NZLݘMFGN@E$DD2AsX@*IB CPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^
iϏ은BI#ƈdX ܁T̓cQ:
rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"_HS1 ^Z4 eg Wb27_k%8ם(ŊO}doJj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg;
i8P/ _Y=чe:ZO?(3wwXR
@hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?# 1jvʬ`p^ Y<L~i/{kHwâ
hs)aLoD~Pf7VM'(@ﰤ ہg9x+ n&;f?/X)T`D1 ߨM ߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$ !AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3
m:@/)IJNv"2x+ ٗ Kx.HҥfAj ^y9*O]#kM`~b_R 7zF h!1߈Vc0a"j6nS Nr )Υ{t*F8#vufz`rs"WG9^EMvc&DAdQy/4 Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫϩ7~8A]&nv|o Y
yKiw\¹9~$ 66nQ fq>,o,IӔ 渱{I
.H>C-Yn馑gQ z taf w0a, Qmpjc5dۈ2yܸ و L+~|- dj qHA}mԵQӅlVdkbze\Ocl=c
;n Li^`Agqr<KG
k5Blۻ֬@2lE\u
ϫ=Y&0Q :Qa!V#Ϻ(_ ٲ $/o|XhLa f-=vAq *q 3xɢ 4 j
m=-dlc\kkQ labe0b Nl{WeP|b -I|LeMaX:QΣ tԻ0JߥA=ؕפmCij4ngF`D-s3
L_
|Pq<'A Wh% of a^)ɘИ"רY=.
\;l tҚG9w&sc d;
mj>zjZ
'}D hibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K
+گ
L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮ d°c&ujm
6?rg WJz{+ 8Ҏվ
| !Bhݳ ڃn&[owGwZjpf; \ebiaklE
x
NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮SG0齽 ʺS0$6TW)#gfz.aJ]h*o+ 7 Z- 1A26b+-Sdl}wEVZOAي»IˬO ~M- JQS#xpaA.U7 Y -۩6˚w]]ll A?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z , 8mF6]pTqke0*1¶ u4%y<8syjHA}X* ݹ 1SbSW§ٖծ 1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8, $5 *F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8 #^T O1ZbbySIOP~V{-b -4R ^~GelHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb#
&??~p$iBF;[wzek~ZS 7H8v ?3$r j7nFY |OQ;
U dؓS
-
\G= &p G w ` )/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+ )`F(>
q-q ,v.Ț/7pqXs Yr3w% vQO+tru՛E~xKO}
|b!ytxB z{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKS NJuyOcN LZMݥFĚGE@ND$A2D@XsBI*C ThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z
&J8 좞V`a/6i\lU,zB\u H=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_
^ϋiBۉI#dX фTQc:r
Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފ Z^ھ4 ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[
;g /P8i_ Y=嗇e:ϏOZw3(?RXw@
Qh+HZ"0*WOIo@}m5N#+'*GA |HX=#?X1 vjʨ`^p YL'! $UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n
:m@I)/NJ2"v+x xKH.jAf^ O*9y]#Mk~`bю_ Rz7h Fм!10cV"ajحn6 S rN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA 4S&ֿ EbLil!>aDƋΪ~7A8n&]|vY oᡱ
Kyiw¡\~9$66 Qnf>q,o,ӹI 散
I{. C>HnY-Qg̰ t zfag jgrn<:ORQhك [/BD7q۵[V9Y?^ [1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg))
'8!.m,M
8STs
e
jv.,r迢KfpK£Ql$օ5pjl7 LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6 _:OтRQ l>+hkAك y!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^ BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= %
GoQcpn
g))/F
'&&\8!.*Zm,M߳
8ScTs
ew<
jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7 LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj( c#齂lPyƲ+SrxqƜa&>'!Ǹ }xnO}orgȢ}c
?G 5 q}#w($@{2
˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd
. ۤO HG ^\^^^^^]]^^^\Z]^^^^^^\^]^^^^^\^+\gntsx7Z 7Z6Z ^
^ (Z^^ 8uZc^ 8uZ^ rZ;] iZi^ TUZ^ =Z rbmnQZ QZ OZ OZPZMZpNZ v^ WARNING: double match for boot device (%s, %s)
boot device: %s
bpf_mcpy bpf_change_type %s: ifpromisc failed: %d %s: descriptor not in list bpfattach maxbufsize peers %s: bpf_setdlt: ifpromisc failed (%d)
bpfops : Media interface
: %s, rev. %d
bge bnx phyflags failed to get phyflags
chipid failed to get chipid
no media present 2500baseSX-FDX, BCM5400 1000BASE-T media interface BCM5401 1000BASE-T media interface BCM5411 1000BASE-T media interface BCM5421 1000BASE-T media interface BCM5462 1000BASE-T media interface BCM5461 1000BASE-T media interface BCM54K2 1000BASE-T media interface BCM5464 1000BASE-T media interface BCM5701 1000BASE-T media interface BCM5703 1000BASE-T media interface BCM5704 1000BASE-T media interface BCM5705 1000BASE-T media interface BCM5714 1000BASE-T media interface BCM5750 1000BASE-T media interface BCM5752 1000BASE-T media interface BCM5780 1000BASE-T media interface BCM5708C 1000BASE-T media interface BCM5481 1000BASE-T media interface BCM5482 1000BASE-T media interface BCM5709 10/100/1000baseT PHY BCM5709S 1000/2500baseSX PHY BCM5709CAX 10/100/1000baseT PHY BCM5722 1000BASE-T media interface BCM5754/5787 1000BASE-T media interface BCM5755 1000BASE-T media interface BCM5761 10/100/1000baseT PHY BCM5784 10/100/1000baseT PHY BCM5785 1000BASE-T media interface BCM5906 10/100baseTX media interface disksort fcfs _bus_dmamap_load_raw: not implemented _bus_dmamap_sync: mix PRE and POST _bus_dmamap_sync: ARM32_BUFTYPE_RAW _bus_dmamap_sync: ARM32_BUFTYPE_INVALID unknown buffer type %d
_bus_dmamap_sync _bus_dmamem_map: size botch cd9660nopl cd9660_reclaim: pushing active IEEE_1282 IEEE_P1282 RRIP_1991A RRIP with incorrect flags? RRIP with incorrect NM flags?
RRIP without PX field?
SP vfs cd9660 utf8_joliet CD001 %/@ %/C %/E root_device fhtovp: lbn exceed volume space %d
fhtovp: crosses block boundary %d
fhtovp: bread error %d
fhtovp: directory crosses block boundary %d[off=%d/len=%d]
ISOFS mount tag VT_ISOFS, isofs vnode
cd9660_strategy: spec org.netbsd.kauth.system %s: %d silo overflow%s, %d ibuf flood%s
device enable failed
' ns16550, broken fifo ns8250 or ns16450, no fifo ns16550a, working fifo Au1X00 UART, working fifo ns16650, no ERS, working fifo OMAP UART, working fifo can't re-init serial console @%lx
txfifo disabled
unable to allocate ring buffer
couldn't establish interrupt
configure failed, error=%d
MEGAHERTZ MODEM XJ2288 config_hook: invalid hook type config_hook: incompatible mode on type=%d/id=%ld != %d config_hook: type=%d/id=%ld is replaced config_hook: type=%d/id=%ld is already hooked(%p) config_hook: malloc failed config_connect: malloc failed config_connect: can't connect with shared hook, type=%d id=%ld cnopen: no console device cnopen: cn_tab->cn_dev == dev cnopen: unable to get vnode reference
%s@%d NetBSD-CORE ELF Processor failed probe - no CPU ID
%s%s%s (%s core) %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled %s: %dKB/%dB %d-way %s unified cache
%s: %dKB/%dB %d-way Instruction cache
%s: %dKB/%dB %d-way %s Data cache
%s: %s does not fully support this CPU.
%s: This kernel does not fully support this CPU.
%s: Recompile with "options %s" to correct this.
unknown CPU (ID = 0x%x) arm700swibug %s: SA-110 with bugged STM^ instruction
ARM600 ARM610 ARM620 ARM700 ARM710 ARM7500 ARM710a ARM7500FE ARM710T ARM720T ARM740T (8 KB cache) ARM740T (4 KB cache) ARM810 ARM920T ARM922T ARM926EJ-S ARM940T ARM946E-S ARM966E-S TI ARM925T Sheeva 88SV131 Sheeva 88FR571-vd ARM1020E ARM1022E-S ARM1026EJ-S SA-110 SA-1100 SA-1110 IXP1200 i80200 i80321 400MHz i80321 600MHz i80219 400MHz i80219 600MHz PXA27x PXA250 PXA210 PXA255/26x IXP425 533MHz IXP425 400MHz IXP425 266MHz ARM1136J-S r0 ARM1136J-S r1 ARM1176JZ-S r0 ARM11 MPCore Cortex-A8 r1 Cortex-A8 r2 Cortex-A8 r3 Cortex-A9 r1 FA526 CPU_ARM2 ARM2as CPU_ARM250 CPU_ARM3 CPU_ARM6 CPU_ARM7 CPU_ARM7TDMI CPU_ARM8 ARM9TDMI ARM9E-S CPU_ARM9E ARM9EJ-S ARM10E CPU_ARM10 ARM10EJ SA-1 CPU_SA110 XScale CPU_XSCALE_... ARM11J CPU_ARM11 ARMv4 CPU_ARMV4 Cortex CPU_CORTEX write-through write-back **unknown 3** **unknown 4** write-back-locking write-back-locking-A write-back-locking-B **unknown 8** **unknown 9** **unknown 10** **unknown 11** **unknown 12** **unknown 13** write-back-locking-C **unknown 15** rev 0 rev 1 rev 2 rev 3 rev 4 rev 5 rev 6 rev 7 rev 8 rev 9 rev 10 rev 11 rev 12 rev 13 rev 14 rev 15 step J step K step S step T step B step C step D step E rev 10step G step A-0 step B-0 step B-1 step B-2 step B-3 step B-4 step B-5 (IXP1200 step A) (IXP1200 step B) (IXP1200 step C) (IXP1200 step D) (IXP1240/1250 step A) (IXP1240 step B) (IXP1250 step B) step A-1 step C-0 step D-0 step 0 *p0 *p1 *p2 *p3 *p4 *p5 *p6 *p7 *p8 *p9 *p10 *p11 *p12 *p13 *p14 *p15 No support for this CPU type (%08x) in kernel cpu.branchpredict cpu.cache cpu.nocache xscale.branchpredict xscale.cache xscale.icache xscale.dcache tag VT_NON, dead vnode
dead_write: lock dead_read: lock m_pulldown malfunction , rrx , %s r%d , %s #%d thumb insn
#0x%08x [r%d] [r%d #0x%03x #0x%02x { r%d-r%d } ^ f%d #%s 0x%04x spsr cpsr p%d f%d, c%d, c%d, c%d, c%d r%d, c%d, c%d, %d %d, r%d, r%d, c%d [%c - unknown] und%s %08x
imb imbrange swi blx Snms mla Snmsd umull Sdnms smull umlal smlal strt daW ldrt strbt ldrbt ldr strb ldrb stm YnWl ldm XnWl ldrsb ldrh strh ldrsh swp dmo swpb mrs msr pFm pF2 bx clz bkpt Sdn2 eor sub adc sbc rsc tst Dn2 teq cmn orr mov Sd2 bic mvn adf PRfgh muf suf rsf dvf rdf pow rpw rmf fml fdv frd pol fpbop mvf PRfh mnf abs sqt lgn sin cos tan asn acs atn fpuop stf QLv ldf PRgd fix PRdh wfs rfs wfc rfc cmf PRgh cmfe cnfe mcr2 #z mcr mrc2 mrc cdp2 #y cdp mcrr #& mrrc ldc2 L#v ldc stc2 stc %s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu)
dkdrn %s at %s (%s) deleted
%s%u: unable to attach pseudo-device
ESDI sectors-per-unit sector-size sectors-per-track tracks-per-cylinder cylinders-per-unit %s at %s: %s
%s: %llu blocks at %lld, type: %s
WARNING: double match for wedge name %s (%s, %s)
wedge:%s dkwedge: unable to attach cfdriver dkwedge: unable to attach cfattach dk-method-%s: method "%s" already exists at priority %d
%s: unable to compute pdev, error = %d
%s: unable to find vnode for pdev, error = %d
%s: unable to lock vnode for pdev, error = %d
%s: unable to open device, error = %d
%s: unable to close device, error = %d
WARNING: double match for boot wedge (%s, %s)
dkwedge dmover_backend_unregister dmover dmreq dmses dmover_session_destroy DM9101 (AMD Am79C873) 10/100 media interface DM9102 10/100 media interface : failed to clear NIC buffer at offset %x - check configuration
dp8390_start: no header mbuf Ethernet address %s
%s: device timeout
%s: NIC memory corrupt - invalid packet length %d
exec_elf32 #! exec_script vmcmd kills extends calls : 3Com internal media interface
ignoring this PHY, non-zero instance
no media present
exphy_service: can't isolate 3Com PHY Fatal %s mode data abort: '%s'
trapframe: %p
FSR=%08x, FAR= Invalid, Fatal %s mode prefetch abort at 0x%08x
trapframe: %p, spsr=%08x
r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x
r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x
r8 =%08x, r9 =%08x, r10=%08x, r11=%08x
r12=%08x, usp=%08x, ulr=%08x ssp=%08x, slr=%08x , pc =%08x
Fatal abort
Kernel mode double abort!
%s: Misaligned Kernel-mode Program Counter
Non-emulated page fault with intr_depth > 0
uvm_fault(%p, %lx, %x) -> %x
UVM: pid %d (%s), uid %d killed: out of swap
%s: invalid size (%lu) Vector Exception Alignment Fault 1 Terminal Exception Alignment Fault 3 External Linefetch Abort (S) Translation Fault (S) External Linefetch Abort (P) Translation Fault (P) External Non-Linefetch Abort (S) Domain Fault (S) External Non-Linefetch Abort (P) Domain Fault (P) External Translation Abort (L1) Permission Fault (S) External Translation Abort (L2) Permission Fault (P) uid %d, pid %d, command %s, on %s: %s
dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s
%s: bad size bad block %lld, ino %llu
bad block cg = %d, irotor = %d, fs = %s
ffs_nodealloccg: map corrupted ffs_nodealloccg: block not in map start = %d, len = %d, fs = %s
offset=%d %ld
cg %d
ffs_alloccg: map corrupted bno = %d, fs = %s
ffs_alloccg: block not in map ifree: dev = 0x%llx, ino = %llu, fs = %s
ifree: freeing free inode dev = 0x%llx, block = %lld, fs = %s
blkfree: freeing free block blkfree: freeing free frag file system full
%s: write failed, file system is full
dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s
ffs_realloccg: bad bprev bad blockno %s: optimization changed from SPACE to TIME
%s: optimization changed from TIME to SPACE
dev = 0x%llx, optim = %d, fs = %s
ffs_realloccg: bad optim ifree: range: dev = 0x%llx, ino = %llu, fs = %s dmode %x mode %x dgen %x gen %x
size %llx blocks %llx
ino %llu ipref %llu
ffs_valloc: dup alloc free inode %s/%llu had %lld blocks
out of inodes
%s: create/symlink failed, no inodes free
ffs_balloc: blk too big Could not unwind indirect block, error %d ffs_indirtrunc: bad buffer size itrunc: newspace snapblkfree: inconsistent block type ffs_snapshot_mount: vget failed %d
ffs_snapshot_mount: non-snapshot inode %d
ffs_snapshot_mount: read_1 failed %d
ffs_snapshot_mount: read_2 failed %d
ffs_snapshot_mount: %llu already on list ffs_isblock: unknown fs_fragshift %d ffs_isfreeblock: unknown fs_fragshift %d ffs_clrblock: unknown fs_fragshift %d ffs_setblock: unknown fs_fragshift %d ffs doclusterread doclusterwrite doreallocblks log_changeopt ffsino ffsdino1 ffsdino2 , not mounting ffs_reload: dirty1 appleufs %s: unknown ufs flags: 0x%08x%s
ffs_reload: dirty2 ffs_mountfs: block size (%d) > MAXBSIZE (%d)
%s: replaying log to disk
%s: replaying log to memory
%s: options QUOTA2 not enabled%s
update: rofs mod %s: file system not clean (fs_clean=%#x); please fsck(8)
%s: lost blocks %lld files %d
%s: `-o softdep' is no longer supported, consider `-o log'
%s: nonsync dir write ffs_write %s: type ffs_wapbl: unknown journal type %d
%s: file size (%lld) non zero
%s: ufs_getlbns failed, error %d!
%s: unexpected numlevels %d from ufs_getlbns
ffs_wapbl: cylinder group size of %lld MB is not big enough for journal
%s: log not allocated, largest extent is %lldMB
%s: GOP_ALLOC error %d
ffs_wapbl_replay_finish: unable to cleanup inode %u
ffs_wapbl: vget failed %d
ffs_wapbl: try to clear non-log inode %lld
%s fs superblock in old format, not journaling
tag VT_NON , fifo with %d readers and %d writers fiford fifowr /usr/src/sys/miscfs/genfs/genfs_io.c genput genfs: bad op addr 0x%x %s at %s addr 0x%02x : I2C bus
unable to create intr thread
i2c-child-devices cookie compatible WARNING: ignoring bad device address @ 0x%02x
iicintr WARNING: intr handler list not empty
WARNING: proc handler list not empty
iic at %s (src=%s dst=%s tgt=%s) icmp6_redirect_timeout: bad route to timeout icmp6_mtudisc_timeout: bad route to timeout inet6 icmp6 rediraccept redirtimeout nd6_prune nd6_delay nd6_umaxtries nd6_mmaxtries nd6_useloopback nodeinfo errppslimit nd6_maxnudhint mtudisc_hiwat mtudisc_lowat nd6_debug nd6_drlist nd6_prlist maxqueuelen icmp6_mtudisc_callback_register sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d
/usr/src/sys/netinet6/icmp6.c icmp6_reflect: source can't be determined: dst=%s, error=%d
ENOBUFS in icmp6_error %d
ICMP6 redirect sent from %s rejected; must be from linklocal
ICMP6 redirect sent from %s rejected; hlim=%d (must be 255)
ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s
ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s
ICMP6 redirect rejected; no route found for redirect dst: %s
ICMP6 redirect rejected; redirect dst must be unicast: %s
ICMP6 redirect rejected; neither router case nor onlink case: %s
icmp6_redirect_input: invalid ND option, rejected: %s
icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s
ICMP6 checksum error(%d|%x) %s
icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d)
ICS1889 10/100 media interface ICS1890 10/100 media interface ICS1892 10/100 media interface ICS1893 10/100 media interface invalid vap id %d vap id %d not allocated invalid channel freq %u flags %x
invalid channel (NULL)
%s: mode %u not supported (caps 0x%x)
Unexpected mode %u %s: no channels found for mode %u
Bad IBSS channel %u bad channel ignored; freq %u flags %x number %u
vap table full %s: no 802.11 instance!
.5 %s: %s rates: %s%d%sMbps 11a 11b 11g FH turboA turboG AMRR increasing rate %d (txcnt=%d retrycnt=%d)
AMRR decreasing rate %d (txcnt=%d retrycnt=%d)
No cipher! %s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u
%s: driver did not delete key index %u
%s: cipher %s has an invalid cipher index %u
%s: cipher %s registered with a different template
%s: invalid cipher %u
%s: unregistered cipher %u, load module %s
%s: unable to load cipher %u, module %s
%s: no h/w support for cipher %s, falling back to s/w
%s: no h/w support for TKIP MIC, falling back to s/w
%s: unable to attach cipher %s
%s: no h/w resources for cipher %s, falling back to s/w
%s: unable to setup cipher %s
%s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u
%s: cipher %s rejected key index %u len %u flags 0x%x
%s: no key index; should not happen!
[%s] no default transmit key (%s) deftxkey %u
%s: WEP data frame too short, len %u
[%s] unable to pullup %s header
wlan_wep wlan_tkip wlan_aes_ocb wlan_ccmp wlan_ckip %s: control frame %s: Invalid key length %u, expecting %u
[%s] Missing ExtIV for AES-CCM cipher
not enough data in following buffer, m_len %u need %u
[%s] AES-CCM decrypt failed; MIC mismatch
AES-CCM [%s] key id %u is not set (decap)
[%s] key id %u is not set (encap)
NONE out of buffers with data_len %zu
[%s] missing ExtIV for TKIP cipher
[%s] discard frame due to countermeasures (%s)
[%s] TKIP ICV mismatch on decrypt
[%s] Discard frame due to countermeasures (%s)
TKIP [%s] out of data for WEP (data_len %zu)
[%s] WEP ICV mismatch on decrypt
WEP [%s:%s] discard %s frame, %s information element, WME too short, len %u [%s] discard %s frame, ssid mismatch: [%s] shared key challenge alloc failed
[%s] extended rate set too large; only using %u of %u rates
reassoc WPA RSN , protection , QoS ie too short ERP bad len %u unhandled id %u, len %u no scan.rates bad scan.rates len %d no scan.ssid bad scan.ssid len %d invalid channel %u for off-channel %u bogus beacon interval [%s] erp change: was 0x%x, now 0x%x
[%s] capabilities change: before 0x%x, now 0x%x
no rates bad rates len %d no ssid bad ssid len %d no ssid with ssid suppression enabled [%s] recv probe req
recv'd rate set invalid [%s] recv auth frame with algorithm %d seq %d
disallowed by ACL TKIP countermeasures enabled shared key auth PRIVACY is disabled bad sta auth mode %u ie %d/%d too long no challenge bad challenge len %d bad operating mode %u bad state %u [%s] shared key %sauth request
shared key response unknown station no challenge recorded challenge mismatch [%s] station authenticated (shared key)
bad seq %d [%s] shared key auth failed (reason %d)
open auth [%s] station authenticated (open)
[%s] open auth failed (reason %d)
unsupported alg %d wrong bssid [%s] deny %s request, sta not authenticated
[%s] no WPA/RSN IE in association request
not WPA, flags 0x%x bad version %u mcast cipher mismatch; got %u, expected %u ucast cipher data too short; len %u, n %u ucast cipher set empty key mgmt alg data too short; len %u, n %u no acceptable key mgmt alg not RSN, flags 0x%x [%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x
[%s] deny %s request, capability mismatch 0x%x
[%s] deny %s request, rate set mismatch
[%s] %sassoc failed (reason %d)
[%s] %sassoc failed (rate set mismatch)
[%s] %sassoc success: %s preamble, %s slot time%s%s
[%s] recv deauthenticate (reason %d)
[%s] recv disassociate (reason %d)
mgt subtype 0x%x not handled too short (1): len %u wrong version %x not to bss too short (2): len %u duplicate seqno <%u,%u> fragno <%u,%u> tid %u data too short: expecting %u unknown dir 0x%x multicast echo unknown src unassoc src [%s] power save mode on, %u sta's in ps mode
[%s] power save mode off, %u sta's in ps mode
[%s] flush ps queue, %u packets queued
multicast fragm? demic error decap error unauthorized port: ether type 0x%x len %u %s: unable to allocate VLAN tag
too short: len %u received %s from %s rssi %d
WEP set but not permitted WEP set but PRIVACY off ps-poll unassociated station aid mismatch: sta aid 0x%x poll aid 0x%x [%s] recv ps-poll, but queue empty
[%s] recv ps-poll, send packet, %u still queued
[%s] recv ps-poll, send packet, queue empty
bad frame type 0x%x [%s] %s
link-layer statistics and controls ieee80211 IEEE 802.11 WLAN statistics and controls %s: sysctl_createv failed, rc = %d
client/peer stations %s: sysctl_createv failed (rc = %d)
vap%u parent inact_run inact_probe inact_auth inact_init driver_caps bmiss_max %s: 802.11 mgt frame too large: %u bad beacon boundary bss %s: %snode %s join
%s: %snode %s leave
%s: notify scan done
[%s] %s replay detected
[%s] michael MIC verification failed
%s: load the %s module by hand for now.
bogus aid %u, max %u %s %p<%s> in %s table
%s: IEEE80211_LOCK not held %s: remove %p<%s> from %s table, refcnt %d
%s: %p<%s> clear key map entry
%s: free all nodes in %s table
0x%p: mac %s refcnt %d
scangen %u authmode %u flags 0x%x
associd 0x%x txpower %u vlan %u
txseq %u rxseq %u fragno %u rxfragstamp %u
rstamp %u rssi %u intval %u capinfo 0x%x
bssid %s essid "%.*s" channel %u:0x%x
fails %u inact %u txrate %u
???? ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set: %s%u start chan %u
%s %s table
%s: %s[%u] still active
[%s] scan candidate purged from cache (refcnt %u)
passive %s: end %s scan
refcnt(ni) == %d ic != NULL %s: fixed rate %d (%d.%d Mb/s) not in rate set %s %p<%s>
%s: add key map entry %p<%s> refcnt %d
[%s] no node, discard frame (%s)
%s %p<%s> refcnt %d
%s: %p<%s> clear key map entry new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02x neighbor %s: merge failed, capabilities mismatch
%s: new bssid %s: %s preamble, %s slot time%s
%s: creating ibss
%s: no scan candidate
%s
macaddr bssid chan rssi rate flag wep essid %s: chan %d->%d
begin %s scan in %s mode, scangen %u
key map out of sync, ni %p nikey %p %s: delete key map entry %p<%s> refcnt %d
[%s] station with aid %d leaves
unexpected operating mode %u bogus long slot station count %d [%s] long slot time station leaves, count now %d
%s: re-enable use of short slot time
bogus non-ERP station count %d [%s] non-ERP station leaves, count now %d
%s: disable use of protection
%s: re-enable use of short preamble
[%s] station needs long slot time, count %d
[%s] station is !ERP, %d non-ERP stations associated
%s: enable use of protection
[%s] station needs long preamble
[%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s
%s: %s scangen %u
[%s] discard frame, age %u
[%s] discard %u frames for age
probe station due to inactivity station timed out due to inactivity (refcnt %u) unable to setup inital BSS node %s: no memory for AID bitmap!
%s: no memory for TIM bitmap!
%s %s table, inact %u
Cannot allocate key index map with %u entries
scan 80211node no WPA/RSN! RSN IE too big, %u > %zu WPA IE too big, %u > %zu ena [%s] send null data frame on channel %u, pwr mgt %s
no ethernet header! %s: cannot expand storage
not enough room, need %u got %zu
[%s] enmic failed, discard frame
mbuf already chained? pktlen %u mtu %u fragment size %u too big! %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x
ieee80211_ref_node (%s:%u) %p<%s> refcnt %d
rcvif not null [%s] send probe req on channel %u
[%s] request encrypt frame (%s)
[%s] send station deauthenticate (reason %d)
[%s] send station disassociate (reason %d)
[%s] invalid mgmt frame type %u
[%s] encrypting frame (%s)
[%s] send %s on channel %u
%s: cannot get buf; size %u
no space for 802.11 header? %s: traffic %u, disable aggressive mode
%s: traffic %u, enable aggressive mode
tim bitmap empty! %s: TIM updated, pending %u, off %u, len %u
[%s] pwr save q overflow, drops %d (size %d)
[%s] save frame with age %d, %u now queued
wlan: %s acl policy registered
wlan: %s acl policy unregistered
wlan_acl 0x %s: %s -> %s
no recent beacons from %s; rescanning
%s: invalid transition
%s: bogus xmit rate %u setup
associated synchronized with %s ssid channel %d start %uMb
NODS %s ->%s TODS %s FRDS %s DSDS %s ->%s) type#%d WEP [IV %.02x KID %u] %dM +%d %s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u]
%s: %s log2(cwmin) %u
%s: WME params updated, cap_info 0x%x
%s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u]
%s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u]
beacon miss reassoc_req reassoc_resp probe_req probe_resp reserved#6 reserved#7 beacon atim disassoc deauth reserved#13 reserved#14 reserved#15 reserved#0 reserved#1 reserved#2 reserved#3 reserved#5 reserved#8 reserved#9 ps_poll rts cf_end cf_end_ack INIT SCAN AUTH ASSOC RUN WME_AC_BE WME_AC_BK WME_AC_VI WME_AC_VO WME_UPSD wlan_internal wlan_xauth rssadapt expavgctl %s: dst %s threshold[%d, %d.%d] %d < %d
%s: src %s rssi %d avg %d -> %d
ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds
%s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d
%s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds
%d-byte , T[%d.%d] = %d external %s: warning: unable to delete rtentry @ %p, error = %d
ifq maxlen drops inet ip6 org.netbsd.kauth.network %s%d %s: ifioctl_attach() failed too many interfaces sndq %s: could not attach sysctl nodes
if_detach: WARNING: AF %d not purged
invalid argument to %s ifaddr ether_multi host is not on local network could not allocate llinfo gateway route is not ours arplookup: unable to enter address for %s@%s on %s (%s)
%s: arp: link address is broadcast for IP address %s!
duplicate IP address %s sent from link address %s
%s tried to overwrite permanent arp info for %s
%s on %s tried to overwrite arp info for %s on %s
arp info overwritten for %s by %s
arp from %s: new addr len %d, was %d
arp from %s: addr len: new %d, i/f %d (ignored)
keep refresh log_movements log_permanent_modify log_wrong_iface arp_rtrequest: bad gateway value
arp_rtrequest: malloc failed
%s(%s): sockaddr_dl_init cannot fail arpresolve: can't allocate llinfo on %s for %s
arpintr revarp %s: can't handle af%d
%s: discarding oversize frame (len=%d)
looutput: no header mbuf ifmedia_add: can't malloc entry ifmedia_set: no match for 0x%x/0x%x
ifmedia_set failed ifmedia can't alloc mem for enet addr
can't map mem for enet addr
can't get subregion for asic
can't match ethernet vendor code
cannot set power mgmt handler
unable to establish power handler
PCMCIA AmbiCom Inc AMB8002T AmbiCom,Inc. Fast Ethernet PC Card(AMB8110) PMX PE-200 UE2212 D-Link DE-660 DE-660+ RPTI LTD. EP400 RPTI EP401 Ethernet NE2000 Compatible ACCTON EN2212 EN2216-PCMCIA-ETHERNET SVEC FD605 PCMCIA EtherNet Card Seiko Epson Corp. P/N: EEN10B Rev. 00 TAMARACK CNet CN40BC Ethernet PCMCIA-ETHERNET-CARD UE2216 ASIX AX88190 DFE-670TXD MELCO LPC2-TX LINKSYS E-CARD DE-650 I-O DATA PCLA corega K.K. corega Ether CF-TD LAN Card corega Ether PCC-T corega Ether PCC-TD corega Ether PCC-TL corega EtherII PCC-T corega EtherII PCC-TD corega FastEther PCC-TX corega FEther PCC-TXF corega FEther PCC-TXD corega FEtherII PCC-TXD (CG-LAPCCTXD) (HardwareFirmwareVer.) SMC 8041TX-10/100-PC-Card-V2 LNT-10TN CF 10Base-Ethernet 1.0 NDC DYNALINK L10C wiinit couldn't load firmware
failed to attach controller
SMC2632W NANOSPEED HFA384x/IEEE NEC Wireless Card CMZ-RT-WP NTT-ME 11Mbps Wireless LAN PC Card Wireless LAN PCC-11 Wireless LAN PCCA-11 corega_K.K. Wireless_LAN_PCCB-11 WL PCCL-11 WLCFL-11 INTERSIL Intersil PRISM 2_5 PCMCIA ADAPTER PLANEX GW-NS11H Wireless LAN PC Card D-Link Corporation D-Link DWL-650H 11Mbps WLAN Adapter igmp igmppl %d.%d.%d.%d invalid argument to in_lifaddr_ioctl in_control in4_cksum: offset too short for IP header in4_cksum: mbuf too short for IP header Couldn't unlink in6_ifaddr from in6_ifaddr
in6_unlink_ifa: autoconf'ed address %p has no prefix
ADD DELETE in6_ifloop_request: %s operation failed for %s (errno=%d)
in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d
in6_are_prefix_equal: invalid prefix length(%d)
in6_prefixlen2mask: invalid prefix length(%d)
in6_update_ifa: a destination can be specified for a p2p or a loopback IF only
in6_update_ifa: prefixlen should be 128 when dstaddr is specified
in6_update_ifa: valid lifetime is 0 for %s
in6_update_ifa: the prefix length of an existing (%s) address should not be changed
in6_update_ifa: failed to remove a route to the old destination: %s
in6_update_ifa: in6_setscope failed
in6_update_ifa: addmulti failed for %s on %s (errno=%d)
prefix ioctls are now invalidated. please use ifconfig.
nd6_prelist_add succeeded but no prefix
in6_control: failed to create a temporary address, errno=%d
invalid argument to in6_lifaddr_ioctl in6_if2idlen: unknown link type (%d)
ip6_options in6_cksum: offset too short for IPv6 header in6_cksum: mbuf too short for IPv6 header generate_tmp_ifid: never found a good ID
%s: got interface identifier from itself
%s: got interface identifier from %s
%s: borrow interface identifier from %s
%s: interface identifier generated by random number
%s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x
in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d)
in6_ifattach: %s has too small MTU, IPv6 not enabled
in6_ifattach: %s is not multicast capable, IPv6 not enabled
in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d)
%s: cannot assign link-local address
%s: didn't unlink in6ifaddr from list
in6pcbpl internet6 inpcbpl internet /dev/console warning: no /dev/console
warning: lookup /dev/console: error %d
init: couldn't allocate argument space init path (default %s) halt reboot use absolute path, "halt", or "reboot"
/sbin/init init: trying %s
exec %s: error %d
Detecting hardware... fork init cannot mount root, error = %d
pgdaemon fork pagedaemon ioflush fork syncer fork aiodoned %s %s (%s) /sbin/oinit /sbin/init.bak kern ostype osrelease osrevision maxvnodes maxproc maxfiles argmax hostname hostid clockrate hardclock_ticks profiling posix1version ngroups job_control saved_ids boothowto boottime domainname maxpartitions rawpartition timex rtc_offset msgbufsize ipc sysvmsg sysvsem sysvshm synchronized_io iov_max mapped_files memlock memlock_range memory_protection login_name_max defcorename logsigexit fscale ccpu cp_time msgbuf maxphys sbmax monotonic_clock urandom arandom labelsector labeloffset labelusesmbr forkfsleep posix_threads posix_semaphores posix_barriers posix_timers posix_spin_locks posix_reader_writer_locks dump_on_panic root_partition drivers cp_id coredump setid owner group no_sa_support posix semmax hw machine model ncpu byteorder physmem usermem pagesize machine_arch alignbytes cnmagic physmem64 usermem64 ncpuonline ddb vendor security i82555 10/100 media interface i82562EH HomePNA interface i82562EM 10/100 media interface i82562ET 10/100 media interface i82562G 10/100 media interface i82553 10/100 media interface ip6flowpl cannot forward from %s to %s nxt %d received on %s
cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s
forwarding redirect maxfragpackets accept_rtadv rtadv_maxroutes rtadv_numroutes keepfaith log_interval hdrnestlimit dad_count auto_flowlabel defmcasthlim kame_version NetBSD-current use_deprecated rr_prune v6only anonportmin anonportmax lowportmin lowportmax use_tempaddr temppltime tempvltime maxfrags use_defaultzone mcast_pmtu neighborgcthresh maxifprefixes maxifdefrouters maxdynroutes ip6_init ip6_nexthdr: m == NULL ip6_input: packet to an unready address %s->%s
pim6 register_mif add_m6fc: %s o %s g %s p %x dbx %p
multiple kernel entries ip6_mforward: ip6_mrouter socket queue full
assumption failed: hdr not split icmp_mtudisc_timeout: bad route to timeout icmp_redirect_timeout: bad route to timeout icmp maskrepl returndatabytes bmcastecho icmp_mtudisc_callback_register ICMP: redirect failed to register timeout for route to %x, code %d
icmp_error icmp len ttl forwsrcrt directed-broadcast allowsrcrt subnetsarelocal mtudisc mtudisctimeout hostzerobroadcast checkinterface random_id do_loopback_cksum inmltpl ip_init ipfrenpl Accounting resumed
Accounting suspended
Accounting started
Accounting terminated
actwat acctwatch Accounting: write failed %d
kcredpl org.netbsd.kauth.cred org.netbsd.kauth.generic org.netbsd.kauth.process org.netbsd.kauth.machdep org.netbsd.kauth.device org.netbsd.kauth.vnode hardscheddiv clockinterrupt Condition variable %.*s pid %d (%s): %s write of %zu@%p at %lld failed: %d
cpu%d fdclose increase kern.maxfiles or MAXFILES fdfile file2 dup2 EVFILT_READ EVFILT_WRITE EVFILT_AIO EVFILT_VNODE EVFILT_PROC EVFILT_SIGNAL EVFILT_TIMER execargs should not happen pspawn lwpwait kernel mapping failed %d
netbsd init died (signal %d, exit %d) orphaned traced process increase kern.maxproc or NPROC forkmx forkulim %s: WARNING: powerhook_establish is deprecated
dopowerhooks %s: %s (%p)
dopowerhooks: %s done
softresume softsuspend softstandby idle/%u create_idle_lwp: error %d kthrwait unnamed WARNING: kthread `%s' (%d) exits with status %d
kthread_exit curcpu holds : %18d wanted by: %#018lx
softint %s: %s caller=%p Kernel lock lwppl sigwait (zombie) swapper malloc_type_attach: bad magic devbuf DMA map pcb routetbl fragtbl UFS mount Export Host ip_moptions in_multi mrt bwmeter WARNING: module error: link_set_modules `link_set_modules' section not present `link_set_modules' section wrong size can't find builtin dependency `%s' too many required modules builtin module `%s' failed to init DEBUG: module: module `%s' not found module `%s' busy cannot unload module `%s' error=%d unloaded module `%s' builtin module "%s" init failed: %d mod_unld /stand/%s/%d.%d/modules builtin %s failed: %d
module modunload module_init: %d module_rele: gone unable to load object pushed by boot loader use -f to reinstate builtin module "%s" out of memory for `%s' cannot fetch module info for `%s' module built for `%d', system `%d' forced load, system may be unstable incompatible module class for `%s' (%d != %d) dependency name mismatch (`%s' != `%s') module `%s' already loaded circular dependency detected for `%s' required module name `%s' too long too many required modules (%d) self-dependency detected for `%s' unable to affix module `%s' module properties failed modcmd function returned error %d for `%s' %s/%s/%s.kmod Cannot %sload kernel object `%s' error=%d .plist plist load returned error %d for `%s' noautoload autoloading is disallowed for %s owner field : %#018lx wait/spin: %16d/%d
locking against myself mutex_init: impossible type Mutex mutex physiod physio %s: %s suspension %s (delegator %s) removed by %s
%s: %s is suspended by %s (delegator %s)
%s: %s-suspended by %s (delegator %s) already
%s: %s assumes %s-suspension by %s (delegator %s)
%s: newly %s-suspended by %s (delegator %s)
resume failed
Devices without power management support: class Powering devices: (failed) Shutting down devices: shutting down %s, skipped. success. %s-self %s: class suspend
%s: driver suspend
%s: bus suspend
%s: suspend enter
%s: suspend exit
Flushing disk caches: Suspending devices: %s: bus resume
%s: driver resume
%s: class resume
%s: resume enter
%s: resume exit
Resuming devices: %s: PMF event %d dropped (no memory)
%s: PMF event %d injected
Input idle handler called
pewpl pmfevent couldn't create pmfevent workqueue pmfsuspend couldn't create pmfsuspend workqueue pmf procpl proc2 proc_args %s (pid %d) changing logname from %.*s to %s
ras plimitpl pstatspl curproc rlimit cputime soft hard filesize datasize stacksize coredumpsize memorylocked descriptors sbsize vmemoryuse stopfork stopexec stopexit could not extract estimated entropy from pool rndread rndsample rnd: source "%s" failed continuous-output test.
rnd: source "%s" failed statistical test. rnd: detaching source "%s". rnd: bad seed length %d
rnd: bad seed checksum
cacheht_time balance_period min_catch timesoftints kpreempt_pri upreempt_pri sched_cpuattach: could not allocate the runqueue runqueue pull runqueue push runqueue stay runqueue localize owner/count : %#018lx flags : %#018x
Reader / writer lock rwlock sigacts ksiginfo sorry, pid %d was killed: %s
sigexit 1 sigexit 2 sendsig: bad version %d
WARNING: softint_establish: table full, increase softint_bytes
softdis soft%s/%u softint_init_isr: error %d %s block/%u softint_init_cpu: cannot allocate memory softint_picklwp wedge: parsedisk use one of: %s[a-%c] none halt reboot
md0 Cannot open "md0" (root) (default %s dump device (default %sb) file system (default %s): use one of: generic unknown device major 0x%llx
%s%llu device %s (0x%llx) not configured
root on %s can't determine root device
dumps on %s sched_unsleep lbolt kpreempt defer: critical section defer: kernel_lock immediate setrunnable: lwp %p state was %d WARNING: negative runtime; monotonic clock has gone backwards
pid %d is killed: %s
exceeded RLIMIT_CPU pid %d, command %s, is killed: %s
kernel %sassertion "%s" failed: file "%s", line %d p->sysctl_child == NULL /usr/src/sys/kern/kern_sysctl.c sysctl_lookup: rnode %p wrong version
sysctl_destroy: rnode %p wrong version
sysctl_create: rnode %p wrong version
sysctl_create: attempt to add node to aliased node %p
sysctl_query: rnode %p wrong version
sysctl sysctl_locate: pnode %p wrong version
sysctl_dispatch: rnode %p wrong version
sysctl_mmap: rnode %p wrong version
sysctl_createv: rnode NULL
sysctl_createv: sysctl_locate(%s) returned %d
sysctl_create succeeded but node not found?!
sysctl: log %p root mismatch (%p)
sysctl_createv: sysctl_create(%s) returned %d
sysctl_free: rnode %p wrong version
root %p left %d size %d content len %d: end
!!SYSCTL_NEEDFUNC!!
sysctlnode sysctldata timecounter choice hardware timestepwarnings %s%s(q=%d, f=%lld Hz) timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u
timecounter: Timecounter "%s" frequency %ju Hz quality %d
tcdetach Time stepped from %lld.%09ld to %lld.%09ld
timecounter: Timecounters tick every %d.%03u msec
dummy ptimerpl ptimerspl nanoslp pid %d attempted to set the (obsolete) kernel time zone
callout_init_cpu (1) callout_init_cpu (2) late/%u callout wait/%u todr_attach: TOD already configured
WARNING: preposterous time in file system
WARNING: preposterous TOD clock time
WARNING: no TOD clock present
WARNING: clock lost %lld days
WARNING: clock gained %lld days
WARNING: using default initial time
WARNING: using filesystem time
WARNING: CHECK AND RESET THE DATE!
Cannot set TOD clock time
tstilepl tstile turnstile_unsleep %08x-%04x-%04x-%04x-%04x%04x%04x bind failed
%s: this kernel is not support SL-C1000
couldn't register event handler
fictitious %s: unable to flush cache
%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors
disk-info lddrn lddtch %s: not drained
: <%s>
%sattach couldn't create thread
%d-bit width, bus clock %u.%03u MHz
%u KHz
100baseFX, 100baseFX-FDX, LXT970 10/100 media interface LXT971/2 10/100 media interface zaurus_restart() for C7x0 is not implemented yet.
The operating system has halted.
Please press any key to reboot.
rebooting...
REBOOT FAILED!!!
ffuart btuart stuart glass cpu not recognized! initarm: out of memory initarm: Failed to align the kernel page directory base 0x%x -0x%x irq %d drq 0x%08x mainbus_bs_free(): Help! mainbus_bs_alloc(): Help! mdidle %s: cfattach_attach failed
md%d: internal %s image area
mfs_initminiroot() called more than once mfs mfsidl mfs_root tag VT_MFS, pid %d, base %p, size %ld
mfs_ioctl not VBLK mfs_inactive: not inactive (mfs_buflist %p) mfs_close mfs_strategy: bad dev warning: mfs read during shutdown
mii_attach: phyloc and offloc specified mii_detach: phyloc and offloc specified OUI 0x%06x model 0x%04x rev %d at %s phy %d miiverbose miiaut mii_phy_setmedia: MASTER on wrong media HomePNA1 10baseT 10baseT-FDX 100baseTX 100baseTX-FDX 100baseT4 1000baseSX 1000baseSX-FDX 1000baseT 1000baseT-FDX couldn't establish power handler in6_savemkludge: no kludge space dos2unixtime(): month value out of range (%ld)
msdosnopl msdosfhpl deget(): pcbmap returned %d
deextend: file too large detrunc(): can't truncate root directory, clust %ld, offset %ld
msdosfs_reclaim(): pushing active extendfile(): attempt to extend root directory
. .. doscheckpath(): .. not a directory?
msdosfs msdosfs_sync: rofs mod RRaA rrAa msdos MSDOSFS mount MSDOSFS fat MSDOSFS temp tag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu msdosfs_strategy: spec rename: lost dir entry msdosfs_rename: updating .. in root directory? msdosfs_write(): bad file type regen_tmpaddr: failed to create a new tmp addr, errno=%d
nd6_init called more than once(ignored)
nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu
ndopts == NULL in nd6_option uninitialized ndopts in nd6_option ndopts == NULL in nd6_options uninitialized ndopts in nd6_options duplicated ND6 option found (type=%d)
nd6_options: unsupported option %d - option ignored
too many loop in nd opt
ln->ln_rt == NULL ln->ln_rt->rt_ifp == NULL rt_llinfo(%p) is not equal to ln(%p) dst=0 in nd6_timer(ln=%p) unspec nd6_lookup: failed to lookup %s (if = %s)
nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p)
from == NULL in nd6_cache_lladdr %s.%d: sockaddr_dl_setaddr(, %d, ) failed on %s
%s: failed to set scope %s (errno=%d)
%s.%d: sockaddr_dl_init(, %zu, ) failed on %s
nd6_rtrequest: bad gateway value: %s
nd6_rtrequest: malloc failed
%s: failed to join %s (errno=%d)
%s: something odd happens
%s: sdl_alen == %u, dst=%s, if=%s
scope error in router list (%s)
scope error in prefix list (%s)
NDP nd6_na_output: source can't be determined: dst=%s, error=%d
nd6_ns_output: source can't be determined: dst=%s, error=%d
nd6_dad_start: called with non-tentative address %s(%s)
nd6_dad_start: ifa->ifa_ifp == NULL nd6_dad_start: memory allocation failed for %s(%s)
%s: starting DAD for %s
nd6_dad_duplicated: DAD structure not found
%s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d
%s: DAD complete for %s - duplicate found
%s: manual intervention required
%s: possible hardware address duplication detected, disable IPv6
nd6_dad_timer: called with null parameter
nd6_dad_timer: DAD structure not found
nd6_dad_timer: called with duplicate address %s(%s)
nd6_dad_timer: called with non-tentative address %s(%s)
%s: could not run DAD, driver problem?
%s: DAD complete for %s - no duplicates found
nd6_na_input: invalid hlim (%d) from %s to %s on %s
nd6_na_input: invalid target address %s
nd6_na_input: a solicited adv is multicasted
nd6_na_input: invalid ND option, ignored
nd6_na_input: duplicate IP6 address %s
nd6_ns_input: ND packet from non-neighbor
nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d)
nd6_ns_input: invalid hlim (%d) from %s to %s on %s
nd6_ns_input: bad DAD packet (wrong ip6 dst)
nd6_ns_input: NS packet from non-neighbor
nd6_ns_input: bad NS target (multicast)
nd6_ns_input: invalid ND option, ignored
nd6_ns_input: bad DAD packet (link-layer address option)
nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d)
nd6_ns_input: duplicate IP6 address %s
nd6_ns_input: src=%s
nd6_ns_input: dst=%s
nd6_ns_input: tgt=%s
in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d)
rtpref: impossible RA flag %x
nd6_rs_input: invalid hlim (%d) from %s to %s on %s
nd6_rs_input: invalid ND option, ignored
nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d)
defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d)
defrouter_select: more than one router is installed
nd6_prefix_onlink: %s/%d is already on-link
nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s
nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d
nd6_prefix_offlink: %s/%d is already off-link
nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d)
nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d)
pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d
pfxlist_onlink_check: failed to make %s/%d onlink, errno=%d
prelist_remove: failed to make %s/%d offlink on %s, errno=%d
prelist_remove: negative count on %s
nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d)
in6_tmpifadd: failed to find a good random IFID
in6_tmpifadd: failed to find a unique random IFID
in6_tmpifadd: ifa update succeeded, but we got no ifaddr
defrtrlist_del: negative count on %s
nd6_ra_input: invalid hlim (%d) from %s to %s on %s
nd6_ra_input: src %s is not link-local
nd6_ra_input: invalid ND option, ignored
nd6_ra_input: invalid option len %d for prefix information option, ignored
nd6_ra_input: invalid prefix len %d for prefix information option, ignored
nd6_ra_input: invalid prefix %s, ignored
prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d)
prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p
prelist_update: IFID undefined (%s)
prelist_update: invalid prefixlen %d for %s, ignored
in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d)
in6_ifadd: %s is already configured
in6_ifadd: failed to make ifaddr %s on %s (errno=%d)
prelist_update: failed to create a temporary address, errno=%d
nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring
nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring
nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d)
ne2000_write_mbuf: negative len %s: remote transmit DMA failed to complete
where did the card go?
setup failed
nfsvinval nfs_doio: type %x unexpected
nfsbioread: type %x unexpected
%s: del route, error=%d
setaddress: socreate, error=%d
setaddress, error=%d
nfsbtd ifupdown: socreate, error=%d
ifupdown: GIFFLAGS, error=%d
ifupdown: SIFFLAGS, error=%d
nfsbif nfs_boot: '%s' not found
setmtu: socreate, error=%d
setmtu: GIFMTU, error=%d
setmtu: SIFMTU, error=%d
deladdress: socreate, error=%d
deladdress, error=%d
nfs_boot: timeout...
nfs_boot: sosend: %d
nfs sndunlock short receive (%lu/%lu) from nfs server %s
%s (%d) from nfs server %s
impossible packet length short receive (%lu/%d) from nfs server %s
Egad!!
receive error %d from nfs server %s
nfsreply nil is alive again nfstrylater mtime ctime %s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u)
%s: re-enabling wcc
nfsiod nfsio nfsiorm nfsauth1 nfsauth2 nfskqpw nfskqpoll nfskqdet %s: vp=%p error=%d
nfsnodepl nfsvapl nfssilly nfs_node_init nfs_reclaim: pushing active nfs send error %d for %s
nfsd send error %d
timer timer start timer stop nfscon sotype nfscn2 nfs server %s: %s
not responding nfs rcvunlock Bad kerb verifier
Not fullname kerb verifier
Kerb nickname short
Kerb nick verifier bad
nfsrvdescpl build > MLEN nfsstats iothreads nfs_vfsops: nfs_statvfs would lose buffers
nfs_args: retrying connect
nfscn3 nfsrcv nfssnd nfsaio nfsdis nfs%u nfs_mountroot: mget soname for %s nfs_mountroot: mount %s failed: %d
root on %s
nfs_mountroot: getattr for root tag VT_NFS, fileid %lld fsid 0x%llx nfs physio/async nfs_readdir: lost in space writerpc readonly vp %p nfsmblk nfs: sillyrename dir .nfsAxxxx4.4 nfs_remove: bad v_usecount DP83840 10/100 media interface DP83843 10/100 media interface DP83847 10/100 media interface DP83849 10/100 media interface DP83815 10/100 media interface pcmcia_childdetached: %s not found
%s: error %d detaching %s (function %d)
(manufacturer 0x%04x, product 0x%04x) function %d: %s
pcmcia_function_init: function is enabled %s: card appears to have bogus CIS
pcmcia_function_enable: function not initialized %s: couldn't map the CCR
pcmcia_io_map: function is enabled!
pcmcia_io_unmap: function is enabled!
pcmcia_intr_establish: function is enabled!
pcmcia_intr_establish: already done
interrupt establish failed
pcmcia_intr_disestablish: function is enabled!
pcmcia_intr_distestablish: already done
Drats! I need a skew!
Cannot allocate cfe entry
CIS checksum failed
%s: CIS version PCMCIA 1.0
PCMCIA 2.0 or 2.1
PC Card Standard %d.%d
unknown (major=%d, minor=%d)
%s: CIS info: %s: Manufacturer code 0x%x, product 0x%x
%s: function %d: unspecified multi-function serial port parallel port fixed disk (ata) video adapter network adapter auto incrementing mass storage SCSI bridge Security services Instrument unknown (%d) , ccr addr %lx mask %lx
%s: function %d, config table entry %d: memory card I/O card card type unknown ; irq mask %x ; iomask %lx, iospace %lx -%lx ; memspace @%lx ; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio %s: %d errors found while parsing CIS
%s: using CIS quirks for pcmcia_check_cis_quirks: malloc pf pcmcia_check_cis_quirks: malloc cfe PCMCIA MBH10302 UNKNOWN CASIO Compaq HP HP Jornada kmpages pmap_bootstrap: No L2 for L2 @ va %p
pmap_alloc_specials: no l2b for 0x%lx pmap_enter: failed to allocate L2 bucket pmap_enter: no pv entries pmap_init_l1: can't get PA of L1 at %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lx pmap_bootstrap: out of static L2s pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p
pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx
pmappl pvepl l2dtblpl l2ptppl Cannot allocate L1 KVM Cannot allocate L1 physical pages pmap_map_entry: no L2 table for VA 0x%08lx pmap_map_entry: can't find L2 table for VA 0x%08lx pmap_map_chunk: no L1 table provided pmap_map_chunk: no L2 table for VA 0x%08lx pmap_map_chunk: can't find L2 table for VA0x%08lx xscale_setup_minidata: can't find L2 table for VA 0x%08lx Am79C901 HomePNA 1.0 interface addr 0x%lx -0x%lx intr %d PXA270 Kernel is configured for %s, but CPU is %s
: Onchip Peripheral Bus
pxaip_attach: failed to map CLKMAN pxaip_attach: failed to map MEMCTL pxaip_measure_cpuclock: can't map RTC %s: CPU clock = %d.%03d MHz
%s: kernel is configured for PXA250, cpu type is %s
pxaip_attach_critical: failed to attach INTC! pxaip_attach_critical: failed to attach GPIO! pxa2x0_memctl_read: not bootstrapped pxa2x0_memctl_write: not bootstrapped pxa2x0_clkman_config: not bootstrapped : can't map registers
Stray DMAC interrupt for unallocated channel %d
: DMA Controller
Can't map registers!
dmac_pxaip_attach: bus_dmamem_alloc failed dmac_pxaip_attach: bus_dmamem_map failed dmac_pxaip_attach: bus_dmamap_create failed dmac_pxaip_attach: bus_dmamap_load failed dmac_dmover_attach: bus_dmamap_create failed dmac_dmover_attach: bus_dmamem_alloc failed dmac_dmover_attach: bus_dmamem_map failed pxa2x0_dmac_abort_xfer: channel %d failed to abort pxagpio_reg_write: not bootstrapped : GPIO Controller
failed to hook main GPIO interrupt
pxagpio_reg_read: not bootstrapped unhandled GPIO interrupt. GPIO#%d
pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0 pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1 pxa2x0_gpio_intr_establish: bad pin number: %d pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN pxa2x0_gpio_intr_establish: bad level: %d pxa2x0_gpio_intr_establish: illegal shared interrupt pxa2x0_gpio_set_intr_level: bad level: %d unable to map register
%s: Bus Error Detected
Interrupt not handled 0x%x
stray interrupt %d
: Interrupt Controller
intr_establish: bogus irq number %d intr_disestablish: bogus irq number %d pxamci_dmac_ointr: non-zero completion status %d
pxamci_dmac_iintr: non-zero completion status %d
mmclk clock stop timeout
unsupported bus frequency of %d KHz
data not a multiple of %u bytes
too much data
couldn't start dma xfer. (error=%d)
mmcmd : MMC/SD Controller
couldn't establish MMC interrupt
using DMA transfer
couldn't alloc rx dma xfer
couldn't alloc tx dma xfer
couldn't attach bus
pxapcic_mem_map: bogus kind pcic_attach_card: already attached %s,%d unable to create event thread for %d
pxapcicev pxapcicss : %d slot%s
can't attach
failed to map MEMCTL
: Real-time Clock
%s: couldn't map registers
%s: using wristwatch register
pxa2x0_io_bs_free(): not implemented
pxa2x0_io_bs_alloc(): not implemented
QS6612 10/100 media interface Mask for route not entered
rn_addmask: mask impossibly already in tree
Non-unique normal route, mask not entered
rn_delete: inconsistent annotation
rn_delete: couldn't find us
rn_delete: Orphaned Mask %p at %p
rn_delete: couldn't find our annotation
radix already initialized rn_init: radix functions require max_keylen be set
rn_init rn_init 2 delayed rn_inithead failed rasops_init: fontwidth assumptions botched! rasops_init: font table is empty
rasops_init: couldn't lock font
fontwidth not 8/12/16 or RASOPS_SMALL - fixme! pcblist rip_usrreq raw6 rip6_attach rip6_detach rip6_usrreq raw_usrreq random_start random_pick doublehash randinc %d%llud%d %s-short NULL rng!
rndtemp rndctx rtentpl rttmrpl rt_init_done == 0 /usr/src/sys/net/route.c rt_timer_add: rtq_count reached 0
rt_timer_timer: rtq_count reached 0
rt_timer_remove_all: rtq_count reached 0
rtfree rtfree: %p not freed (neg refs)
rt_timer_queue_remove_all: rtq_count reached 0
rtinit: wrong ifa (%p) was (%p)
rtfree 2 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto
10base2
10baseT-FDX
10baseT
route rtable %s: message too long %s: Cannot map registers SA-11x0 OS Timer
clock: hz=%d stathz=%d
saost_count rtts : PCMCIA/GPIO controller
%s: invalid CF slot %d %s: failed to map memory %x for scoop scoop_pcic_set_power: bogus power state scoop_pcic_write: bogus register scoop_pcic_read: bogus register sa6_recoverscope: assumption failure (non 0 ID): %s%%%d
couldn't create dma map. (error=%d)
mmctaskq couldn't create task thread
%s( manufacturer 0x%x%s product 0x%x %sat %s function %d " couldn't alloc memory (sdmmc function)
couldn't supply bus power
couldn't supply clock
couldn't enable card: %d
couldn't identify card
no functions
i/o init failed
mem init failed
bad CIS ptr %#x
CIS parse error at %d, tuple code %#x, length %d
CISTPL_FUNCE(common) found in function
CISTPL_FUNCE(common) too short
CISTPL_FUNCE(function) found in common
CISTPL_FUNCE(function) too short (v1.00)
CISTPL_FUNCE(function) too short
bad CISTPL_FUNCID length
bad CISTPL_MANFID length
CISTPL_VERS_1 too short
unknown tuple code %#x, length %d
%s: CIS version %u.%u
couldn't supply voltage requested by card
couldn't send I/O OCR
couldn't set I/O RCA
couldn't select I/O RCA %d
couldn't read CIS
can't change bus clock
can't read EXT_CSD
unrecognised future version (%d)
unknwon CARD_TYPE: 0x%x
can't change high speed
can't re-read EXT_CSD
HS_TIMING set failed
unknown SD CSD structure version 0x%x
unknown MMC CSD structure version 0x%x
unknown MMC version %d
couldn't set mem RCA
mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x
SD_SEND_SCR send failed.
can't change bus width (%d bit)
switch func mode 0 failed
switch func mode 1 failed: group 1 function %d(0x%2x)
write-protected
copy-cred-on-fork models Traditional NetBSD: 4.4BSD org.netbsd.secmodel.bsd44 secmodel_bsd44_modcmd::init: secmodel_register returned %d
secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d
secmodel_bsd44 suser,securelevel,extensions org.netbsd.secmodel.suser is-root org.netbsd.secmodel.securelevel is-securelevel-above org.netbsd.secmodel.extensions Traditional NetBSD: Extensions extensions_modcmd::init: secmodel_register returned %d
curtain usermount user_set_cpu_affinity extensions_modcmd::fini: secmodel_deregister returned %d
Traditional NetBSD: Securelevel securelevel_modcmd::init: secmodel_register returned %d
securelevel_modcmd::fini: secmodel_deregister returned %d
Traditional NetBSD: Superuser suser_modcmd::init: secmodel_register returned %d
suser_modcmd::fini: secmodel_deregister returned %d
dev %llu, %llu
spec_close: spurious pgrp ref spec_close: not special spec_ioctl spec_write type spec_read type spec_node_init: unable to allocate memory spec_node_destroy: corrupt hash using Seeq 84220 isolate/reset hack
Seeq 80220 10/100 media interface Seeq 80225 10/100 media interface Seeq 84220 10/100 media interface
dump to dev %u,%u not possible
dumping to dev %u,%u offset %ld
dump area unavailable
device bad
device not ready
area improper
i/o error
aborted from console
succeeded
%s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x
configure: `%s' driver %s failed: %d configure: attachment `%s' of `%s' driver %s failed: %d %s with registered handlers cfgmisc detachall config config_devalloc: %s (%zu < %zu) config_devalloc: memory allocation for device softc failed config_devalloc: memory allocation for device_t failed %s: could not expand cd_devs config_devalloc: device name too long pmfsusp device-driver device-unit attribute-name loc-name locators interface-attributes config_detach: forced detach of %s failed (%d) detached
%s: unable to allocate callback config_interrupts: unable to allocate callback config_defer: can't defer config of a root device config_defer: unable to allocate callback config_attach: allocation of device softc failed Found %s (root) %s at %s WARNING: power management not supported
root device %s not configured
done.
WARNING: %d error%s while detecting hardware; check system log.
detaching %s, unable to detach instance
fini config_cfdata fini rollback failed fini rollback init rollback unsupported
blst_radix_free: freeing free block blst_meta_free: freeing already free blocks (%llu) %llu/%llu blst_meta_free: freeing unexpected range blist_meta_alloc: allocation too large blist_meta_fill: allocation too large blst_meta_fill: filling unexpected range bufq strategies bufq_alloc: sort out of range bufq_alloc: no strategy ureadc: non-positive resid ureadc: non-positive iovcnt cprng %s: nist_ctr_drbg_reseed failed. cprng %s: bad reseed state %d cprng %s: instantiation failed. cprng %s: WARNING pseudorandom rekeying.
bdevsw_attach: block majors exhausted cdevsw_attach: character majors exhausted writ %s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld) disk_attach: can't allocate storage for disklabel no raw partition and disk reports bad geometry no raw partition and partition table is full dos partition I/O error mbr partition exceeds disk size disk label read failed disk label corrupted disk label write failed BEA01 NSR0 iso partition bad sector table I/O error bad sector table corrupted %s: can't alloc vnode for %s %s: can't open dev %s (%d)
%s%d%c evcnt /dev/null set{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed
extent_print: NULL extent extent `%s' (0x%lx - 0x%lx), flags = 0x%x
0x%lx - 0x%lx
extent_free: start 0x%lx, end 0x%lx
extent_free: region not found hashinit: bad cnt hashinit: invalid table type hashdone: invalid table type KMGTPE kMGTPE %qu%s%c%s disknames iostatnames iostats iostat_alloc: cannot allocate memory for stats buffer iostat_free: iostat_count == 0 %s: busy < 0
iostat_unbusy kcpuset kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS
kmem-8 kmem-16 kmem-24 kmem-32 kmem-40 kmem-48 kmem-56 kmem-64 kmem-80 kmem-96 kmem-112 kmem-128 kmem-160 kmem-192 kmem-224 kmem-256 kmem-320 kmem-384 kmem-448 kmem-512 kmem-768 kmem-1024 kmem-2048 kmem-4096 kmem-8192 kmem-16384 not modular %s error: %s: %s
lock address : %#018lx
current cpu : %18d
current lwp : %#018lx
lock error klog runonce percpu pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p)
pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p)
page %p, nmissing %d, time %u
POOL CACHE POOL %s: size %u, align %u, ioff %u, roflags 0x%08x
alloc %p
minitems %u, minpages %u, maxpages %u, npages %u
itemsperpage %u, nitems %u, nout %u, hardlimit %u
nget %lu, nfail %lu, nput %lu
npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu
empty page list:
full page list:
partial-page list:
no current page
curpage %p
no log
cpu layer hits %llu misses %llu
cache layer hits %llu misses %llu
cache layer entry uncontended %llu contended %llu
cache layer empty groups %u full groups %u
full cache groups:
group %p: avail %d
%p, 0x%llx
%p
empty cache groups:
%s: too large itemsperpage(%d) for PR_NOTOUCH poolbusy phpool-%d pcgnormal pcglarge pcache pcachecpu pool_get: %s: page empty pool_put: %s: page header missing Must specify a pool to print.
(null) Skipping crash dump on recursive panic
panic: %s: table is full - %s
%s: table is full
pserialize exclusive access psrlz specificdata_domain_delete: not implemented specificdata_setspecific vmem %s-%zu vmem-va vmem-meta vmem_size vmem_rehash %s: workqueue_create %d
vmemev bt_pages bt_count bt_inuse xclocv xchicv crosscall unicast xcall xcall/%u filedelay dirdelay metadelay syncer vnode
aio_jobs_pool aio_lio_pool posix_aio aio_listio_max aio_max aiowork aiodone aio_process: invalid operation code
sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s
parked mqmsgpl posix_msg mqueue mq_open_max mq_prio_max mq_max_msgsize mq_def_maxmsg mq_max_maxmsg mqsendcv mqrecvcv pset psets_max %d:1 ,%d:2 posix_sched pri_min pri_max direct_select pollsock compat newreno tcpcongctl TCP: invalid wscale %d, assuming %d
tcpipqepl tcp_pulloutofband synpl Connection attempt to TCP %s:%d from %s:%d
(unknown v6) Connection attempt to TCP [%s]:%d from [%s]:%d
tcp_output REXMT tp->t_lastm == NULL tcp_output sackholepl tcpcbpl tcp_init tcp_new_iss rfc1323 sendspace recvspace mssdflt minmss msl syn_cache_limit syn_bucket_limit init_win mss_ifmtu sack available selected win_scale timestamps compat_42 cwm cwm_burstsize ack_on_push keepidle keepintvl keepcnt slowhz log_refused rstppslimit delack_ticks init_win_local keepinit recvbuf_auto recvbuf_inc recvbuf_max sendbuf_auto sendbuf_inc sendbuf_max ecn enable maxretries globalmaxholes globalholes local_by_rtt iss_hash abc aggressive mslt remote remote_threshold vtw %s: af %d tcp_usrreq tcp6 %s: could not allocate %zu bytes for hash anchors %s: could not allocate %zu bytes for fatp_t array %s: could not allocate %zu bytes for vtw_t array ttyrub: would panic c = %d, val = %d
not a controlling terminal
no foreground process group
empty foreground process group
load: %d.%02d cmd: %s %d [ %#lx/%d %#lx %ld.%02ldu %ld.%02lds %d%% %ldk ttypause ttyraw ttyrawf ttycan ttycanf ttyout ttyoutf tkstat nin nout cancc rawcc qsize 0123456789abcdef ghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ /dev/XtyXX pqrstuvwxyzPQRST ttyldisc_init: termios_disc ttyldisc_init: ntty_disc termios ntty tablet slip ppp strip hdlc increase kern.maxptys putc: required clalloc
b_to_q: required clalloc
udp6_output: IPV6_V6ONLY option was set for a connected socket
udp6 rfc6056 udp6_usrreq udp checksum udp_usrreq ufs_reclaim: pushing active %s: bad dir ino %llu at offset %d: %s
bad dir First bad, reclen=%#x, DIRSIZ=%lu, namlen=%d, flags=%#x, entryoffsetinblock=%d, dirblksiz = %d
Second bad
checkpath: .. not a directory
ufs_readdotdot: directory %llu contains garbage instead of ..
ufs_parentcheck: inode %llu reached via .. of inode %llu is not a directory
ufs_direnter: newblk ufs_direnter: compact1 ufs_direnter: compact2 mangled entry i_size too small ufsdir ufs_whiteout: unknown op rename: EXDEV rename: same file ufs_strategy: spec tag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d
mode 0%o, owner %d, group %d, size %qd accf accf_ stream seqpacket dgram %s: source too long, %d < %d bytes sockaddr msize mclbytes nmbclusters mblowat mcllowat mbpl mclpl m_copydata: off %d, len %d m_copydata: m == NULL, off %d m_copydata: m == NULL, len %d m_copym: off %d, len %d m_copym: m == 0, off %d m_copym: m == 0, len %d [!COPYALL] m == NULL in m_pulldown() packet tags unix somaxkva sokva sopendfr bad initial sb_max value: %lu sopendfree soinit1 %d soaccept: !NOFDREF soclose: NOFDREF soopts netio sbappendaddr sbappendaddrchain sbappendcontrol semi-panic: sbcompress
sbdrop sbcreatecontrol: message too large %d
msgcontrol msghdr sockname mbfree mbdata mbheader mbsoname mbsopts mbftable mbcontrol mboobdata unp_thread unpgc uipc_init %d unp_attach unp_connect2 unp_disconnect uipc 1 uipc 2 uipc_usrreq uipc 4 piusrreq : %s (OUI 0x%06x, model 0x%04x), rev. %d
: OUI 0x%06x, model 0x%04x, rev. %d
undefined instruction in kernel amappl cownow cownowpage anonpl livelock uao_set_swslot: uobj = %p
uao_set_swslot: NOSWAP object uao_getpage uao_get uao_create: hashinit swhash failed uao_create: swslots allocation failed uaoeltpl uao_flush: strange, got an out of range flush (fixed)
uao_put %s: impossible uao_det ubc_fault ubc_init: failed to allocate ubc_map ubc_init: failed to allocate inactive queue heads ubc_init: failed to map ubc_object ubc_alloc %s: error=%d
udv_fault udv_detach udv_attach flt_noram5 flt_pmfail1 flt_pmfail2 anonget1 anonget2 flt_noram1 fltamapcopy fltagain1 flt_noram2 fltagain2 flt_noram4 uvm_fault_unwire_locked: address not in map uarea uvm uvm_init: page size not set uvm_km_bootstrap: could not reserve space for kernel uvm_km_bootstrap: could not reserve kernel kmem %s: unable to allocate space in parent map uvm_km_suballoc: unable to create submap uvm_km_suballoc: submap allocation failed km_pgrm km_getwait2 plpg loanagain loanzero loanuopg user_va0_disable vmmpepl vmsppl vm_map %s: kernel object %p %p
vmmeter loadavg uvmexp uvmexp2 maxslp uspace idlezero uobjwirepg uvm_setpagesize: page size %u (%#x) not a power of two uvm_page_physget: called _after_ bootstrap uvm_page_physget: out of memory! uvm_pageboot_alloc: out of virtual space uvm_pageboot_alloc: pmap_growkernel() failed uvm_pageboot_alloc: out of memory uvm_page_physload: page size not set! uvm_page_physload: bad free list %d uvm_page_physload: start >= end uvm_page_physload: unable to load physical memory segment
%d segments allocated, ignoring 0x%llx -> 0x%llx
increase VM_PHYSSEG_MAX
uvm_page_physload: tried to add RAM after vm_mem_init WARNING: unable to allocate %ld page color buckets
uvm_pagealloc_strat: bad strat %d uvm_page_bootstrap: no memory pre-allocated emergva pager_map pagedaemon: deadlock detected!
anonmin filemin execmin anonmax filemax execmax inactivepct pdpolicy reactexec reactfile reactanon pglalloc ractx %s: vnode type 0x%x %s: swap to sparse file %s: can't get vnode for swap device %s: can't lock swap device %s: can't open swap device swapmap %s: vmem_create failed swp vnx swp vnd swapctl: miniroot copy failed swapctl: copystr swap_on: miniroot larger than swap? swap_on: unable to preserve miniroot Preserved %d pages of miniroot leaving %d pages of swap
swapdrum_add swapiod %s: workqueue_create failed %s: swapdev not in list uvn_fp1 uvn_fp2 buf mem pool index %d forcing bufcache %d -> 5 forcing bufcache %d -> 95 needbuf bufinit: cannot allocate submap biopl buf%um buf%uk buf%ub bufcache bufmem bufmem_lowater bufmem_hiwater bufinit2: can't establish soft interrupt bflush biolock biowait allocbuf: buffer larger than MAXBSIZE requested biodone2 already cachegc ncache nchinit %d namecache entries scanned entries collected over scan target under scan target forced reclaims cwdi dirhpl dirhepl dirhash memused maxmem dirhash_remove couldn't find entry in hash table
operation %s not listed in %s.
vfs_op_descs vfs_opv_init: bad operation vfs_opv_init: operation vector without default routine. fstypes magiclinks pnbufpl lf_findoverlap: default lockf namei_simple_convert_flags: bogus sflags
chrooted pid %d uid %d (%s) detected outside of its chroot
/../ arm zaurus kernel_ident ruid rgid Invalid nameiop
relookup: null name relookup: lookup on dot-dot unmount: dangling vnode %sunmounted %s on %s type %s
forcefully unmount of %s failed with error %d
WARNING: some file systems would not unmount
unmounting file systems... syncing disks... vfs_mountroot: root device unknown vfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu) vfs_mountroot: rootdev not set for DV_DISK vfs_mountroot: can't get vnode for rootdev vfs_mountroot: can't open root device
%s: inappropriate for root file system
root file system type: %s
WARNING: No file system modules have been loaded.
Supported file systems: no file system for %s (dev 0x%llx) cannot find root vnode, error=%d mount: lost mount %s: failed to start extattr: error = %d
Unmounting fresh file system failed vnode @ %p, flags (%s)
tag %s(%d), type %s(%d), usecount %d, writecount %d, holdcount %d
freelisthd %p, mount %p, data %p lock %p
vflushbuf: not dirty, bp %p vflushbuf: dirty VT_UFS VT_NFS VT_MFS VT_MSDOSFS VT_LFS VT_LOFS VT_FDESC VT_PORTAL VT_NULL VT_UMAP VT_KERNFS VT_PROCFS VT_AFS VT_ISOFS VT_UNION VT_ADOSFS VT_EXT2FS VT_CODA VT_FILECORE VT_NTFS VT_VFS VT_OVERLAY VT_SMBFS VT_PTYFS VT_TMPFS VT_UDF VT_SYSVBFS VT_PUFFS VT_HFS VT_EFS VT_ZFS VT_RUMP VT_NILFS VT_V7FS VT_CHFS VNON VREG VDIR VCHR VLNK VSOCK VFIFO VBAD %s: failed to start extattr, error = %d %s: failed to stop extattr, error = %d symlink-target fdesc kernfs afs fstrans fstrans_start: cannot upgrade lock %s: illegal state %d vnodepl vdrain vrele %s: holdcnt vp %p %s: neg numoutput, vp %p %s: cannot reclaim dead but not clean %s: bad ref count %s: unable to lock %p vndsbusy wapblentrypl wapbl flush_disk_cache verbose_commit wapbl_cache_sync: %s: dev 0x%jx %ju.%09lu
wapbl_write_commit: error writing duplicate log header: %d
%s: %lld.%09ld this transaction = %zu bytes
wapbl_flush: current transaction too big to flush
wapbl %p
logvp = %p, devvp = %p, logpbn = %lld
circ = %zu, header = %zu, head = %lld tail = %lld
fs_dev_bshift = %d, log_dev_bshift = %d
bufcount = %zu, bufbytes = %zu bcount = %zu reclaimable = %zu reserved = %zu errcnt = %d
dealloccnt = %d, dealloclim = %d
inohashcnt = %d, inohashmask = 0x%08x
entries:
bufcount = %zu, reclaimable = %zu, error = %d
bufs = %p,
%p, dealloced blks = %lld:%d, registered inodes = %d/0%06o, wapbl_register_deallocation: out of resources wapblrec wapblinopl Unrecognized wapbl magic: 0x%08x
Unrecognized wapbl type: 0x%08x
wapbl_replay: corrupted records
system. user. security. trusted. xattr-name xattr-list xattr-val vmapbuf vunmapbuf vop_bwrite vop_lookup vop_create vop_mknod vop_open vop_close vop_access vop_getattr vop_setattr vop_read vop_write vop_ioctl vop_fcntl vop_poll vop_kqfilter vop_revoke vop_mmap vop_fsync vop_seek vop_remove vop_link vop_rename vop_mkdir vop_rmdir vop_symlink vop_readdir vop_readlink vop_abortop vop_inactive vop_reclaim vop_lock vop_unlock vop_bmap vop_strategy vop_print vop_islocked vop_pathconf vop_advlock vop_whiteout vop_getpages vop_putpages vop_closeextattr vop_getextattr vop_listextattr vop_openextattr vop_deleteextattr vop_setextattr : ATI Imageon100 LCD controller
failed to map config (errorno=%d)
failed to map register (errorno=%d)
failed to vram register (errorno=%d)
unable to create new screen (errno=%d) Sharp Zaurus frame buffer Sharp Zaurus LCD std standby immediate command didn't complete
wd_standby: status=%s
wdstart1: bad return code from ata_bio() ST506 %s: ( error not notified wddump: try again wddump: polled command has been queued wddump: unknown atacmd code %d wddump: device timed out wddump: drive fault wddump: DMA error wddump: wddump: unknown error type %d device fault device timeout channel reset , retrying soft error (corrected)
wd_get_params: bad return code from ata_get_params IDENTIFY failed
SPLIT_MOD15_WRITEFORCE_LBA48 quirks %s
drive supports %d-sector PIO transfers, LBA48 addressing
LBA addressing
chs addressing
wd_setcache command not complete
wd_setcache: status=%s
flush cache command didn't complete
wd_flushcache: status=%s
wdioctlstrategy: No matching ioctl request found in queue
physio split wd ioctl request... cannot proceed
obsolete (address mark not found) no media/write protected aborted command media change requested id not found media changed uncorrectable data error interface CRC error address mark not found track 0 not found bad block detected ST3120023AS ST380023AS ST360015AS __wdccommand_kill_xfer: unknown reason %d
__wdccommand_kill_xfer atarst %s:%d: %s
%s:%d:%d: %s
lost interrupt type: %s tc_bcount: %d tc_skip: %d
missing untimeout %s channel %d: reset failed for drive 0 drive 1 atapoll atadrdy atacnf wdccmd atardl can't subregion I/O space
memory mapped mode
i/o mapped mode
wdcattach Digital Mobile Media CD-ROM PCMCIA Portable CD-ROM Drive NinjaATA- EXP PnPIDE F1 SHUTTLE TECHNOLOGY LTD. PCCARD-IDE/ATAPI Adapter FREECOM PCCARD-IDE IO DATA CBIDE2 LOOKMEET IDE CARD Lucent/Prism/Symbol 802.11 controls command timed out, cmd=0x%x, arg=0x%x
command failed, cmd=0x%x, arg=0x%x
timeout in wi_seek to %x/%x
%s: failed in wi_seek to %x/%x
detect auto increment bug, try again
%s: cleaning outstanding rssadapt descriptor for %s
wi_cmd: busy bit won't clear.
xmit failed
%s: %d tx cmds pending!!!
%s: tx rate %d -> %d (%d)
record read mismatch, rid=%x, got=%x
record buffer is too small, rid=%x, size=%d, len=%d
%s: invalid channel %d
failed to allocate %d bytes on NIC
timeout in alloc
tx buffer allocation failed
%s: interface not running
%s write fid %x failed
Lucent Symbol could not get mac address, attach failed
802.11 address %s
%s: using Unknown PRISM2 chip Unknown Lucent chip
%s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u)
using default channel list
no available channel
no supported rate list
%s read fid %x failed
%s: null node %s bad idx %02x
%s null node, rssdesc %02x
%s txpending[%i] wraparound tx failed , retry limit exceeded , max transmit lifetime exceeded , port disconnected , invalid format (data len %u src %s) , status=0x%x wi_scan_result: unknown firmware type %u
Lucent Technologies, WaveLAN/IEEE Sony WaveLAN/IEEE Lucent Embedded WaveLAN/IEEE RF:PRISM2 MAC:HFA3841 RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.B RF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.A RF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.B RF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVAL RF:PRISM1 MAC:HFA3841 CARD:HWB1153 RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flash RF:PRISM2.5 MAC:ISL3873B(PCMCIA) RF:PRISM2.5 MAC:ISL3874A(Mini-PCI) RF:PRISM2.5 MAC:ISL3874A(PCI-bridge) RF:PRISM3 MAC:ISL3871(PCMCIA) RF:PRISM3 MAC:ISL3871(Mini-PCI) added (%s , %s emulation %s: emergency X server detach
wsdisplay_switch1: not switching
wsdisplay_switch1: invalid screen %d wsdisplay_switch1: screen %d disappeared
wsdisplay_switch3: not switching
wsdisplay_switch3: invalid screen %d wsdisplay_switch3: screen %d disappeared
wsdisplay_switch3: giving up
wsdisplay_switch2: not switching
wsdisplay_switch2: invalid screen %d wsdisplay_switch2: screen %d disappeared
wsdisplay_switch2: giving up
wsdisplaytty() on status device wsdisplaytty() on ctl device wsdisplay_common_attach: no memory kbdmux %d : console (%s, %s emulation) , using %s wssw screen %d deleted
wsdisplay at %s wsdisplay: event queue overflow
wswait wsdisplay_noemul EDID dumb wsemul_vt100_output_c0c1: ESC in kernel output ignored
vt100 OI OM Oj Ok Ol Om On Oo [28~ [29~ [1~ [2~ [3~ [4~ [5~ [6~ [7~ [8~ OA [A OB [B OD [D OC [C [11~ [12~ [13~ [14~ [15~ [17~ [18~ [19~ [20~ [21~ [23~ [24~ [25~ [26~ [31~ [32~ [33~ [34~ OP OQ OR OS Op Oq Or Os Ot Ou Ov Ow Ox Oy [>24;20;0c P2$u P0!u%5\ [?62;6c [0n [%d;%dR [?13n [?21n [?27;1n wsemul_vt100_handle_dcs: bad type %d %s: unknown version %d wsevent_read ccw wsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d
wsfont_unlock: font not locked Boldface connecting to %s
wskdet wskbd_detach: %s didn't detach
mux %d cannot load keymap : console keyboard attach error=%d
couldn't register as input device
wskbd at %s %s: event queue overflow
wskbd_get_mapentry: %d(%d): bad entry wskbd_load_keymap: %d: recursion too deep wskbd_load_keymap: %d(%d): bad entry wsmux_getmux: no memory for mux %d
wsmux: attach out of memory
%s: disconnecting from %s
: pseudo power management module
: I2C controller
unable to attach PXA I2C controller
unable to establish nSD_DETECT interrupt
unable to attach MMC controller
%s: zmci_set_power(): unsupported OCR (%#x)
%s: not configured.
can't map bus space
%s: not configured
zssp: zssp_ic_send: invalid IC %d
%s: dir offset too large on fs %s (mounted from %s)
%s: dir offset too large for emulated program
/usr/libexec/ld.elf_so %s-%s Kernel RNG "%s" monobit test FAILURE: %d ones
Kernel RNG "%s" poker test failure: parameter X = %lld.%lld
Kernel RNG "%s" long run test FAILURE: Run of %d %ds found
Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d < %d)
Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d > %d)
%s: invalid base %d arc4random: WARNING, hit 2^29 bytes, forcibly rekeying.
arc4_randrekey: rekey callback bad length arc4random p->p_refcnt != 0 /usr/src/sys/lib/libkern/../../../common/lib/libppath/ppath.c unused v6 v7 sysv v71k v8 other hpfs ados hfs filecore ext2fs ntfs raidframe jfs2 vinum udf sysvbfs efs nilfs minixfs3 0%llo prop string propstng < > & plist version="1.0" ?xml !DOCTYPE plist %s%s
deletetunnel bad hexadecimal digits hexadecimal digits too long strings too long "%.*s" address: %s: getifaddrs %s: ioctl %s %s
SIOCGIFADDRPREF preference %d valid only with vlan(4) interfaces vlantag SIOCSETVLAN %s: getvlan [ vlan n vlanif i ]
vlan: %d parent: %s
VLAN tag -vlanif fatal signal: %s cannot get kernel security level: %m can't open %s: %m can't get %s for controlling terminal: %m cannot change kernel security level from %d to %d: %m /dev/constty /dev/console /usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin can't exec `%s' for single user: %m can't fork single-user shell: %m, trying again wait for single-user shell failed: %m; restarting shell stopped, restarting single user shell terminated (%x), restarting ./MAKEDEV /etc/MAKEDEV initial setsid() failed setlogin() failed /dev -MM MAKEDEV exit status %d
Unable to run MAKEDEV invalid major number invalid minor number too many fields for format kern.drivers usage: %s [-rR] [-F format] [-m mode] [-u user] [-g group]
[ name [b | c] [major | driver] minor
| name [b | c] major unit subunit
| name [b | c] number
| name p ]
%s -l [driver] ...
invalid format: %s %s: invalid group name %s: invalid user name lrRF:g:m:u: character major %d block major %d format is meaningless for fifos node type must be 'b', 'c' or 'p'. unknown driver: %s invalid number: %s %s: uid/gid not changed invalid unit number invalid subunit number 386bsd 4bsd bsdos freebsd hpux linux osf1 sco solaris sunos svr3 svr4 ultrix @ Z g o
D v M @ T ` h [ { Ē ڒ " @ . ? M d @ * y /q "q * y %s,%s asprintf getargs union puffs| %s on %s type %.*s: %s
already mounted force mount_puffs rump rump_%s mount_%s exec: Cannot create pipe Cannot open fd to mount program %s not found for %s statvfs %s %s on %s type %.*s %sunknown flag%s %#x %smounted by %sfsid: 0x%x/0x%x reads: sync %llu async %llu , writes: sync %llu async %llu , [%s: %s] usage: mount %s
mount %s
mount %s
[-Aadfruvw] [-t type] [-dfruvw] special | node [-dfruvw] [-o options] [-t type] special node Aadfo:rwt:uv from_mount unknown file system %s. unknown special file or file system %s. %s: unknown special file or file system. :@ WARNING: autoselecting nfs based on : or @ in the device name is deprecated!
WARNING: This behaviour will be removed in a future release
asynchronous extattr hidden nocoredump relatime soft dependencies symperm exported read-only NFS exported exported to the world anon uid mapping kerberos uid mapping non-reserved ports WebNFS exports with quotas root file system being updated reload filesystem data force unmount or readonly change retrieve mount arguments ados filecore ntfs udf sysvbfs efs nilfs strdup ܕ ( 7 x j { o K s @
' b norrip bgens bextatt bnojoliet bnocasetrans brrcaseins usage: %s [-o options] special node
getmntopts egijo:r userquota groupquota rdonly extatt gens maplcase casetrans nrr rrip joliet rrcaseins Warning: realpath %s "%s" is a non-resolved or relative path. using "%s" instead. ܕ ( 7 x j { o
@
K 9& V @
s @ g o: mount table full incorrect super block specified device does not match mounted device %s on %s: %s softdep ܕ ( 7 x j { o
@
K s @ b shortname blongname bnowin95 bgemdosfs bmntversioned b ronly b waitonfat b fatmirror usage: %s [-9Gls] [-g gid] [-M mask] [-m mask] [-o options]
[-t gmtoff] [-u uid] special mountpath
Gsl9u:g:m:M:o:t: stat %s uid=%d, gid=%d, mask=0%o, dirmask=0%o, flags=%s
unknown %s id: %s invalid file mode: %s ܕ ( 7 x j { o K s @ R % / 5 @ > E M S X ) @ y ^ @ b soft bwsize brsize btimeo bretrans bmaxgrps bintr bnoconn bnqnfs b nfsv3 b
kerb b dumbtimr b leaseterm b
readahead bdeadthresh bresvport brdirplus breaddirsize bxlatecookie bnoac usage: %s %s
%s
%s
%s
%s
[-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-I readdirsize] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node conflicting version options illegal -a value -- %s illegal -D value -- %s illegal -I value -- %s wsize rdirsize leaseterm readahead deadthresh timeo retrans illegal -R value -- %s illegal -r value -- %s illegal -t value -- %s illegal -w value -- %s illegal -x value -- %s 23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UX getnameinfo: %s sotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d
addr=%s, port=%s, addrlen=%d, conn dumbtimer nfsv3 rdirplus mntudp resport nqnfs soft nfsv2 maxgrps Unsupported socket family %d recvrpc: reject, astat=%d, errno=%d
getport: %s callrpc: error = %d
sendrecv: short write! (%zd < %zu) no : or @ spec can't get net id for host "%s": %s 3 a Ѫ H _ u ū V i ٬ Q ͭ %s: can't read disk label; disk type must be specified %s partition type is not `%s' W T W T b S S %s `%s' is not a valid number. `%s' is not a valid suffix for %s. %s `%s' is too large to convert. %s `%s' (%lld) is less than the minimum (%lld). %s `%s' (%lld) is greater than the maximum (%lld). usage: %s [ fsoptions ] special-device mount-point
usage: %s [ fsoptions ] special-device%s
[disk-type] where fsoptions are:
NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u: B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v: -mfs WARNING: -G may create file systems which cause kernel panics
sector size `%s' is not a power of 2. unknown gname %s expected files per directory free space % number of inodes unknown optimization preference: use `space' or `time'. invalid quota type %s bad mode `%s' unknown user %s Apple UFS volume name cannot contain ':' or '/' Apple UFS volume name cannot be zero length in-filesystem quota is incompatible with -O0 mount `%s' failed base=%p, size=%ld
can't open file %s can't fstat opened %s %s: open for read %s is a block device. use raw device %s: open for write %s: getmntinfo %s is mounted on %s no default sector size %s partition is unavailable Unable to determine file system size size %llu exceeds maximum file system size on `%s' of %llu sectors can't ftruncate %s to %lld can't fstatvfs `%s' can't malloc buffer of %d Creating file system image in `%s', size %lld bytes, in %d byte chunks.
writing image Warning: chosen fsize of %d is less than Apple UFS minimum of %d Warning: chosen bsize of %d is greater than Apple UFS maximum of %d %s %s %d%% Warning: changing optimization to space because minfree is less than mfs:%d %s: mount: %s abnormal termination -B byteorder byte order (`be' or `le') -F create file system image in regular file -G make sanity calculations non-fatal (testing only!) -I do not check that the file system type is '4.2BSD' -N do not create file system, just print out parameters -O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2 -S secsize sector size -T disktype disk type -V verbose output verbosity: 0 ==> none, 4 ==> max -Z pre-zero the image file -a maxcontig maximum contiguous blocks -b bsize block size -d maxbsize maximum extent size -e maxbpg maximum blocks per file in a cylinder group -f fsize frag size -g avgfilesize average file size -g groupname group name of mount point -h avgfpdir average files per directory -i density number of bytes per inode -m minfree minimum free space %% -n inodes number of inodes (overrides -i density) -o optim optimization preference (`space' or `time') -q (user|group) enable specified quota -p perm permissions (in octal) -s fssize file system size (sectors) -u username user name of mount point -v volname Apple UFS volume name getrlimit setrlimit rdfs: read error for sector %lld: %s
wtfs: write error for sector %lld: %s
cg 0: bad magic number first cylinder group ran out of space isblock bad fs_fragshift %d
internal error: can't find block in cyl 0 clrblock bad fs_fragshift %d
fsinit: inode value out of range (%llu).
setblock bad fs_fragshift %d
illegal expected average file size %d
illegal expected number of files per directory %d
block size must be a power of 2, not %d
fragment size must be a power of 2, not %d
fragment size %d is too small, minimum is %d
block size %d is too small, minimum is %d
block size %d is too large, maximum is %d
block size (%d) cannot be smaller than fragment size (%d)
Maxcontig raised to %d
fragment size %d is too small, minimum with block size %d is %d
ilog2: %d is not a power of 2
Too many fragments (0x%llx) for a FFSv1 filesystem
Filesystem size %lld < minimum size of %d
CGSIZE miscalculated %d > %d
%s: %.1fMB (%lld sectors) block size %d, fragment size %d
using %d cylinder groups of %.2fMB, %d blks, %d inodes.
Cannot allocate I/O buffer preposterous size %lld
super-block backups (for fsck_ffs -b #) at:
Too many cylinder groups to fit summary information into first cylinder group Panic: cylinder group too big %s%*llu, ... Error making filesystem usage:
%s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval]
[-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host
Cannot resolve "%s" (%s) %s only supported with IP %s (%s) 0.0.0.0
Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s
TCP: from port %u, to port %u
UDP: from port %u, to port %u
ID=%u icmp_seq=%u for icmp_seq=%u Can't turn off special IP header failed to clear cached route Can't set special IP header sendto wrote %s %d chars, ret=%d
----%s PING Statistics----
%d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets! %.1f%% packet loss round-trip min/avg/max/stddev = %.3f/%.3f/%.3f/%.3f ms
%.1f packets/sec sent, %.1f packets/sec received
%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.3f ms Cannot create socket Cannot shutdown for read setuid Bad/invalid number of packets Bad/invalid interval %s Bad/invalid preload value %s Only one of -P and -p allowed Bad/invalid packet size %s packet size is too large bad tos value: %s ttl out of range -g Bad/invalid maxwait time %s ac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw: Must be superuser to use -f Must be superuser to use < 1 sec ping interval Must be superuser to use -l Sorry, no audible output for flood pings "-p %s": patterns must be specified with 1-32 hex digits
%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x PATTERN: 0x Can't turn on socket debugging SO_DONTROUTE Can't disable multicast loopback Can't set multicast time-to-live Can't set multicast source interface Can't set source interface/address PING %s (%s): %d data bytes
Cannot set the receive buffer size recvfrom packet too short (%d bytes) from %s
remote host does not support record route
remote host does not support source route
wrong total length %d instead of %d [*** sequence gap of %u packets from %u ... %u ***]
wrong data byte #%d should have been %#x but was %#x Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set. Next MTU=%d Source Route Failed Unreachable unknown net Unreachable unknown host Unreachable host isolated Net prohibited access Host prohibited access Bad TOS for net Bad TOS for host Communication prohibited Host precedence violation Precedence cutoff Bad Destination Unreachable Code: %d Source Quench Redirect Network Redirect Host Redirect Type of Service and Network Redirect Type of Service and Host Redirect--Bad Code: %d New router addr: %s Echo Request: ID=%d seq=%d Router Discovery Advert Router Discovery Solicit Time To Live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Address Mask Request Address Mask Reply Bad ICMP type: %d
LSRR: (same route)
RR:
NOP
unknown option 0x%x usage: %s [-dln%sqvxz] [-- ]
(can't restart init): poweroff dlnpqvxz halted by %s powered off by %s rebooted by %s: %s rebooted by %s SIGTSTP init SIGTERM all processes SIGKILL all processes WARNING: some process(es) wouldn't die reboot() usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno]
%s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno]
%s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno]
%s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file]
[-s fileno] [file ...]
%s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file]
[-M mtreefile] [-s fileno] [file ...]
option requires an argument -- %c illegal blocksize -- %s block size must be greater than 0 unknown digest algorithm: %s %c and %c options are mutually exclusive can't open %s illegal dump number -- %s dump number must be greater than 0 b:cD:df:himM:NRrs:tuvxy none of i, R, r, t or x options specified Begin incremental restore
./restoresymtable Calculate node updates.
Begin level 0 restore
Calculate extraction list.
Verify the directory structure
command lines cannot be continued
missing %c
Warning: undefined file type %d
%s > %s: %s: no filename match.
glob() aborted.
unknown error!
add %s: not a directory
%s: not on extraction list
%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s Available commands are:
ls [arg] - list directory
cd arg - change directory
pwd - print current directory
add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted
extract - extract requested files
setmodes - set modes of requested directories
quit or xit - immediately exit program
what - list dump header information
verbose - toggle verbose flag (useful with ``ls'')
help or `?' - print this list
Debug - turn on debugging
If no `arg' is supplied, the current directory is used
ls: out of memory
directory reopen failed
%s%s: name exceeds %d char
/
verbose mode off
verbose mode on
setmodes what Debug debugging mode off
debugging mode on
%s: unknown command; type ? for help
restore interrupted, continue |NIL |ONTAPE |INOFND |NAMEFND |MODECHG dir %10llu %s
%s: not on the tape
./%llu Mark entries to be removed.
Delete whiteouts
%s: REMOVE
corrupted symbol table
name/inode conflict, mktempname %s
[%s] %s: %s
deleted hard link %s to directory %s
[%s] %s: %s|LINK
cannot KEEP and change modes NODE and LEAF links to same inode [%s] %s: Extraneous name
%s: (inode %llu) not found on tape
[%s] %s: inconsistent state
[%s] %s: impossible state
Find unreferenced names.
%s: remove unreferenced name
unreferenced with flags Remove old nodes (directories).
cannot remove, non-empty Continue extraction of new leaves
Extract new leaves.
%llu: bad first
%s: not found on tape
expected next file %llu, got %llu
unknown file on tape
unexpected file on tape Extract requested files
Add whiteouts
Add links
Check the symbol table.
incomplete operations Warning: missing name %s
type should be LEAF missing inumber %llu
bad seek pointer to rst_seekdir %d
Mangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %lu) Extract directories from tape
%s/rstdir%d %s/rstdir%d-XXXXXX cannot mkstemp temporary file %s cannot open temporary file %s %s/rstmode%d %s/rstmode%d-XXXXXX opendirfile: %s
Root directory is not on tape
no memory directory table
error reading directory
corrupted directory: bad reclen %d
corrupted directory: bad inum %d
%s/ Warning: `.' missing from directory %s
Warning: `..' missing from directory %s
%s%s: name exceeds %lu char
Set directory mode, owner, and times.
modefile not defined
directory mode, owner, and times not set
fopen: %s
cannot open mode file %s
cannot find directory inode %llu
error setting directory modes
Cannot find directory inode %llu named %s
write error extracting inode %llu, name %s
read: %s
cannot find entry in parent list addino: out of range %llu
duplicate inum deleteino: out of range %llu
deleteino: %llu not found
%s is not a directory
%s: pathname too long
bad name
no space for string table
no memory to extend symbol table
bad name to addentry %s
link to non-existent name
duplicate entry
cannot move ROOT not marked REMOVED freeing referenced directory freeing non-empty directory lookupino failed link not found Checkpointing the restore
cannot create save file %s for symbol table
fwrite: %s
output error to file %s writing symbol table
Initialize symbol table.
no memory for entry table
cannot open symbol table file %s
stat: %s
cannot stat symbol table file %s
cannot allocate space for symbol table
cannot read symbol table file %s
Incremental tape too low
Incremental tape too high
initsymtable called from command %c
Checksum error %o, inode %llu file %s
unallocated block in symbolic link %s
seek error extracting inode %llu, name %s
lseek: %s
Warning: %s %s
End-of-input encountered while extracting write error extracting inode %llu, name %s
write: %s
symbolic link name: %s->%s%s; too long %d
Cannot have multiple dumps on pipe input
ioctl MTFSF: %s
Cannot allocate space for tape buffer
cannot open %s: %s
the epoch
[unknown] #Dump date: %s #Dumped from: %s #Level %d dump of %s on %s:%s
#Label: %s
/set uname=root gname=wheel
error writing to mtree file Changing volumes on pipe input?
You have not read any tapes yet.
Unless you know which volume your file(s) are on you should start
with the last volume and work towards the first.
(Use 1 for the first volume/tape, etc.)
You have read volumes Specify next volume #: Volume numbers are positive numerics
Mount tape volume %d
Enter ``none'' if there are no more tapes
otherwise enter tape name (default: %s) Cannot open %s
header read failed at %d blocks
tape is not dump tape
Volume mismatch: expecting %d, tape header claims it is %d
Wrong dump date
got: %s wanted: %s read %ld recs, tape starts with %ld
Skipping %d duplicate record%s.
active file into volume 1
mid-media short read error.
partial block read: %d should be %d
Tape read error while trying to set up tape
trying to resynchronize
restoring %s
skipping over inode %llu
continuation failed: %s
End-of-tape encountered
Note: Doing Byte swapping
gethead: unknown inode type %d
Volume header (%s inode format) begins with record %lld Dumped inodes map header Used inodes map header File header, ino %llu File continuation header, ino %llu End of tape header ; predicted %ld blocks, got %ld blocks unexpected tape header
unknown tape header type %d
resync restore, skipped %ld blocks
ran off end of tape
not at beginning of a file
no memory for %s
%s: inconsistent map size
%s: map size changed
Verify tape and initialize maps
tape read error: %s
Tape block size (%ld) %s (%ld)
is not a multiple of dump block size Tape block size is %d
Tape is not a dump tape
Converting to new file system format.
cannot stat .: %s
bad block size %d
Tape is not volume 1 of the dump
no header after volume mark!
Cannot find file removal list
Missing address (header) block for %s at %d blocks
%s: unknown file mode 0%o
skipped socket %s
unextracted directory %s
extract file %s
%s: zero length symbolic link (ignored)
extract special file %s
%s: cannot create special file: %s
extract fifo %s
%s: cannot create fifo: %s
fifo %s: cannot create file: %s
%s (%s) = %s
MD5 SHA1 RMD160 warning: cannot rename %s to %s: %s
rename %s to %s
warning: cannot create whiteout %s: %s
Create whiteout %s
|REMOVED |TMPNAME |EXTRACT |NEW |KEEP |EXISTED %s is not on the tape
dump core bad entry: %s
parent name %s
sibling name: %s
next entry name: %s
next link name: %s
next hashchain name: %s
entry type: %s
inode number: %ld
flags: %s
delwhiteout: not a leaf warning: cannot delete whiteout %s: %s
Delete whiteout %s
removeleaf: not a leaf warning: %s: %s
Remove leaf %s
removenode: not a node removenode: non-empty directory Remove node %s
newnode: not a node Make node %s
not on ino list %s%ld%llu RSTTMP mktempname: called with TMPNAME symbolic hard warning: cannot create symbolic link %s->%s: %s
warning: cannot create hard link %s->%s: %s
linkit: unknown type %d
Create %s link %s->%s
%s type=%s uid=%d gid=%d mode=%#4.4o flags= nodump %suchg %suappnd %sopaque %sarch %sschg %ssappnd Lost connection to remote host. Protocol to remote tape server botched.
(rmtgets got "%s").
Protocol to remote tape server botched (code "%s").
who are you? invalid user name: %s /etc/rmt O%s
%d
C
R%d
W%d
L%d
%d
I%d
%d
0123456789abcdef DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG 3 K t & L v * R r UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC
ALLMULTI OACTIVE SIMPLEX
LINK0LINK1LINK2MULTICAST UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING
XRESOLVE LLINFO STATIC
BLACKHOLECLONEDPROTO2PROTO1 pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtu U G H R D M @ d m C X L S B c 1 @ 2 p %s: inet %s; %s: link %s; %s: (%d) %s; not in table entry in use routing table overflow prefixlen is not supported with af %d %s: bad value botched keyword: %s Usage: %s [ -fnqSsv ] cmd [[ - ] args ]
Internal Error default 0.0.0.0/%s %s&%s af %d: %s (%d) %s
sockaddrs: routing message version %d not understood
#%d: len %d, if# %d, %s, flags: metric %d, flags: if# %d, what: re-associate disassociate scan complete join michael replay #%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llx arrival pid %d, seq %d, errno %d, flags:
locks: inits: route-sysctl-estimate actual retrieval of routing table Examining routing table from sysctl (address family %s)
writing to routing socket: %s write to routing socket, got %d for rlen %-20.20s dfnqSstv Cannot allocate memory %s, %s old usage of trailing 0 assuming route to if old usage of trailing digit assuming route via gateway -host and -net conflict soup->so_dst soup->so_gate soup->so_mask soup->so_genmask soup->so_ifp soup->so_ifa : gateway %s RTM_ADD: Add Route RTM_DELETE: Delete Route RTM_CHANGE: Change Metrics or flags RTM_GET: Report Metrics RTM_LOSING: Kernel Suspects Partitioning RTM_REDIRECT: Told to use different route RTM_MISS: Lookup failed on this address RTM_LOCK: fix specified metrics RTM_OLDADD: caused by SIOCADDRT RTM_OLDDEL: caused by SIOCDELRT RTM_RESOLVE: Route created by cloning RTM_NEWADDR: address being added to iface RTM_DELADDR: address being removed from iface RTM_OOIFINFO: iface status change (pre-1.5) RTM_OIFINFO: iface status change (pre-64bit time) RTM_IFANNOUNCE: iface arrival/departure RTM_IEEE80211: IEEE80211 wireless event RTM_IFINFO: iface status change RTM_CHGADDR: address being changed on iface %02x unspec sysctl of routing table Routing table%s
Protocol Family %d:
%-*.*s %-*.*s %-6.6s
Gateway Flags %-6.6s Internet AppleTalk atalk expire hopcount inet6 iso llinfo lockrest nostatic osi proto1 proto2 recvpipe rtt rttvar sendpipe show ssthresh x25 xns xresolve flushall nocloned nocloning noblackhole noreject mpls 23 L df / a . R N o < f # P / T w
, 8 e + D [ x
7 ] w 4 T " J }
D k 5 U q ! # ! F " ^ $ % & & & & ' ( 2 ( j ) * * * + , , 1 , L - u / 0 0 0 0 ) 1 F 1 ^ 2 t 2 3 6 7 9 :
; ; '
; R
; w
;
;
;
;
;
; ;
# ; @ ; \ ;
~ ; = > ? ? - ? C ? ` @ y A B C }
D E
F !
G 9
H K
I u
J
K
L
N
P
P P P $ Q E R S S c S ~ S T U W X
Y ' Z : Z o Z Z [ [ [ [
\ & \ 8 \ N ` h a u a a b c d S g
w % usage: %s device command [arg [...]]
Commands pertaining to scsi devices:
Commands pertaining to scsi busses:
Use `any' or `all' to wildcard target or lun
invalid target: %s invalid lun: %s SCBUSIODETACH SCBUSIOSCAN SCBUSIORESET SCIOCRESET SCIOCDEBUG not %s: no caches enabled
%s: read cache %senabled
%s: write-back cache %senabled
%s: caching parameters are %ssavable
%13u
unable to allocate defect descriptor invalid block number: %s %s: scsibus%d target %d lun %d <%s, %s, %s>
failed to clean Unit Attention: %s current disk sector size: %d
invalid block size: %s imm formatting. SCIOCCOMMAND %s: SCSI command timed out %s: device is busy %s: device had unknown status %x .%d0%%. .100%%..done.
%8u %4u entire track defective %10u
unable to allocate defect list grown physical
notice:requested defect list format not supported by device
and defects : none reported
%s: scsibus%d target %d lun %d %s block address
-------------
bytes from
cylinder head index
-------- ---- ----------
cylinder head sector
-------- ---- ----------
: none bus unknown %s command: %s [primary] [grown] [block|byte|physical] [blocksize [immediate]] identify reassign blkno [blkno [...]] reset prevent allow tur getcache setcache none|r|w|rw [save] flushcache setspeed [speed] target lun detach Diagnostic Failure on Component 0x%02x ASC 0x%02x ASCQ 0x%02x Parameters Error in %s, Offset %d, bit %d Error in %s, Offset %d Actual Retry Count: %d Progress Indicator: %d SENSE KEY: %s
%c Filemark Detected %c EOM Detected %c Incorrect Length Indicator Set
INFO FIELD: %d
COMMAND INFO: %d (0x%x)
ASC/ASCQ: %s
FRU CODE: 0x%x
SKSV: %s
Additional Sense Information (byte %d out...):
%2d: %s: Check Condition on CDB: No Additional Sense Recovered Error Media Error Hardware Error Illegal Request Unit Attention Write Protected Blank Check Vendor Unique Copy Aborted Aborted Command Equal Error Volume Overflow Miscompare Error Reserved No Additional Sense Information End-Of-Partition/Medium Detected Setmark Detected Beginning-Of-Partition/Medium Detected End-Of-Data Detected I/O Process Terminated Audio Play Operation In Progress Audio Play Operation Paused Audio Play Operation Successfully Completed Audio Play Operation Stopped Due to Error No Current Audio Status To Return No Index/Sector Signal No Seek Complete Peripheral Device Write Fault No Write Current Excessive Write Errors Logical Unit Not Ready, Cause Not Reportable Logical Unit Is in Process Of Becoming Ready Logical Unit Not Ready, Initialization Command Required Logical Unit Not Ready, Manual Intervention Required Logical Unit Not Ready, Format In Progress Logical Unit Does Not Respond To Selection No Reference Position Found Multiple Peripheral Devices Selected Logical Unit Communication Failure Logical Unit Communication Timeout Logical Unit Communication Parity Error Track Following Error Tracking Servo Failure Focus Servo Failure Spindle Servo Failure Error Log Overflow Write Error Write Error Recovered with Auto Reallocation Write Error - Auto Reallocate Failed ID CRC Or ECC Error Unrecovered Read Error Read Retried Exhausted Error Too Long To Correct Multiple Read Errors Unrecovered Read Error - Auto Reallocate Failed L-EC Uncorrectable Error CIRC Unrecovered Error Data Resynchronization Error Incomplete Block Found No Gap Found Miscorrected Error Uncorrected Read Error - Recommend Reassignment Uncorrected Read Error - Recommend Rewrite the Data Address Mark Not Found for ID Field Address Mark Not Found for Data Field Recorded Entity Not Found Record Not Found Filemark or Setmark Not Found End-Of-Data Not Found Block Sequence Error Random Positioning Error Mechanical Positioning Error Positioning Error Detected By Read of Medium Data Synchronization Mark Error Recovered Data With No Error Correction Applied Recovered Data With Retries Recovered Data With Positive Head Offset Recovered Data With Negative Head Offset Recovered Data With Retries and/or CIRC Applied Recovered Data Using Previous Sector ID Recovered Data Without ECC - Data Auto-Reallocated Recovered Data Without ECC - Recommend Reassignment Recovered Data Without ECC - Recommend Rewrite Recovered Data With Error Correction Applied Recovered Data With Error Correction & Retries Applied Recovered Data - Data Auto-Reallocated Recovered Data With CIRC Recovered Data With LEC Recovered Data - Recommend Reassignment Recovered Data - Recommend Rewrite Defect List Error Defect List Not Available Defect List Error in Primary List Defect List Error in Grown List Parameter List Length Error Synchronous Data Transfer Error Primary Defect List Not Found Grown Defect List Not Found Miscompare During Verify Operation Recovered ID with ECC Invalid Command Operation Code Logical Block Address Out of Range Invalid Element Address Illegal Function (Should 20 00, 24 00, or 26 00) Illegal Field in CDB Logical Unit Not Supported Invalid Field In Parameter List Parameter Not Supported Parameter Value Invalid Threshold Parameters Not Supported Not Ready To Ready Transition (Medium May Have Changed) Import Or Export Element Accessed Power On, Reset, or Bus Device Reset Occurred Mode Parameters Changed Log Parameters Changed Copy Cannot Execute Since Host Cannot Disconnect Command Sequence Error Too Many Windows Specified Invalid Combination of Windows Specified Overwrite Error On Update In Place Commands Cleared By Another Initiator Incompatible Medium Installed Cannot Read Medium - Unknown Format Cannot Read Medium - Incompatible Format Cleaning Cartridge Installed Medium Format Corrupted Format Command Failed No Defect Spare Location Available Defect List Update Failure Tape Length Error Ribbon, Ink, or Toner Failure Rounded Parameter Saving Parameters Not Supported Medium Not Present Tape Position Error At Beginning-of-Medium Tape Position Error At End-of-Medium Tape or Electronic Vertical Forms Unit Not Ready Slew Failure Paper Jam Failed To Sense Top-Of-Form Failed To Sense Bottom-Of-Form Reposition Error Read Past End Of Medium Read Past Begining Of Medium Position Past End Of Medium Position Past Beginning Of Medium Medium Destination Element Full Medium Source Element Empty Invalid Bits In IDENTIFY Message Logical Unit Has Not Self-Configured Yet Target Operating Conditions Have Changed Microcode Has Changed Changed Operating Definition INQUIRY Data Has Changed RAM FAILURE (Should Use 40 NN) Data Path FAILURE (Should Use 40 NN) Power-On or Self-Test FAILURE (Should Use 40 NN) Internal Target Failure Select Or Reselect Failure Unsuccessful Soft Reset SCSI Parity Error INITIATOR DETECTED ERROR Message Received Invalid Message Error Command Phase Error Data Phase Error Logical Unit Failed Self-Configuration Overlapped Commands Attempted Write Append Error Write Append Position Error Position Error Related To Timing Erase Failure Cartridge Fault Media Load or Eject Failed Unload Tape Failure Medium Removal Prevented SCSI To Host System Interface Failure System Resource Failure Unable To Recover Table-Of-Contents Generation Does Not Exist Updated Block Read Operator Request or State Change Input (Unspecified) Operator Medium Removal Requested Operator Selected Write Protect Operator Selected Write Permit Log Exception Threshold Condition Met Log Counter At Maximum Log List Codes Exhausted RPL Status Change Spindles Synchronized Spindles Not Synchronized Lamp Failure Video Acquisition Error Unable To Acquire Video Out Of Focus Scan Head Positioning Error End Of User Area Encountered On This Track Illegal Mode For This Track %s: SCSI command timed out
%s: device is busy
%s: device had unknown status %x
PF PF 0* X X X , , x < < Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -]
illegal time format FINAL %s -n /usr/bin/wall %s: Can't find `%s' (%m) *** %sSystem shutdown message from %s@%s ***
System going down at %5.5s
System going down in %ld minute%s
System going down in 30 seconds
System going down IMMEDIATELY
/etc/nologin
NO LOGINS: System going down at /sbin/reboot /sbin/halt %s: Not super-user b:Ddfhknprvxz Incompatible options -f and -n Incompatible options -%s and -r now TZ time is already past Shutdown at %.24s.
Shutdown NOW! shutdown: fork shutdown: [pid %d]
%s by %s: %s
System shutdown time has arrived
but you'll have to do it yourself
/fastboot fastboot file for fsck
About to run shutdown hooks...
. /etc/rc.shutdown
Done running shutdown hooks.
-v -x -z -d Can't exec `%s' (%m) Can't exec `%s' hw.disknames usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto]
%s -a [-p priority] path
%s -q
%s -c -p priority path
%s -D dumpdev|none
%s -d path
%s -l | -s [-k|-m|-g|-h]
%s -U [-n] [-t blk|noblk|auto]
%s -z
could not set dump device to %s %s: setting dump device to %s
WARNING: %s is readable by the world WARNING: %s is writable by the world %s: adding %s as swap device at priority 0
%s: removing %s as swap device
%s%s%c sw priority= nfsmntpt= empty mountpoint /sbin/mount_nfs %s: mount failed /sbin/umount noblk %s: adding %s as swap device at priority %d
%s: failed to add %s as swap device
%s: failed to remove %s as swap device
%s: umount failed swapon usage: %s -a [-t blk|noblk]
%s ...
ADUacdfghklmnop:qst:z could not get dump device no dump device set dump device is major %llu minor %llu
%s: there are swap or dump devices defined in /etc/fstab
%s: no swap or dump devices in /etc/fstab
KBytes MBytes GBytes no swap devices configured SWAP_STATS SWAP_STATS different to SWAP_NSWAP (%d != %d) %-*s %*s %8s %8s %8s %s
Device Used Avail Capacity Priority %-*s %*ld %8ld %8ld %5.0f%% %d
%-*s %*s %8s %8s %5.0f%% %d
%s/%s swap space
%ld/%ld %s swap space
total: %s allocated = %s used, %s available.
total: %ld %s allocated = %ld %s used, %ld %s available
%-*s %*s %8s %8s %5.0f%%
Total %-*s %*ld %8ld %8ld %5.0f%%
Usage: %s [-fR] special | node
%s: not currently mounted fR fetch_url 8 8 9 sendrequest recvrequest ĝ m> q> u> y> }> > *************************************************************************************************************************************************************************************************************************************** TYPE %s %s TYPE %s %s: unknown mode.
Continue with %s %s [anpqy?]? %s; %s aborted
Prompting off for duration of %s.
Interactive mode: off.
confirmation options:
a answer `yes' for the duration of %s
n answer `no' for this file
p turn off `prompt' mode
q stop the current %s
y answer `yes' for this file
? this help list
nmap: unbalanced brackets.
Using %s mode to transfer files.
changetype: unknown type %d binary ascii tenex We only support %s mode, sorry.
We only support %s format, sorry.
We only support %s structure, sorry.
STOR APPE STOU local-file remote-file local-files Glob pattern `%s' not found Restart is not supported by the remote server.
RETR r+ remote-files mreget Skipping non-relative filename `%s'
Can't open source file %s
Version: %s %s
NetBSD-ftp 20100605 %s %s.
Bell mode Editing support not compiled in; ignoring command.
Packet tracing mark: bad bytecount value `%s'.
Hash mark printing %s (%d bytes/hash mark) Verbose mode Use of PORT/LPRT cmds Progress bar Interactive mode (none) Disabling gate-ftp mode - no gate-ftp server defined.
Gate ftp: %s, server %s, port %s.
Globbing Preserve modification times %s: bad debugging value.
Debugging %s (ftp_debug=%d).
remote-directory CWD command not recognized, trying XCWD.
XCWD %s Can't chdir `%s' Local directory now: %s
Unable to determine local directory
DELE %s from-name to-name RNFR %s RNTO %s MLSD NLST MLSD is not supported by the remote server.
nlist pager output to local-file: mls SHELL Can't execute `%s' Can't fork a subshell; try again later username USER %s Password: PASS %s Account: ACCT %s Login failed.
Unable to determine remote directory
Remote directory: %s
Local directory: %s
directory-name MKD command not recognized, trying XMKD.
XMKD %s RMD command not recognized, trying XRMD.
XRMD %s arguments to SITE command SITE command line to send SITE CHMOD %s %s SITE UMASK SITE UMASK %s SITE IDLE SITE IDLE %s HELP HELP %s QUIT Account: ?Ambiguous command.
?Invalid command.
?Invalid proxy command.
Not connected.
Case mapping Carriage Return stripping Ntrans off.
Nmap off.
mapout Passive mode: %s; fallback to active mode: %s.
EPSV/EPRT on IPv4 EPSV/EPRT on IPv6 Store unique Receive unique Get transfer rate throttle: %s; maximum: %d; increment %d.
Put transfer rate throttle: %s; maximum: %d; increment %d.
CDUP CDUP command not recognized, trying XCUP.
XCUP restart: Invalid offset `%s'
No restart point defined.
Restarting at %lld for next get, put or append
SYST Limit of 16 macros have already been defined.
macro name Enter macro line by line, terminating it with a null line.
macdef: end of file encountered.
Macro not defined - 4K buffer exceeded.
%s %lld
%s %s STAT STAT %s Local file "%s" is newer than remote file "%s".
sndbuf rcvbuf xferbuf %s: size must be positive.
Socket buffer sizes: send %d, receive %d.
No such option `%s'.
Setting `%s' to `%s'.
%-*s %s
Unsetting `%s'.
FEAT is not supported by the remote server.
FEAT MLST is not supported by the remote server.
MLST MLST %s OPTS is not supported by the remote server.
OPTS %s OPTS %s %s ebcdic account bye cdup disconnect edit epsv epsv4 epsv6 features fget idle lcd lpage lpwd macdef mdelete mget mlst modtime mput msend newer nmap ntrans passive pdir pmlsd quote recv remopts rename restart rhelp rmdir rstatus runique sendport site struct sunique throttle usage anonpass ftp_proxy http_proxy no_proxy rprompt '%s' macro not found.
parse_url: invoked with NULL argument! http:// ftp:// file:// Invalid %s `%s' Unknown port `%s' in %s `%s'
HTTP fetch aborted.
Invalid URL `%s' ;type=a ;type=i ;type=d Directory listing via a URL is not supported Invalid suffix `%s' in URL `%s' *?[]{} Can't connect or login to host `%s:%s' fetch_ftp: unknown transfer type %d
ftp: The `CWD ' command (without a directory), which is required by
RFC 3986 to support the empty directory in the URL pathname (`//'),
conflicts with the server's conformance to RFC 959.
Try the same URL without the `//' in the URL pathname.
localhost No support for non local file URL `%s' Invalid URL (no file after host) `%s' No file after directory (you must specify an output file) `%s' copied Can't open `%s' Can't seek to restart `%s' Copying %s (restarting at %lld) retrieved , Can't restart via proxy URL `%s' proxy URL Malformed proxy URL `%s' Scoped address notation `%s' disallowed via web proxy Can't lookup `%s:%s': %s Trying %s:%s ...
Can't create socket for connection to `%s:%s' Can't connect to `%s:%s' Requesting %s
%svia %s:%s ( GET %s HTTP/1.0
Pragma: no-cache
GET %s HTTP/1.1
Host: [%s] Host: %s :%u Accept: */*
Connection: close
Range: bytes=%lld-
restarting at %lld Cache-Control: no-cache
FTPUSERAGENT User-Agent: %s
User-Agent: %s/%s
Writing HTTP request Receiving HTTP reply: %s Content-Length: Content-Range: Received unexpected Content-Range header Last-Modified: Location: Transfer-Encoding: Bogus transfer encoding `binary' (fetching anyway) chunked Unsupported transfer encoding `%s' Proxy-Authenticate: WWW-Authenticate: Basic Not expecting partial content header No redirection Location provided by server Too many redirections requested Redirected via %s
Redirected to %s
Error retrieving file `%s' Unknown error retrieving file already done
Size of `%s' differs from save file `%s' /usr/src/usr.bin/ftp/fetch.c rcvbuf_size > 0 Unexpected EOF reading chunk-size Invalid chunk-size Chunk-size `%.*s' Unexpected data following chunk-size Writing `%s' Unexpected EOF reading chunk CRLF Unexpected data following chunk Reading file Can't change modification time to %s Improper response from `%s:%s'
remote abort aborted; closing connection.
receive
send abortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort.
421 Service not available, %s.
No control connection for command Can't determine my address of connection to `%s:%s' Can't fdopen socket Connected to %s.
PASV EPSV Can't create socket for data connection wrong server: return code must be 229
Passive mode refused.
Passive mode AF mismatch. Shouldn't happen!
wrong server: return code must be 227
Passive mode address scan failure. Shouldn't happen!
LPSV wrong server: return code must be 228
%u,%u,%u,%u,%u,%u,%u,%u,%u %c%c%c%d%c parse error!
Can't set SO_REUSEADDR on data connection Can't bind for data connection Can't determine my address of data connection Can't listen to data connection EPRT |%u|%s|%s| PORT %d,%d,%d,%d,%d,%d Poll timeout waiting before accept Can't poll waiting before accept Can't accept data connection Can't access `%s' runique: can't find unique file name.
Lost control connection for abort Can't send abort message %cABOR
proxy server does not support third party transfers.
No primary connection.
PORT %s REST %lld local: %s remote: %s
Error aborting proxy command local: %s %s: not a plain file.
/usr/src/usr.bin/ftp/ftp.c sndbuf_size > 0 Reading `%s' Writing to network Can't chmod `%s' Reading from network WARNING! %d bare linefeeds received in ASCII mode.
File may not have transferred correctly.
Can't change modification time on %s to %s Usage error
Error resetting connection remote server timed out. Connection closed user interrupt. Connection closed remote server has closed connection usage: %s [-46AadefginpRtVv] [-N netrc] [-o outfile] [-P port] [-q quittime]
[-r retry] [-s srcaddr] [-T dir,max[,inc]]
[[user@]host [port]] [host:path[/]] [file:///file]
[ftp://[user[:pass]@]host[:port]/path[/]]
[http://[user[:pass]@]host[:port]/path] [...]
%s -u URL file [...]
Proxy c %sommands may be abbreviated. Commands are:
?Ambiguous %s command `%s'
?Invalid %s command `%s'
rprompt: no such option `rprompt' ftp> prompt: no such option `prompt' Sorry, input line is too long.
anonymous http FTPSERVERPORT ftpgate NETRC $NETRC `%s': %s FTPMODE Unknown $FTPMODE `%s'; using defaults pftp FTPSERVER Neither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp TERM dumb INET6 support is not available; ignoring -6 Bad quit value: %s Bad retry value: %s Bad throttle value `%s' 46AadefginN:o:pP:q:r:Rs:tT:u:vV Can't lookup `%s': %s /.netrc %s/.netrc: %s FTPANONPASS PAGER FTPPROMPT FTPRPROMPT Retrying in %d seconds...
getoptionvalue: invoked with NULL name getoptionvalue: invoked with unknown option `%s' %lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) xsignal_restart: called with signal %d
%s: transfer aborted because stalled for %lu sec.
%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETA KiB MiB GiB TiB PiB EiB Token in .netrc too long Can't read `%s' Error: .netrc file is readable by others Remove password or make file unreadable by others Remove account or make file unreadable by others Missing macdef name argument.
Macro definition missing null line terminator.
Unknown .netrc keyword `%s' 4K macro buffer exceeded.
machine MDTM REST STREAM TVFS Remote system type is %s.
215 UNIX Type: L8 215 TOPS20 Remember to set tenex mode when transferring binary files from this machine.
ftpXXXXXXXXXX Unable to create temporary file `%s' Can't find list of remote files SIZE is not supported by remote server.
SIZE %s MDTM is not supported by remote server.
MDTM %s 191 Y2K warning! Incorrect time-val `%s' received from server.
Converted to `%s'
%Y%m%d%H%M%S Can't parse time `%s'.
%a, %d %b %Y %H:%M:%S %z
Can't convert RFC 2822 time: buffer too small %a, %d %b %Y %H:%M:%S GMT %a, %d-%b-%y %H:%M:%S GMT %a, %b %d %H:%M:%S %Y Unable to determine real path of `%s' crankrate invoked with unknown signal: %d Unable to determine rcvbuf size Unable to determine sndbuf size Unable to set sndbuf size %d Unable to set rcvbuf size %d
EOF received Error encountered Input line is too long Sorry, arguments too long.
(%s) %s; %s aborted.
operation Can't bind to `%s' Can't %s socket flags for connect to `%s:%s' Can't set socket non-blocking for connect to `%s:%s' Unable to allocate %ld bytes of memory Unable to allocate memory for stringlist Unable to add `%s' to stringlist ftp_strdup: called with NULL argument Unable to allocate memory for string copy Name (%s:%s): Name (%s): Login failed $init Already connected to %s, use close first.
main: gateserver not defined Connecting via pass-through server %s
non-print stream NetBSD gzip 20101018 malloc failed failed to read stdin %s: unexpected end of file %s: trailing garbage ignored input not gziped (MAGIC0) input not gziped (MAGIC1) unknown compression method 1.2.3 failed to inflateInit Z_NEED_DICT error data stream error internal stream error memory allocation error unknown error from inflate(): %d error writing to output truncated input invalid compressed data--crc error invalid compressed data--length error decompression error deflateInit2 failed deflate failed deflateEnd failed %c%c%c%c%c%c%c%c snprintf compressed uncompressed ratio uncompressed_name read of uncompressed size %12llu %12llu %2.2d. %5s%% can't read stdin (stdin): unexpected end of file (stdin) can't stat: %s %s is a directory %s: unknown suffix -- ignored can't read %s couldn't close input couldn't close output %s: uncompress failed couldn't open (leaving original): %s couldn't stat (leaving original): %s stat gave different size: %lld != %lld (leaving original) could not create output: %s %s is not a regular file usage: %s [-123456789cdhlV] [ [ ...]]
123456789cdhlV .gz D " D # D % D ' \Y Y tY
SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS
Commands marked with * may be preceded by a number, _N.
Notes in parentheses indicate the behavior if _N is given.
h H Display this help.
q :q Q :Q ZZ Exit.
---------------------------------------------------------------------------
MMOOVVIINNGG
e ^E j ^N CR * Forward one line (or _N lines).
y ^Y k ^K ^P * Backward one line (or _N lines).
f ^F ^V SPACE * Forward one window (or _N lines).
b ^B ESC-v * Backward one window (or _N lines).
z * Forward one window (and set window to _N).
w * Backward one window (and set window to _N).
ESC-SPACE * Forward one window, but don't stop at end-of-file.
d ^D * Forward one half-window (and set half-window to _N).
u ^U * Backward one half-window (and set half-window to _N).
ESC-) RightArrow * Left one half screen width (or _N positions).
ESC-( LeftArrow * Right one half screen width (or _N positions).
F Forward forever; like "tail -f".
r ^R ^L Repaint screen.
R Repaint screen, discarding buffered input.
---------------------------------------------------
Default "window" is the screen height.
Default "half-window" is half of the screen height.
---------------------------------------------------------------------------
SSEEAARRCCHHIINNGG
/_p_a_t_t_e_r_n * Search forward for (_N-th) matching line.
?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line.
n * Repeat previous search (for _N-th occurrence).
N * Repeat previous search in reverse direction.
ESC-n * Repeat previous search, spanning files.
ESC-N * Repeat previous search, reverse dir. & spanning files.
ESC-u Undo (toggle) search highlighting.
&_p_a_t_t_e_r_n * Display only matching lines
---------------------------------------------------
Search patterns may be modified by one or more of:
^N or ! Search for NON-matching lines.
^E or * Search multiple files (pass thru END OF FILE).
^F or @ Start search at FIRST file (for /) or last file (for ?).
^K Highlight matches, but don't move (KEEP position).
^R Don't use REGULAR EXPRESSIONS.
---------------------------------------------------------------------------
JJUUMMPPIINNGG
g < ESC-< * Go to first line in file (or line _N).
G > ESC-> * Go to last line in file (or line _N).
p % * Go to beginning of file (or _N percent into file).
t * Go to the (_N-th) next tag.
T * Go to the (_N-th) previous tag.
{ ( [ * Find close bracket } ) ].
} ) ] * Find open bracket { ( [.
ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>.
ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>
---------------------------------------------------
Each "find close bracket" command goes forward to the close bracket
matching the (_N-th) open bracket in the top line.
Each "find open bracket" command goes backward to the open bracket
matching the (_N-th) close bracket in the bottom line.
m_<_l_e_t_t_e_r_> Mark the current position with .
'_<_l_e_t_t_e_r_> Go to a previously marked position.
'' Go to the previous position.
^X^X Same as '.
---------------------------------------------------
A mark is any upper-case or lower-case letter.
Certain marks are predefined:
^ means beginning of the file
$ means end of the file
---------------------------------------------------------------------------
CCHHAANNGGIINNGG FFIILLEESS
:e [_f_i_l_e] Examine a new file.
^X^V Same as :e.
:n * Examine the (_N-th) next file from the command line.
:p * Examine the (_N-th) previous file from the command line.
:x * Examine the first (or _N-th) file from the command line.
:d Delete the current file from the command line list.
= ^G :f Print current file name.
---------------------------------------------------------------------------
MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS
-_<_f_l_a_g_> Toggle a command line option [see OPTIONS below].
--_<_n_a_m_e_> Toggle a command line option, by name.
__<_f_l_a_g_> Display the setting of a command line option.
___<_n_a_m_e_> Display the setting of an option, by name.
+_c_m_d Execute the less cmd each time a new file is examined.
!_c_o_m_m_a_n_d Execute the shell command with $SHELL.
|XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command.
v Edit the current file with $VISUAL or $EDITOR.
V Print version number of "less".
---------------------------------------------------------------------------
OOPPTTIIOONNSS
Most options may be changed either on the command line,
or from within less by using the - or -- command.
Options may be given in one of two forms: either a single
character preceded by a -, or a name preceeded by --.
-? ........ --help
Display help (from command line).
-a ........ --search-skip-screen
Forward search skips current screen.
-A ........ --SEARCH-SKIP-SCREEN
Forward search always skips target line.
-b [_N] .... --buffers=[_N]
Number of buffers.
-B ........ --auto-buffers
Don't automatically allocate buffers for pipes.
-c ........ --clear-screen
Repaint by clearing rather than scrolling.
-d ........ --dumb
Dumb terminal.
-D [_x_n_._n] . --color=_x_n_._n
Set screen colors. (MS-DOS only)
-e -E .... --quit-at-eof --QUIT-AT-EOF
Quit at end of file.
-f ........ --force
Force open non-regular files.
-F ........ --quit-if-one-screen
Quit if entire file fits on first screen.
-g ........ --hilite-search
Highlight only last match for searches.
-G ........ --HILITE-SEARCH
Don't highlight any matches for searches.
-h [_N] .... --max-back-scroll=[_N]
Backward scroll limit.
-i ........ --ignore-case
Ignore case in searches that do not contain uppercase.
-I ........ --IGNORE-CASE
Ignore case in all searches.
-j [_N] .... --jump-target=[_N]
Screen position of target lines.
-J ........ --status-column
Display a status column at left edge of screen.
-k [_f_i_l_e] . --lesskey-file=[_f_i_l_e]
Use a lesskey file.
-K --quit-on-intr
Exit less in response to ctrl-C.
-L ........ --no-lessopen
Ignore the LESSOPEN environment variable.
-m -M .... --long-prompt --LONG-PROMPT
Set prompt style.
-n -N .... --line-numbers --LINE-NUMBERS
Don't use line numbers.
-o [_f_i_l_e] . --log-file=[_f_i_l_e]
Copy to log file (standard input only).
-O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e]
Copy to log file (unconditionally overwrite).
-p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n]
Start at pattern (from command line).
-P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t]
Define new prompt.
-q -Q .... --quiet --QUIET --silent --SILENT
Quiet the terminal bell.
-r -R .... --raw-control-chars --RAW-CONTROL-CHARS
Output "raw" control characters.
-s ........ --squeeze-blank-lines
Squeeze multiple blank lines.
-S ........ --chop-long-lines
Chop long lines.
-t [_t_a_g] .. --tag=[_t_a_g]
Find a tag.
-T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e]
Use an alternate tags file.
-u -U .... --underline-special --UNDERLINE-SPECIAL
Change handling of backspaces.
-V ........ --version
Display the version number of "less".
-w ........ --hilite-unread
Highlight first new line after forward-screen.
-W ........ --HILITE-UNREAD
Highlight first new line after any forward movement.
-x [_N[,...]] --tabs=[_N[,...]]
Set tab stops.
-X ........ --no-init
Don't use termcap init/deinit strings.
--no-keypad
Don't use termcap keypad init/deinit strings.
-y [_N] .... --max-forw-scroll=[_N]
Forward scroll limit.
-z [_N] .... --window=[_N]
Set size of window.
-" [_c[_c]] . --quotes=[_c[_c]]
Set shell quote characters.
-~ ........ --tilde
Don't display tildes after end of file.
-# [_N] .... --shift=[_N]
Horizontal scroll amount (0 = one half screen width)
........ --no-keypad
Don't send keypad init/deinit sequence.
........ --follow-name
The F command changes files if the input file is renamed.
---------------------------------------------------------------------------
LLIINNEE EEDDIITTIINNGG
These keys can be used to edit text being entered
on the "command line" at the bottom of the screen.
RightArrow ESC-l Move cursor right one character.
LeftArrow ESC-h Move cursor left one character.
CNTL-RightArrow ESC-RightArrow ESC-w Move cursor right one word.
CNTL-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word.
HOME ESC-0 Move cursor to start of line.
END ESC-$ Move cursor to end of line.
BACKSPACE Delete char to left of cursor.
DELETE ESC-x Delete char under cursor.
CNTL-BACKSPACE ESC-BACKSPACE Delete word to left of cursor.
CNTL-DELETE ESC-DELETE ESC-X Delete word under cursor.
CNTL-U ESC (MS-DOS only) Delete entire line.
UpArrow ESC-k Retrieve previous command line.
DownArrow ESC-j Retrieve next command line.
TAB Complete filename & cycle.
SHIFT-TAB ESC-TAB Complete filename & reverse cycle.
CNTL-L Complete filename, list all.
H- --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t) ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t ?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t ?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t HELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done Waiting for data LESS LESSSECURE VISUAL LESSEDIT %E ?lm+%lm. %f @/\less/\help/\file/\@ WARNING: terminal is not fully functional No filenames allowed with -t option LESS_TERMCAP_DEBUG <%s> LESS_TERMCAP_ LINES li kr kl ku kd kP kN kh @7 kD hc xn da ti cm vb bc |^ Nothing in top line Nothing in bottom line No bracket in top line No bracket in bottom line No matching bracket ch_ungetchar overrun Warning: log file is incomplete seek error read error Finishing logfile seek error to 0 invalid chardef chardef longer than 256 invalid charset name LESSCHARSET LESSCHARDEF LC_ALL LC_CTYPE LANG UTF-8 utf-8 UTF8 utf8 latin1 LESSBINFMT *s<%02X> LESSUTFBINFMT ESC ^%c 8bcccbcc18b95.b 8bcccbcc18b95.b126.bb iso8859 8bcccbcc18b95.33b. latin3 8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b. arabic 8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b greek 8bcccbcc18b95.33b4.2b4.b3.b35.b44.b greek2005 8bcccbcc18b95.33b14.b35.b44.b hebrew 8bcccbcc18b95.33b.b29.32b28.2b2.b koi8-r 8bcccbcc18b95.b. KOI8-T 8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b. georgianps 8bcccbcc18b95.3b11.4b12.2b. tcvn b..b...bcccbccbbb7.8b95.b48.5b. TIS-620 8bcccbcc18b95.b.4b.11b7.8b. 8bcccbcc18b95.bb125.bb 8bcccbcc12bc5b95.b. windows-1251 8bcccbcc12bc5b95.b24.b. windows-1252 8bcccbcc12bc5b95.b.b11.b.2b12.b. windows-1255 8bcccbcc12bc5b95.b.b8.b.5b9.b.4b. 5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b. IBM-1047 4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.b ANSI_X3.4-1968 US-ASCII ISO-8859-1 latin9 ISO-8859-15 latin2 ISO-8859-2 ISO-8859-3 latin4 ISO-8859-4 cyrillic ISO-8859-5 ISO-8859-6 ISO-8859-7 IBM9005 ISO-8859-8 latin5 ISO-8859-9 latin6 ISO-8859-10 latin7 ISO-8859-13 latin8 ISO-8859-14 latin10 ISO-8859-16 IBM437 EBCDIC-US IBM1047 KOI8-R KOI8-U GEORGIAN-PS TCVN5712-1 NEXTSTEP windows CP1251 CP1252 CP1255 LESSHISTFILE .lesshst LESSHISTSIZE "%s
LESSSEPARATOR .less-history-file: .search .shell Non-match First-file EOF-ignore Keep-pos Regex-off &/ (P) Pattern not found !done |done less %s (N-th) [Press 'h' for instructions.] There is no --%s option There is no %s option Command not available Examine: Cannot edit standard input WARNING: This file was viewed via LESSOPEN No next file No %snext file No previous file No %sprevious file No next tag No previous tag No such file goto mark: |mark: Brackets: Warning: some commands disabled Warning: some edit commands disabled Warning: environment variables from lesskey file unavailable Cannot use lesskey file "%s" /usr/bin/.sysless LESSKEY_SYSTEM /etc/sysless LESSKEY .less Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s" "%s" may be a binary file. See it anyway? Missing filename ("less --help" for help) LESSMETACHARS ; *?
'"()<>[]|&^`#\$%=~ LESSMETAESCAPE %c%s%c lessecho LESSECHO %s -p0x%x -d0x%x -e%s -n0x%x %s* LESSCLOSE ...skipping...
Cannot seek to that file position Determining length of file Don't know length of file Cannot seek to beginning of file Cannot seek to line number %n Cannot seek to end of file LESSANSIENDCHARS LESSANSIMIDCHARS 0123456789;[?!"'#%()*+ [m Line numbers turned off Calculating line numbers (press RETURN) Cannot seek to start position Invalid mark letter Mark not set Mark not in current file log file support is not available Input is not a pipe Log file is already in use No log file Log file "%s" j Invalid line fraction Invalid line number Position target at screen line %d .%06d Position target at screen position %s Invalid column fraction Invalid column number Horizontal shift %d columns Horizontal shift %s of screen width tags support is not available Tags file "%s" less
Copyright (C) 1984-2009 Mark Nudelman
less comes with NO WARRANTY, to the extent permitted by law.
For information about the terms of redistribution,
see the file named README in the less distribution.
Homepage: http://www.greenwoodsoftware.com/less
Tab stops and then every %d spaces -" must be followed by 1 or 2 chars quotes %s Use "h" for help Number is required after %s --%s -%c (--%s) Value is required after %s No such option Cannot change the %s option Cannot query the %s option Cannot use "-+" or "--" for a string option Can't use "-!" for a numeric option Negative option is invalid The %s option should not be followed by = %s is an ambiguous abbreviation ("less --help" for help) There is no %s option ("less --help" for help) LESS_IS_MORE Search includes displayed screen Search skips displayed screen Search includes all of displayed screen Max buffer space per file (K): Max buffer space per file: %dK Don't automatically allocate buffers Automatically allocate buffers when needed Repaint by scrolling from bottom of screen Repaint by painting from top of screen Be less helpful in prompts Be helpful in prompts Assume intelligent terminal Assume dumb terminal Don't quit at end-of-file Quit at end-of-file Quit immediately at end-of-file Open only regular files Open even non-regular files Don't quit if end-of-file on first screen Quit if end-of-file on first screen Don't highlight search matches Highlight matches for previous search only Highlight all matches for previous search pattern Backwards scroll limit: Backwards scroll limit is %d lines Case is significant in searches Ignore case in searches Ignore case in searches and in patterns Target line: 0123456789.- Don't display a status column Display a status column Interrupt (ctrl-C) returns to prompt Interrupt (ctrl-C) exits less Don't use the LESSOPEN filter Use the LESSOPEN filter Short prompt Medium prompt Long prompt Don't use line numbers Use line numbers Constantly display line numbers log file: Log file: prompt: Ring the bell for errors AND at eof/bof Ring the bell for errors but not at eof/bof Never ring the bell Display control characters as ^X Display control characters directly Display control characters directly, processing ANSI sequences Display all blank lines Squeeze multiple blank lines Fold long lines Chop long lines tag: tags file: Display underlined text in underline mode Backspaces cause overstrike Print backspace as ^H Don't highlight first unread line Highlight first unread line after forward-screen Highlight first unread line after any forward movement Tab stops: 0123456789, Send init/deinit strings to terminal Don't use init/deinit strings Forward scroll limit: Forward scroll limit is %d lines Scroll window size: Scroll window size is %d lines quotes: Don't show tildes after end of file Show tildes after end of file Horizontal shift: 0123456789. Use keypad mode Don't use keypad mode Use new bottom of screen behavior Use old bottom of screen behavior F command follows file descriptor F command follows file name search-skip-screen auto-buffers clear-screen quit-at-eof quit-if-one-screen hilite-search max-back-scroll ignore-case jump-target status-column lesskey-file quit-on-intr no-lessopen long-prompt line-numbers log-file LOG-FILE quiet raw-control-chars squeeze-blank-lines chop-long-lines tag-file underline-special hilite-unread no-init max-forw-scroll window quotes tilde no-keypad old-bot follow-name silent Invalid pattern No previous regular expression Please re-enter search pattern Nothing to search tags LESSGLOBALTAGS %s -x%s %s GTAGS GRTAGS GSYMS GPATH No tags file No such tag in tags file unknown tag type Tag not found \ can not be used as a string delimiter newline can not be used as a string delimiter whitespace after %s undefined label '%s' RE error: %s unterminated regular expression expected context address more than one number or 'g' in substitute flags no wfile specified bad flag in substitute command: '%c' unexpected EOF (pending }'s) 0123456789/\$ command expected invalid command code %c command %c expects up to %d address(es), found %d unexpected } extra characters at the end of %c command command %c expects \ followed by text extra characters after \ at the end of %c command filename expected w command read command branch empty label duplicate label '%s' substitute pattern can not be delimited by newline or backslash unterminated substitute pattern \%c not defined in the RE unescaped newline inside substitute pattern unterminated substitute in regular expression transform pattern can not be delimited by newline or backslash unterminated transform source string unterminated transform target string transform strings are not the same length extra text at the end of a transform command unused label '%s' usage: %s [-aEnr] script [file ...]
%s [-aEnr] [-e script] ... [-f script_file] ... [file ...]
ae:f:nrE stdout: %s ..." sed: %lu: %s: first RE may not be empty \
\%d not defined in the RE \abfnrtv
disconnecting... unknown ACU type can't open phone number file unrecognizable host name missing phone number
call aborted hayes
timeout error (%s)
[sh]
!
can't execl can't fork can't create %s
[cd] %s: bad directory
%s
[EOT]
%d %s%c Local command? can't fork!
can't find `%s'
away for
%d
timed out at eol
chars transferred in lines transferred in
write error
can't establish pipe
List command for remote system? can't execl!
[set] ~{[*?$`'"\ echo %s "Echo" failed
"%s": No match
Buffer overflow expanding "%s"
[put] usage: from [to]
%s: cannot open
cat>%s
stty -echo;cat>%s;stty echo
Local file name? [take] usage: from [to]
%s: cannot create
cat %s;echo second minute hour receive file from remote host send file to remote host take file from remote UNIX put file to remote UNIX pipe remote file pipe local command to remote host connect program to remote host change directory exit from tip suspend tip (local+remote) suspend tip (local only) set variable get this summary send break Usage: cu [options] [phone-number|"dir"]
Use cu --help for help
BSD tip/cu
Usage: cu [options] [phone-number|"dir"]
-E,--escape char: Use this escape character
-F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control
-f: Use no flow control
--nostop: Do not use software flow control
-a, -p,--port port: Use this port as ACU/Dialer
-c,--phone number: Call this number
-h,--halfduplex: Echo characters locally (use "half duplex")
-e: Use even parity
-o: Use odd parity
-P,--parity {even,odd,none}: use even, odd, no parity
-l,--line line: Use this device (ttyXX)
-s,--speed,--baud speed,-#: Use this speed
-t: Connect via hard-wired connection
only one escape character allowed bad flow setting even bad parity setting more than one line specified /dev/%s more than one parity specified E:F:P:a:p:c:l:s:hefot0123456789 more than one phone number specified cu%d all ports busy link down unsupported speed %ld Connect failed escape phone halfduplex nostop HOST no host specified REMOTE /etc/remote unknown host %s can't open host description file possible reference loop in host description file du %s: missing device spec
%s: missing phone number
tb hf pr dl dv cu pn di pa usage: %s [-v] [-speed] system-name
%s [-v] [-speed] phone-number
n
r t fEb %c
%2s %-2s %c %s
Lost carrier. %s: unknown parity value
Connected
connected
%s: must be interactive
%s, unknown option v0123456789 phone number too long (max = %d bytes) tip%d link down
PHONES bad baud rate %d %s
[EOT]
can't clear O_NONBLOCK access denied
out of core
%s=%-5d n
r
t bf record %s: unknown variable
%s/.tiprc set %s beautify baudrate ba dialtimeout dial eofread eofr eofwrite eofw exceptions framesize phones raise raisechar rec script tabexpand verb echocheck linedelay ldelay chardelay cdelay etimeout rawftp hdx localecho hardwareflow AT
Cannot synchronize with hayes...
timeout waiting for reply
ATH0
03 cannot hang up modem
please use 'tip dialer' to make sure the line is hung up
ATv1
dialing... ATv0
ATTD 01234 RING NO CARRIER ERROR in input CONNECT 1200 Unknown Modem error: %c (0x%x) Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command]
no such group `%s' G:g:u: no such user `%s' too many supplementary groups provided setgroups setgid -i s S% ? c% D% - ĝ Y% 5 ĝ L% A J U% Y a V% y F% E% W% ĝ W% ĝ X% ĝ ]% B% R% R% ĝ hU% y ]% C% # 4 |B% @ M ]% R [ Y% b J H% k s I% G% J% ĝ J% ĝ K% J ^% ĝ _% M% `%
ĝ a% ĝ b% y } p"
' 6 = C J O W G" \ e p u z ~ hw.disknames
!"#
/bin/ksh /bin/csh mdnsd+nsswitch No %c: <: page up, >: page down /sbin/halt -q /sbin/reboot -q %-25s %.50s Could not initialize menu system, please check your terminal type.
Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s"
Screen too narrow (%d + %d > %d) for menu "%s"
Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s"
Help: exit: x, page up: u <, page down: d > Exit Zeroconf FFSv1 4096 8192 16384 32768 512 1024 2048 Config menu google-public-dns-a.google.com google-public-dns-b.google.com run mdnsd only run mdnsd and resolve local names do not run mdnsd [ MSGTXTS msg_prompt_win: newwin(%d, %d, %d, %d) failed
usage: sysinst [-r release] [-f definition-file]
Installation messages in English en_US.ISO8859-1 Yes Some None On Off unchanged Delete? reinstall sets for upgrade NetBSD/zaurus 6.0.4
This menu-driven tool is designed to help you install NetBSD to a hard
disk, or upgrade an existing NetBSD system, with a minimum of work.
In the following menus type the reference letter (a, b, c, ...) to
select an item, or type CTRL+N/CTRL+P to select the next/previous item.
The arrow keys and Page-up/Page-down may also work.
Activate the current selection from the menu by typing the enter key.
Thank you for using NetBSD!
You have chosen to install NetBSD on your hard disk. This will change
information on your hard disk. You should have made a full backup
before this procedure! This procedure will do the following things:
a) Partition your disk
b) Create new BSD file systems
c) Load and install distribution sets
d) Some initial system configuration
(After you enter the partition information but before your disk is
changed, you will have the opportunity to quit this procedure.)
Shall we continue?
Ok, let's upgrade NetBSD on your hard disk. As always, this will
change information on your hard disk. You should have made a full backup
before this procedure! Do you really want to upgrade NetBSD?
(This is your last warning before this procedure starts modifying your
disks.)
Ok, let's unpack the NetBSD distribution sets to a bootable hard disk.
This procedure just fetches and unpacks sets onto an pre-partitioned
bootable disk. It does not label disks, upgrade bootblocks, or save
any existing configuration info. (Quit and choose `install' or
`upgrade' if you want those options.) You should have already done an
`install' or `upgrade' before starting this procedure!
Do you really want to reinstall NetBSD distribution sets?
(This is your last warning before this procedure starts modifying your
disks.)
Mounting %s failed. Continue?
I can not find any hard disks for use by NetBSD. You will be
returned to the original menu.
I found only one disk, %s.
Therefore I assume you want to %s NetBSD on it.
On which disk do you want to %s NetBSD? Available disks average file size (bytes) mount point (or 'none') sec MB NetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk
into multiple BSD partitions. You must now set up your BSD disklabel.
You can use a simple editor to set the sizes of the NetBSD partitions,
or keep the existing partition sizes and contents.
You will then be given the opportunity to change any of the disklabel
fields.
The NetBSD part of your disk is %d Megabytes.
A full installation requires at least %d Megabytes without X and
at least %d Megabytes if the X sets are included.
Choosing megabytes will give partition sizes close to your choice,
but aligned to cylinder boundaries. Choosing sectors will allow you
to more accurately specify the sizes. On modern ZBR disks, actual
cylinder size varies across the disk and there is little real gain
from cylinder alignment. On older disks, it is most efficient to
choose partition sizes that are exact multiples of your actual
cylinder size.
Choose your size specifier You can now change the sizes for the system partitions. The default is
to allocate all the space to the root file system, however you may wish
to have separate /usr (additional system files), /var (log files etc)
or /home (users' home directories).
Free space will be added to the partition marked with a '+'.
MB Cylinders Sectors Filesystem
Mount point? Size for %s in %s? Change input units (sectors/cylinders/MB) NetBSD partition Whole disk Boot partition Add a user defined partition Accept partition sizes. Free space %d %s, %d free partitions. Reduce partition sizes by %d %s (%u sectors). The start value you specified is beyond the end of the disk.
With this value, the partition end is beyond the end of the disk.
Your partition size has been truncated to %d %s.
Type enter to continue
This disk is too large for a disklabel partition table to be used
and hence cannot be used as a bootable disk or to hold the root
partition.
We now have your BSD-disklabel partitions as:
This is your last chance to change them.
Start %3s End %3s Size %3s FS type Newfs Mount Mount point
--------- --------- --------- ---------- ----- ----- -----------
%9lu %9lu %9lu %-10s %-5s %-5s %s Show all unused partitions Partition sizes ok The current values for partition `%c' are,
Select the field you wish to change:
MB cylinders sectors
------- --------- ---------
FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9s Toggle Restore original values Select the type other types %s
Special values that can be entered for the size value:
-1: use until the end of the NetBSD part of the disk
a-%c: end this partition where partition X starts
size (%s) %s
Special values that can be entered for the offset value:
-1: start at the beginning of the NetBSD part of the disk
a-%c: start at the end of previous partition (a, b, ..., %c)
start (%s) Badly formed sector number
Select file system block size Select file system fragment size Please enter a name for your NetBSD disk Ok, we are now ready to install NetBSD on your hard disk (%s). Nothing has been
written yet. This is your last chance to quit this process before anything
gets changed.
Shall we continue?
Okay, the first part of the procedure is finished. Sysinst has
written a disklabel to the target disk, and newfs'ed and fsck'ed
the new partitions you specified for the target disk.
Okay, the first part of the procedure is finished. Sysinst has
written a disklabel to the target disk, and fsck'ed the new
partitions you specified for the target disk.
Could not open %s, error message was: %s.
mount of device /dev/%s%c on %s failed.
The extraction of the selected sets for NetBSD-6.0.4 is complete.
The system is now able to boot from the selected harddisk. To complete
the installation, sysinst will give you the opportunity to configure
some essential things first.
The installation of NetBSD-6.0.4 is now complete. The system
should boot from hard disk. Follow the instructions in the INSTALL
document about final configuration of your system. The afterboot(8)
manpage is another recommended reading; it contains a list of things
to be checked after the first complete boot.
At a minimum, you should edit /etc/rc.conf to match your needs. See
/etc/defaults/rc.conf for the default values.
The upgrade to NetBSD-6.0.4 is now complete. You will
now need to follow the instructions in the INSTALL document as to
what you need to do to get your system reconfigured for your situation.
Remember to (re)read the afterboot(8) manpage as it may contain new
items since your last upgrade.
At a minimum, you must edit rc.conf for your local environment and change
rc_configured=NO to rc_configured=YES or reboots will stop at single-user,
and copy back the password files (taking into account new system accounts
that may have been created for this release) if you were using local
password files.
Unpacking additional release sets of NetBSD-6.0.4 is now complete.
You will now need to follow the instructions in the INSTALL document
to get your system reconfigured for your situation.
The afterboot(8) manpage can also be of some help.
At a minimum, you must edit rc.conf for your local environment and change
rc_configured=NO to rc_configured=YES or reboots will stop at single-user.
Your disk is now ready for installing the kernel and the distribution
sets. As noted in your INSTALL notes, you have several options. For
ftp or nfs, you must be connected to a network with access to the proper
machines.
Sets selected %d, processed %d, Next set %s.
The NetBSD distribution is broken into a collection of distribution
sets. There are some basic sets that are needed by all installations
and there are some other sets that are not needed by all installations.
You may choose to install a core set (Minimal installation), all of them
(Full installation) or you select from the optional distribution sets.
The following are the %s site, directory, user, and password that
will be used. If "user" is "ftp", then the password is not needed.
e-mail address Enter the nfs host and server directory where the distribution is located.
Remember, the directory should contain the .tgz files and
must be nfs mountable.
Enter the floppy device to be used and transfer directory on the target
file system. The set files must be in the root directory of the floppies.
Enter the CDROM device to be used and directory on the CDROM where
the distribution is located.
Remember, the directory should contain the .tgz files.
Available CDs Multiple CDs found, please select the one containing the install CD. The installation sets have not been found at the default location on this
CD. Please check device and path name. Enter the unmounted local device and directory on that device where
the distribution is located.
Remember, the directory should contain the .tgz files.
Enter the already-mounted local directory where the distribution is located.
Remember, the directory should contain the .tgz files.
I can not find any network interfaces for use by NetBSD. You will be
returned to the previous menu.
The following network interfaces are active: %s
Does one of them connect to the required server? I have found the following network interfaces: %s
Which device shall I use? You did not choose one of the listed network devices. Please try again.
The following network devices are available: %s
Which device shall I use? To be able to use the network, we need answers to the following:
Your DNS domain Your host name Your IPv4 number Server IPv4 number IPv4 Netmask IPv6 name server IPv4 name server IPv4 gateway Network media type The following are the values you entered.
DNS Domain: %s
Host Name: %s
Primary Interface: %s
Host IP: %s
Netmask: %s
IPv4 Nameserver: %s
IPv4 Gateway: %s
Media type: %s
The following are the values you entered. Are they OK?
DNS Domain: %s
Host Name: %s
Primary Interface: %s
Host IP: %s
Server IP: %s
Netmask: %s
IPv4 Nameserver: %s
IPv4 Gateway: %s
Media type: %s
IPv6 autoconf: %s
IPv6 Nameserver: %s
Are they OK? Please reenter the information about your network. Your last answers
will be your default.
Waiting while network interface comes up.
Could not create /etc/resolv.conf. Install aborted.
Could not change to directory %s: %s. Install aborted.
Delete after install Release set %s does not exist. All selected distribution sets unpacked successfully. There were problems unpacking distribution sets.
Your installation is incomplete.
You selected %d distribution sets. %d sets couldn't be found
and %d were skipped after an error occurred. Of the %d
that were attempted, %d unpacked without errors and %d with errors.
The installation is aborted. Please recheck your distribution source
and consider reinstalling sets from the main menu. Your choices have made it impossible to install NetBSD. Install aborted.
The distribution was not successfully loaded. You will need to proceed
by hand. Installation aborted.
The distribution was not successfully loaded. You will need to proceed
by hand. Upgrade aborted.
Unpacking additional sets was not successful. You will need to
proceed by hand, or choose a different source for release sets and try
again.
There is a big problem! Can not create /mnt/etc/fstab. Bailing out!
Help! No /etc/fstab in target disk %s. Aborting upgrade.
Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade.
I cannot save %s/bin/X as %s/bin/X.old, because the
target disk already has an %s/bin/X.old. Please fix this before
continuing.
One way is to start a shell from the Utilities menu, examine the
target %s/bin/X and %s/bin/X.old. If
%s/bin/X.old is from a completed upgrade, you can rm -f
%s/bin/X.old and restart. Or if %s/bin/X.old is from
a recent, incomplete upgrade, you can rm -f %s/bin/X and mv
%s/bin/X.old to %s/bin/X
Aborting upgrade. There was a problem in setting up the network. Either your gateway
or your nameserver was not reachable by a ping. Do you want to
configure your network again? (No allows you to continue anyway
or abort the install process.)
Would you like to continue the install process anyway, and assume
that the network is working? (No aborts the install process.)
Making device nodes ...
It appears that /dev/%s%c is not a BSD file system or the fsck was
not successful. Try mounting it anyway? (Error number %d.)
target root is missing %s.
The completed new root file system failed a basic sanity check.
Are you sure you installed all the required sets?
Floppy file system type Could not find the file on the floppy.
The floppy was not mounted successfully.
Please load the floppy containing the file named "%s.%s".
If the set's has no more disks, select "Set finished" to install the set.
Select "Abort fetch" to return to the install media selection menu.
Is the network information you entered accurate for this machine
in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used.
Distribution set Selected
------------------------ --------
Base System (/etc) Compiler Tools Games Online Manual Pages Miscellaneous Kernel Modules Test programs Text Processing Tools X11 sets X11 base and clients X11 configuration X11 fonts X11 servers X11 programming Source sets Kernel sources Base sources Share sources GNU sources X11 sources %-27s %3s Select all the above sets Deselect all the above sets Install selected sets There was an error in extracting the file %s. That means
some files were not extracted correctly and your system will not be
complete.
Continue extracting sets? There must be a single partition marked to be mounted on '/'. partitions %c and %c overlap. No bootcode for specified FS type of root partition Sorry, the root file system can't be FFSv2 due to lack of bootloader support
on this port.
You can either edit the partition table by hand, or give up and return
to the main menu.
Edit the partition table again? Could not open config file %s
Please choose the timezone that fits you best from the list below.
Press RETURN to select an entry.
Press 'x' followed by RETURN to quit the timezone selection.
Default: %s
Selected: %s
Local time: %s %s
Back to main timezone list The disk that you selected has a swap partition that may currently be
in use if your system is low on memory. Because you are going to
repartition this disk, this swap partition will be disabled now. Please
beware that this might lead to out of swap errors. Should you get such
an error, please restart the system and try again. Sysinst failed to deactivate the swap partition on the disk that you
chose for installation. Please reboot and try again. The root password of the newly installed system has not yet been initialized,
and is thus empty. Do you want to set a root password for the system now? You can now select which shell to use for the root user. The default is
/bin/sh, but you may prefer another one.
There is no defined root file system. You need to define at least
one mount point with "/".
Press to continue.
Enter slattach flags
Pick an option to turn on or off. Scripting Logging Status: Command: Finished Command failed Command ended on signal NetBSD-6.0.4 Install System Exit Install System Install NetBSD to hard disk Upgrade NetBSD on a hard disk Re-install sets or install additional sets Reboot the computer Utility menu Back to main menu NetBSD-6.0.4 Utilities Run /bin/sh Set timezone Configure network Partition a disk Logging functions Halt the system yes or no? Hit enter to continue Choose your installation Set sizes of NetBSD partitions Use existing partition sizes Megabytes Cylinders Sectors Install from FTP HTTP NFS CD-ROM / DVD Floppy Unmounted fs Local directory Select your distribution Full installation Installation without X11 Minimal installation Custom installation ** hidden ** Base directory Binary set directory Source set directory Transfer directory User Password Proxy Get Distribution Continue What do you want to do? Try again Set finished Skip set Skip set group Abandon installation Abort fetch File system Select IPv6 DNS server other Perform IPv6 autoconfiguration? Perform DHCP autoconfiguration? Root shell Sendmail is no longer in this release of NetBSD, default MTA is
postfix. The file /etc/mailer.conf still chooses the removed
sendmail. Do you want to upgrade /etc/mailer.conf automatically for
postfix? If you choose "No" you will have to update /etc/mailer.conf
yourself to ensure proper email delivery. To use the network interface %s, you must agree to the license in
file %s. To view this file now, you can type ^Z, look at the contents of
the file and then type "fg" to resume. To configure the binary package system, please choose the network location
to fetch packages from. Once your system comes up, you can use 'pkgin'
to install additional packages, or remove packages. Enabling binary packages with pkgin requires setting up the repository.
The following are the host, directory, user, and password that
will be used. If "user" is "ftp", then the password is not needed.
Making backup of rc.conf failed. Continue? rc.conf backup saved to %s. Restoring backup rc.conf failed. Deleting old %s entry failed. Package directory configure a prior installation of password set NO DONE Abandoned ***EMPTY*** Timezone Change root password Enable installation of binary packages Enable sshd Enable ntpd Run ntpdate at boot Enable mdnsd Configure the additional items as needed. Finished configuring Install pkgin and update package summary Your system is now configured to use pkgin to install binary packages. To
install a package, run:
pkgin install
from a root shell. Read the pkgin(1) manual page for further information. Fetch and unpack pkgsrc Installing pkgsrc requires unpacking an archive retrieved over the network.
The following are the host, directory, user, and password that
will be used. If "user" is "ftp", then the password is not needed.
pkgsrc directory Fetch and unpack pkgsrc for building from source Network configuration failed. Retry? Quit without installing pkgsrc Installation of pkgin failed, possibly because no binary packages
exist. Please check the package path and try again. Installing boot blocks on %s....
We now have your NetBSD partitions on %s as follows (Size and Offset in %s):
Kernel (GENERIC) Kernel (C700) We are now going to install NetBSD on the disk %s.
NetBSD requires a single partition in the disk's MBR partition table,
this is split further by the NetBSD disklabel.
NetBSD can also access file systems in other MBR partitions.
If you select 'Use the entire disk' then the previous contents of the
disk will be overwritten and a single MBR partition used to cover the
entire disk.
If you want to install more than one operating system then edit the
MBR partition table and create a partition for NetBSD.
A few hundred MB is enough for a basic installation, but you should allow
extra for additional software and user files.
Allow at least 5GB if you want to build NetBSD itself.
Which would you like to do? Edit the MBR partition table Use the entire disk Total disk size %lu %s.
Start(%3s) Size(%3s) Flg Kind
---------- ---------- --- ----------------
%10d %10d %c%c%c You have not marked a partition active. This may cause your system to not
start up properly. Should the NetBSD partition of the disk be marked active?
You will be prompted for the geometry.
Please enter the number of sectors per track (maximum 63)
and number of heads (maximum 256) that the BIOS uses to access the disk.
The number of cylinders will be calculated from the disk size.
Sysinst could not automatically determine the BIOS geometry of the disk.
The physical geometry is %d cylinders %d sectors %d heads
Using the information already on the disk, my best guess for the BIOS
geometry is %d cylinders %d sectors %d heads
real geom: %d cyl, %d heads, %d sec (NB: for comparison only)
BIOS geom: %d cyl, %d heads, %d sec
Your disk currently has a non-NetBSD partition. Do you really want to
overwrite that partition with NetBSD?
Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s %ssize (maximum %d %s) Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s)
%s%sStart (in %s) Partition kind (0..255) There can only be one extended partition The Current MBR partition table is shown below.
Flgs: a => Active partition,
I => Install here.
Select the partition you wish to change:
Partition table OK Delete partition Don't change Other, input number
Do you want to re-edit the MBR table (or abandon the installation)?
There is no NetBSD partition in the MBR partition table. There are multiple NetBSD partitions in the MBR partition table.
You should set the 'install' flag on the one you want to use. Setting up the DOS partition table ...
Rewrite of MBR failed. I can't continue. Log ended at: %s
# Script ended at: %s
sysinst terminated.
sysinst: environment variable TERM not set.
Dr:f: sysinst: screen too small
sysinstmsgs. zaurus xfer dir /usr/INSTALL ext dir ext src dir ftp host ftp.NetBSD.org ftp dir pub/NetBSD/NetBSD-6.0.4 ftp prefix /zaurus/binary/sets ftp src prefix /source/sets ftp user ftp pass ftp proxy nfs host nfs dir /bsd/release cd dev fd dev /dev/fd0a local dev local fs local dir targetroot mount /targetroot dist postfix .tgz diskname mydisk pkg host pkg dir pub/pkgsrc/packages/NetBSD pkg prefix /zaurus/6.0.4/All pkg user pkg pass pkg proxy pkgsrc host pkgsrc dir pkgsrc prefix pub/pkgsrc/stable pkgsrc user pkgsrc pass pkgsrc proxy /bin/X .old /usr/X11R6 /usr/X11R7 /tmp/sysinst.sh #!/bin/sh
# Script started at: %s
script file /tmp/sysinst.log Log started at: %s
------------------------------ sysinst: failed to allocate output window.
openpty() failed fork() failed executing: %s
&& chroot(%s) for %s execvp %s select select failure: %s
select(2) failed but no child died? Dynamic menu creation failed.
vasprintf(&scmd, "%s", ...) realloc(argv) for %s :% %.*s%s %%%02X /tmp/dhcpcd-lease Could not open %s /sbin/ifconfig -a 2>/dev/null Aborting: Could not run ifconfig.
Could not run ifconfig. lo0: %s%.*s iwi ipw hw.%s.accept_eula %s=1 manual /sbin/ifconfig %s media %s /sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done /sbin/dhcpcd %s -d -n %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo $gateway; break; }; done cat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver -a "${address#*:}" = "${address}" ] && { echo $address; break; }; done domain-name host-name 0xff000000 0xffff0000 0xffffff00 /etc/resolv.conf cat </etc/resolv.conf
;
; BIND data file
; %s %s;
Created by NetBSD sysinst on search %s
nameserver %s
EOF
/sbin/ifconfig lo0 127.0.0.1 /sbin/ifconfig %s inet %s %s up -s 115200 -l /dev/tty00 /sbin/slattach /sbin/ifconfig %s inet %s netmask %s /sbin/ifconfig %s inet %s /sbin/route -n flush -inet /sbin/route -n add default %s /sbin/ping -v -c 5 -w 5 -o -n %s -_.+!, -_.+!,/ %s://%s%s/%s -a /usr/bin/ftp %s%s/%s%s /sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2 /mnt2/%s hostname hostname=%s
/etc/ifconfig.%s cat <>%s%s
%s netmask %s media %s
%s netmask %s
/etc/hosts cat <>%s/etc/hosts
#
# Added by NetBSD sysinst
127.0.0.1 localhost.%s
%s defaultroute defaultroute="%s"
ifconfig_%s ifconfig_%s=dhcp
eon gre ipip gif faith nsip ppp tun /libdata/firmware/if_iwi/LICENSE.ipw2200-fw /libdata/firmware/if_ipw/LICENSE %s -p -b 16 -c 4 /dev/r%s%c %s -p -c 3 /dev/r%s%c /sbin/fsck_%s %s -p -q /dev/r%s%c :no_mbr %s (%s, %s) %s (%s, %s %s) %s -f /tmp/disktab %s '%s' disklabel -w -r -i -tffs -o async -tlfs -tmsdos -tffs -o log /sbin/newfs %s%.0d /sbin/newfs -V2 -O %d -b %d -f %d%s%.0d /sbin/newfs_lfs -b %d %s /dev/r%s%c /mnt ,dp ,log ,noauto ,async ,noatime ,nodev ,nodevmtime ,noexec ,nosuid /etc Creating %s/etc/fstab.
cat <%s/etc/fstab
Failed to make /etc/fstab!
# NetBSD %s/etc/fstab
# See /usr/share/examples/fstab/ for more examples.
/dev/%s%c none swap sw%s 0 0
%s/dev/%s%c %s %s rw%s%s%s%s%s%s%s%s %d %d
/dev/%s%c /tmp mfs rw,-s=%lli
swap /tmp mfs rw,-s=%lli
kernfs /kern kernfs rw
ptyfs /dev/pts ptyfs rw
procfs /proc procfs rw
/dev/%s /cdrom cd9660 ro,noauto
/kern /proc /dev/pts /cdrom /dev/%s%c /dev/%s %s ffs %s /dev/%s %s ufs %s raid cd0a /sbin/mount -rt cd9660 /dev/%s /mnt2 /bin/sh MAKEDEV all vasprintf(&spatterns, "%s", ...) sed -an -e '%s;H;$!d;g;w %s' %s /sbin/mount -rt %s /dev/%s /mnt2 %s/%s/%s /sbin/umount /mnt2 /dev/rcd%d%c CD001 aa /sbin/mount -r -t %s %s /mnt2 sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s' /etc/localtime UTC zoneinfo /usr/share/zoneinfo/
Please consult the install documents. /usr/share/zoneinfo/%s /etc/rc.conf cat <>%s/etc/rc.conf
/etc/rc.conf.tmp.XXXXXX /etc/rc.conf.bak.XXXXXX /etc/sysctl.conf cat <>%s/etc/sysctl.conf
s/^rc_configured=NO/rc_configured=YES/ /sbin/fsck_lfs /sbin/mount_lfs /sbin/newfs_lfs /.sysinst /usr rm -rf usr/X11R7/lib/X11/xkb/symbols/pc progress -zf %s tar --chroot -xhepf - rm %s mkdir -m 755 /mnt2
/usr/sbin/postinstall -s /.sysinst -d / check mailerconf /usr/sbin/postinstall -s /.sysinst -d / fix mailerconf /usr/sbin/postinstall -s /.sysinst -d / fix kern-GENERIC kern-C700 modules games man tests xbase xcomp xetc xfont xserver syssrc sharesrc gnusrc xsrc /netbsd /sbin/init /etc/rc /etc/rc.subr /sbin/fsck /sbin/fsck_ffs /sbin/mount /sbin/mount_ffs - async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %s cd to %s
cd %s
/bin/cp %s %s mv %s %s cp -p %s %s /sbin/mount %s /dev/%s%c %s%s /sbin/umount %s%s if [ $? != 0 ]; then echo "%s does not exist!"; fi
/dev/r%sa NetBSD60 s,^%s$,%s=%s, adding %s=%s
replacement pattern is %s
source for 3rd-party packages pkg_add %s/pkgin s,^[^#].*$,%s, /usr/pkg/etc/pkgin/repositories.conf /usr/pkg/bin/pkgin -y update passwd -l root chpass -s %s root %-50s %-10s chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwd getent passwd root | cut -d: -f2 chroot %s getent passwd root | chroot %s cut -d: -f2 buf %s strlen(buf) %zu
XXX Help String ntpdate /tmp/checkrc.sh Could not open %s for writing #!/bin/sh
. /etc/defaults/rc.conf
. /etc/rc.subr
#!/bin/sh
. /etc/rc.conf
. /etc/rc.subr
if checkyesno %s
then
echo YES
else
echo NO
fi
chroot %s /bin/sh %s 2>&1 var %s is %s
%s.
%s can't delete extended main-extended mixup User answered no to destroy other data, aborting.
Unknown (%d) %*s %*s (%s) Extended partition, LBA FreeBSD/386BSD Linux swap DOS FAT16, <32M DOS FAT16, >32M Windows FAT16, LBA Windows FAT32 Windows FAT32, LBA NTFS volume set PReP Boot Unknown (%lli) %6lli%8s%10lli%10lli %c %s %lli%s /tmp/disktab Creating disklabel %s
cat <>/etc/disktab
Could not open /etc/disktab Failed to open /etc/disktab for appending.
%s|NetBSD installation generated:\
:dt=%s:ty=winchester:\
:nc#%d:nt#%d:ns#%d:\
:sc#%d:su#%u:\
:se#%d:%s\
nparts limited to %d.
:p%c#%u:o%c#%u:t%c=%s: b%c#%u:f%c#%u: *************************************************************************************************************************************************************************************************************************************** ĝ m> q> u> y> }> > usage: %s [-ez] [-b buffersize] [-f file] [-l length]
%*.s [-p prefix] cmd [args...]
input size b:ef:l:p:z gzip -l %s reading compressed file length closing compressed file length pipe gzip pipe fork for gzip exec()ing gzip malloc for buffersize fork for output pipe could not exec %s writing %u bytes to output pipe + q$ W + + M -%u usage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count]
[-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr]
[-s packetsize] [-h hoplimit] [-g gateway] [hops...] host
sendmsg ping6: wrote %s %d chars, ret=%d
nxt %u, len %u (%lu bytes)
Jumbo Payload Opt: Length %u
Router Alert Opt: Type %u
Received Opt %u len %lu
--- %s ping6 statistics ---
%ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms
IP6 Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x
%s-> HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d
ESP TCP: from port %u, to port %u (decimal)
UDP: from port %u, to port %u (decimal)
Unknown Header(%d)
\%03o invalid peername packet too short (%d bytes) from %s failed to get receiving hop limit failed to get receiving packet information %d bytes from %s, icmp_seq=%u hlim=%d dst=%s (DUP!)
wrong data byte #%d should be 0x%x but was 0x%x refused, type 0x%x unknown, type 0x%x unknown code 0x%x, type 0x%x NodeInfo NOOP NodeInfo Supported Qtypes , compressed bitmap , raw bitmap refused unknown qtype truncated no address %s (TTL=infty) (TTL=%u) TTL=%d:meaningless TTL=%d:invalid TTL=%d 03 draft no name invalid namelen:%d/%lu No Route to Destination Destination Administratively Unreachable Destination Unreachable Beyond Scope Destination Unreachable, Bad Code: %d
Packet too big mtu = %d
Time to live exceeded Time exceeded, Bad Code: %d
Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x
Echo Request Echo Reply Listener Query Listener Report Listener Done Neighbor Solicitation Neighbor Advertisement Redirect Destination: %s New Target: %s Node Information Query Supported qtypes DNS name IPv4 nodeaddr , subject=%s(%s) , oldfqdn , no subject , subject=%s DNS label (invalid) , invalid Node Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left
[%d]
[%d]%s
invalid socket buffer size illegal number of packets -- %s Must be superuser to flood ping illegal hoplimit %s illegal hoplimit -- %s illegal timing interval %s %s: only root may use interval < 1s too small interval, raised to 0.01 Must be superuser to preload illegal preload value -- %s patterns must be specified as hex digits -R is not supported in this configuration invalid source address: %s illegal datalen value -- %s datalen value too large, maximum is %d a:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW too many intermediate hops ff02::2:0000:0000 getaddrinfo failed getaddrinfo for the gateway %s: %s gateway resolves to multiple addresses setsockopt(IPV6_NEXTHOP) setsockopt(IPV6_RECVHOPOPTS) setsockopt(IPV6_RECVDSTOPTS) -f and -i incompatible options Unable to allocate packet IPV6_MULTICAST_HOPS setsockopt(IPV6_USE_MIN_MTU) setsockopt(IPV6_RECVPATHMTU) setsockopt(ICMP6_FILTER) setsockopt(IPV6_RECVRTHDR) can't allocate enough memory %s: invalid interface name can't initialize rthdr bad addr family of an intermediate addr can't add an intermediate node UDP socket UDP setsockopt(IPV6_PKTINFO) UDP setsockopt(IPV6_UNICAST_HOPS) UDP setsockopt(IPV6_MULTICAST_HOPS) UDP setsockopt(IPV6_RTHDR) UDP connect getsockname you need -b to increase socket buffer size setsockopt(SO_SNDBUF) setsockopt(SO_RCVBUF) setsockopt(IPV6_RECVPKTINFO) setsockopt(IPV6_RECVHOPLIMIT) PING6(%lu=40+8+%lu bytes) %s --> recvmsg path MTU for %s is notified. (ignored)
new path MTU (%d) is notified
IPv6 address Success Refused rtsol_timer_update ifconfig make_packet main rtsol_check_timer sockopen sendpacket rtsol_input interface_up get_llflag interface_status lladdropt_fill " ) probe_init defrouter_probe sendprobe rtsock_input_ifannounce rtsock_input X usage: rtsol [-Dd] interface ...
usage: rtsol [-Dd] -a
usage: rtsold [-1Ddfm] interface ...
usage: rtsold [-1Ddfm] -a
<%s> %s illegal interface state(%d) on %s stop timer for %s set timer for %s to %d:%d failed to get link layer information for %s interface %s was already configured memory allocation failed link-layer address option has null length on %s. Treat as not included. memory allocation failed for %s multiple interfaces found probing %s adDfm1 adD kernel is configured not to accept RAs kernel is configured as a router, not a host failed to open a socket failed to initilizatoin interfaces failed to initialize %s failed to setup for probing routers failed to open a pid log file: %s timer expiration on %s, state = %d %s status is changed from %d to %d No answer after sending %d RSs there is no timer New timer is %ld:%08ld poll: %s malloc for receive msghdr failed malloc for send msghdr failed ff02::2 inet_pton failed for %s IPV6_RECVPKTINFO: %s IPV6_RECVHOPLIMIT: %s setsockopt(ICMP6_FILTER): %s send RS on %s, whose state is %d sendmsg on %s: %s recvmsg: %s failed to get receiving interface packet size(%zd) is too short invalid icmp type(%d) from %s on %s invalid icmp code(%d) from %s on %s invalid RA with hop limit(%d) from %s on %s invalid RA with non link-local source from %s on %s received RA from %s on an unexpected IF(%s) received RA from %s on %s, state is %d ioctl(SIOCGIFFLAGS): %s ioctl(SIOCSIFFLAGS): %s checking if %s is ready... socket(SOCK_DGRAM): %s getifaddrs: %s ioctl(SIOCGIFAFLAG_IN6): %s get_llflag() failed, anyway I'll try %s is ready %s is tentative %s is duplicated ioctl(SIOCGIFFLAGS) on %s: %s ioctl(SIOCGIFMEDIA) on %s: %s unsupported link type(%d) shutdown: %s lo0 ioctl(SIOCGDRLST_IN6): %s default router list contains a non-link-local address(%s) probe a router %s on %s interface %s inserted interface %s removed bring interface %s to DOWN state rtmsg type %d, len=%lu rtmsg type %d too short! A D y HD ED ! A RD A . `D @ lD @ yD @ D @ D @ D @ D
@ D @ D D
D E E @ E )E 3E CE QE @ jE xE E E E E E A D E F F @ F " Copyright (c) 2006-2012 Roy Marples = b c d "X e q f &X g h 2X i k @X l
J m FN n ! o JX p . q b/ r UX s KJ t \X u fX v mX w S x tX z y X A X B X C )U D X E R$ F X G X H X I j J X K X L X O X Q [ S T X U X V X W Y X Y Z Y | ʁ ~ $Y } -Y
( ( ( ( 0 ( E H D )
%s: found %s on hardware address %s %s: hardware address %s claims %s %s: sending ARP announce (%d of %d), next in %d.00 seconds %s: sending ARP announce (%d of %d) send_arp: %m %s: searching for %s %s: checking for %s %s: sending ARP probe (%d of %d), next in %0.2f seconds pipe: %m forking to background failed to notify parent: %m failed to read child: %m forked to background, child pid %d %s: using static address %s STATIC %s: using IPv4LL address %s IPV4LL %s: received approval for %s INFORM TIMEOUT %s: leased %s for infinity %s: minimum lease is %d seconds %s: rebind time greater than lease time, forcing to %u seconds %s: renewal time greater than rebind time, forcing to %u seconds %s: leased %s for %u seconds TEST RENEW REBIND REBOOT BOUND fcntl: %m host does not support a monotonic clock - timing can skew memory exhausted (xalloc %zu bytes) %s_%s=%s memory exhausted (xrealloc %zu bytes) memory exhausted (xstrdup) /var/run/dhcpcd.sock %s: deleting IP address %s/%d del_address: %m %s: %s route to %s/%d %s: %s host route to %s %s: %s default route via %s %s: %s route to %s/%d via %s %s_%s ROUTERADVERT interface=%s reason=%s pid=%d ifmetric=%d ifwireless=%d ifflags=%u ifmtu=%d interface_order= if_up=true if_down=false if_up=false if_down=true profile=%s new_ssid=%s NOCARRIER old_ssid=%s vfork: %m %s: executing `%s', reason %s PATH=%s PATH=/usr/bin:/usr/sbin:/bin:/sbin waitpid: %m writev: %m removing %s: forcing router %s through interface %s: router %s requires a host route changing %s: add_route: %m adding deleting %s: del_route: %m %s: adding IP address %s/%d add_address: %m write_lease: %m - %s
%s
0.0.0.0/0 %d %d %02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x %d.%d.%d.%d %s: using Classless Static Routes (RFC3442) Duplicate address detected %s: writing lease `%s' %s: open `%s': %m %s: reading lease `%s' ip_address subnet_mask subnet_cidr broadcast_address network_number %s_%s= ms_classless_static_routes time_offset time_servers ien116_name_servers domain_name_servers log_servers cookie_servers lpr_servers impress_servers resource_location_servers host_name boot_size merit_dump domain_name swap_server root_path extensions_path ip_forwarding non_local_source_routing policy_filter max_dgram_reassembly default_ip_ttl path_mtu_aging_timeout path_mtu_plateau_table interface_mtu all_subnets_local perform_mask_discovery mask_supplier router_discovery router_solicitation_address trailer_encapsulation arp_cache_timeout ieee802_3_encapsulation default_tcp_ttl tcp_keepalive_interval tcp_keepalive_garbage nis_domain nis_servers ntp_servers vendor_encapsulated_options netbios_name_servers netbios_dd_server netbios_node_type netbios_scope font_servers x_display_manager dhcp_requested_address dhcp_lease_time dhcp_option_overload dhcp_message_type dhcp_server_identifier dhcp_parameter_request_list dhcp_message dhcp_max_message_size dhcp_renewal_time dhcp_rebinding_time nisplus_domain nisplus_servers tftp_server_name bootfile_name mobile_ip_home_agent smtp_server pop_server nntp_server www_server finger_server irc_server streettalk_server streettalk_directory_assistance_server user_class fqdn_name nds_servers nds_tree_name nds_context bcms_controller_names bcms_controller_address client_last_transaction_time associated_ip uap_servers netinfo_server_address netinfo_server_tag default_url subnet_selection domain_search sip_server sixrd reason ifmetric ifwireless interface_order allowing %d seconds for IPv4LL timeout usage: dhcpcd [-dgknpqwxyADEGHJKLOTV] [-c script] [-f file] [-e var=val]
[-h hostname] [-i classID ] [-l leasetime] [-m metric] [-o option]
[-r ipaddr] [-s ipaddr] [-t timeout] [-u userclass]
[-F none|ptr|both] [-I clientID] [-C hookscript] [-Q option]
[-X ipaddr] get_duid: %m %s: using ClientID %s %s: using hwaddr %s manage_link: %m stop_control: %m via NAK: %s: %s %s %s %s `%s' %s: %s %s %s %s: %s %s %s %s %s: no profile %s %s: selected profile %s PREINIT %s: open_socket: %m %s: open_udp_socket: %m %s: sending %s with xid 0x%x %s: sending %s (xid 0x%x), next in %0.2f seconds %s: send_packet: %m %s: send_raw_packet: %m FAIL %s: releasing lease of %s RELEASE %s: broadcasting for a lease (requesting %s) %s: broadcasting for a lease %s: removing IP address %s/%d %s: waiting for 3rd party to configure IP address 3RDPARTY %s: waiting for carrier %s: informing address of %s %s: rebinding lease of %s %s: failed to renew, attempting to rebind %s: renewing lease of %s %s: removing interface %s: invalid UDP packet from %s %s: blacklisted DHCP packet from %s %s: server %s is not destination %s: packet greater than DHCP size from %s %s: bogus cookie from %s %s: wrong xid 0x%x (expecting 0x%x) from %s %s: xid 0x%x is not for hwaddr %s reject NAK reject DHCP reject invalid address offered ignoring offer of not ACK or OFFER acknowledged %s: non whitelisted DHCP packet from %s %s: needs a clientid to configure %s: discarding expired lease EXPIRE received SIGINT, stopping received SIGTERM, stopping received SIGALRM, rebinding received SIGHUP, releasing received SIGUSR, reconfiguring received SIGPIPE received signal %d, but don't know what to do with it /etc/dhcpcd.conf --version 5.5.4 --getconfigfile --getinterfaces --listen control command: %s bc:de:f:gh:i:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLO:Q:S:TUVW:X:Z: handle_args: no interface %s: expiring for new hardware address %s: carrier_status: %m %s: carrier lost %s: carrier acquired %s: lease expired --help dhcpcd 5.5.4
%s
/var/run/dhcpcd%s%s.pid chdir `/': %m dumplease requires an interface /var/db/dhcpcd-%s.lease %s: no lease to dump DUMP sending commands to master dhcpcd process send OK failed to send commands open_control: %m dhcpcd will not work correctly unless run as root sending signal %d to pid %d dhcpcd not running kill: %m waiting for pid %d to exit pid %d failed to exit dhcpcd already running on pid %d (%s) /var/run mkdir `%s': %m /var/db flock `%s': %m version 5.5.4 starting start_control: %m init_socket: %m open_link_socket: %m ipv6rs: %m no valid interfaces found aborting as link detection is disabled no interfaces have a carrier %s: interface not found or invalid DISCOVER REQUEST DECLINE ACK /etc/dhcpcd.duid nothing to do poll: %m `%s' out of range `%s' is not a valid CIDR `%s' is not a valid IP address hostname: %m hostname cannot begin with . vendorclassid: %m leasetime must be a positive value metric must be a positive value timeout must be a positive value userclass: %m invalid vendor format vendor: %m vendor option should be between 1 and 254 inclusive reboot must be a positive value skip_hooks=%s ptr both disable invalid value `%s' for FQDN clientid: %m static assignment required ip_address= subnet_mask= ms_classless_static_routes= all routes need a gateway routers= option `%s' does not take an IPv4 address /libexec/dhcpcd-run-hooks %s-%s:%s-%s:%s%s%s %s-%s fopen `%s': %m dhcpcd: option requires an argument -- %s
dhcpcd: unknown option -- %s
env reconfigure vendorclassid leasetime persistent inform userclass vendor waitip allowinterfaces noarp nobackground nohook lastlease nogateway xidhwaddr clientid nolink noipv4ll nooption require dumplease variables whitelist blacklist denyinterfaces arping fallback noipv6rs %s: probing for an IPv4LL address %s: IPv4LL %d second defence failed %s: defended IPv4LL address %s: failed to acquire an IPv4LL address %s: sending IPv6 Router Solicitation %s: sendmsg: %m %s: no IPv6 Routers available %s: %s: expired Router Advertisement %s: %s: expired option %d recvmsg: %m IPv6 RA packet too short from %s IPv6 RA did not contain index or hop limit from %s invalid IPv6 type or code from %s RA recieved from non local IPv6 address %s %s: Router Advertisement from %s %s: Short option %s: zero length option %s: Option length exceeds message %s: invalid option len for prefix %s: invalid prefix len %s: invalid prefix in RA %s: invalid RDNSS address %s: invalid DNSSL option received RA for unexpected interface from %s rdnss dnssl ra%d_from ra%d_%s ra%d_prefix_len ra%d_prefix_vltime ra%d_prefix_pltime ra_count %.2x %s: up_interface: %m %s: unknown hardware family %s: if_init: %m failed to write signal %d: %m /dev/bpf BPF version mismatch - recompile Kernel is not configured to accept IPv6 RAs Kernel is configured as a router, not a host B B B B B @@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ @ @ @ @ @ @ @ @ @ @ (@ (@ (@ (@ (@ (@ (@
@ @ @
@@@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ (@ (@ (@ (@ (@ (@
@ @ @
@@@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ (@ (@ (@ (@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @
! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ a b c d e f g h i j k l m n o p q r s t u v w x y z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~
! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` A B C D E F G H I J K L M N O P Q R S T U V W X Y Z { | } ~ :j >j `a hi Gj `e pi Pj Vj \j bj I hj Aj 8E nj @ Jj tj D @}
/etc/group /etc/master.passwd %s%s%s
646 towlower towupper alnum alpha blank cntrl graph punct xdigit Unknown error number Unknown signal number YP FAKE error %d
%ju %ju%s%0*ju , uappnd uchg nodump opaque sappnd arch schg snap archived dump sappend schange simmutable uappend uchange uimmutable , /dev/ptm tty pqrstuwxyzPQRST 0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ /dev/XtyXX w %s%s.pid /var/run/ /dev/ %s%s%s%c autoselect auto 11a 11b 11g fh 11na 11ng Ethernet ether TokenRing token FDDI IEEE802.11 CARP manual none 10baseT 10baseT/UTP 10UTP 10BASE-T 10base2 10base2/BNC 10BNC 10BASE2 10base5 10base5/AUI 10AUI 10BASE5 100baseTX 100TX 100BASE-TX 100baseFX 100FX 100BASE-FX 100baseT4 100T4 100BASE-T4 100baseVG 100VG 100VG-AnyLAN 100baseT2 100T2 100BASE-T2 1000baseSX 1000SX 1000BASE-SX 10baseSTP STP 10STP 10BASE-STP 10baseFL FL 10FL 10BASE-FL 1000baseLX 1000LX 1000BASE-LX 1000baseCX 1000CX 1000BASE-CX 1000BASE-BX10 1000baseT 1000T 1000BASE-T HomePNA1 HPNA1 10GbaseLR 10GLR 10GBASE-LR 10GbaseSR 10GSR 10GBASE-SR 10Gbase-LRM 10Gbase-Twinax 10Gbase-Twinax-Long 10Gbase-T 10GbaseCX4 10GCX4 10GBASE-CX4 2500baseSX 2500SX DB9/4Mbit 4STP DB9/16Mbit 16STP UTP/4Mbit 4UTP UTP/16Mbit 16UTP Single-mode SMF Multi-mode MMF CDDI 10baseT-FDX 10BASE-T-FDX 100baseTX-FDX 100BASE-TX-FDX FH1 FH2 DS1 DS2 DS5 DS11 DS22 OFDM6 OFDM9 OFDM12 OFDM18 OFDM24 OFDM36 OFDM48 OFDM54 OFDM72 DS/354Kbps DS/512Kbps OFDM/3Mbps OFDM/4.5Mbps OFDM/27Mbps full-duplex fdx half-duplex hdx flowcontrol flag0 flag1 flag2 loopback hw-loopback loop master rxpause txpause EarlyTokenRelease ETR SourceRouting SRCRT AllRoutes ALLR dual-attach das adhoc hostap monitor turbo ibss wds mesh -o %s: option not supported Missing %s argument Invalid %s argument `%s' kern.labelusesmbr Cannot copy string; %zu chars needed %zu provided Cannot append to string; %zu chars needed %zu provided Cannot copy string Cannot allocate %zu bytes Cannot re-allocate %zu bytes Cannot open `%s' Cannot format string |s s s s s s s s s s s s s s s s s s s t t t t $t ,t 0t 8t ? @ A B C D E F G x \ z ^ y ] ~ _ `
I V } a { M J O P [ K H L R S Q N T U
Inkey state screwed - exiting!!! Inkey: Cannot allocate new keymap Could not malloc for key entry
inkey: Cannot allocate new key entry chunk add_new_key: bad type passed
unknown 5M S 7 )
# $
r ? 7 Q Q j % ^ . " Ar
O . E g
. _ l } J 2
7 W e m < B . >2 0 <s g + Q
| q ; o / | > W a 3 V 9V i + h[u 8 e " m : M k : k + t g Zw X ( h2 ) \ A _ 4 | v @ d p S \ n' Px 8 K { k 1 Z
V T r ] ; f | Q } [ k v / t m F / B 6 z F 7 * : e P : @ [ \/ q Gk % # e $ _ p uH v? 5 < > d E A |~ M; " i 7 h 9[ 9 Y Z = K g = M ) ] \ b s l *E X [ C Bp h 9 `% Xb
n %p0%{10}%/%{16}%*%p0%{10}%m%+ %p0%p0%{2}%*%- %p0%p0%? %>%t %+%; bw am ut cc xs YA YF YB xt xn eo
gn hc HC
km YC hs hl in YG da db mi ms nx xb NP ND NR os 5i YD YE es ! hz " ul # xo $ Yo Yp Ya BT co Yc Yb it lh lw li
lm ma sg
Co Yd Ye pa MW Yf Yg NC Nl Yh Yi Yj Yk Yl pb Ym vt Yn ws ac S8 bt bl Yv Zz Xy cr ZA ZB ZC
ZD cs rP
Zy ct MC cl cb ce cd ci Yw ch CC cm do ho vi le CM ve nd ! ll " up # vs $ Yx % ZE & dc ' dl ( dv ) DI * ds + DK , S1 - hd . eA / Yy 0 as 1 SA 2 mb 3 md 4 ti 5 dm 6 mh 7 ZF 8 ZG 9 Xh : im ; ZH < Xl = ZI > Xo ? ZJ @ ZK A ZL B S2 C mp D mr E Xr F S4 G mk H ZM I so J ZN K ZO L Xt M us N ZP O Xv P SX Q ec R ae S RA T me U te V ed W ZQ X ei Y ZR Z ZS [ ZT \ S3 ] S5 ^ ZU _ se ` ZV a ZW b ue c ZX d RX e PA f fh g vb h ff i fs j Gm k WG l HU m i1 n i2 o i3 p is o if q iP r Ic s Ip t ic u al v ip w K1 x K3 y K2 z kb { kB } K4 ~ K5 ka kC kt kD kL kd kM kE kS k0 k1 k2 k3 k4 k5 k6 k7 k8 k9 k; F1 F2 F3 F4 F5 F6 F7 F8 F9 FA FB FC FD FE FF FG FH FI FJ FK FL FM FN FO FP FQ FR FS FT FU FV FW FX FY FZ Fa Fb Fc Fd Fe Ff Fg Fh Fi Fj Fk Fl Fm Fn Fo Fp Fq Fr %1 kh kI kA kl kH %2 %3 Km %4 %5 kN %6 %7 kP %8 %9 %0 &1 &2 &3 &4 &5 kr &6 &9 &0 *1 *2 *3 *4 *5 *6 *7 *8 *9 kF *0 #1 #2 #3 #4 %a %b %c %d %e %f kR %g %h %i %j !1 !2 kT !3
&7 &8 ku
ke ks l0 l1 l2 l3 l4 l5 l6 l7 l8 l9 la Lf LF LO mo mm ZY ZZ ! Za " Zb # Zc $ Zd % Mi & nw ' Ze ( oc ) op * pc + DC , DL - DO . Zf / IC 0 SF 1 AL 2 LE 3 Zg 4 RI 5 Zh 6 SR 7 UP 8 Zi 9 S6 : pk ; pl < xl = px > pn ? ps @ pO A pf B po C PU D QD E RC F rp G RF H RQ I r1 J r2 K r3 L rf M rc N cv O sc P S7 Q sf R sr S Zj T s0 U s1 V s2 W s3 X sA Y AB Z AF [ sa \ Sb ] Zk ^ Zl _ SC ` Yz g sL h sp b Sf c ML d Zm e YZ g YI h MR i Zn j st k MT l Zo m Zp n wi o Zq p Zr q Zs r Zt s Zu t Zv u ta v Zw w ts x TO y u0 z u1 { u2 | u3 } u4 ~ u5 u6 u7 u8 u9 uc hu WA XF XN Zx @0 @1 | @2 @3 @4 @5 @6 @7 @8 @9 8 < @ D H P T X \ P ` d h d p P x | tc bel ^G cr ^M cud1 ^J ht ^I ind kbs ^H kcub1 kcud1 nel ^M^J TERM environment variable not set not enough memory to create terminal structure cannot access the terminfo database %s: terminal not listed in terminfo datase unknown error %s: generic terminal %s: hardcopy terminal t ` 9 ; \ ansi @ P
bG [%i%d;%dR [6n [?%[;0123456789]c [c * [39;49m Z
[4%p1%dm [
[3%p1%dm H [8m \V [0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m 3 [5m 4 [1m E [7m ] [10m ` [m c [m U [0;10m C [11m J [7m N [4m ? +,-.0`afghjklmno~pqrs_tuvwxyz{|}~ S [10m 1 [11m 3 [%p1%dD . [%p1%dB 5 [%p1%dC 8 [%p1%dA , [%p1%dP - [%p1%dM R [%p1%dX [1K [%i%p1%dG v [I 0 [%p1%d@ 2 [%p1%dL 1 [%p1%dS { } [Z [D [B [C
[A [L B [4i C [5i '
[S G %p1%c[%p2%{1}%-%db 7 [%p1%dT U (B V )B W *B X +B [3g O [%i%p1%dd [Z [H[J
[D [B ! [C [%i%p1%d;%p2%dH # [A ' [P ( [M [J [K [H k H v [L R
[H AX f bs f dumb P
R
vt100 $ P
@G 3 ``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ 3 [5m$<2> 4 [1m$<2> [H[J$<50>
[%i%p1%d;%p2%dr 3 [%p1%dD . [%p1%dB
5 [%p1%dC ! [C$<2> [%i%p1%d;%p2%dH$<5> 8 [%p1%dA # [A$<2> [J$<50> [K$<3> [1K$<3> / (B)0 [H v k H R
{ OD OB OC
OA pf1 pf2 pf3 pf4 @ [0i B [4i C [5i N 8 E [7m$<2> S M$<5> S T [?7l [?1l> ` [m$<2> c [m$<2> K >[?3l[?4l[?5l[?7h[?8h P 7 \L [0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2> U [m$<2> 1 2 [?7h [?1h= J [7m$<2> N [4m$<2> [3g Oy Ox Ot Ou Ov Ol Ow OM OP OQ OR OS x Oq y Os z Or ~ Op On bs f vt220 $ P
Z 3 ``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ 3 [5m 4 [1m [H[J
[%i%p1%d;%p2%dr 3 [%p1%dD . [%p1%dB
5 [%p1%dC ! [C [%i%p1%d;%p2%dH 8 [%p1%dA # [A , [%p1%dP ' [P - [%p1%dM ( [M R [%p1%dX [J [K [1K / )0 h [?5h$<200/>[?5l [H v k H 0 [%p1%d@ q /usr/share/tabset/vt100 2 [%p1%dL v [L R D o [?7h[>[?1h F[?4l { [D [B [C
[A OP [21~ [23~ [24~ [25~ [26~ [31~ [32~ [33~ OQ [34~ OR OS [17~ [18~ [19~ [20~ [1~ [28~ [2~ [6~ [5~ [29~ [4~ pf1 pf2 pf3 pf4 @ [i B [4i C [5i ' E N 8 E [7m S M S (B$<4> T [?7l Y [4l ` [27m c [24m J [?3l P 7 \K [0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2> U [m(B 1 (0$<2> 2 [?7h ; [4h J [7m N [4m [3g bs f wsvt25 $ P
@ Pc [?25l [?25h o [r[25;1H [3~ [8~ [11~ [21~ [23~ [24~ [12~ [13~ [14~ [15~ [17~ [18~ [19~ [20~ [7~ * [m J c Z
[4%p1%dm [
[3%p1%dm 3 ``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ 3 [5m 4 [1m [H[J
[%i%p1%d;%p2%dr 3 [%p1%dD . [%p1%dB
5 [%p1%dC ! [C [%i%p1%d;%p2%dH 8 [%p1%dA # [A , [%p1%dP ' [P - [%p1%dM ( [M R [%p1%dX [J [K [1K / )0 h [?5h$<200/>[?5l [H v k H 0 [%p1%d@ q /usr/share/tabset/vt100 2 [%p1%dL v [L R D { [D [B [C
[A [25~ [26~ [31~ [32~ [33~ [34~ [1~ [28~ [2~ [6~ [5~ [29~ [4~ pf1 pf2 pf3 pf4 @ [i B [4i C [5i ' E N 8 E [7m S M S (B$<4> T [?7l Y [4l ` [27m c [24m P 7 \K [0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2> U [m(B 1 (0$<2> 2 [?7h ; [4h J [7m N [4m [3g bs f xterm P
@ 1 [%p1%dS [3;2~ [1;2F [1;2H [2;2~ [6;2~ [5;2~ z OE } [Z OD OB OC
OA OF OM OH [2~ [M [6~ [5~ 7 [%p1%dT OP [21~ [23~ [24~ [1;2P [1;2Q [1;2R [1;2S [15;2~ [17;2~ [18;2~ OQ [19;2~ [20;2~ [21;2~ [23;2~ [24;2~ [1;5P [1;5Q [1;5R [1;5S [15;5~ OR [17;5~ [18;5~ [19;5~ [20;5~ [21;5~ [23;5~ [24;5~ [1;6P [1;6Q [1;6R OS [1;6S [15;6~ [17;6~ [18;6~ [19;6~ [20;6~ [21;6~ [23;6~ [24;6~ [1;3P [15~ [1;3Q [1;3R [1;3S [15;3~ [17;3~ [18;3~ [19;3~ [20;3~ [21;3~ [23;3~ [17~ [24;3~ [1;4P [1;4Q [1;4R [18~ [19~ [20~ [1;2D [1;2C [1;2B [1;2A [3~ 5 ``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ 3 [5m 4 [1m [Z [?25l [H[2J
[?12l[?25h
[%i%p1%d;%p2%dr 3 [%p1%dD . [%p1%dB
5 [%p1%dC ! [C [%i%p1%d;%p2%dH 8 [%p1%dA # [A $
[?12;25h , [%p1%dP ' [P - [%p1%dM ( [M R [%p1%dX [J [K [1K h [?5h$<100/>[?5l [H [%i%p1%dG v k H 0 [%p1%d@ 2 [%p1%dL v [L R
H [8m o [!p[?3;4l[4l> { @ [i B [4i C [5i * [39;49m N 8 E [7m S M S (B T [?7l V [?1049l Y [4l [?1l> [?1034l ` [27m c [24m J c K [!p[?3;4l[4l> P 7 Z
[4%p1%dm [
[3%p1%dm ]F [4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m cF [3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m \R %?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;m U (B[m 1 (0 2 [?7h 5 [?1049h ; [4h [?1h= [?1034h J [7m N [4m [3g O [%i%p1%dd [?1;2c [%i%d;%dR [6n [c 8 kDN s [1;2B kDN3 s [1;3B kDN4 s [1;4B kDN5 s [1;5B kDN6 s [1;6B kDN7 s [1;7B kLFT3 s [1;3D kLFT4 s [1;4D kLFT5 s [1;5D kLFT6 s [1;6D kLFT7 s [1;7D kRIT3 s [1;3C kRIT4 s [1;4C kRIT5 s [1;5C kRIT6 s [1;6C kRIT7 s [1;7C kUP s [1;2A kUP3 s [1;3A kUP4 s [1;4A kUP5 s [1;5A kUP6 s [1;6A kUP7 s [1;7A kDC3 s [3;3~ kDC4 s [3;4~ kDC5 s [3;5~ kDC6 s [3;6~ kDC7 s [3;7~ kEND3 s [1;3F kEND4 s [1;4F kEND5 s [1;5F kEND6 s [1;6F kEND7 s [1;7F kHOM3 s [1;3H kHOM4 s [1;4H kHOM5 s [1;5H kHOM6 s [1;6H kHOM7 s [1;7H kIC3 s [2;3~ kIC4 s [2;4~ kIC5 s [2;5~ kIC6 s [2;6~ kIC7 s [2;7~ kNXT3 s [6;3~ kNXT4 s [6;4~ kNXT5 s [6;5~ kNXT6 s [6;6~ kNXT7 s [6;7~ kPRV3 s [5;3~ kPRV4 s [5;4~ kPRV5 s [5;5~ kPRV6 s [5;6~ kPRV7 s [5;7~ bs f AX f meml s l memu s m %s.cdb TERMINFO TERMCAP $TERMINFO $TERMCAP TERMINFO_DIRS HOME %s/.terminfo /usr/share/misc/terminfo ansi vt100 vt220 wsvt25 xterm %s: %s: unknown capability %s: %s: cap name is too long no seperator found: %s %s: %s: illegal ^ character %s: %s: non octal digit %s: %s: string is too long %s: %s: invalid string %s: %s: not a number %s: %s: number out of range 2 K n , X ` % K bw am bce ccc xhp xhpa cpix crxm xt xenl eo gn hc chts km daisy hs hls in lpix da db mir msgr nxon xsb npc ndscr nrrmc os mc5i xvpa sam eslok hz ul xon #
" "
"$ bitwin bitype bufsz btns cols spinh spinv it lh lw lines lm ma xmc colors maddr mjump pairs wnum mcs mls ncv nlab npins orc orl orhi orvi pb cps vt widcs wsl
acsc scesa cbt bel bicr binel birep cr cpi lpi chr cvr csr rmp csnm tbc mgc clear el1 el ed csin colornm hpa cmdch cwin cup cud1 home civis cub1 mrcup cnorm cuf1 ll cuu1 cvvis defbi defc dch1 dl1 devt dial dsl dclk dispc hd enacs endbi smacs smam blink bold smcup smdc dim swidm sdrfq ehhlm smir sitm elhlm slm elohlm smicm snlq snrmq smpch prot rev erhlm smsc invis sshm smso ssubm ssupm ethlm smul sum evhlm smxon ech rmacs rmam sgr0 rmcup rmdc rwidm rmir ritm rlm rmicm rmpch rmsc rshm rmso rsubm rsupm rmul rum rmxon pause hook flash ff fsl getm wingo hup is1 is2 is3 if iprog initc initp ich1 il1 ip ka1 ka3 kb2 kbs kbeg kcbt kc1 kc3 kcan ktbc kclr kclo kcmd kcpy kcrt kctab kdch1 kdl1 kcud1 krmir kend kent kel ked kext kf0 kf1 kf2 kf3 kf4 kf5 kf6 kf7 kf8 kf9 kf10 kf11 kf12 kf13 kf14 kf15 kf16 kf17 kf18 kf19 kf20 kf21 kf22 kf23 kf24 kf25 kf26 kf27 kf28 kf29 kf30 kf31 kf32 kf33 kf34 kf35 kf36 kf37 kf38 kf39 kf40 kf41 kf42 kf43 kf44 kf45 kf46 kf47 kf48 kf49 kf50 kf51 kf52 kf53 kf54 kf55 kf56 kf57 kf58 kf59 kf60 kf61 kf62 kf63 kfnd khlp khome kich1 kil1 kcub1 kll kmrk kmsg kmous kmov knxt knp kopn kopt kpp kprv kprt krdo kref krfr krpl krst kres kcuf1 ksav kBEG kCAN kCMD kCPY kCRT kDC kDL kslt kEND kEOL kEXT kind kFND kHLP kHOM kIC kLFT kMSG kMOV kNXT kOPT kPRV kPRT kri kRDO kRPL kRIT kRES kSAV kSPD khts kUND kspd kund kcuu1 rmkx smkx lf0 lf1 lf2 lf3 lf4 lf5 lf6 lf7 lf8 lf9 lf10 fln rmln smln rmm smm mhpa mcud1 mcub1 mcuf1 mvpa mcuu1 minfo nel porder oc op pad dch dl cud mcud ich indn il cub mcub cuf mcuf rin cuu mcuu pctrm pfkey pfloc pfxl pfx pln mc0 mc5p mc4 mc5 pulse qdial rmclk rep rfi reqmp rs1 rs2 rs3 rf rc vpa sc scesc ind ri scs s0ds s1ds s2ds s3ds sgr1 setab setaf sgr setb smgb smgbp sclk setcolor scp setf smgl smglp smglr slines slength smgr smgrp hts smgtb smgt smgtp wind sbim scsd rbim rcsd subcs supcs ht docr tsl tone u0 u1 u2 u3 u4 u5 u6 u7 u8 u9 uc hu wait xoffc xonc zerom < # E 1 j ` r8 ' g | S V X X } ! Q X >c G 4 * r X v U l jR 2 C l , Us h x 4 " sW ) h m k c K u = z > ;'
D h = * w H U Y s f 4 / ~ >: % # K 3 } * t -y da, 0 ? u Z v
D n d > c + +1 t D yA L A a
d N n 2 K ) kc e U i E 4 0 8 * J ! k ! " Q Y $ 9 J D ' oN , K
F W W x 6 e @ o F [ M A } b y r 6 Y K } .5 \q 6 q Z 5L 8 n A FY J
_ c dv 32 : ] x [ ' ~ | i
acos acosf asin asinf atan2 atan2f hypot hypotf cosh coshf exp expf y0 y0f y1 y1f yn ynf lgamma lgammaf log logf log10 log10f pow powf sinh sinhf sqrt sqrtf fmod fmodf remainder remainderf acosh acoshf atanh atanhf scalb scalbf j0 j0f j1 j1f jn jnf gamma gammaf log2 log2f acos: DOMAIN error
asin: DOMAIN error
atan2: DOMAIN error
y0: DOMAIN error
y1: DOMAIN error
yn: DOMAIN error
lgamma: SING error
log: SING error
log: DOMAIN error
log10: SING error
log10: DOMAIN error
pow(0,0): DOMAIN error
pow(0,neg): DOMAIN error
neg**non-integral: DOMAIN error
sqrt: DOMAIN error
fmod: DOMAIN error
remainder: DOMAIN error
acosh: DOMAIN error
atanh: DOMAIN error
atanh: SING error
: TLOSS error
gamma: SING error
log2: SING error
log2: DOMAIN error
0C 0` P s p 0
` @ X ; x 8 h ( H T + t 4
d $ D \ S | < l , L R # r 2 b " B Z C z : j *
J V @ 3 v 6 f & F ^ c ~ > n . N ` Q q 1
a ! A Y ; y 9 i ) I U + u 5
e % E ] S } = m -
M S # s 3 c # C [ C { ; k + K W @ 3 w 7 g ' G _ c ? o / O ` P s p 0
` @ X ; x 8 h ( H T + t 4
d $ D \ S | < l , L R # r 2 b " B Z C z : j *
J V @ 3 v 6 f & F ^ c ~ > n . N ` Q q 1
a ! A Y ; y 9 i ) I U + u 5
e % E ] S } = m -
M S # s 3 c # C [ C { ; k + K W @ 3 w 7 g ' G _ c ? o / O A @ ! @ a ` 1 0
@
incorrect header check unknown compression method invalid window size unknown header flags set header crc mismatch invalid block type invalid stored block lengths too many length or distance symbols invalid code lengths set invalid bit length repeat invalid literal/lengths set invalid distances set invalid literal/length code invalid distance code invalid distance too far back incorrect data check incorrect length check
# + 3 ; C S c s @ @
! 1 A a 0@` inflate 1.2.3 Copyright 1995-2005 Mark Adler P 8 8 8 deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly @ P (b \ h x (b 1.2.3 need dictionary stream end file error stream error data error insufficient memory buffer error incompatible version
( 0 8 @ P ` p
0 @ ` 0 @ ` L , l \ < | B " b R 2 r
J * j Z : z F & f V 6 v N . n ^ > ~ A ! a Q 1 q I ) i Y 9 y E % e U 5 u
M - m ] = } S S 3 3 s s K K + + k k [ [ ; ; { { G G ' ' g g W W 7 7 w w O O / / o o _ _ ? ? @ ` P 0 p H ( h X 8 x D $ d T 4 t C # c
0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z- A1b62S-+ldEw}ZVǖAOIъ OM~- QJ#SpxAaU.7 Y -6]]w ll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* , m8 6F߲]qTp0ek*1u 4yީ%8 S1bSWĔՖ k1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$ ,52F* sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL 8^#ܖ TZ1ObbSyOIV~P-{ b-R4 ٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ
?&~?$pi;FBzw[keZ~7 Sv8H 3?r$ 7jnԄYFܨ |OQ;օ
U d S
-
=G\ p& G w ) ` /a߫i5&LsZ<#0zMzFM8,9; :R:( q-v,.7/pXqY s3r %w+OQvrtEux܉~OK
}!b|ty Bxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HIN SKyuJcO NZLݘMFGN@E$DD2AsX@*IB CPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^
iϏ은BI#ƈdX ܁T̓cQ:
rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"_HS1 ^Z4 eg Wb27_k%8ם(ŊO}doJj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg;
i8P/ _Y=чe:ZO?(3wwXR
@hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?# 1jvʬ`p^ Y<L~i/{kHwâ
hs)aLoD~Pf7VM'(@ﰤ ہg9x+ n&;f?/X)T`D1 ߨM ߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$ !AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3
m:@/)IJNv"2x+ ٗ Kx.HҥfAj ^y9*O]#kM`~b_R 7zF h!1߈Vc0a"j6nS Nr )Υ{t*F8#vufz`rs"WG9^EMvc&DAdQy/4 Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫϩ7~8A]&nv|o Y
yKiw\¹9~$ 66nQ fq>,o,IӔ 渱{I
.H>C-Yn馑gQ z taf w0a, Qmpjc5dۈ2yܸ و L+~|- dj qHA}mԵQӅlVdkbze\Ocl=c
;n Li^`Agqr<KG
k5Blۻ֬@2lE\u
ϫ=Y&0Q :Qa!V#Ϻ(_ ٲ $/o|XhLa f-=vAq *q 3xɢ 4 j
m=-dlc\kkQ labe0b Nl{WeP|b -I|LeMaX:QΣ tԻ0JߥA=ؕפmCij4ngF`D-s3
L_
|Pq<'A Wh% of a^)ɘИ"רY=.
\;l tҚG9w&sc d;
mj>zjZ
'}D hibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K
+گ
L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮ d°c&ujm
6?rg WJz{+ 8Ҏվ
| !Bhݳ ڃn&[owGwZjpf; \ebiaklE
x
NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮SG0齽 ʺS0$6TW)#gfz.aJ]h*o+ 7 Z- 1A26b+-Sdl}wEVZOAي»IˬO ~M- JQS#xpaA.U7 Y -۩6˚w]]ll A?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z , 8mF6]pTqke0*1¶ u4%y<8syjHA}X* ݹ 1SbSW§ٖծ 1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8, $5 *F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8 #^T O1ZbbySIOP~V{-b -4R ^~GelHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb#
&??~p$iBF;[wzek~ZS 7H8v ?3$r j7nFY |OQ;
U dؓS
-
\G= &p G w ` )/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+ )`F(>
q-q ,v.Ț/7pqXs Yr3w% vQO+tru՛E~xKO}
|b!ytxB z{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKS NJuyOcN LZMݥFĚGE@ND$A2D@XsBI*C ThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z
&J8 좞V`a/6i\lU,zB\u H=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_
^ϋiBۉI#dX фTQc:r
Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފ Z^ھ4 ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[
;g /P8i_ Y=嗇e:ϏOZw3(?RXw@
Qh+HZ"0*WOIo@}m5N#+'*GA |HX=#?X1 vjʨ`^p YL'! $UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n
:m@I)/NJ2"v+x xKH.jAf^ O*9y]#Mk~`bю_ Rz7h Fм!10cV"ajحn6 S rN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA 4S&ֿ EbLil!>aDƋΪ~7A8n&]|vY oᡱ
Kyiw¡\~9$66 Qnf>q,o,ӹI 散
I{. C>HnY-Qg̰ t zfagnts\D 4E D prop_string_append_cstring /usr/src/common/lib/libprop/prop_string.c src != ((void *)0) _prop_object_externalize_append_char
_prop_object_internalize_find_tag h t ` | ` ؏ 8k \ J prop_object_retain prop_object_release prop_object_release_emergency prop_object_equals_with_error /usr/src/common/lib/libprop/prop_object.c ctx->poec_capacity != 0 ctx->poec_buf != ((void *)0) ctx->poec_len <= ctx->poec_capacity < > & plist version="1.0" plist !((*cp) == '\0') array ?xml !DOCTYPE plist