P
P u 걎 00 000b S 00
K KK ^ P Q P 000b S 00
K KK E P
5 p0
S # *p 3 ( \
0l lK008#80P E00h0 0 0 h Z
!8 888 P
P @ 08 Y 8 s0 000 0 + (Kh4@^ \]
-LLMX0 d0P(( 0T L 0娐<L$ H P0 @ H0KP 4 RK
8 p
Q8 8< P D `Pa ` W % W# 8<0 S D 0P c00c0 W 4H0 ` H \0 \0G! !B 01 T(7 W 4 KHKT `P0
~ 0
3S 80< R D bP00c0 < 0b S 00 S
40 0004 H0 40H T 0H0 J U
?`J 40
#R7 8 < Q D aP b ,000c X $ X" 8 < Q< D P 0 a0c0 X5 4 Hp ` H CH H 0 T1 J X 4 KHKT 0 `P
@ X08KDpK 0 P<0K0 pP
0p `P
@ a0 v 3 S R
P R
8D 000b S 0D0
@ K `P@ 0@? S P < ^H` P8 D`0 00f S D
@K `P@`
< C @ 0 S7
\@ L0 L0 T.J `P 0d
Ꮞ 0P
\0 < #\0 L0@ Q T L0 T L0 T JL0
XT0( 0d 嶎
8 S T ZP P ̌L 0 0d L0K @PL0\@
< q P0 S*
80@ D 000b S 0D0
@ K 3 `P@ a P
0 00 K 0 R ` < \ C P P0, K@ I `P0@
< @< 0 S
0 R V
T
< L 0 0X | W h j40 0004 H0 K 0 k X40 0004 H0 (Kh4]
-LtM`d0p p 0x 0 C R 0C S> p圛- y P>pl X l 娐00T0 0<0 d0Kt t PT \J
8 @@ @
#R7 8 < Q D P a a , a T $ T" <0 S) D0P c00c0 T" T0d 0d0 00 0DA AD! T(7 T T KdKT @P0
[ 0
3S 80< R D bP00c0 < 0b S 00 S
T0 000T d0 T0d T 0d0 Hp0 S ?@ T @@@
Q 8< P D `P a ` T pT KdK @P
i 0dp000 d0 00 0pDA AD! yHtT0 \
#R 8 < Q D P 0 a0c0 ,000c S 00 S
DT0 000T d0 T0d@ 0 d0 $: 0J sT0 2
#R 8 < Q D P 0 a0c0 ,000c S 00 S
T0 000T d0 T0d 0d0 h9 0 0 -
#R 8 < Q D P 0 a0c0 ,000c S 00 S
T0 000T d0 T d0 d T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
T0 000T d0 T d0 d T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
zT0 000T d0 T d0 d T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
JT0 000T d0 T d0 d # S RTh
$ S R04
3S 80< R D bP00c0 0,00c S 00 S
T0 000T d0 T0d@ 0d0 4 08 @ \
3S 80< R D bP00c0 0,00c S 00 S
T0 000T d0 T d0 d $- 0
3S 80< R D bP00c0 0,00c S 00 S
T0 000T d0 T d0 d $ S RTh
S R04
3S 80< R D bP00c0 0,00c S 00 S
pT0 000T d0 T0d@ 0d0 4 0H P \
3S 80< R D bP00c0 0,00c S 00 S
;T0 000T d0 T d0 d $- 0
3S 80< R D bP00c0 0,00c S 00 S
T0 000T d0 T d0 d 00C S T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
T0 000T d0 T0d@ 0d0 0 n : :#g W
#R 8 < Q D P 0 a0c0 h4ph\X4`^ \\4@^T4],000c S 00 S
T0 000T d0 T0d@ 0 Q d0 0 '0 0008 @ p
, H P p
, p ` K0XK ` 0\0K 0` 1O @P
T t \
X` 000b S 0`0
h K `K @Ph ! PP9 `+ P X ` 0 00a S `
hK `K| @P|h
\ ( ` ` `d L0KC @P tL0 \\`-
X` 000b S 0`0
h K `Kg @Ph U
P
X` 000bS ST ` `KT Z @P Y U
, K 0` 0` Kw @P<` U 1p 0l0K00 H Pl0\`t \
X` P 000b S 0`0
h K `K @Ph h 4 0 R
Pt = X `000j S 0`0
h K `K @PhK ) K %4 " 0 $K | 0 | 0D Q P t Q P Q P P @P 0U PsPX` Pp 000b S 0`0
h K `K @Ph P
0 0P KXK` K @PPp
\ J7 X@
Z t \X0%( 0y 03 LK< K
P UX08@X0 t\ + Y
V
Ć p Cx `嚖0 X( ( 0& 3 X` 000b S 0`0
h K `K\ @Ph 0@? S \ H@ 0 ӿ T L T0 000T d0 (K
x-` P 0L 0 \ @ T T 0+N x
-LM 0d @l0 p P ,x R 06 0 t0 | p `00`0娐x0 S (0L0 0<0 h0K& pT x PI
8 `` `
#R6 8 < Q D aP b , a V # V! 8 <0 S D0P c00c0 V| T0h 0h0 Fa aF 0 1
T(7 Ve T KhKT 3 `P0
Y 0
3S 80< R D bP00c0 < 0b S 00 S
T0 000T h0 T0h T 0h0 C0 S ?` T ```
Q 8< P D `P a ` V T KhK `P
Q 0h00 0h0 oFa aF 0 1
BxT0 Q
#R 8 < Q D P 0 a0c0 ,000c S 00 S
㙾T0 000T h0 T0h` | 0h0 R4 4 0T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
fT0 000T h0 T0h` 0h0 | 0 sT0 2
#R 8 < Q D P 0 a0c0 ,000c S 00 S
-T0 000T h0 T0h` 0h0 <: 0 0 .
#R 8 < Q D P 0 a0c0 ,000c S 00 S
T0 000T h0 T h0 h `) T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
ɽT0 000T h0 T h0 h ( T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
㘽T0 000T h0 T h0 h ' T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
gT0 000T h0 T h0 h ' # S Ri
S RT0 4
#R 8 < Q D P 0 a0c0 ,000c S 00 S
+T0 000T h0 T0h` 0h0 4 08 @ ]
#R 8 < Q D P 0 a0c0 ,000c S 00 S
T0 000T h0 T h0 h $. T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
ƼT0 000T h0 T h0 h $ S Ri
t S RT0 4
#R 8 < Q D P 0 a0c0 ,000c S 00 S
㋼T0 000T h0 T0h` 0h0 4 0H " P
#R 8 < Q D P 0 a0c0 ,000c S 00 S
VT0 000T h0 T h0 h $. T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
&T0 000T h0 T h0 h N
#R 8 < Q D P 0 a0c0 ,000c S 00 S
T0 000T h0 T0h` 0h0 X!0 Q @1 000 0 08 @ p
8'z H w P p
.'p 0XKdK 0\0K0 000 1岧 `P
q x0 S"
Xd 000b S 0d0
` K
`P` @ pP / h4X4`^ \\4T4@^]p X d 0 00a S d
`K X KdK `P` p 0 0d L0K ᤴ `P L0\0t0 x0 S-
Xd 000b S 0d0
` K X K dKǽ `P` W
P
Xd 000bS ST d X KdKT 㺾 `P X W
t, K 0 d K 0XK֭ `P< t W p
1 p 1 0l0K00 pPl0\0t0 x0 S
p Xd 娠0 00b S 0d0
` K X K dKt `P` } T2 0 RK Xd` 000f S 0d0
` K X KdK Z `P``c 0 #K (K4 } K xpD ( S R 000 0 S # S R @ Y ~ R
(K Q P x X p
ᐠ
ꀀp0Xd P0 000b S 0d0
` K X K dK `P` 3 P
0 0P KXKd K- `PP p
\ 命 p R`
Z 0 SX0%( 0w 03 LK< KR P YX08`X0 Q \ l W
x VW 0q0 R 0 S@
|0 S0|0
S |
Vp5 | x P 0r0 Q 0 S
<`K # S R8 $ S RH 5 t 1 pP 0p 9
t O H t p0 堐 t Q
Ề W p 0|Hp 0( (0 Sp 0& 2 Xd 000b S 0d0 0@? S Q\ H`p` K dKE `P`
M 0 ƹ V ( T0 000T h0 s(K
-LtM `p T` x t pd0P 0 0
`=h h 9| t Z(0L0 0<0
l0K7 Z @X I
8 pp p
#R6 8 < Q D`P `a a` , a W $ W" <0 S0D`P ``c00c` W X0l` 0l0 00 0Gq qG! T(7 WX KlKT E pP0
0
3S 80< R D bP00c0 < 0b S 00 S
X0 000X l0 X0l T 0l0 =t0 St X ```
Q 8< P D `P a ` V tX KlK pP
0lpt000 l0 00 0tFa aF! < Z5
0j sX0 2
#R 8 < Q D P 0 a0c0 ,000c S 00 S
㧸X0 000X l0 X0lp 0l0 9 0 0 = -
#R 8 < Q D P 0 a0c0 ,000c S 00 S
tX0 000X l0 X l0 l X0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
DX0 000X l0 X l0 l X0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
X0 000X l0 X l0 l X0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
X0 000X l0 X l0 l & # S RXh
S R04
3S 80< R D bP00c0 0,00c S 00 S
㨷X0 000X l0 X0l` 0l0 4 08 ? @ < \
3S 80< R D bP00c0 0,00c S 00 S
sX0 000X l0 X l0 l $- 0
3S 80< R D bP00c0 0,00c S 00 S
DX0 000X l0 X l0 l $ S RXh
S R04
3S 80< R D bP00c0 0,00c S 00 S
X0 000X l0 X0l` 0l0 4 0H P \
3S 80< R D bP00c0 0,00c S 00 S
ԶX0 000X l0 X l0 l $- 0
3S 80< R D bP00c0 0,00c S 00 S
㥶X0 000X l0 X l0 l Y `㦹?p X0| ``
#R9 8 < Q D P a a ,000c V & V$ < Q: D P 0 a0c0 V3 X0lp 0l0 00 0xFa aF ! \: V xX KlK 0G pP
S ZT X0
#R 8 < Q D P 0 a0c0 h4X4`^ \\4T4@^],000c S 00 S
X0 000X l0 X0l` 0l0 0 0 000 08 @ p
W! H P p
M! t\KhK0 0`0K0T0K0$1
1С pP
P ZqH
W \h 000b S 0h0
d K 0 pPd 9 ^ @PE
\h 000b S 0h0
d K pPd E0@? S P ` 嬸 `Hp \ h 0 00a S h
dK pPd
` 呸 ` p ` `L0Kd pPL0\`
< `\h 000b S 0h0
d K з pPd & T
P
\h 000bS ST h T ø pP
P T
, K 0` 0 ߧ pP<`
` D p `\h p 0P00b S 0h0
d K ጷ @Pd k D4 0 R
P| > \ h000j S 0h0
d K o @PdN K 4 0 $K 0 0D Q Pp | Q P Q P P @P 0U PsP\h p 0P 00b S 0h0
d K . @Pd
\ P
0 0P Kh KW @PPp
` 廷p p Y@
Z | \X0%( 0w 03 LK< K| P UX08@X0
`
` 嗷 `T0 S
W p@w @3 W W tp 0 B V @@ T
& ,0K `!`#t p 0 pP<0\`
W
V
{ x 0 `p Y0( ( 0&" Z`q : W ( X0 000X l0 0 ) VX0 000X l0 p (K
-LMp @d0倐 0` 0 <|0 >| d Y d $ H 0<0 l0K p@ `@ 堵| PT \I
8
#R6 8 < Q D@P @a a@ , a Z $ Z" <0 S0D@P @@c00c@ Z T0l@
0l0 00 ` 0J J
! T(7 ZT KlKT 孷 @P0
0
3S 80< R D bP00c0 < 0b S 00 S
ㅳT0 000T l0 T0l T 0l0 7 \ `ㄶ?@= T0
#R7 8 < Q D P a a ,000c Y $ Y" < Q{ D P 0 a0c0 Yt T0l@ 0l0 I I 0 1瀐
>7 Y[ ڀT KlK 0) @P
5 |T0 Y4
HK r 2
#R 8 < Q D P 0 a0c0 ,000c S 00 S
T0 000T l0 T0l 0l0 : 0 0 -
#R 8 < Q D P 0 a0c0 ,000c S 00 S
IJT0 000T l0 T l0 l T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
㔲T0 000T l0 T l0 l T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
dT0 000T l0 T l0 l T0
#R 8 < Q D P 0 a0c0 ,000c S 00 S
4T0 000T l0 T l0 l # S RTh
\ S R04
3S 80< R D bP00c0 0,00c S 00 S
T0 000T l0 T0l@ 0l0 4 08 @ \
3S 80< R D bP00c0 0,00c S 00 S
ıT0 000T l0 T l0 l $- 0
3S 80< R D bP00c0 0,00c S 00 S
㕱T0 000T l0 T l0 l $ S RTh
S R04
3S 80< R D bP00c0 0,00c S 00 S
ZT0 000T l0 T0l@ 0l0 4 0H P
3S 80< R D bP00c0 0,00c S 00 S
%T0 000T l0 T l0 l $- 0
3S 80< R D bP00c0 0,00c S 00 S
T0 000T l0 T l0 l K
#R 8 < Q D P 0 a0c0 ,000c S 00 S
ưT0 000T l0 T0l@ ! 0l0 0 \1 000 08 T @ p
M H J P p
C XKhK0 0\0K0`0K001 1儜 @P
U A `P | \?
Xh 000b S 0h0
d K @Pd
\ } ` `PPH
Xh 000b S 0h0 k
d K ò @Pd b
\ ^ P h4X4`^ \\4T4@^]
` X h 0 00a S h
dK 坲 @Pd P Pd L0KV @P? |L0 \\P-
Xh 000b S 0h0
d K hKz @Pd % V
P
Xh 000bS ST h hKT m @P Z V
, K 0P 0 ኢ @P Xd@ 000d S 0d0
` K
@P`@ + K '4 $ 0 'K$K 'K D Q P 00x0 0 S 0Pt0 'K Q P P @P 0U PsPtP PXd Pp 000b S 0d0
` K
Ὦ @P` @ P|
0 0P K
0 @PPp1 | @ P
U x QX0%( LK< K 0 P t RX08@X0 X. X d@000d S 0d0
` K
| @P`@
\ ) ˡ1P g6 P
01p91 \ 0 X 8 T0 000T h0 (Kh4T41u ]
0-LM@ P 唡 0 8 @ 08K0
-L M 0 @ R
dl
1808 1屍 0&8 @ 08K@^
-LM 0 Q 0 1 K @^ 0 R /0S* /
-L MD@K p`P f @$0K T: 0 ! 0 S e @ P ` Tp 00"1$K
-LM pP @4`K T"
0 0 S e @ K5
-L M ` P X@
ph Wp "/ X . P@g TppGr W
0 00
/ 00 X0RBD T
. @ RBD(K
-LM ` 2 0 S!0` @?Kp1 . 02 ,PK0b \2% \ !0 0" R
b b.K b@ T W.K K 7e K K/KKe K K/KGe K .K z/C.(K7p\
-L 06/ 0"S
4 p
- L P
p\
-,0L @ (0!ki 8P忸 05/}`x dP(0 4`崸 6/ ` 0 S Ox PU, p (0 8P垸 ;5/
- LP`Ḹ @ p `(0 00(p00$00,00<0(0 4ps 7/0L 0 00 0 J $Ki p\)])]q\1]nG]]
-(@` 0,`00(0 PL 4pI 8/(0 4A 9/(0 4`9 6/ ,0 `0,0(0 4- :/
00000 0,0 0 #0
00 0
0000 0`
0 f 0 f0`000
x-P BL @0 R- MM|M M 0"S* $ 0"S
(0 4P 5/(0 ` 8P ;5/ 03
0"S
# p x
- L ) p 3
x- L@`۷ PT L K @0 00 800 P Kxh x腺]$]
0-L @Ѭ PP 0
-L M `p K?0 P S& 0A T#
0 S
0 s
S $0 S 0 \00 $10 K @ ,0 (1(0 0$0 80 0400,0K$ $ @ T K ]NDP
0-L P@w 01 S
R
$ R $ 0 0 ? K0h &]
- 0D , L $0 0 0 00@DP Y T 1 0 11 (K1]>^#]s]
p-LAM 0 PQ @ ` `
8 ' G/K< 0 G/K Kp4]]
-L p@` V@
0 s
S 0 s
P0S PsP P P"
Q
w( P P
Q
n( P P
Q
e( P PP
Q
[( PP Y
9/ P U
@`F
-L@N 0 003/
-X0L
( ]
-L9 <1 S :(00 0 Q?0@
Q
T RC G )X00X0( `& 0,p & ` "တ0 10 !40 >P 0<0 0< Q 40 S400E
S 0 $ K0~?K0 ` ;^4]Q]
]?]]]]l]x]]]]]]]]]]#]X]a]L]s]]]]]]]iO^]]]]]] ]
]] ])]3]:]
-A pL M `P$1 S s
(1 S s Ά PY
QV
0 4 P0 4O Z X @! 0 S
] $# R
X
X-0 W
h PP
h 0 0 41 P 041p C 0P d C/ 00 00 ! 0B?040 @ T(K q\^Ea]]>^4]{]]r\ P
P / P
P /D / / /1 S ! ! 1! n 00 0 S
! R ! R
1 /
0-L P@ P
S , QA 0 SF 1 !0 0
-阐L P`p
@ @ 0 S
R R
0 A Q
P @00C@0 Z \
-䐟L M p` P
@0 @ S
\!
Q R
0
0@ 00@ @ pP U @ @ @
0 (K\
-LM@ ` 0
00080 80 0 00 = pP
P @0 X * Y
00K
P $Ki) ^x
0-LM PQ @H
, KL @, KM U
U K K"K P K07N /
-d0 @`L _$1PT `P
PpY Q x
0-L0L P01T p @ 0 P
9 0@^
-L @뼐 Pp` 0 U *T P
P 0t I PX U`Pp0 S
0 4 0 0$Kk͍x]
-PpL ` P @ 0 T *T P
ᴚ@Px
-818 A RL @` B H0 SA
k p P 0 W * p G0 0 Q *P P H` ႍ |p ` 0 V * C P
T P 0@ j `@ 1 x]
-LMPKH0 p` ` @0 D0KT0 0 @ 0 0 00 0 0
@t @3 P@ T $K
-LM `P p@|K ` 0KL0 0 00 0 000 00 K`8 8#4`# /
- @L
- @L p@- 0@ ?0?@ S
P"P?P T
? S P 0 0 P"'%W? ?P R
A `&g?` U
@$G?@ Rq P p0 P""%R? ?P R
A`&b?` U
@$B?@ RZ P p0 P"!%Q R
DA`&U
@$RI P p0 P R
A` V
@ T: P p0 P R
@` V
@ T+ P p0 P? ?P R
@`?` U
@?@ R P p0 "#,à R
<@$\
!R P p p p p8E ]
0-L P@ Q
P@
0 P0
- PL @p` V W P`
@ p
- 0L 0 P pEtE]00 P
(01 1D0 0 0S s / /E@^,0 P
$01 S
0S s / /E@^!:! P /0 0 S /<0. T4 S
Q
/ 0 /E 0 P / 刋E 0 P / E
- L g
- L ^ T
-0{ t 0:#6 H0 L D L Z
P
O U
0 @0
4 @0 \
@
0 04 tp Up 4 0< M4 S`
` ^ \
@ \Y p3 H03/S Y
< ! P P P `
0 P 0 q 0 P P4P <0 0@ 0<08 @0 R
Y440044 YH0D000H0D0 0 <40<42 @ \8pp0,< 0
10
14p Y
< L `
0D 8 ,<0, p Z 000084084
W2
LH 0D 1
N @D D P
< \
0H4&*$0P \
u U
< S3 (KE 9@< :3]>\]
-L4M @`X RT U P 2P0 S0R4 L X0 V *&:X :6 S 1 P PT P`
T z 0'u 0H0 P0 VZ * YU
P <
< 0
\0 \0 S
R$ R g H H - U , K
1P# U P D K0 P U 00 0R4
P R4 S N
Pj U-
L p L Y
D K0 D0G L4 S
0\ \N \pL R P 0R4PH T%84H 0b84P (KoHN >
-L@ M `0 4 P@p
_ @P
- @L1@00@
< 0@
- @L @00@
< @
-L$MP!ʠ @@0 0 %, !@0 R4 <
0 4"8 Y2
:
q
a W,
R)
S
%
^ P
P
< v< <0 S
T U
0 R 5 P
< b< <0 S P{ T Ub
0
@ @ < <0
@0 Nb@0 H40$ 8 P 0 Z
R" Q ! P 0 S
0 0< 48 0 p <
0 N P ,@@ 00< @0 &<
! (K9]]]
-(0L1 1 S 0 803/ @^
p-L MP @ :# `P
0 0 0< Kph
-L Ma 1!D0 P pj Q$ Rg P A刀 Tሁ
D @ T
HĔHP \ !
RC
QD U 8
4 WX1/ 0 !000 Q
1/1/04 0
1/ WH
W P PEP兀 U
h PU
T1 T
i 0L4081 q * M@4 SD$D$D4@$ HT 0 S0 Q $ P$ P$ B B R T0 Q| 0$ P$L 9P0 ! R !9, , K0h 0E 9>@^?
- @PL
0 00Kh
-0@L p {00 3/03/ ` @ P$ P @`
V@0 3/@ @ 0 0 _ 003/ 90X( \8 0 /9
-BLM`84 P l2`! R0 ʀ0 !H0 `1<2 82 4 0 00 !r f`X%ZQ`4 XU *(H0a V d(!
dĐ
Q` * 8 P8
* 8 P8 d
! i) R h(:
48 P8 8 l8h(帀0+;h(l8 X
$ `8P6`8P<03/,03/03/ L0 !P 00 `1D00 <0 8 0 00 !`(K9@^ȏ菃쏃E,B
x-l@L ` P` (Z %6 Q1 00 $P00 3/03/x E0@-HD T 0$@!ʠ Q P ! R
L" ! R
," R
!% 0H P$0! /
-D4DTL,M>0h(! 0>0>00d( X8}ut x1 q0p H4!* $01000P$024081 ` H ,1 ` `0`0`ʽ 1 01D `0 `0@@dTXַ 0 `H 0 ``0`0 㮽 0 H 0 ` `0`0` 塽 ^}<03/(K@^E9DB@lB]F]h]]]Y> ] DN?T ]BI]CN@@X9
-L$M4 ,( $1 P @ p ( QpG D ( Uᕘ(1 *0 0< @P
0 040K000 00 0 0U P
2 4`Ʉ V T * 8 P0 1J `8
(P(K :@<ؠ^0X)],0@]@ @-@! T
T @ 4 0; @9
-L@p Q$:
Q P x P P` V` P H pJ $EP $Kih9b]]
0-!LQ @v X 0T$ TD0E
->LMp~ PP@ p0 R
R 1! j 1! k ` ZY
0 Q$* X1 Z 00 Q! 4 14 F VJ00 R 8 4 P84 Z * Ȱ"% 0 Z QU 4 4 H XJ Q 4
4 J ZJ (K]9Y ]]\ 0
/Y
p-T0L M ` @P* 0@ S
ZKpYp@-h0
P
A 0 0 P U
@ \ :`E@ P P S R pY@-X0 : S
A R
@ \ : B Q 0 Y
x-AQ1 `**$LL ::*0 ; `j`傿0+/ R0 P$ +*+* **** * * * d 0* H U *0?00?x` k`Y9 !i(PNDGN
-0L p 0@`a 0>0>0P U
$: P @ f :#K6J 0?0?0000?Ĩ^Ȩ^%]
-ĀL M @z T& *$: :6 S1!r 0j&eP
T0 *L H R
00 @ 2/ 0 2/00 Jf A 003/(KE0H4 /E
- L P \
-(@` 0,`00(0 PL 4pw 8/(0 4o 9/ ,00,0(0 4`c 6/
00000 0,0 00300000
- LP`p @ pN 9 `(0 00(p00$00<,00<0(0 4p* 7/0L 0 00 0 g $Ki \)])]\1]nG]]
x-P BL @0 R- ԈNhNTNN 0"S* $ 0"S
(0 4P 5/(0 ` 8P ;5/ 03
0"S
- p x0@-(@,A T
T@
H @P U
U
C L
P PPP PP P
P \PÁ0 0 0 $@0 @ 0 @0. 0/ 0T^P^X^D^,^(^0^ ^@O
-LlM @P Yp,`
Y'
\ 2 1`02T $ $\(l0K 0 "(0 % PG H0[0D L K
(0HK? P G
5 !2 1h - K` (1 0 00#00 $ĠlK R$ | P x p , t , K P H0[
P0 0K 0 00
0HK? p 3(K@O8o
-L M00K 0 P 2K6 K40K P) 0@0 S C[3[@@cH$H`0p尠} 00 s[ x'x M Pp `Fh&h (K
-L M00K 0 P 2K6 K40K P" C[c[0@@fHܸ$Hxp00 P0`0 0
[ɸf@DH$H (K
-LM(0Kp 0 P *K. K,0K P B[b[(@@fHᦸ$HB(0 ( P00 "[@DH R2[0$H0 $K
-L M(0Kp 0 P *K. K,0Ki P b[2[``ch&h( 2[@ S2[ S *@0D0 P@ `Fh&h# K
0-LM @| Ktl KP U
U l K` l Kp l KH
l K\ l K` l KH l K|K KlK0 0 0 8#8 #K0
-LMPq @K 0 K ` r 0`
\@ L` 60s 3 P Y 0 D P
L `
x P `
` V Ix (K \
-0L @ S
S
4 S
`0 S 0q0 0q0
4 S
p 0 P 00 00 S\
-L$M00K` 0 @ 2K6 K40K P9 P 4
pW U
S[3[ PPc1 .X %Xp p߾ P U' @ 3[@ 8 #8' @0 P@00 J
* (K0
-L$M00K` 0 @ 2K6 K40K< P* u P %
S[3[ PPcX %Xp00D @0 붃[@0
0(0 y PD尀 pGx'x (K
p-L M$@P0 ` T Q
Q @ | @ T @p (K! ]]]
0-L(M 0 P0 0 0@80 0 , ( 08 K$0 ~ P
8 K 0品 K0pN
-Lʹ
P
ƹ((0* R R=]]]
-L4M Pᄐ 2 @ P x20t20p 0 \ 0 0P , ] @]0 ]ܙN /G- (M 1Q 0P3 Y 0PiX z᠋ 0
P $ C P S $ P ( P U S \ P
@P @P@ @ ̠D PP P P (
A 0 S(Ѝ0 /ᰏ
-DL 0 S
, Q
0 SP8 0 SP3 0 SP. ` p
00`
" P 00 0P K 00 \ ,0 3/\? L0MPl @. l P 0 QΌ
Q 4 N 0 T0 0 0 S0 Q00 R!
Q ` Q0 R ` L \ 0 S R R
- p U
` P0P 0 RPP 0 0 0#00#0 ]x]]] 0
- L`p0 S 0 0@ T 0 0
0 S @ U
0P 6/ P
0- P@L ㍈ P@ 0N
-鐀 @Lpp S( X ` P0p 0 0p 0 d0(0 ` 0 000 00 0x O<O8 OO
0- 0L @ SP p M 0P
0K0h 0 0
x- 1L R ! P U
$ LP P P@ Kxhn gM P ` * 0 0 0 P 4:l P`P \ 0 00 @ T
P$ xx ]W9]m]Nu]]
-@p 0 L P Q T
` ` 0 P0`O TP
H TS 1/ 0/L 1 ) 0)0 SC 1* 0*< 1* 0*5 1, 0,. 1, 0,' 1/ 0/ B 0 - 0- 1- 0- 1. 0. 1. 0.PP@A Yz 0 (@ Pz # 0# Sz *lPЪ
-L Mp1@ ` P
T8@# 070K0K 0p 80KCK 4@ @ T
0 S@ @8K 70[ S/@ 8 K04 @ 9@ U
,P K
p-L M P a @ U0 Q/ P K ! a, P
( Kb P# 0 S ) U Pi U e U U kPE U \ \ 4 Kp
-4a MLp @i1 p 0 P9 `Q U ʀ0 !0`q 0 0 00 !0 0 h `P 8 `P
@ 0 ^0jt P ) 7 K@^ȏ菃쏃P^L^
- L^ `]1M / sd0 /N
--L0 M00 $1` p @ P T1
!0 R+ 1 S
R% P
P P
P U
0SP P
0 p 00p0 @ T2
0 Q
Q) H0 0 `KT0 0 @0 0K 00K P" p0 S
d0 S
t R "!, 4 ` d p %$ P
p 00p0 @@@ T@ H@ 7 Zd P h RK P
.!0x t S
p pc W p
! 3
=
(K`pO
p-LDM 0 @P S 40 S 4 P Ky0 L0 00H0 0D0 H0, S
$1 0<0 080 H03 000 T0K 0 PK 0N `P - 0 S
P
0 S400@0 0'$'$(%(%)&&#&#)&H0T 2``0P0` 0# P T0`0 0Kp
-L M0 `3 PP[
0 0B S d0@ t M x@ jT @!@p T I3 P >
000D(@0 @(@ p p 046 T f `1 X
0 6 0 0 RpBppp6 W
bX06@` V(0 S 0000@0 6 (K\?]1\
-L M @p P 4 ` < K 㧶2 3K<0K r < K0ᶂKr K
x-L @ `| PD0@ \0 H0 0H05 ` < R@@ 8@ \ <@@ 0P $a KxhN
-LMK@ `pP 0 0d000 S
x KU@ K Kx0㔀 p % P
0 U KN
-0LM00 @ S
4 K4 K028 :K3 K0 K K0 P
KN
-P1LM00 @ S pi
10 ` K 4 0
\
\9
\ \4
\ 1 \
\-
K 5 \
U \G T
0
T0
T0 0 $! K0 ٵ"0K.K4 0 , K P"
0 U
0崀 0 00x K0 Ԁ 廵2 K:K40 K⌐ 0 x0 P
0 X` V(KN
-80L8M00 S
@0K P
K N
-P<1L8M00p SF
P0K @P@
0
3S 8 <0 S
0D P c00c0 < 0b 0 U 1 `P 4 ᮵P `
U
0 ࣵ0000 (00(00 PP KN
p-L M `PB @ wp P0 00 @0 0 P5 O^
-T0L @忛0 , `0 @0 l k q = PB0 , R, 3 0X $ h (0@pX( 0^#] 1]]]]]]]<]D]]
- L 復 p 3
x-H` @L P 00 0 @0D0L 0D0 PPDP Kxh8
x- PL @ U
H` 0 R0D00 0 00 Kxh x
0-L7 0 @
pP `0 S X K0h 0
-pL @`a䐟P V ʀ0 !0`10 0 00 !0 03/ P 0
0 !1`a 0 00 ! 0 $Kky@^ȏ菃쏃^
-L0 0 S Q
0 03/
-L M P @P Ce _ 0` P022$0 ` 0 T
$00 SP 0 00f?00
-0@L$0 3/L
p-L\MP @ `t KX 㝩 UP705KL0X tKXP ,0 P $0 T0
Kp2
-L\M @X l K z< lK$0 K
0-LXMP$ @ X l Kf 0 lK 05K0408P0 20$0 P 004[ 0K02
0-LXM$0 P@ " ,0 S
Q
S
0 R ,@ X l K30 T5K00 8 TP0 lK20 0$0 r T P,@K0
-$L @ 0 03/0 03/0 03/00
x- 0L @ 4P `
U
P
$ `P 09 0 4 P
P 04 80( 0 x
p-LM0 @ 03/ P 0X
99 0 P0 `03/ 6/ PP \ 0 03/ PP
8c 0
$0
$0
PP 0
PP
$0 c $0 0
0
4P U xc pc z 0 9 0M K
9 0 oF $0
0
E P
kc 0
P
`c P U4P0 S#
0
0 S P U 0 ( KB2 h2K2( K2K0 P $0 L0% 9 0 0Kpy]] ]]]]] ]O ]
- `LP9H $ *Lp @@ T
0 R0D00 e 03/ 0 S 0 @
R @ <@ H
-L$M 0 P`0 0 F/ 00 ٧@ T
@ { p w $ 0D 0p m
i e $
43I Q 0 $ b @0 T @0p @ S P 8
Se
! S P[ 0 b = @ 0P
S
0 b Se
" S ( 0 P0 0 S@ T 4sb
"1 1@ P1o 08
@0 @0@ Q
T P
) T P
O J P0 X @ p @ 0 T0 4
4 0 4 <0 8
Z Y <04 @
P@
P B !
0 H0a U (Ko
] ] ]P]x]\]]]&]@]Y]
- 0L @ PJ ` {3 % &0 ?_ t3 :_ 0 S x 5_ j3 " 2` ._ c3 L (_ < Kh$_ V
0 a , ` _ V|]]]]?]>^4]
x-\0 L P R 0%0'@ 0&04 ,b`(A `V @Px(!\
-LXMP Qp0k @;dh d`X t Kk505K20,0 0X` 8p 4P 0 3/ U 0 03/ V,00 tK@0 ,0 K
-销L\M p`Pd@ X | KB0 |K6K`` 4 P \ R V
4 ~@T< p 3 U R\ K '
-LXM Q p@0PP0tP `X t K x^t405KP20 tK,0 XP ST0 0 K@-\ 0` S ڀ @!`18 00 , 0 00 , !@^ȏ菃쏃0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
p-L M 0 K0 0 @p PP 0 P0 0% 0 #. R( 00 0
40 0 0 03/ ` < PP 0 I PP
` Kp]]
-L P= 0 @0 P
` 0@80 @0800 03/ ! P` p
X m` 000(0 V `0p`080 8 ]]
p-LM P @ 0` 0K P 0K [Kp
p-LM P @` K P 1 0 0KKp
-@L P Q0p `0 @
0 0 $ `P0 i
0 P1NP1 R0003/ `P
|_ P `P
(_ 000 1 P ]]
x- @ 0 L0P P
k0 {X`P 00 0 S
[0P PU : 0 dU< x x^^
0- 0L @0P0 S
>0 K0hL0
-LM 0K c [ K
-LM 0K c!# K
-LM 0K # K
-LM 0K #!# K
-L M P`@p @ T0d @ P @@D @ K
-L M P`@p@ T0d @ P @@D! @ K
0- 0 PL0@ 0 K0h
0- 0 PL0@ 0 K0h
-Lp0 0 P(0 S `1 =
@P
# 6
P ` M
/_ P 0 ` S 0 0 (03/ 000 `00 @00
x- PL @0(0 S
0 ` R000 Q 0 (03/0
Kxh
x
0-LG0 0 @(0 S
P |0 S ts K0h0
x- `L X@ P T
p0 3/ M@ P0 ,03/ Kxh``8 8#4`# /
-LM$ P 0 @0 0
p K␠K p p0* 0P @00 p0 5 PP 0xP R @@ 0% K?w P000 P4 %6 U 0 (> @ @ K P,]P
0-LM PP $
5 P
R ` Kw P
P0 R B @ @( 5 T $ = K0 ,]PP- /
-L `P` @pj5 _ P@
\@
T@
]t]+^E]
- 0PL M
S
00d dd @P
X Q P 4@ `X I @P
, Q @ K`]E]z]] / / /
-LM Q `0 , R(
S
S
S" dpK 3 X @5 T
@/ T
`) V ᠩ P K
-L M Q S @
p00 S
\
H Q P
0K c,, P [ P K :] ]
- QL M @
Q
$ L \
| R
0t P 0K cXX P
[ P ( R
0_ P K :] ]
-LM
0K P
[ K b]B]
-LM@K00 p 0` ` P0 ǘ0KT0 0 P 0 0 00 0 0MPu P3 PP U 0 0 S
S
00 P
$K
-LM@K00 p 0` ` P0 単0KT0 0 P 0 0 00 0 0SMPu P3 PP U 0 0 S
S 00 P
$K
- PLLM
: P 8 0 00hhh$ P8
X8iP PT @ HH@@ 44 (($4 0 0 `p!
0 (0 40K @@ @$@,p0` LT40,K 0,3 0 0! 0 @@ @$@(p,` < 5Tl3l#<0 0 '!0 00 @$@(p,` T3 0 0!4 K0 @@ @$@(p,` T2 0 0!2 04 K0 @@$@(p,` < S2"0 0 ! 4 K0 @ P$@(p,` S$2$"0 0 !0 04 K0 @$@(p,` S1!0 0 !0 04 K0 @$@(p,` S001< 0 0!( 0 @@ @$@,@0` S@1@!<0 0 ! 0 @ P$@(,@04` S0 0 0 !0
0( @$@,p0` 0zS X@ V P8
d 8ZO 8 (Kw]]] DP1]FPE]EP ]>]t]]GP]+^]HP]u]]
0-L@0PM P 0 0 T @@ @0 0b],
-@LM 0K p ` `P0 0K\0 0 ` 0 0 P0
0K`v `3 P` V 0 S $ P 0 (K,Զ
-AL Q? PPPPPPPPPPXPPPPPPPPPPPP PPPPPPPPPPPPPPPPPPPP S 0 0 S
# S! 0 0 S =d P
S
S
L0 0 S<0 0 S
40
80 R
0C S S
, Q
Q
Q P0 P /
B R , S 0 P / /,Զ Q
Q 40 P 0C S 0 P / /,A Q QPQPQPQPQPQPQPQPQPQP(0 P 0 P / /,,0( 0 S 0 P / / @,
0-ALP@ Q6 RPRP4SP4SP SP4SP4SP4SP4SP SP PPE
U% 0 0 S! 0 U P
Pd0
P 0 S080 0 S 0 00 P 0 0,
-H2LML 0 0 @ Pp!
0(0 40K @@ @$@,p0P `Q40,K 0,1 0 0! 0 @@ @$@(p,P 8 Q'.0 18|0 0! 0 @ @$@(p,P Q 0!4 K0 @@ @$@(p,P Q000 0 0!04 K 0 @0@$@(p,P Q'.0 0 0 0!4 K0 @ @$@(p,P Q'.0 P0 0 0! 0,0 @ @$@(0P 0Q(K>]t]NPV]+^O]0 /,
-|L t p@p h d \ X P L D @ 8 OP1],PPE]]4]+^] /
-L
@ | x p l d ` X T L H @ WP,]P(XP1]@YPE]YP ],[P^]d[Pw][P]
-@@L KhP
- PL M
: P@@ t0t t 0 00h @P
\ -K P Q
H@ Q @P
, K KWPl ]]]pP4] 0 ") / / 0 !Р! / 0 !
! /@-A 1 H0 0 00 S 0!1 <
x- 0P@ `L $ ( , $ 0 ( 4 , 8 0 < 4 @ 8 L< 0@0 p< 00 01X1 07 0x
-D1LMQ @ p H -KH `L K!@ HB mK 1 1 1iK 7801 x6 s e Ko/K!.Ks @ TL
600 0 0 p 0 0 0 L
-LMp ` n P 0 SA @ P 0 U T
p0 R
R 1 0 0" 1 0 0! dJ K@^i]
-L,M3@ 1PD0 d0 p S8
40 Q
Q0 SK
S P 0 S
Z 00 0000O8 " PL0 0L020#4@0 0D <0 8 :! P ` l8 B 0TH0 -H0 S @ P
0< R E t Pz 0 S 0 S
n 00 0@1娡0#4@0 0D <0 8 : P ` d8 0LH0 H0 S @ 0P
H0 [H0 R 0< R 0 S
V `
V
B B R0 8@" P V 0 Sh0 1l 040K ! P `
40 ( 00 0C 0 (K@^p^ hd
-LLM1P @0` Sl
0 S
Se 0 0Q! p ] R [ 0t!040K P
00 R
R
@ T K4ğ 0cKßK$K p ᄎ먄ᇛ 0tb @p D 80KԄK 0 @%K 0` X 嬕 pP`X 80 0 b R1
\ 1
8 X 0 S
Z ( H (K@^ hdt]
-LDM 2 `0p S
Sz z0 0 @ o p 0 Sl
R h 0!040K) P
00 R
R
` V k4 0c ?K%K$K DKT 0$K%K0b Z! Z ` 000 $K}8 0 80K 0 $K P& 80 0 b Z!
P 0P
8 X0 kX0 Y8 F 80 P 0 S
Z ]H (K@^ hd]
-LMp ` * P 0 SA @ P i 0 U T
0 S
S
'H K]
-`L p e P 0 SA @ P 7 0 U T
0 S 00 1 KhY Kh) @^ 0 Q r - /
-0L0 P
0-@L P0 S 00 0 S K0h 0 X03/- P
0 0
-pL` P 0 SA @ P 0 U T
B
@P @$0 @0
-LM@ `P0qK g 똀 P P 0 S/
S9 a V 1 110 S0 T \I 0 0 Q
0 40
00 S ~ y j
0 00 1弱 Pj
( AG 0 0C0 H 0 S 00[ X K0 S1 00 f X P $ (K@^@{h]]p
-LM0< 0 : : # "$ 0;F K ]0 0 0ڠD D0 0 #R
: :#6 Cp S / /Z
-0L S 0
- L 0 w]cPt
-L @P1 P F 1 P
"- ! 0 0 S
a U T 0 ^
0A 00 00 00A0 @ Z
,Kor1 00]pt
-@L ` PH"- 0! p W
0 V
0! U T 4 P
y0 pl t V 000 S
i00p $ b P 0 ppt
-L ` P @0? S T pp A T
R @ T
P
@0 T 0 0 * P @px00 /00 /
x-@L P\ `0 S
@ 0c 0000 Kxhp
-0L ` p A"- ! 00 S | E S 0 0
0 S 0 0 0P0@0 0D0 T 0 Kh0 pt ]
- L~ P
\
-(@` 0,`00(0 PL 4p 8/(0 4 9/` ,00,0(0 4 8/
00000 0,0 00300
0
000
(0 4` 6/00 000000@ 6600
- LP` @ p} F DG `(0 00(p00,00<0 0?>@ S0$0 0 $0;G $0 03/(0 4p 7/0T 0 *G 00 8 F c|( $KiG \)])]\\@]1]nG]]
x-P BL @0 R- T{PzPzPt{P 0"S* $ 0"S
(0 4PS 5/(0 ` 8PK ;5/ 03
7{ 0"S
{ p { { { x
x-L @{ 0 S
,0
(0 4P 5/ P
0 (0 8` ;6/ x踈
p-@LM P` *
OK ,P M0 2 ~?2 02 ]0 K 0 ! S 2
T 0 K D 0& 80 <0 @ ?5/Kp u (0P0002?0/ S0?0 S / 0 P /
x-l0 L 0 Q P
P P `P8@ 0E S P` P x 00x uP
-2L$MB<03/ S R
|2 ` R 0`R S R
HH":: !#&8C "ʠ ʠ !,&-C Pv
0 Ss
1 @ C t (KoC F PB @@ ? #K1@q 0`P80 0 UI *1煑@<0 < 0f 0& S! *$& R 4D@0 B @08 0 w! {80 0:00 #K = > U
5/00( X
PP P
0 R ᆁ P!U0 R0U S㾠E 10 0 3/40 << 4 ] - |^^^^^P^ Q
-LM `p 0P 0@ P
0@ Khh T
d00 S
X0 0 S
7 4/40 1L, = ( p K^\4]X
-LM 0 0 K
-0M L K
-LM 0 0% K
- @PL `P
0 Kh = ^
0- P L @P
0 S000 03/ 0 Q
0-TPLH@ T
0 R0L0 0 3/ & P
-0L `X0p SPP@
7/ P0 S
@ T 0 S % @T p ` T T P
-DL8QT00A S
4 9
QP0 S
3/PPp ` U
0 3/ P ` VP0X0P P
0 R0T0 % e6 |0 P 0
x T` 0 S
L p9 0 U
404 4 U $Ki9 ZP̶^1]4]^$0$ $ 08S0 )Q̶蘃P
0-@L PD [ T
0 T 0A T
( @ @ 0
-L K h
-L@< P
Kh4 /
-40L @ 0 S 40040 L0 S
3/ P
-40L @
0 S 40040 P0 S
3/ P
-T0L S
3/ T040LP 040 /
x- 0P @L0P0L 40`0400 S
5 @ @ H (( 0 S KxhI D\K
-L @V
P
X0 S
3/ X /
-PL @ p40`
0 S ژ! Q
0 00 tt {00C0 TX s @ 00(0 (1, 0f@ @^s a\u y
0-P @L i0 0C S00 I K0hr\ /\ /
-40L @ 0 S
0 S 40 040 `0 S
3/ P
-4 L @
0 S 40 040 d0 S
3/ P
-h0L S
3/ d0 0\` h00l0 /
-l0L @ S
3/ 0\0`0d0l0p /
-4 L @
0 S
40040 t0 S
3/ P
-40L @
0
0 S
40040 x0 S
3/ P x0 0pt |0 /
-|0L @ S
3/ 0p0t0x0|0
x- PD L` P @
D0 T *H01 S
3/@ x
-HP `D L 0 S
\
0A # @D p laDHp{ U
#
-H`DpL P @ T
!1 R0 G
R
@ R
@ T:
T
7D@H@Q Khd# 01
- pL `. ? p 00Ȁ0000"@ P!Bp p W
W @ @ T
P
00 R 0@ P
00 R 0@ T $Ki%P
0-0L @ 0 S
S
S) K0h P
P PP0 00 0 R 0 R PP0 0C0 0 S 0 R 0 0
x-L @` PP
n P
P x
- 0L @ S f0 0 Kh
0-PL h P @
6 L 8 = P 4 8 P ( 8 0 0@X^ǩ]]
-L @6 Khw
-L@0 v,0@ T B B Kh5P
p-L M `4 K P @
0 R
R0 PP 4 KI P4 K Ul (0
`49 0 S
Q P, I" KpPh^
p-L M P`4 K P @
U @P 4 K4 K Kp
-LM p< K P @ T#
W
`
W
`P 4`
040 0 S
0 3/ P U4`< K @< K^ $K
0-LM P, K J P @
c
| P
, K, KE K0
-LM `@ ! `, T , !
4 K# P @
0$0 SP
0 S
p P
0 $0 3/ [P4 K4 K KP
- 0 MLp 0 0 `c PP" P 0 @P
0 0 h p0R PP
D @0 x 0> K`PTPv]DPЎP^
-L M pP `P# ` 0X @P
t P
h S6 @ \\ L0 `P
0 00 <0 ? ] P KЎPDP^^TP`P^0 /
P -L
{ p 3 /p@- 0 S0%
R P`@ 6b @T5R < 0 p R Pb <Š @` V 0 0 p@ T B p
- QL M @` P P P P 0 " P140 0IP P!r P00
U V : T 0 0`g V
T0 0 ` TA 00 40 P P 1(K
-LMP @ RJ
R#b,r0 "b 0 R |
0 W `` 0G4 Z$ 0 s!
U W W 4 0 p
0Pe0 P SP U 4 i5 0 0 S :PEP (K^
- L b 0a < 0
M5 0 0 00 ^
-L$M 0 @ S0`P,r 0 R
Q | 00 R?
0 05 ( j #!4 G8 剑 \' S$ * f0 Z! r x 4 W
< 8 <
0 0 <Pj R0540
`00(K ^]^ 0 ba3 @- 0 S@C0
-L$M R @P`
Y 0H N R`G Y#r,8 )r0 R |
8 X pp 0 jဃ뗠# H 0 倡 < X%
@ @40 `l P00 8 0 \ S * 4 e \! r@ p4 00i 0 (K<
0@ ^^
-L ` p P Up2R1r1: D @0 ` P 6 0G
- @L * Kh%
0-LM @PP
0 S e p 0Pe PK0
0-LM @PP
0 S 0P PK0
-L M R`P00 @ p w W P@
U U= *%
P 0 S2
S T: (Ko00"Rp#0J!8 40 0 Y 00 T 0 S
0 s
T :P 40@e @ 40 @8 `
p(K
-L M @P
0 S 00` 0 K
-L M p `" @ P 0 V`!` y X
V * fX Ki+
0-L@P P T
P P 0 @ @0
- LDM `,0Kp @ P `# p ``A `$`(p,0 600 S
X A P ` `$`(p0( 0,04 0h6 (K^`^$P
-LM P@p弐张 0`00 0D S *0
S
"v0K 0 P 0 p v0K 0 P @p@0 0 0K 0x00 0(KP^1]P^\]
- L M 0pP S
H 0
S P0ࠟ @
Y *` V
W
0 Hx P0
T@
0 Q@ 0 T t 2 W @ 1x P
P@03/ (K8Q4P^P^P^\^
- 0L3/
-L03/
- L03/
-L03/
0-L @P 0P
$ P {0
-L 0 @3/ KhH 0 /
0-L P@ P
0
0-( @LP y l0 00D^
-L @ Kh_
0-0L @P 0 00 00 P 0P0 0K0h8
x-L @P` 0 S W0 S 00 0 R00 00C 0 Kxh
- @Lp 0 `0 0 V
P UP0 3/ 0 PP0 ` P 00C S 0 W 0D00 /^
0- 0L R@
R ʠ 1 P Q BP P
t Q
P 0 0 0 000C000C0 0 0 0^6^\
0-L(M@ S
0 0 ^ h01 1D0 \ <0K40 000 0 0 00< PD04K8 BK$ 0 P=K0\@^^
0-L(M S @
0 0 ^ h01 1D0 T n <0K40 000 0 40@ PD04K< 8 BK$ 0 =K0\@^^
- L p`@ V7
P3
P U 0 0C0 0 VP1 R
40
)0 S 0 0p P 0p`e0 000e000e0 0 \@^@-` V 0
@ P U T V * f@
p-L M@ K`P, P 0 5 @ HP Kp
p-L M@ K`P P 0 O @ 2P Kp P P
-LxM`K@ p ` w P
P o PU) 0`D0 0 00TP 0 000 00^, ` Y $K
x-QL P`P@
4P0 SP' 0"PV
u x
x-PP @L` (0 S0(0
R0 Kxh\
-@0LM 0 S00 K90 0 K ^d@B
-LMp @`P W P0
S 0 P0嘱( A$p^ S 0 < :/ 0 0X 0KH P
/ KR^|^
-@L Pp` 0 Kh
-LDMH0p `00̠0 @ P =0 ,0 0 `A `$`(0 0 3\000P0 `0Q0,0A `$`(0 02(K^hHP^4P
-L(MpP `b0 & @ `1 P> ⽰( ^ UL Y,K L p0P ,K pX 00KG P
T j/ , K H)00X2P0 S . KP^^
- L 0 ^d
- @LL *X H( Z^ t &.) & Kh$
-LM` @ P0 pP0 S
Pp W 4KL G4K 0 4 K ( Y
P3 0
d P
0UW#
Xr Upe0Xr5 :0X2 0P0L P$0K # X G P
H . X0s L X0
s 0P0L $K^
- LMP 0p` S
: 0@K 0 P K` u0 00 0 0T@ 00 00* K@Q,Pd
- `L P V@ 40pH0P j(0 0(@ \
-APL @
` WPp W 0(P\ @^
-, LM 0K #@ 8 y= %= K
-80LM 0K# <8 p= = K
-0 LM 0K# @ 8 ^= = K
-$ L # 0 @
-,@L 0 t KhC@
-t2L,M 0 @ S@ XrX 5P U
@-%@ 05040 408080<0<0@0@020 `0 $P Q *H \
' L @ Pࠁ P
$$ \ * c T0H0HLL$ @ S0 \@N 0C$ C#HH0`P T0 P0 U< *
UT P GL K6H C< K6$KK P4 D0K0c S40 P K 4 #K 0 Y X 4 \ Z 0
0rPP $`8 (@V 0 @H
(K^ @ ʚ;
-``L P @T F50 S
0$ B2#Hp ` D` Kh~ @
0-@0L P @4 (50 S
D Q
K0hh @
0-80L P @, 5@ T
@ V 0 @
0-T0L P @H 50 S
U , C 0 5t ; 0 @
-PL ` p @50 S
T p & 0$ R *00 H V
ࠁ$ ! Ht
@
x-x0L P @l `50 S
V L x0 U :0 x$ E! Hs x @
x-<0L @ `0 P50 S
b Kxh @
0-40L @ P( |50 S
, K0h @ / / / / / /, / Q
: Q 40 0P s /4 9 0P s /4 /4 ! 0P s /<0 / P8 /@ /
-0L q p 3 P0@-
0 @0 0 S P U0 0 0 Q 0D0 @0 0 S @ T0 0 000^^^^ p
-LM S PP40 `@0 00
xx<0 p$ <0 p S Q
0 <0 q P<0
0 0 S0 0 0 S0 0 0 QG 0 SC Q] V= > V[
0 S #3 # 0 S ! R
R , \
0 0 0 S \+ Ds S P
$! r< 03 0 Qa S @ P 1 S V2 0a 0 4 p< < S 0 S d"d2D P" 0 S ! R
R p W
0 0 0 S * h q S T P_
少! zr< 01 0q W@Q 4 ` 0 W P'
p$ 0 80 - P 40 I < Hr< P
<08 0 ;n P
0N- 0 0T 0p 00 00- @U@S @ N (Kp^^^Z^.^^^ZT^ ^
x-,@L P` xp 0 Q P
00 0 P 0 0 / /^^ 0 Q P
00 0 P 0 0 / /ᘎ^^80 40 0 S \
0 / /^^80 40 0 S \
0 / /ᘎ^^
- @L c T 0 0 T
0 01 S
0 0 0 t 0 \
R 0 S H S < A T @ @ p^^^^^^
- @PL X %T0 L0 0 R 0 \ @
@ _ p^^
- @PL X T0 L0 0 R 0 \ @
@ ? p^^
-L M pPPA
1 @ T" ` V0
00 4 m
H P004#
R @ T 0 B R |0 0 T ` d0 01 S
U
(P 00E @ (Kp^^^^
-L M pPPA
1 @ T" ` V0
00 4 l
G P004#
R @ T 0 B R |0 0 T ` d0 01 S
U
'P 00E @ (Kp^^^^
0-PL @P @0%T 0 U
0 01 S
0 0 0
z 0 0 \
Q 0 S p S d ! R
4 4J L@ P @ P V 0 p^^^^^^
0-PL @P 0%T 0 U
0 01 S
0 0 0
1 0 0 \
Q 0 S p S d ! R
4 4J L@ P @ P
0 p^^^^^^
-L M @PT p `4 V
0 0 0l,@ P`p 05l 0.l< 0:/(KtQ\`Q~^3^^^^^^^
-L
P
0 S
- @Lf
0 S
P &
X ^
-lP `L @pjH Q@
@
T
4/ @
- @LX
P
Y 0 0 f c Kh^
- @Ll <` Kh8X
X
X i
/ Q $ 0b0?o R 0c 0P0 0a0?o 0c Q 0T0 /
- `Lp` l @ 0 Pt0p0G \p
-pC T 0L ` 00 $ A
?sk Q P @VP0 T 0$@
-L[
K K0K a K K0KX0 S 0 S T o R 0 < p W 0q0 R 0 S3
X0 -
p @( :0 8 E7 *D ^4 Y
L Z
h i
H Y
: ^ ! *D@ P @
88 Q Y :e d+ R)
| 340 R3 Q4 0 \ 0
ٝ @P2
ĝ- #@ @ 4@00@ 0 @(K
-LM K
-LM 0 000 0 K
-LM 000 0 00 0 K
0-LM @P \ P 0H 0 0N @ T
G @ K0h,- ^G ^r ^
-pL P @ 0 `I X
C @P 9 @ 0 S
R : Q Z V R X
Z 0
X
V* T
@ VJ
* J R @ @0 ^ ^P#
Px-LP`
88 S L L L PL@ UL U
u R _ P
U
: U 0 1 0! S
R
R @D @x ^
Q -L Q
@ 0 0 K h, ^
-L$M` V P D Y 0 40 D^ Y0 40:pI Wܠ `@ P
Q *l@P U T
`p S R j *xx Q 0` 0` P P
00 <`0 0(K ^ ^]1] ^
p-LL M ˠ @ p P
]`@ \` P Kp?]?]
-LtM0 S T Q pp R @1 0 pI h K ra " !h W01h0#0 ` V2
Z2 : KBK @PKGKCKDK KKH Kd P ` X \ ` X h T p P @P
g x`@ @ N (K舚TQ
-L$M ` p0 P @@0K 0H0 T!
Z 0 S' V c]P P @ Ka Y 0 @ KH @0Kt 0@ K00KN] W * 0
@ KT 0P ` Ppix@ L0 L0 P (K茚TQ Q P / / P Q / /
-Lq @ "8("S 0 /
-@@L P($8"( R
` V
p@0 S 0m> : P
@@ 0$( R ((
- @ L P @ /
- L @Pp `
0 3/
0 3/ 0& B`!Q 000@^ 0 & ! Q / @^\0` P / !`80 00 , 0 00 , ! /@^ȏ菃쏃0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
x-QL @ U
`
1 S
S
0 0 03/ KxhxZ
-1L @ S
1 S
0 f 01Z$ 1 S / / 1 S /0 fZ
-L MA p P~ ` Y 0 3/+ Y
0 8 K<0 DP @@ W0 8 K80 D0K40 ~8 K ^ `& 1 Q
-0 1 3/@ 1 wq c(K@^GQ<0 Q1 B ! R / l $0K( `# R T D @ \ ( P
,*0 @ p$Kx@^KQ
-`@ ML @ @ 0 0 KLQw ^
-$0 @L P
0 0! 1 /@^
-,0L1 @ P 2 S
@^ Y 1 /
x-L P@` 4/ Kxh@^
0-H0LM @ 4 0K P P K0 KQT0 R
-LM T0, * 0K P K R
-LMp0@ `+ T P P U
@
Q
0 h 0 { P
Pp U
RT0 0 X
\
4 p( h 0 KHo]~ ^ ^
-LM T0, * 0K P K T0
-,@ML0 X0 0L0 K,0 0!0(00,0 000 $ 0e K 4^$RQ
-hB RLM p! P
00 0 CK U ` P @J! V0x
Yv h CK1 +T p Kl K K< KD
KH
KL K8 K0 K4 K
K
K K K K K CKKCK 1 R"
K4 K8 K0 K K KF K \
^ K K GKFKFKEKEKDKDK C K0Y
P ` (KdQ
0- @LP T
!0 5/ @0
^\0` P / !`80 00 , 0 00 , ! /@^ȏ菃쏃0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
x-L @` P 00p0 0 R
P4 4
P08 08 S
R4 4
R08 0 8 0 Kxh@^@p@- 0 M 00
@ P0 U :" 00 0 0 00 0 0 Ѝp 0 S
` U : 0 0 @ 0 0P P 0 0 S0 S
` U 00 0 PP 00 S
0- 0L P S@ 00
0 R : 00 0 0 0 0 @ 0 0 0 00 0
x- 0L @ SP x 0 Q ` R `
~ 0 ` x
x-1`D S0L @0C0<0P0cD0 0 S p0@ 0 0 S 0P P`800C800000 S000x
0- 0L @ SP
D 0 Q 0 00@- 0$M 00
Q @0 S
PP @ @ 0@ T
0 0
@ 0 S
P P @@ 0 @ T
0 0 0 00 0 0 00 0 0 $Ѝ0
-LM40 0 P弃00 3 U @P 0p` S 0 S 0 S:00 0 0b 00?o 0c R 0 0 0 S V` Wp F [ 0 40L0 0*+ 8,0lDH`dp p$`hTP4 [( a8 [@ 08 " Q # W : c <0 8 ^[8 B8 X[8<0 \ @p I┐ cG[p0 <
0 R0 S thQ l # @ T10 `*[ 000000000P0 t 0 x
i000 0 S p ` V
h hQ P ` `000 @@ 0 S = 0 S 0X00\00 @ 0X@@ S
(Ko)0 `00 @@(K^lQT1
^XdQ
-LM8 , P@uH㑅&0 ! T @P `p ` p 0P U @E0P @ 0|0 @ 0x0 @ @H l 0 \0 @ @H P ( 0$K蘢T_
^h
^Qr
^^|
^
^褃
^Х`d /
-tP @L p^ЂxH L0 R+ `0 S X l0 0l0Č `0d 3/ CH L0 R:0 S
P
0 0 00y 0 S P
` Vp #
Q
(!( "$ "" "! L ! `,, ` ` V ?,h R D BD H H ! R B R R 0 0 ! ("(!< R R R 0 0 0 S0000D 00,0 R * :t]
^
-tp @L PT 03/ `P
`0 S
d 3/ 0 3/ `P
p0@ PP P P V U
V
T0 03/ q m0$(p S 00P0P0 0 011` p0@ 0 00018 #h00 S0 0Ð0D <0 Wpg D p `
0" 0 S00 SP 0S: R ` ` `80 0 S800000h^
-L @D ,0 R * h P
-`L@Q1 S 1 S0
1
p 1 01>< 0 @ 0$0 0 0 `00Х@
-L,Mtp 0 P H0 `p0
DK4` @P @ T
04 R T @ 0 @@@ DK4@ @ T h p0
0 `c `X21 0 0 S 0`0 `010C1000D00D0H00CH00 Sl0@
0l0x 41 S% 00 0080 S 4 S H K. 0 S 0 0 S0@0@00 0 S000 < B S 0 S 0 0 S0@0@0@ HK K t @ T
0 S
@
^h^
x-L P` @ T
0 S T003/p0@ 9x
p-L M @$P0 S
@₊ 0 R 0 0x+ R x+GT X \0 RT \00\0X T 8 T 00C S0 T p t`* PK 00% Q
x ( Kp蘢dQ@T
0- @1LP3/ K0h
-L `@ T
p P0 UP *1 0@> S
-t`L @ p001100 <@ 1
M 01 0 p R 坿`tP U
h hLL P Px0P0 @0x0 0 S H ӿ!3 @ K0P00 @00QVI @^^dQ
-L$M p`d P @P
0 00 0 0 00000000m K褃
0-L Pd K`0t@ T
<1H 0<1县 5, =<1( 0C<1@ K0h~꘢dQk
-0L @ 0 S ژ0 0 S 0tU P 0p`000410181 V Q N $KiIxxUQ
-LM`0 ` S
d 3/ P
t ᆿ P & 0$pK0'0@P Q
8 00 R |0 b R :<0D c,0 R : (0 S
(K $Kh^dQ
x-L P 嵾`0 @ x; S@ R@
0 T 8 Q
x;P0L 0P0 `0 `P0, 0CP0C ۾ U @ x蘢@dQ
-L
- @L z<1 S
@ 0 R 0tPx00 p` 屾 4 a 0 0 뀀Q U
Q
0 0 Q
0 0 = U
8 d` V ; $Kk#꘢dQ@Х
-L @ KhL褃`d /
-LM p`@똀 P0p00 S
0C0 0 T(0 0 0 0 0 R0 `( K0Z P( K@^
-L pP널 `0p00 R * P 0 $Kk@ Q05@5: Z P@^
-0`L 0 @P S0
V 0 ` VP p
V
R P W
h0 V
T
T
T
W
(0 0 S T
0 03/Ȧ^Q
- L \ 0 ̦Q00 S / wQ̦00 S / 廽Q̦
-L< 00 0 K hȦ\
x-H` PL Ol@@
1 @ T
1@ 厽 x@{
- @PL
0 7 Kh@{
-L0 @ Ȧ
-0Q PsLPTMhP R PPtP U PtP@P `P Pd H lP XP PP P% P
XPPXP hP U
Z
HP0u`P 03 Z03 S dH 'PPpPPP @ P
0 PLP \ `
PPP c X
$ 0 Xi
* XF
X@
# X `P0- XE
. XE
+ X D Xw
9 X P\P P U X
X X
O X ` o X
i Xe
d Xb
h X @`l XE
n X{
j X `t XF
q XA
s X
v x X
z X=
u Xp Y 0 @ T\@ @ @d\@ @`PP 0* X P0 @όL 0H Q ,ӔόL P0 k\PP00H⒅%\P 0H QP0 PP 0l SPPP ` `ll 0p,K@ L@ 0l @2 `
p
@@p@ p
@ @@ HDH_ T @t P0- p 0X@ @4
X@_ 0 + @ 0X@@$ 0XP P
@@p@ 0 <p @
,p 0 p @0
@ P @ Pq p P @`l 0 xg p6L@ \ T x & Px @
LP @l UP x F @L x `【
@@p0@@ ,p P @9 p @@p@ p @
@ P0) @ P0$ U U lP
p
@@p@ p @ @ @ P0
`0 0 L RkƣL Q RH
S
S5
DK0 D K T !. P@0 0C 0
0 Q000B+ T U TA
0x GT00 Cx
0T G @P0@@A D0K l00%0B$2>@P0 D@K-0K0lL@L0 X
,KlpPLP @LP UP YTP PTP T00T0 XPT0\ SPPXP SP U0c p0 p0 S h Q
Z
H `0r 03 Z03 S dH x xp00C Y
h Q
Z 6 H `0r 03 Z03 S , , dH x %
h R
Z
H0q` 03 Z ! 3 R
0 0 dH x dH x ` Z03 S
U \0T0Pa U h R
Z
H` 0q 03 Z03 S 0 dH x xPELP@e0P T h Q
Z
H `0r 03 Z03 S P 0 dH x x@DLP@P T
h Q
Z
H `0r 03 Z03 S0T0J TdH @ _
\PT0@c P TYh Q
Z
H `0r 03 Z03 S P dH j@Dt@,0 THP 03/X (K\R^\ Q
-0-LMP@ 0 @ @ 00 R @ 0@ K0
- -T0LM1 1l
10 R
0 K @^
- -T0LM1 1l
10 R
0 K @^
- -LM0 0 0 0 K
- -LM<0 0 00 ; K
- -LM+0 0 00 {* K
- -LM0 0 00 j0 0 S K Ȧ
0-LMP @ 0 P T 0 0 S K0hiK0Ȧ
- -L M00 K Ho]
p-LM` K @`,P 0 0) T U
U 00F 0ćKp
-L `\1 0 S
PA1 S
I@ ) T P
o1"!"40040 Q0 S 0 p WAp {pؠ00 0 S
0 0 Q 0 j 0刐 S @ ` 0 | \ @ n` U 0 S
<0< 0 Q0 1 3*^@^ئȦQY^a0 ^4]]
- -LM
- - LM0 0 j K
-L M @< 0, K8 -@K R
> KA]
-L @' Kh*
-0-LM @P @ 0 @ @ h00 R @ 0 @ ^
yK0 0Q
^^
p-LM `@P 0 P >00 R 0 004OKp
-0-LM @P P @ 0 S
㦂 P
@P v0 0 0 0+K0
0- -LM0 0 00 K Ho]
p-l0L M 0 @P`
T
@8 0 ` 0KphKp̶Ho]
- -LM K
- -L M00 K
- -L M K
-0LM 0 P`@@pR U
PL 0 0 p K$0 0 S Kh K̶Ho]Ȧ
- -LM K
- -L M00 9 K
- -L M K
p-p0L M 0 @P8S` T
@8 0H ` 0OKphKp̶Ho]
- -LM K
- -L M00 K
- -L M K
-0L M 0 Pp@
@@l0 U `
PL 0 0 0 S Ki K̶ȦHo]
- -LM K
- -L M00 K
- -L M K
-0LM 0 P`p@
@@g U
PL 0 0 p `$0 0 S Kh K̶Ho]Ȧ
- -LM K
- -L M00 N K
- -L M K
- pL@W a WP ᘶ ~ 1 T P 0 00@ K
-LM T0, A*( 0K P K Q
-LMT0 *0K P K
-LM p @ P `4@ 倮0` 0K 4 R D0A T
0 S@!00c100C00 S 0 `00 V
0 S yh n 00040 S 0 ,0K`# 000 ` V
0 S `h U 0000040 S 0 ,0K`# 000 `T0 S,
0 S) 0 Y% h 8 440,K08 S@( (40 4` S 0 10i1v HT0`
3/ v ;4 Q
0 S 0 @(K @-(A R @ !< 1 @?T0 ( Q T0
-LM K
-sL4M80 00 @` S@ P1 x {l w\3KX*P3 A p<#@s P R @ 0C(p 3 *#K ?# a0 X00 T 1 @P
u @0 p L0CXp\p4 0E0 M @0K P0 0$ T00pq`00q Z!(0;2 ,11017 Sp41 1P `:E%pq Z0 1Jͅ 1 0 ``0 0K `0h000ϙ `P
} ZL0 S
塥 r `LP,`P H0 S
Ꮵ 0 (0?0t0 0 儥 傥 # K^^@^XQ
-T2LDM1H` Q@2 p 0 Rn @ lKS P L0? S{ P0 Sx d0 Ss
`0 Sp W X P
P
P f p pL@ T
$0 S
H RL0 8S 5 V
$0L@80 P 0l K@
1 僝|0 V
0c 0
t R
@ h = @ W
6 @ @ m (K@^@{
-0ML 0< K
-LM P p m P
@@
@f
1 X0 0(0K0h00@0g P
X ) (0<1 0 ( ( 0 $ x Q
t R
d R 0(0( ( B ڍ $K
-LM Q` p1 @ T PP 0 P
(Ⱇ PP 0K PP K K
-LN <1 0 /1 0 /
- AL ` 儛 $ PP ɛ N U 0 S
$0
R 庛 \ pP$ c pP
p P
$0$ ( R
p 嘛
0- APL C PP 创 0
b 偛 0
0- Q@L , ̌ @P q 0$0 $$ ( R
@ @ o @ Z 0
p-L M a @P K 0㙑 @ G T Q
K G @ Kp
-L0MP p A? U` # 0 L K(0<0 x0@P 40 ] 0``0 0 Ӛ њ q PP
U
LKR P
K@{
x- Q @L `嵚<1 S@
T
<1 S$A(0 S
4ae 00041541(0 S z $ Gc ` ݚ ` x
-0 L1 ` A$!40 Pp { Q
! R S 04 SP
RP x 0Kd% !40 4 f g Kp
0-LM @( K P (P $ K I% O }g$ K QK0
0-LM @ $K- P ( K$P P 0 S
($ K &%( 0 00 0& Tg Q
$ K & K0
Q -L Y00 P
P0-L
@P tP@ Ⳗ @P U
L 0D@ 0 S
[( 囖$0 e 0 0\ ̓@
-LDM P
Z @ 2 2
0 B2
@ N
<,@K$2r"0` 0 P!
0 $(,`0P <42 0 0! $(,`0P
00 Pf
'>1 0 0!
0 $(`,P '>1
0 0!0 0
0$(`,P '>T1
0 0!0 0
0$(`,P y'> 1
0 0! 0 0
0$(`,P f'>0 0 0!
0 $(`,P S
@P
@ \ \ Z @ (K^^ ^̓
^^R^^^^\1]R Q 0
x-L @ P!` P
0 R00 `VP P
0 T ] ] ⊕ z Kxh
-L (P` h $c U
Z
X@ 坒
\K C
0 @@(KR@{
- ML $ K
-L M @ P
$K 㭋 P $ K K / / Q 0C S p / /
0-L P@ S0 S
ᚒ0
-!LLM `,pK0`' @ P 0 (0 0 ``A `$`,0 8 00 S$
'.0 0 00 `A0t0$`( 0,08 00P0 `0D0A0 `$`(,8 0u(K^^*R ̓(])R
-LMP`}
p 0 @ 0 \ *0 1 S
4 K0 4K+.X " Up
W 1 P pB K ̓ ^@x#^
-LMK@ p ` ` Q0KT0 0 ` 0 0 0 000 0 0`v `3 P` V @- 0 S@) @ T@# ` 凑 T *0! R 0 S: T Ƒ @
( P 躑 @ $K ̓@x40 P 0@ 1 S
/ / ̓
- @L N t01@ T `P
` 匑' 0夀D$ 圠 R$`0 q 00 0} /p0 P 0 U
R0Q o0 !0$ Q00C0f / @x@^ ̓@{@z
-@0@@L P 3 U Ġ^ ̓T(R1]
- 0ML 00` V pP - @ 0 R'
P ސ R | # P
W0pQ @ Kp @P
i K ̓@x
- 0 ML@ 00 0V P KhO K
-L M P 0 00 00 0V @Pu 卐 0$` R8@ 8 8 pp R ̐@d 0 S U P
p彐
@U 0 u00 F
uP U
$ V S 婐@A W ` V
R
P
80 P
厐 匐$ ꊐaP P U
08 S "|00 S V =Q p4 n Q
0 K p @ @ (K@^@x@{@z@
-LM @ 0 00 p`
0 V PP} t T
t
T PP
m Pk t 11@ T t
1!D01 x( 1 RP
R
A xPxP xxP<
uxP, ŏ ș pP . 式 `P
P# X
<1 X
$Q U L0 @00 ᴁ Z
Q
0 K P P P Y
0 劏00AD01 ͏ (K@x@^ ̓@{ ď
0-L P@ q0 S
ḏ0
p-L MP @` KV ᧿ PP 0 0
㍿ Kp
0- QLP@
Q
Q 00R P
0R P
h0 T
@D T t0 P 0 0 0
-L M p r w x P0 4 o
0 Sk 0@ Sh U
A PP W \ Q`0
L Q L11 Q @ T@
00 S
<10 R7 s40 Sh0| 03
d) R` h Rt`
R`
t` S`F8 S8`
0T P8
G
t0h S
0 03/ ;$A Y
(K@{@^
-L M @ Kڇ P 0KmK
-L MpPB @P
R 0 00 !T `P
1 Ύ t`h 1 Î0H S`F W U ` K
-L M@ K 0K P K 㱈 P Q
K 㩈K
-LM@ 0 , K (0 Pu QB, 忾 pPh
$0 SW 40 T p 0 S
a 0 3 PP v`F & p`0
k; Q 0 00 'T `P@
Z+ X
<1 X
$A T (0 S P
(K/, P
),0 0 o` 2 V` ` `L +, P
(K( P
, (K ,p K@^@x@{
-LM@ p K U `P( m PP`
``
!0S P
1` 0 Q
% 1 ` ͽ K
-L
-t1t!DML @0p 0 `
!,PK( 0 @@ @$@,p0`@%<1 (0 0! @0@ @$@,p0` 00帀 S#
0 0 0! 0 @@ @$@(p,` p0? 0 0! @@ @$@(p,` 0, ( R (K)^
0̓/^5^=^4RE]
-H0L `AT1 P HA T
p `@ KhY@^
-'.8ML0 P0 0 0!<0 00(00,0 000$ 0` K E^
-LLMh $dH PT pPA Q\
<K p h0H S H \qp@ 0 TXX1`p d X `0HaLaD1h 0 Pl0 HpPc ` d d H0L` P P0 D D T EP0 PE P pP h o X i y W 1 D0T R p '] P p
22P! p @BBA
ZPK
Ͻ PPb
X
0PQ W
߄ 0PD 0 V0
Є 0P5 0 z0 0 00000 p 3 X R 0
0 Ʌ 0 s 3 W R
ᾅ 0 s 3 V R
ᲅ 0 K U
0 n0 (K@^
p-L4M @` P
<K } P K
0-LM A P. i K P 1
ֈ i K P U K0
- AL$M> PpP`H ,0K # U A@0 嶈 VH < 0 S
S
R `083 l0 O 3 Q ܆ 0 S2 l0 0 R< K S,0K ` V
<K g P
Q
, K vKp
x- QL ` @m 0 4 8 @0 K 6 PP 7 0 $
0( 0,00 R 0 $0(0,0c Q D B0c0a S
Pe
00 0 S
S @ ` @` ` @0 S
S.
9 V
050504,d d0 S d 0& TE
` <0 &l I $<0 0 0P0 P099P0 T&
`0 04 T
0 0 S 0 S
P 40P 4P 0 S
00 0 V04 04 VE 'E P
0 0 V
<$ T
0 S 0 <0 8 <0 8 ! ? P
K H V T 0 0000 Q
""k! `0 j! ""h! 0 i!: 0=0T0t1T P 7- 妄 0ܒ1 1 11141 100$1010; 0r,!?` 0 m 0 p:
X2 0 S0;0:
82 0 S080: ; : S;81 1 V
` ȹ P1 T
p P1 + P ! Q881 0x!10 0(10110 141 0?0=D $1 R 0 a Q0!x1 0; 0; 0 @
* 0 4
8 <000 0 Z
ܘ
t0 v @ <@ ڭ 0 ܭ (K ^^уVU0SU4S
-LMp @P 0 ` 0 KX2 x0 !p S\ hr ` d" p * p Z
$4 0, K S0 0x1 4 K
0 P x %.K/ P#
c 凭/@@ P@ 剭 W@
P
p P P o+ 0+) 0) $ϱ
X W
J X d t `벚p $(, R
R 0 0 @PY0: \B`R
edBhR0e R 1 RD D01 00CT00P0x1=
S:0:x1`0` S00 0[0201 0
S Q 00 x1
P1 0 S:0:
0
01 0 S:0:XB @( P@ Ѭ+ 0+) 0) Ь X$ h*0 P
1 S000 S000 0?00 O 奬! 0 姬 (KUу уWVU\PR^
--LIMH0[dO0H0K 0 0 倬. 0. 僬 K 80 o 0#2 S
S,
g 0 R% * 0KE P
0 Q% *DK Y
04#$48#8l0 | 0 R%
* 0K P
0 Q: Y
04
8 <
$( $(,r
$( $ ( ! $"(#,r
S
04 8 , 04 8 , 04 8 ,
0 S
(00l0 0 4 8 #
( 0 #211 S 00 \0 S
岫 0 崫 l \ ?
0 R !0K P
0 Q; Y 劫 0 匫 L \
0 S : R
0@ 0 0 A 1 1 K (
`K , \
\
8 0l K 4 0 0
@0$0 4 8 < P W Hp[p J 1j 0 3 0 $ | ] P P; H@[@7 K P (\K& K ,YK 0 lK$K0K PP H0[ I j 0 0 K$0/ P P U \ H0[ H Ԫ 0 ֪481 S
0 S
0 @K4 8 \ 0 4 8 P K 0 4 @$#4"$8("( i 0 p@ l K $00H PPg H0[
H0[ f DW ~ 0 倪61 SD
ǟ 4 nj 0 4 o0 $0 PP
< 0 S* \
. K↼ K 4 K. }$ K. y 0 4 $#4K "$(8"( K#8b \
p0 R
: (ps U
(p l H0[ 0 0 0 P
\ 0 00 0 S
f 0@`@4
P8 <`c Vk
0#0##<00 `F4 S0C0Ʌ#4PŃ0Ʌ"Pœ ɕ ɕ V0 S ddP ũF 0 ? ©`0 S
0 $0(0,@0 R s 姩J 0 ? 天 0 @f$(, " "", $ R`f`&d` P 0 T
(c wV 0 y} `<d h l@ `b V6 r _R 0 a V ]
04 8 <@ 0b SU <0 S/ 0 $0(0,@0 R% 8 0 @f 9 S{ P0
0 $0(0,@0 R
0 483 T S O l K"6 K T1Td j PC
0 4 8 <@ @ 04
8 <000 0 , `(
` 0 4
8 <000 0 ` 0 @4 8 <@ @0 @0@ 0 ~ ;
! 0
0! a$ H l `/ P DH R ! TD!@!
T
@
04
8 <! b R9 4!0b S5
Tv
= r $ \o
T$
0 4
8 < !0 c R ! 1 c R 1@
P= 0 S
0P 80 W 0 Y 0 [4 8 <,10$101000 0 ;81 = \
` 嶰 P> U
p P > ;(.
! Q ! R8!8Q T0;"
\N ! 0! ' X 0 `0` Sk1h1j1i1 0K
L1 S
. ca 0@4 8 <0#$0 #(#< 0 1 T @c d @_ w 1 `0 ٤R 0 ? ֤ 04 8 <0C1 04 8 <(1}
$
( ,a Qa 4 a R] S0
. l1 S+
0c S' L= p1c@= Ql! \M 唤F 0 ? 0 勤 0 4 8
04 8 < c \ $ P
0#0##<00 L4 S0C0Ʌ#4`ƃ0Ʌ"`Ɠ ɕ ɕ@ \ D 0,\`00 EF 0 ? B "
0 $0(0,$1 R + 0! 4 $J?@@ P@4>@ @_@0! 4 4 0 4 4 8 - 4 1 0 1 04 8 <0#0##<000l0 0 4 S0l0#40 ` 1
; S 0 S
\J ӣV 0 գ~ 0P$!T0X0\ 10Pc0P U I 幣R 0 廣0 U0 b 0 ? 嬣 ?
;
S< 04 8 <$!0b S1 m 0 4 8 40 8 00 4
8 4 0 8
00 4 #$40#4 004#$40#40 1 S 0 $0(0,$1 R 0LH00 N 0 H0 ? J e du 0 `PeP 0 S
04 8 [ R1 1` 0 $0(0,$1 R. 0 S+ ; S(
$!00$1
P@ P 嬟. 0./ ?/ 媟 g1
u q d q 0K 0 P00 000$10$1(K
- L0
0' S (w P
H@ f 0 h 0! у `8 8#4`# / 0 R S
4 /H P / / /\0` P / !`80 00 , 0 00 , ! /@^ȏ菃쏃0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
0-TQX1L @ EQ PQ
d \1+ UP1P01 S
0 x Sx04 8 /+; R0Ҳ;0^\^
-LM` V(` 4 0 S(400 ` ` `` \l
\
V 0 S
lАO \
\
p @b (p b Q ` V5 c Qb Q * 0 p g R00$ Q 0 l R ` 0l S0g S 0` P`
0 b Q000 l R ` 0b S 0 `P
10g S q(KUU
0- 0@L4
P8 < d R@ Q
00d S 00d S 0 @0d S @00
-L @ Q
0 0 01 / l \ l 0 Sl \ ` /1@- S
!l Q 0 Q
0c S 0@c T0 1 c R 0;
! 0 / P / /`8 8#4`# / 0 R S
4 /H P / / /
x- @L P` T
P
4 z P
&
D 0 P ! Q88!0 1 1 Kxh[x0S
x- @L P` T
P
4 ᳶ ᏹ P
&
D 0 P ! Q88!0 1 1 Kxh/x0S\0` P / !`80 00 , 0 00 , ! /@^ȏ菃쏃
- 0L(@+ R 3 Q!
@ A R
R + R ` R L X'1M
߀ 0M
X Khր f
- 0L(@+ R 3 Q!
@ A R
R + R ` R L *'1M
㱀 0M
X Kh言 f 0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
- @Lh 0
: 0
0-d0@L 00 SPP L U Q * 0 , 00 S
0 K0h0L^0SHS
- L K hS
- 0L S̀@
S
X T
`0 S d0 S h0s p0 S t0 S x0s
T
(` `p W
0 R
(k 00 zh pP
00(0 0 RP
R9
X @ 0 &a ``0 0 0
00 0
\ ` T
l | 0
00 0 ("( (!"(r ` ` `0 0 0000 p L0 " "", " R
)40 00)<0~
)4 0)8)0 00`0 0`0 S a00 S S a00 S
66& 6 6 6 6 7 p0 S q00 S S q00 S
7 70<0000 8#8"8S
0 4 8 /0 ` 0c S1 41 0c S- ʲ0T#tt1x'x W% * (1 W0 :90 0 D4 8
10f S 90a0T1 > 0 $K\X\ЃR̓@F
0-0@ PLc 0 K0hcЃ
-8 @Lp`P1@@P@$KiPЃ
-BL M ` U0P
/ p ۲ P*
)
0 S&
P" Jl Q ) !`R8 K#K . "KL"0 [ 0 K& 0( 2¹ y 80A1;08#8;8S 0; $ 0$ 1 Q<AX % 0% T!X1 \1\! C1 S01 S01 S000(1 0?01 S
; S 忋( 0( 0 S 010 S 01; S
P
P
T!X11X1 0T10 141 1 0L1; S0;0103/ T Kt^ ЃRуf \^
x- a PL PT0@
8 P 2 ;TX! S\` 0 H1 0c S *!B! R 1$b R Y' 0' \ < M% 0% P >00 d 00 Kxh\Tуу V
-qLM P T0@
`` ̱ P W hq !& 0& $+(R> 0 S(0 Q(01 ,
R* 1 S
! H! b0 R( * & 0& 0$ 0 RA0C 0C 0 00 0 0?0 h0 0?0
֊' 0' ي <o KhSууhS^
-P @L S0p
` Z P 01;
S
1 S
P H! b R <0 0?0 s KhSу^
-0L R Rh RT R@ 0 R( S 0 0 V^
0-TP @L 6S @00 S P
0 00v K0hpS
-P@L SD0 $ 40 ^S$0$ KhVUу^у
- @L W8 U` S KhO /
-LM@K00 p 0` ` P0 '0KT0 0D0 0 P 0 0 00 0 0Pu P3 PP U 0
S0 0$K
-LMP Q2 0@ 0 U
`
R a c @ P p0 U2 \3 R @R T
0 S 0 00 (0 P K
-wr \
\@
( 0 \,K 02 L02 12 0+0|" x2 0 0 ( 0 Q @ 0K (0 0 0d"Kc2KL\ ` R [1K\!K$1 `0X1 J ( ,K 0 02 P02 12 \ 0K+0|" x2 0 0 ( 0 8 0 (0dK 0 cK4 K 6AL0`2 `0 \ [K\K$0,KUK L0X1 p0 V 00 X 0 S
K
->L P
h0 1R
H
͌ 0Fs
`@; U2< 00 R (K
-L M 0 00L 0 0000000 0> K у
0-LM PQ@
H P
0K # R # K P 0 0 K0
-LM@( , 0 00 0`冷 P
(0 S
W
@ T
! @ PP 52 Ki KЃ
-LGMPp`!U P| P U0
W
@ \ S
R @ \ Q Y 0 @,1 0 01 *Q p@ P,
0!0 ,R S R K K,SJ P +1[ Y0[ S Sr
S ,1[ S0[ S$1 S Q qB
R Q q8
̑KK 1 Pi K?K 1 @Pd P:[K- K?K@|I K0ū P
(0 S
U
P U
! P @P: 56 0 @/ S 1 S 0 1s 00 0 R R r 0" XKK K?K ,1[ SPX PK :[@( p P @ P @ +@ @ (KlPЃ
-LM@`K p` P00,K 0 Pd0,0` 0 0\ 00 0
0uPu P3 PP U (` SP00 o P (K
-PLM 0K p` ` @0 |0KT0 0 @ 0 0 00 0 0B@t @3 P@ T 0 S 0 P P: dP $KlS
-LM@K00 p 0` ` P0 E0KT0 0 P 0 0 00 0 0 Pu P3 PP U 0 S 0 @ 0 O ,P $K
-LM@K p P/K `
0 P 0 0 ` 00 0
0\@ L` ҒPu P3 PP U < P
,` O @ O (K̓ \
\ ꈗ/ /
- LⳖi^
-0dML, @ P` 0 p! @@ @$@(`, 0P 0 ,0 0,p! @@ @$@(`04P 0 ̙P? 0D?',p0 0!0? @$@ 00(`0408P 0 Კ>Ο 0 0,p! @@ $@(`08P 0 4 H 囙H> 0 04,p! @@$@(`08P 0 H 備@> ,p04> @$@0 0! >(`0 04`8P 0 k= ,p0 0!= @@ 00$@(`0408P 0 T= ,p0 0!= @@ 0"0$@(`0408P 0 =H= ,p0 0!4= @@ 00$@(`0408P 0 &< ,p0 0!< @@ 0$@(`048P 0 < ,p0< @$@0 0!<(`0 00408P 0 P< ,p0 0!<< @@ 0 0$@(`0408P 0 ,0 ; ,p0 0!
0 @@ @$@(`0408P D0K ʘ,0 ; ,p0 0!0 @@ @$@(`0408P 80K ᳘L;, 0 0!4;H @ 00@$@(0,P8 K0 :H 0: 0 0!0$ @ @(0,P8 K0 H 冘:8*,p0 0 !: @$@ 0 0(`0408P 0 nP: H094,p0 0!,: @$@ 0(`08P 0 V9 ,p0 0!9 @@ 0
0$@(`0408P 0 ?9 ,p0 0!9 @@ 00$@(`0408P 0 (P9 ,p0 0!<9 @@ 00$@(`0408P 0 8 ,p0 0!8 @@ 00$@(`0408P 0 8 ,p08 @$@0 0!8(`0 00408P 0 T8 ,p0<8 @$@0 0!08(`0 00408P 0 ʗ7 ,p07 @$@0 0!7(`0 00408P 0 Თ
<7 ,p0 0!0 @@ @$@(`0408P 0 P7 ,p0 0!<7 @@ 00$@(`0408P 0 ᅗ6 ,p0 0!6 @@ 00$@(`0408P 0 n6 ,p0 0!6 @@ 00$@(`0408P 0 WT6 ,p05 @$@0 0!06(`0 00408P 0 ?005ş 0 0!0,p @ @$`(`0408P 0 H &5 ,p0 0!5 @@ 0 0$@(`0408P 0 ,0 @5 ,p045 @$@0 0! 5(`0 00408P 0 4$,p0 0 !4 @$@ 00(`0408P 0 ޖ4 ,p0 0!4 @@ 00$@(`0408P 0 ǖH4 ,p0 0!44 @@ 00$@(`0408P 0 ᰖ3 ,p0 0!3 @@ 00$@(`0408P 0 ᙖ3 ,p0 0!3 @@ 00$@(`0408P 0 ႖L3 ,p0 0!83 @@ 00$@(`0408P 0 k2 ,p0 0!2 @@ 00$@(`0408P 0 T,0 2 ,p0 0!0 @@ @$@(`0408P <0K =" 0 @ !42@$@ 00(0,P< K0 ) 2 @0 0!1@$@ 00(0,P< K0 4" 0,p !1 @ 0
0@$@(`0408 Kp
-LMT1! P@ Rk TV
!` V ` B/@ B R p!P ? R> n 6
1D @ B
0hFS c?Ō*P T. p KQ P `
K T15T10:0c? Pa UPPU J ?` ~~ [
0
:0\ 0 0 B K \^ 0 s
S0 /
-
@Lp卭 B1 Q 2 S0 1?0~0B?0 P !?0~ B Q?0 S 0? ~0B0Q?01
-LM P K K K 7p W
8 K K
K p. xK@ @ \K @`Kx `K @`@K x@K $ 7x K \ K @ K Kh
x- @`L\ P|70N@@ @00] _@$ 7 0 0 S
xhDV
-LM 0 0`p V3
` V2
` V@0
|@ T"
0 S * H7 D7 B7 Q P 0 S
4 PP ~7 0 S
y7` Y
H03 B B B @2dP ⩕ ᬬ ᕙ"
0 K7~K Z V
x _?0 `" K'~K J 6@@ T4
P 60 S
37(0 S
S 0 K d L0!~ 0 Kd!L0}K 0 S $1 Q
0 7$A0K K @0bT 6 @N=0 S0 KK(1@ PKK00 N=0 S0 JK0@ PJK00 0 t0⩕ R
0C S D0 08DF$E @ 0 0d
d @ KT 0} K (K^,^I^i^x^]^ ](^]?B H' ^
x-jL P@ d P60 P1B
U
c ` [ @ @ V 6 xh
0-L g? @P Q @0@ t \,
P g?0 U 0h^
x-PL @ `6 U
0P @ R00 V (`0
0 00 00 PP0C0
P P1B
0
P 06 xh
x- @Lp 5`0 S0 P
PQBY
|Q U
5/ 0 PP
6 xh
-a L0 R @P Dp0 S U
0m P P ^
x-0@L P` 5 P 5 xh
0-LP @ P
W 0 0:t]
-ALM s5q5 @ Tk
0 P! `b`oo R `f ``
a /o Q b r!` P U0 F12 1 "!10C S1 !1 R10!1 VpT
5 U!
: U&
, 0 00
r5 K0 5 K
W
W
f X
P
f$ 5 J5 0 G5(K@{hDV
-0L # P
-LtM━ P @p`440
P!B
@
"5 < ( 20 ! Q[ l0 X
RU
T!R
P 0d PL 1 0 S 4{ 4p2 0 4 f0 4<4@2 0 Sj U7
4 U% L1 N
?0 !{ 0U4
x 0 0`c? `Pa ? 0 P0 T12
X4 Z/
T1
J d Z
`1d`# K TJ P" P`K 0m P
T1`PE
4 0 Sʫ0 4대H
0 S U0
PP h -4 F0 S L r4B<
8 m4# d4 Z3
(Kh@^@{^\
0-H@ PL 4 0 000 PP000K0hC4hDV
0-HP @L 300 0C0 0 R 00 K0h+4hDV
x-L e@ ` ᑑ0 @ P ( 4 @ ` l x p
l
N I0 Q!!!!0 x耎SDV^^^^^^
0-QL @ 3 30 Q!!!!01 S
!1 R 101! 3 P3 ڐ ᡐ @ x ( 4 ` l ⓩI⑩ K0hce@{hDV
-bTML 3 \ }j 2 @,K P p@(;0 0!P(P 0 @@ @$@,0p }00,2 (P0 0! 0 00P 0 @@$@,4p r}001 0 0!00 0(P 0 @@$@,4p @ Z}00|1 (P0 0!(0 0000 0 @@$@,4p C}00$1 0`0 0!0 `(P00 0 @@$@,4p ,}0,`K@& P0(P 0P! <0K @@ @$@,P0p }'> 0x0 @0l0 @0 0!X0$@(P 0,p < K80K }(KhS$Sw]^^^^^; ] ^tSDV B@-2@ " !1 S! 1$0 ! u 0@ kDVh
0- @L\ P[20 U00 P00BY 2 0 2 0h
- @L $ʧ0
( Kh
0-L @P
T Q
@ ' Q
" x 0 0.00>;0
0 <0mQ Q
x I $K0h菧0
0- @Lp 1l0 R g? @ P 000022 U
0 1 ; 0h^@{
0-L @ PP 1 2 0h
-L @
$ 1 2 h
-TaL
. |T8
B\ @ P B\ C$ @ PC $ B@ PBHA%
4T
U
V
S
Y <0 S PH <? P14
0 TP SP "0000? U$ 0 ! T1
T0 S H1
e P
xf P 0 00PP1
1 S
3/ P0000 【 90 /
f1 Y Y
^ - * 09 g1 Y Y
T15 T00 S
6T15T1O -
`1 Y Y a1 Y Y
V `1 Y Y b1 Y Y
V u 9
e1 Y
Y
0 <0 P d1 Y d1 Y Y
T15T10<0
Y
Y @
< S [1 Y Y
0 S
]1 Y' Y%
3 0 R
P 0 S
Q
] 3 0>;0 I
\1 Y6 YP3
| P 0 P
p
m p 0
P P
" lp@p \ p 0
P P K z V
@ R
^1 Y Y
Xj j1 Y Y JT0 0 R
1 RV R N P PH W @
Y
X1 Y
Y1 Y
Z1 Y
Y
1 @+ 0 Sc? > 0
:0/ c ᷠmX1 Y Y
P
JXE UP# U
PE0
d!e1 R ,Ko h \
0-P1 PL @
/ @ / 0h
-L$MT10K2T10 @90 0 0 000 K P 090K
-T1L @
T1T 0 h1 P i1 S
-`L @ p@/AP P P
1 RP
0 P1B P
U Q
◤ X
I ⒤ g/ h
x-TL @P` 8 / U S/" R xh
-LDM0 `X Sh p: 0 #K4䤟 @14@ `@ P@ p.T!T
a1 Q, l )
S&
t4G^ P l0 1 0 S H/p
@ $ ` pT T
T!T "$ b \! 42' ( 2/&@Tp Rd R@1d@# ' K < P0 & @
`K Q ( t R 0p@@ 0
0 W#p@@ p D4 0 4 & Zt
0
@@ & (KVh
-pD! : : #6aL$ P&A@
0@ @
R
0
P R 0@
Q0 S @
0@
T
q 3 0 0C P QT!"$ R @
0 @
T Q
Y
,⻛ & Vh
0-X0 PQL 0 A
D 6& T
0 S
|A@t @3 @ U
t& 0V
-qL @0 P4 P P ppm 0 S UP
!X `8&0 U TP K& X U ! 60 `P `P 7&
W 0堐a V# T W P ,p l % 0 Z
T & : TW 0 Q
& V
^c^
- :@ :L#F p P x0x 0a @%|Q U
X % L0D p|1䀄%0 003/T1 ;T1PPPQPVhS
Q0-L @0P 0$ }%0 T @@% 0V
- @L( D% T@
|W0 V
- @ P. S RL `p
": :d #6` AL%
$Ԛ
, $̚4 Kh%hV
- :@ :L#F P `p PN 8%%41 01 @0@ P`, 1 H10L10T1K
$1 Q" l
S
T P 1 0 S
l
l$ S 0P
<00 $00" T0 S! <
$# = ` 6 0 00 $00 S
|Q U
0 0 3/ P ! @`T0 S P U
Pl $ 9 PT C$ U
T0 S @ T`, $ V
P(K@^V^h
-`4$L Mp :: #6Q4 @ V ` V
0
P0 @0P0T1;T1f T1
0
P0 @0P0T1;T1 W@ Pq
p3 Rm h3 V?
;1 V!
L3 VN
D3 V_ <#0 0: ,3 V;
K0 V
S 3 V 0C V1 * 3 V
I 20 S) D 0 S0 0! `0 V
`0 0 `0 V
` 00 0 0d S0 0 00# t<# ` ,#x # P0E> St #T1 S \0 00 0 $ 0A>A0BQ3 \ 0 0 0 0 S 00 000C S00 0 P{ 0
-L @pU` W0 S 0 0h h S" Q P% Pa UP ᐰ0pe`0e0 0P 0 P U0 0
x- PL`+ Q@4
V 0 @@c T @@c+ L0b #
@l d R 0 S ! BB.A.A B\" @ S
0 @ S
d \ x
0- @LP0 U 00
U0 S Rb0 b Q 0a R00 Pa 0 S 0 0K0h
x-L@ `0 P S x S
0 S h P00 00 ` 0B R
S 0 QA 1
S 0 QA 1 0 0000 S000 xy^
-L M `Q p@ ] l0 0 ST
S+ 0 S
00 0$ <g PC 0 P SP`P` UP ᜯ0 S 0`ep000P 0P U00 V& 0 R! A @ Q⢑ Š!L" !'* ȠJ
l Q
000 - (K^@- 0 S0 0 S Q
t0C S 0
0 Q @ T
00c S 10CB>A>A0BP3 ̌ @-0l S 0
0 \
@0d S@@ 10CB>A>A0B\3 ,
0- @L R P
Q B A Q P
0c S 10CB>A>A0BQ3 \ R 0
0-L @P p
0401 1l
10 P
3 /@^@- l@
\ @ @
x-`h0LP1 l0
10 @ T
4) 0 P # x x@^
x-`h0LP1 l0
10 @ T
4 0 n P x x@^
0-L0P 1l
10 @ T
, P 0 0
0-L ( l !
P
| Q
Q h@ 1! Rl @@l@ 0 K0h` 0 0at @{
-LM ` R @P0 (` `
0 S0 0 S
/00 ` K 0 Spl8 ppw p3 K m P `K
p` \
0 01K 姽 P K
V
\ G
p0 S t0 S x0 S |0 S
80 0 S 0 S 0s P0 `0 S d0 S h0 S l0 S s `0 00K00K0 40_ ` Q
W
P V0 0 S 10 `0 S d0 S h0 S lp W 0 `0 (0 K`KyKp p !0K 0 K40mg P
K K+K n`K4 S; (0K 00@ K K P ^ K 嵀 P #
5`@ R p0 S t0 S x0 S |0 S90N
s P0
,Qf0B p `` 0 X(
3S
8 <0 SD00c 08 0b 0 S : 00j0000
00 *, PP70
0 (00
0(0 + \
0K \ + (K$
p
"$ Y,$ 0 * 8#< 40#4 0 X0
XL 40# ##<0` 0 0D 40 R S
4H ⫬ 㧬i8)8#4i# 0 S 00 S S 00 S
00 0 0 0 0 0 0 S 00 S S 00 S
0 8 `#8)8<000000 8#8"8S
00 0 S9 `+ PP4
V
P 00 S (01
(K 0 `X& (0H@ P F* ( P
B* 10 1H@ T# 0# "T 1M
&? K 0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
-L MPp` s0 @ 0 0 P K
0-L @` P f? { 0
0-L PR @ v{ K0h
0-L PF @ \? 0
x- @L Pp0 S t0 S x0 S |0 S
- ` { ` ` 1 01x x9 x
-L`P p @ y P u
- @L Pp0p S t0 S x0 S |0 S
` y @ W T > 8
x-L @=C L ` x P A U (0 A P 0 xxV
-(0 @L( 1M
G> ( 0M
X Kh>>
-2LML @Pp ` 0 0! 0 @@ @$@(P,p0` Of00@2 0 0! 0 @@ @$@(P,p04` 9f'>1 0 0!0 40 0 @@$@(P,p08` 0 f01'.0 0 !4 0 @@$@(P,p08` f'>81 0 0!$1 @ 0040@0$@(P,p08` e0 00 0 0!0 0040 @0$@(P,p08` e0 00 0 0! @0 @$@(P,p04P8` eP R<0 (Ko` W]^|^V^p]VX]&SE)^S
-L M0 @p SPK 0 SH PF 0@ S5 P?
P
1 0 S` 9 ` U)
0 S $
( 0 R * T) % 40K4 0 $ T 3[#[t 0u P 3[#[ 0 D`H `0$ s ` (KW\TER\
- 0L `0P@ p W
W
0 S
0 S
@ /@ @
- P PL4M @`PH0
0 S0 S T
" (K0 K#K $KJX( P *I6 P ,K (X B p j 0 0 ;0 $K P
eO J ? P@@P 0K 0 @ %K1/ K04 K 0 %K 01/ @G@0 X Y $K ?K R K06 #K R0#ӡ £#á0# # 嘇 4 @9 XwB (K (
-L$MPd0@ ) R d0 0 0 01/3 ꨠ<0 ` cD # 0 K K r K)K S R d R 0 R0K0 0 0[=0[ S < [. R S C 0 S R
;0[. S 0 S R ` (K
-L1\M 0 @`H0 d0H P <L ` A P A0x ` 4 K# 1/` P q ?K%K FH Z K ` #K R0K P`%K R
K1 1 R K
0 J 00 0 080K0 ዢ @P 0
0 S80
P 0 pG pp p L 0@ @ (KV
-LM` p 0PP 0 ` T0 0@0 0h00h0t P3 YtP
d040
0J S ( 0 080K0P00 0 j P80
S0P80 P S0 80d 0 S 0r0 S0
t R
0000h0 0 H h t 0h H0 d0 ZT00Cx0 \ Q
I ? S R : P `Pl x ` P ; l @K @Px ` T0 p T 0C K X0 ?)K(K )KpT0 |0 L d \ `0| S 40
M`x @ P
` 0@K 0
? @PC PH0 S X d 0 S d @00@@0 S &`X T 0` 0cP ` 0 S
PH R)
0 R
d 8 @ b R h R`\0 H P H dh yd d ` R ` 00i\0 H 0 S+
d 8@ R# 0 P0 \
R @` d@0\@ H 80|0L0 0#Kl0 Qd0h j f ` 0L p 0`0 P R L Sl R 0`0\0 l |0 I@ P
R Q Z< 08S8 t R3
8 S0
` " @P H0 S (K )KᐙT0H L0 `0T Z` X0p T0 bT \0L P T0L LX @ T咂T0 X c Z`
0P 0 0 ! W d0` 80@ ) Q P |" d `08 @ 0) Q ! 00 0@ ܜ t0 S
Z T `0 `0\0 Z$
Z[
#K Q P P ` d 4K <0K @P
<0P 00P 0 0 ʣ @ @d ! N `XC 0p T0 bT#K U T <` d 4K <0K[ @P ` r @P
< 8
0 p R \0 00 0 D K0 P d080@ 2`[1`[ V #[0 R 8@0 # S RK p
0 P( p p
" LK P0KX @ T P @P
P PP0 S
p 0) p p (K.. 倳FT /
-LM0 K @ $ 01/ P0 0K
p-L M@ K a 0 PP `P
z P Kp- /
0-LMPK @$ 1/ P 0 0 Q
Q
0 0F 0K0
-X LM 0 S
<0 00 B H0 K WX^ / 00C S 0 /0 LIW
0- @L Pz0 S
6 K0h00 (00 S
0P s / /
-@Ld 0 S d0 0 0 0
0K10[1K20Kd0 00 H K 01/ PD ?) Q ! 0 0 0)- H0DK 0 ޑH 5 P+ d0 0 009/ P _E H0T 0 0 > T }ET \ 0 8 0C8#880 00 0 080 00 0T < Td T T (K P\
-LM@P U
0 S
# [ d 8 S
BH # P
,10 S; 10 S5 T 0 P- 0㸛 8 0C8#880 00 08 0C8#880 0 -0 0d0 00 01/ 0㒛 ^ d m $K
-LTM ` d0ph l A h W X @@ a `T0K
KPL KL0 HP <
8@ 4 X T LKh 0P @P
X 4 <0X 0c p x0 4P\ Ut x0 0K
㐘 0 \@XPp U= * Z
R@
b4 R㸠@2
l Q t ź t P : x0 嚐
B l
;K x0 K R 0 @ P\ x0 `5x0 @ @ R
T
0 0 0 0b1 0&K\ 74X 44h 0 Q P 00 0 (K
0- @ Ld0 00 S
S 00 S0 h0 S
!P 0 0 S( p 0 0 K0h
-LM 0`0C S H#I S R 8 P
; N @ P# S R 0 $ 婏# R ( @ P6 0 1 T
0 Sd@ @ T
P
903/ P
#$ 1/ P
ᨏ P #$ 00 \
@ c \ T l 0=
` 0 0l S0! 00 00 @ `c V T `l`f` 0=(K^^^ P0@-B
Q 0 @ R S \ c@0l00 0 +
0a(0(00 Pa 0 @ T 0 \ 0
(0(00 (0 S 0 c P0 P00p@- @ `P 0 00800000p
-Lp @P Q Q b @`0 `a V`! 8/ P @Pf U Q \ / 0l S Q / / /
0- @8 L0P PsP<0 S 0<0
< "~ P
U& U80 < < 8 8@
L DT 8
H \
DP L0 `Pb@
U `P
0
V 0嬠0cp,2 Xp1 S0 Wp!0 0Pgg0000g S00pp W @ T U U @ ` \
-L M `p P U PZ Wph P Sg&
0 #
0 @P0
0 0(00j(0((0! X h0 0 07 P P . (+ X 0 P&
} @P
0h0000
\00 008 < =|8080 r 0p 0 0 0P (K 0
-L M r4 `p80 @
p0p(p 0p Spf4 0 0 V `c 0 S 00<0 W PPU < UP! R
8 180080 `pW
P U `0
PjU 0 Y 0$ S T 5 PD
0<00#8@40 400;P0 0 @HL00
3S" 8 <0 S D0P c00c0 < 0b S SP1 0 U 1 ! 0 `iPPjU P
0
3S 80< R DP 0` c 0,0 c R ! R !T 0@ @Z0 h
3S 80<0 Sa V
0 PP 7 y Pj { PP
V 0
0 jW ! T 5 PD
0<00+P 40 4`!00 0@0H0 08P L00 0;00 S0p0 )
3S 80<0 S" !1 R Y Y 1 Z
0 @ @ 0 l 0000l S0 0 P @ Y0i00 @ P 0@ `@4 0
( R((K\
- PLM
K K
-LM0 0 K
x- @PL
`` 0
0 P0
1 4 U@x\
x- @L` PP 0
V 0f0Ó0 @0` x
- r 00LM? Pp
9 Q ` V U_
0 V ,0K #J `c P
< 80 80 P @ <
R
L2 00 0$0 80 Y0(0(p0h(0 Y f R ! 0 c
R& 000 10 008 < "z80800 w `pc0 V P `0 w W QE
U wA
P#9H1 ZD T 3 PD
0<00+P 40 4 !00 0@0H0 08@ L00 , `
3S 80< QD P0 ` Y R ! 00f R ! 0 PD00" 0" 0 (0 0" 0"(K ^6 ^ N ^\
-LM & K
-LM K
- PL p @PH
$1 00 0$0 8 0
00 008 < ty8080 P U
`P
` 0
d00 008 < Vy8080 P 0 0" 0" \
-L0K M # L @P u0@ 4" 4" K\0b
Q-L @`p9 I PP4
0
0ppp gp,2 Y p1 V0! Wp!0 ?0`g g0000g S00pp @ T V V @ &82 082\
- RLP M` 0P P00 0 ppA <0 d @Pg
0㠑000K `(p80 W0[ Z
@P
S < 0e S0!jS' T @0 |2D P@0
< 8@$ $ @ H PL ` D
) S`1k#` ` S Z <" Q 0`0 S
3/ ~80P8@ @<0pf UP
(K\
-LM K , ) P
K
-L(p ` PPI
1 00 0$0 800@ W T 1 PD
0+8@40 400 0@0H0 0< P L00
W 1+# (0 g
0pW
- P ? @ 8 \
- PL MP@0 0 7 R 0@ 0 S @Pc T U T 0 0 S @
p 4 4
#R 8 < Y @`e 8 U \<
Z Y
Z 0 @P
0 S PP @
f R
\< \R
4 \
Q 8< \
D bP c , a R
Y 0x0 00p 0
3S 8 <0 S0D 08 0b 0 S Y 0 S 00f0 0 0 }0 P`f` @B 0 e P Z @ T 1 PD
0<00+8@40 400 0@0H0 0 P L00 = P;
` L}0 `f`0 P0 000 H 0 0 @8 \@ P(Kq ^\
x-L `
P @!
P V T 0 PD
0<00+8@40 400 0@0H0 0 P L00 P { xxx\
0- @QL P P
P@0 0 $0 0$ /$0 S 0$0 / R0 /
-L@ Kh
0- @QL P $@ T
Q
K0h0 R$ P
0 S / /
0- @L PP
| 0
-@L p$P ` U
@P V 0$0 0 0 @$@ P` 0$0 /$ / /
- @$ L P
(F ( ⇶ <? Kha@
x-@L` 00C S0 P ,0 P $PPu P3P W U
x
x-`@LP {$00 S9
(0 S
:90040 080 0 0' 0'00` 0:0> `P@@ x
-@Lp` (P$@ T U
Kh
0-@0L P@@ T
$ dz P @ 0@
- @L @ P
Kh訽
0-L @P2 P
( R
@ @ 0 0
0-LM PK @P rT@
R
K0
p-L M `P$K P $ @K 0 0$ ˽ Kp
0-LM PK @P $0 S@ @ T@ @ T
> K0
x- QL `@ 0P:40 P
x 780 P x x
- @QL p`
Hw P P3 / Q
P By PP N6 P< @ X :0$(P 0000Q 4 8 t @ ? ^@
x- @PL
T
. P @@ @@. `P@
影 | 厱 x X. 0P DP @ T
8. x,0 失 x x x@H\DT1]
-LM ` 0,KZ' PP0 |, K @P P& PP 0k PP`
p
P 0` S @ B@ p W,00,0 W K@
-LM Q `p0 K(Kɾ P @( 00$ K(00 00 0(00 8/ @P p0 l0 0 R@# *0 p 4 K @P
0( 冾 040 ( 0 $K\@^ 0@[@
-L4M p @<K 0 L0 & P} H K@K‾ Px H0 , K( ! @0 0 03/ PP^ <P0 堡 a < K @P & |1 0 RJ *0 <K 0L K0 P
PB +p
P9 0ᴱ P6
` V+ P0 S P$ 0 S : @ L@ R @ 00@ @ @@ 0L0 H @ @\L P
O P P H@ 0 `00(K\@^
-LM _ K @[@
-LM P(K`p P. &( P 00 0 W 00 S
,0K8 @P (, ⠳ @ V,0
#@(0 T B
@ @( w K 0
-LM p` ,KS P BK T 0
$,0 Q ,0K# P< Kɚ; 008 0c80@0 R=
9 W7 $ R4 ! 1 Y
b b R R% L
R
8T '00 S@( V
$ ^ `@ \W`
-LDM @00 T ` p P 000 0 4 4 V0 ( Y
! 80
8 l2 QP0l2P30 \0 X0 \<0 P !0w X4v
00
00 U0 S
^ T P]
0 0c ` S 0 X 4 ; P
YN UL S 4 Q
E S S
< < o B < P? e V0 KL L 0 00 P >dDH 08PPp:L@#*0<00D 4 @ 0$04H 000g0 0 0 g 0 R0 000C0 Wz
g L p P00( p(p8 p X YLP 40 Z 00 S
z0p W d P(p p@ P@ 0 SG pD WB : Z@ h3 0P0 0P 0 S8
W
p!Wxl d l PH d"
80 T0=; P(Ơ
H H X6f8 !T d `0 'Y `0 0_dhjY 00 Z 0 S
K0
4 R
00 S 2 0{c0 W p0 Y p{
g @04
Y p
p Wp P
g
00 S @ W 0g0ó00 . J0 00 1 9 8 X P! ! Y;ö1 0 Q 0
D0 0 3/ 0 @T 0
@ S, S:
S( ! S>
B SA
S
B S T
V t! S8
S K
M T! S B S/ B S
S <
>
S<
5 1 4K3040 1 00 ( ! $ ! ~ 0 @4 0崀 U K BT0 0, 4KK ^ @ *@ N KЫ ^^
- 0 L P pn
-L$M PT3 ` U p 0@0 WB
W?
W<
W:
W @ W6
W
W B W
W< W+
W
W 2 W 0 Wd
W m <K X 8@ T ! d2 vU T<0A S1001r @K Xj @0 S1ppqc @K z X[ @ QW 1 W
W
0C W
X P 7H 0;0D P1;1
; 0 Q@0 @005 0 Q@0 @01/ <KV E X& CK 14
U 0 cL0 H U PH L04$ T
@@ Z
0@0 0 W@001 * X* X 0 S
0 S
3/ P
* P \ (K ^ ^
0-LM@P( K 0 ( K9(K
@( K# K0
x-PL `P@(P 0 0P S0 S
0 Z x S P
x
x-0L P S x / @P
0 S ` T PD
0<00+8@40 400 0@0H0 0 P L0 ` m0 0x\
-L M @P 0m $KhMT
0-D0@LP r 0 S
S
\0H0X0
1 H0H0H00 0 X @,X 0\\\
x-L @P P G `P
H0S101
$0XS000 x@^08 080@0<@0 8 P 0@0 /08 0c80@01 Kh! !
- @Lۥ ٥ Khե
P- L2 :̀p@`Q` U ʀ0 !0`1 0 0 0 0 , !|0 , 0vid0 0 !1`Q 0 00 ! @^ȏ菃쏃W
-0LM pQ `1 h W 1<@0I@8 ? P
40pH 0 WDpD0<0 RH0 K@^W
- RL Pp 0
( 0 L# `X
0 R`@ D< b8 b R S < @P
P PD
0<008@ 40B30 0@0 H0L0P 0 0 0 j V ` 0 S
`T0 S@L@T@P`
^
- RL p `@ 0 4j#
j (0 T@(P` ` V` X
PP`! T0 S@L@T` 0 S`P` P U /0
{00
@ T
P1 7 ^`
- `RL @ 0 # 0 P P 0@DP010 >00 0 0 03/ P V
1 01; ™ x
-L@L P T L0 SP0T0 0tpL0 [ 0
%0 `0
1 V
@`
-L MPP `pP
U 88 G
@PA
U8 U PD *
0<008@ 40B30 0@0PPH0 0 Z T 00 BD P00
< 0$ $ 8@ @ PH L00
`0 0P@p (KO ^ \\
p-LM P K@ `P
sg Kp
0-L P@ 0 T
n @ 0
x-X (P 0X @@ L, \
n 0 ` T
x
-L
- 0L P
- 0L S 0 @ @ Kh
-L PX0 0X0 X (p@ @
A` M ` 0 T
V
# X (0 X e
x- P@ QL
D 0 ` T
t x
0- @ PL 0 T
K0ha0
-LMP0 0@p (K 0. P$ (0 !*! `P
( %. Y 0 $ 0 ( 0 0( $Kd\ 0 0 S /
-LM@ K0 T P0 0K
-LM `P K@) pP
v ` m ៨ K
0-LM P@ K P P 动 K0
-LM P @8 p墨 P
(0 S
u& 4 K0K `P
l 00 ` 0
H X
P {
! z
!
$ Rv
Q Q
5 $ ,j
pPf !t W $_ R
t4 < P< 4 0( Ġ T @< u pH?< H
W
4 }4 00 004 P1 0 ߩ 0 0#. 140 580 ` ܧ -p p #p p
Χ@040 1 廩 X
P (K+]d\@^
-LM p` KP, @P7 ! %@, > @P 0!00 S
! D$ $ R_ 0 @1 P
p P
0! ! t@ @ $@ ] w A K
-X1L4M1 @ a 0 0p @K8 K0H Q PH> @0 <KP8040 P8 K0B @P) <0 8000 * P Y @ @ T 4 K @P <0 倨 @4 | <0 @4 (K@^
-销L@p ` T
TP
V
0 S 0 S
`I) V
P
劦`` P 0@
-LtM` \0 V A
R R( g P lPK R P Pl lPK ! pD t K xp |p Q p| | p WP P M T! P
]p
Tp
+ pUd 0$ 00 ` K0 0| p l0K U
(K]
-L Mp 0` R W !4 @P W Q R
P 00 4 t K Z004 @ TPPpe W T @ 0c
(K ]
-LM `@ KPpm P
0 00 p 00 P K
0-LM @KS P
! P ̥ K0
0-L MP@ U
0 S*
U( 0K, K P# ( K0 U 0 (K
00 P, 1
H ^ PP I( K 啥 K0
0-L(M 0@ S
0KC P
- 00 8K4 K 0P % ( K40(K 080!++!8 PP 00 S
S 1, 7 PP , K 1 P( K T K0
-EL$M@ `P@X h18K1 q @0 q P @K 80 `04K 0f `P> 40@ K0K!*!80!*!5 `P/ 00 Ԑ 0@0< K 8 ( 0K% `P <04
( 00084 `4 V < Q @ M @ 4 8 @ (K@^d\
-LMp K `[ @P P ! 9@
P 0 2/ @ T
Ť K
-LMp K `5 PP @ 4 2/ P U
ᣤ K
-LM pP`P&
C 0 0
KO P 0 S@ U P
d S T P
T 0 0
K J @ @ Ki ^
p-L MP ` K0 P # 0 @ P
T
P r P
ܣ Kp
p-L,M ` @P P
,K P,K
0 0 K000 0 P #00 @0 P
^ T
P ? P
ᩣ Kp
-L@4M8K( $ 000 8 0 4 0 0 K <0K P
#<0Q @< P
- K
p-L4M P@ `8K P. 0 43 0 (08 K S<0KH @0K P (0 S 80K8 @0$ P 8K< w PP
@ P
U 8K 8 K Kp]
-LtM P
lK ] P \ K#FKeKd0T @P P2FK Rd @<2 PFK0d0 `xK P 0 PLK S;#T0 t S @ 0 Te
2LK 0 + pP] t :40 P
tp <0tKx Sp0K
L0Kl P
pp# P p W p pB <0 S L t0 pP
7
LKp pP
0 LK i 0L K00 0 pP" 40@ 0 S
P\ K9#&KK PT d0K0c ST0 Pl K T %K R pt P
H Wx0 @t T (Kɚ; 6e] ʚ;
-L M @K. P #0J @ P
& K
-L M @K P #04 @ P
K S
-`:0 RL pP7 t U @ PD
0 8@40B30 0< @0PPH0L0 P a pP
P0 V @ 0 R " R Õ P \
0-LM P@ K 0 P K0
0-LM P@ K 0 P K0
-LMp 0$ $ Q
R R(@l`K ` l`K 0 S ` @P l`K0 x0 0(K 1 D0 t0 | 0 R | | \ P0~ Q Q
0 S K 08 @P] Rh 0 S
1 P
K0% @PJ p
Up
p_ 0| 0,A 0 K4/ 0 @P0 |0
S
t T
# T
T 0 0 Đ D
c @ W
0| R
@ m
Bl0K V
< P
h P
d @ (K]@{
-L M pP @,K( K `P
0
H0
C
00(0, 0
@ j K
-L0M0( $ 0K 0 ( K, 0 K
p-L,M P@ `8K P 3 0 ` 8 K0Kp
-LLM p` TKP K⋡ @P 8 0 P S;#\0 L`K\0 U#
2 X0 P P0@` T 04 P d 0 0 00 X0 PP
@ TT0 PD U (K]- /- /p@- @ T$
00! R
R R 00 0 HP P`00 @P 0` !p p
-0L M ` V#
@ ! R
@ T` RP R R p B"! W Zp0 40 8/400 (K
- 0L S
& ^ I
- @PL
4 80( S 08 @< Kh6x
0- @PL
P 0
(0 S(0 C K0h0
0- @PL
P 40 0C40 C K0h蔟0
0- @ PL 0 T
K0h{0
-L Mn @P s`0 S 0 S
3 + P U
<08T80 X
H,{03 P P U'
&*
&Q? X P d
PC A 0 Q Z 0 S^
00 S[
|2 000 0 Q
4 Q
8 Q C( QP U
2 P
Q
@0 0jh b !
t
X000 000 , X
L <4 X
( < 1 P UQ
(0 S
00 S
8 R 4 S 00S
!
P0 S000@000000P ᖞ$ P U000 ^x^@y WP2U
-p `L @ P X
0 S Q R U
PD
08@<40B30; @PP0HPLP
P ,Ko\@\
- L
- L
0- @ L P 0 ]0 0
x-L0 PL @ ` U
0 P# =
Kxhx
- @L P
-p1!L ` R P+ @@ 00
1x0D0.H 1@0L @
D0D0H0H0L0L0@00@01 S
S
S
( 0 0Pl ) ^
-0L P!` @ pP ! 0 R
R @
D D H H L0L0@00@0 E C @^
- @ L P
9 P
PKh
- @L -
-@L 0 T&
! R
R
R R
R P Q 101B 00Kh< ^
-L
-LM @᭐ P
娐 ` `( K 0 P
(Ps r s r 厐p 0p V 凐` $K
-L M1 p S
S
S # 0 S
`, 0 @Q0c 000( ,00 c0@ 8R/0(00M
X M / K ^ ^
0- @L PP$ P
0 0 k , 0
- @L 0 ! R
R 0 S
P
N
-LM @ `0! SPu @0P%Pq 0@01 K f q `P[
00 X00 Q a CKu pP) pC?K( W
9 P R ꎝ N p 0p; K ! 囀 00 80 !10;;0 C?K0KM pP
s p # p I 001p $0x0D01呏1H 哏@0L 0@04 S @0 0@0p p @0P0@0 (K
- @L P p` V
N L p p0 S
` V
62 P
} `d`0 S
r _0 S 0 S
0 !, } Khg KhMx
-5L @
x-1L @ SP
S
S Q < 0 S ` 0 00 \ 0 S
0 S
P P0
@ Px s P
xW ^
x- @L P ` 0 @ U? Kxh
-LTM @P@0`% 0@0 pK? o PP `u
T0D` @0 l` hP Ə< l Kt `P
o g Xp0 S&`` o !倪 `PX }P U !1 R
)`H 00
1 `=`7 ( 0P
P ` R
$ x0 $ Y$ $ x0@ P@
`P ! 0 R
R @ @0 0
$0 S \ & h@0 0@0(K
x- 0L P S`
@ T d @1
} 0 $0 S 1 P C x x
0-LM H@HP A$@ 0 0f P
K0 ^P3U ^
-LM P 0p U` @ 0 8 P
P5 00C S0 K PP, 0 S
S' 0 S@000 0 S@000@0 0 S
S*P @0 P
D @ P *P K
-L M` 8 P@ APE%Qw
1 <0 4 8 p 000 0 SX
8 Q p W p ( Y 0 S8 dg PF 40 P P
W
9帜pG Z3 p W:@ 0"
0 p0 4 D0 = 8
Ǟ 0 &4 B4 m D00 S 8 $4 <,
( p p> W0 00 0 c W (K P / 1U
-L4M @S Pp< `
(511D0 0 S 5 R 0 S S 0C#100 40 080 4 4_80H @0 00 Y @@ QH P =#4
X P
(0 S
*Lt= 4 . P%
W 0
00 S D 2 T P0 L *0 0 4 4 L P0T 0 40 Z 80 80 X
P5= X! 0
@0<04 08@ 4 00 0 0D@0P H0L0 X 1 S
SL
S H <1 Q
8 } P
9 - n l 0 S='
P"@0 X
1 @ἐ 0R P
1 70 1 J H M
8 < RS
CP RL
@
@ m @ T㼠
P @ ! R
R
( , b , ( b 8* (!M
T
9 (K@^ Р^W ^@\ ^ /
-L M P`K @ C (1 ?~ 'r 03/ P
0
0 `(0 00(00$00< 0,0F(0 4p 7/0 0
(0 4P 5/4 P00 40
4 % F$ (Kon8* ^H ^)]\1]nG]]
x-P BL @0 R- QUtQU`QU RU 0"S* $ 0"S
(0 4P 5/(0 ` 8P ;5/ 03
E 0"S
E p LF PF TF x
-(@` 0,`00(0 PL 4p~ 8/(0 4v 9/` ,00,0(0 4j 8/
00000 0,0 00300
\
000Y
(0 4`Q 6/(0 p 4`I 6/, @
4 *
(0 4`; 6/(0 ` 43
9/ ` 00
6
60 6 60
60 @ 6 0
600000
<000`
!G 0 000A- a P) S' !60 S# p@ X
L0x0L0 0 \Cyz W 1 0L0(0L0 0 @^p P
0-L0M @| Q
p Q d d Q Q S 0 D KT0 DKD0 8 40 ,@ K0@^ 0 ! R ! /
x-L P` @` x 0 S d
00-L0H S@@<0 x( D
p-L M PK `% @ T
P0P 0 呿 0 S
P @@ # P Kp
x-PP`L @ 1 6 y u
0 0 Kxh(
-LMP \@ 4 K 0 s / G0@-80 #A R D A2@_0@ P
S R
0<00 0 0
-LM80 M CA T 0<0!F D0@AB0!_ Q
` W V
X
0 80 [ `P0 80
Q` a @@ L X X@
T000 T00C00 S 0 S (K@
-L M#K@0 P@p8 >
p@80 T2 0 s)
#K 5 P 4 00 "b P
3 0 #KE P
3@03303
T
Y p 3 03 p#K* 0@#K W p p
@ 0 S
#K* 0#K80 X |l 0 X
#KG5 @P @ #K @P gho9 Y
303 3 03@
03 0 ! 0 0q0 S400 #
P R5 ! ; G Y
3
P F h U5 X p 0 3 03A;3@03@ (K ^ ^(
-0L M#6@ P
8 !C
x!t d X 00 C800 YP
*
c A V &BN GR P0 @ "D00 @ P0
R0 < P0 Y80080
* 0. Z
l 2 X. T@ S@1@ SH H0L 40L0@ C╽ (K@W ^ ^\@P /
0-`0LM\@ T LP \ @A00 @ 0 0X 0TK0@@ ^
- L- P
K hF
-LM 0 4
V ` p!ZFnK- $C Pp` 0nK V!ZF
"` 0`p@P 6!:& R` E4 00V#ZF.K T0 "ƠCʌ1 ,? ! Rp
< Z9K4K
0h0 |0Kd 0 0 0`
K nKmK
`
IԐ ̐Kp|Kp Z
p Vl
3p
`"K R R
K P` -K 3 -K* 0 P-Kp
`3 #
Z
0` 0 0 3 8!03 0 0 0 v Z
p0 W0 00 p
K
P
K \ xUxUUUUxU [3 S 3 0 S c9(0, #6,` G 3 P 叼H Hch0d S d 0 傼 (K ( ^_ ^(g ^ \
-L M&p$K 0 K
$0 00 0`? P ` @ T
T
t L $ 3 S ]3 0 K$ 3
$0#K # K(
-L4M #K0 1#K#A R W D0 P0H0 *2A40< 8 0 0#2 AD @ H U^ @ A T<
L #K P03 $K R0/ #K Q P`
$K ` Q P4 00 p V P
X P0 T D X ATP0`p R R L@PcK R `p
?#K @ P K P0
<
P gD @ P X
, i( X0hX0(Ko譻(K@ D
0-LM0 @ sM
fC PI (NH0 SL L L0H 呻 C AP U
O83
03 倻 0 0 0(0, #6 2 x m 0 ) f#A R @ D < & _, XK0h K0@(v ^
-AL p @ Y @ @^ H` V
d5 #A R @ P/ D Q0 @0 0 S
^ @@ ^࠱ ^
R 0 P
@ A @<01 S S00 S
@ P# T @ z P
C T
V
= 嗺 V
@@
-sLLM P @I@
00MD X
Ǻ T
@P004 c@3 0< C c s Q@ 0l #640
! 0 0 0 0 R0"&*4 [ K D X 0H A X4K $܃K ˅ 0T 7 00 0<L (K$04P
Pe00ESRa^ ^W\
-2L0>0 0D0 @ 00 S
0 R /XĠ^ |
- Q 044 LM, 0K P K 0
-L `pP @ T
/) 0 /@ 0 $Ki3\
-L 0 0 K h3\ P / Q
R0-L P@
壴 T
埴 K0h
- 0L @ 00Pp0 U
S I `P 0 b Q50
U$`
p ` 000
-L M0 `Q 0 H@ r@
T pp @p P U 0 0 PP
0 T 0330 P 0a) P 0 P0 K, 1 Pp0
X ./ T
7+ 0D c 00 P (KD: ^
0- PPL
D@000 0 R
0000 0D
-LM0P`H 0p @ 0 J( 0 P 0 a, pP
$ 1 P p
x . p `h z V
* 303 * < 廳 V
0 2 (KE ^(
-L M@0` PH 0 p ( 3 0 0 Q
, `P
< * 儳3
3 C03 0 P `,
|. `( #0 S
i* 3
3p03 B* ph ^ W
(0, #63
3C03 0 *2 (K(Q ^
-(sL M0` P000 S21X"\" X"\"@ T)
3 S
@P"
3
030 00 Y
f 0 0l" 0 0/ 1 S 0 0@" 0$' U 0 0 `( @P
>00060 Pk
- 3x0 0x0 ; 0 0 <
僲 Y8
3
_ X
P T; 0 0 p ,n ) 嶲0 R
宲 5 3
00 S
X & O z) 嗲3C030 R Y
卲 U
0D cy V
000L (KD@^] ^f ^o ^(
-LCMp `@ K P@p } K K KPx- 0Q > P `= 0 S
@
0 K 0sN@:@ ` 0 @ t K P
a0 V8 4 Q
7
@ @4 \K[ \ K K0 K (
[ R $ R
Kh P
00
0 0 00
, ; Hp$ X W PP u [ R L P! Pe%V U P! ` P b2, B R K P 0Ƞ W`
c
d
KD 0`K0L0 SI UG
W X-
0 "
0 ! 1 J !1 1/ 0 S Y 1 S#
1 -1# R S( q0 Wa60 0Pe 0P 0 @0 Se
B _ 0pYH0 q 1 0 Xv0F XlK
, P !8 ! \
Q / 0 X*
0 Y&
Q# 01 ٰ 3( ! ~% 1 [ S0 0Ã P 0 )0 /, K!@ r j QH K P
# P 8 0/ O0 `3 S
0Hp0[ S000
0 S P `
K '+ 0[h' S(
0 S% 00KK ,0KP# K S p
P 0 @h ' 尰3 KKA030 0C0 @0 0 KK00 R 00 $P U
0 lK Z
? 0 K B 0 l0K
a0F s7 0 Z4
3 3 S Q : 0 01 =' + $ 1 00 0 0 [ P 0 (0 .0, K1 [@0 R0 "! Y K
31X" X" cH K1lK\" \" :3 00 0 b0 K K L0 000n` p 01/ P
# P ,3 4 0/ C p
PA
K X pp W `
Y0 P US ~& 囯03 W
0D c P
K V
V 3
3 03
2 & q m 0[ S09 A 00
000 1 R 9 P3 S
0H`0[ S000
P 3
3 K03 0000@* KK 0. KH`0 0 K 0K p !
P @ 0 y@0
0
+3
303 0 KK W @ @00K (K@^ ȶz ^Dd\(^ ^ ^\ ^ ^
-LMp$ K@ ` P P K* P$0 J T: T0%* S$0
U
t Ǯ y $ e \ u$P$0@0 S ,
# P
% U
寮$ a K ^(
x- @L`P Kxh
- QL pP`@ T * Y00
P
T
J T0 0! 0XT0 0 01 0X `
-PPLpN `h .@ . 0 @ ^ 0X
-. LM . K . .
R0-L P@
0D0 D D K0h
-L M@ ؋ 00K
-D0ML 080 0 ;
>0 K ^X@ 0 @ 0 z@ 0 @ 0 @ / /
-x0xpDPAD0L ` U
202 ,D0 D0 , @ P 2 S
Kh @^^ 0$0
@& 0#0@ #@# 0"l0@ "@ 1*@*H0@D ?6!:PT0 % S R 0% /^^D
0-l0LAP 00 S
w@0 000ct00h0m @ 0 @^[\^ ^
- LM 0 S / N:l0+ KK % n n k/% #& /$ 5T, +. K D ^?
-L$MP8 U Z
p0E0 #U *X! W Q SZE)QENPc@@N$~@pTH# ` U=
40K 0008 0 0P
S q
T R)
@N@
T `3J3 `# 4 i \!
@0 < < ` Pl @04 0 00K 0 p P
V (K0X
-@0L @ R
,0 " P P ,X
-RLDM` pAv p1 0 1ZL`K 00
! 0 0` !
P
0 0 PH0D 0 1 0, 4! 0 0`
P
A
0 B/\1 `PE:H 0` `00`0 0 !M` 1 0 S *o, <* | 0w p 00xy 0 00pH0D ,(K,X0?,\' !^7!^ b!^Q|Q ^
-LM >p R'(~, 0' p @ P @0 `
P
0p p + V `PT
0
0
0 0* P
(Kg!^\!^!^
-X1LM L1 p`0 P P0 @c0c K z1 %#K T0, j 0 p" P
3
03 0 0 0 \`p $ J P$ 2 Z
l K
" \ 哫@P 厫 Y
< >800 X iX(Ko肫(K,,X\!^( D
-霐L@M`p V *@ P T #3 U X
d0K! ' PPJ f&` V d0K " ``$K\
.-P^P L `@P
c
4 Kh
-L,M@P0 P00 0p1^ 0 N&, ' P 0K PG 0` D 18P 0Pp5A @0 00<0 0pgD0 80 S)
0 0P @0 S
0 0 D0 S
5( P
h % #z #A @0 < %80j:C80 $0 )0 (K,,X!^\
- @NL M@00K P3 0`P p U'
X3A3 p 0 p 0P X
% x00
0 m #ZE # @0 o%j 0 d)00 0(K!^,X\
x-.D0@N@ L ` P 0 L) Kxh>,X\
0-D@L P
P
@ @ T # 30,X
- pL ` V0 @ 0 S P
Ꮺ P 0 P U P0A3 0 S R
# A ## R S 0 S O! U
`F Kh( ^
0- PPL
D@000 0 R
0000 0D
0-L 0 @
P4 堩 0 S
0(
-L `p P U A 凩3 S
Ω@ 3 S &3 P03 L 復 @ B" T
0 0 p Ჩ _ a (
R0-L @P
塩 U
坩 T
K0h 0
-LpH KlM Pl \ `0 x W
l0\ @p H0 D <0 0p < < Dx > P < ps D04`d0 d 00b0 S00 500
$@< y <@ <0D t 080 00p0 $0h0 H0 S
X X 6d p RH0;
SQ
40t a: @PJ
0
P
3
Q 3 S40H KH$ %000@ 40H K H P
y
# Y 4 /h @ʨ3 S
40H K H 3 S %3 03 8@ 0 S
h 40 R
$@H 夨0 Q
40 PK " nP LK @ L 01/q Pg H K
#40 PKL b" LK 0 1/ P
# P 3
/ 0
H K X Y
VP0 @ RP03 Y
4 D 0D c P%
H K Z
Z P 3
P043
/P w )P T qP0# # k_ 0 d P K P
H K G \P00D 0 <
H@! 1 X% 0 d 0j P L! A H K4E# H K) P,
T
3 C003 (0 " ק3 03 Hh H Kj X00X0 S
< X0 S\ 6pc \ wp`0c0 S ` A (K^!^( ^"^
-L4M#K Pp Uz A` 0e S0,`K0&匧0&` cK` 01/# P ` x1
t
0/ PK p 4 Z: 0 W
W
`D @ ` ᠧ VD @/ P D @ K@D @ p0
፧4 Z
!0 ` 7 50 K l | z@ ` ` o VP
(K ^"^( /
0-<@L,P 0< K0h_ \
p- `ML @ ``` ` 0^ PP*
N 3 @03#3
X$ P T$3033
3D 03ͦ 0 S
Kp(
- `ML @ ``` ` 0p PP %
# 壦0 W `0# #
0# B# P3 @03 զ3 A03 K( 0 R : P 3 # / / 0 R : P 3 # / / 0 R
S01 R
S01 /
-L p @ 0 S
0P
00#0 @a T@1 V
T @1@@
0-0@ P 0L0c0 000 S b // 0 SK0h %
-00L S @P
Rpp p0 S
R`` ` /0 S
b W W
0 R
00 W
Q
V V
0 R
00 V
$Kir 0@ )
-'>8MLP0 0D0 $0 0!00( 00,0 0000 K "^HU8X
-LMK p ` `P3@0K\0 0 ` 0 0 P 0 0 0
0`v `3 P` V` R
0 00 0 0 S
0nk P
(K8X
-L` P@ 0
P #6 R
Q 0b
T0` T 0006 R
B
Q
@b0 0 F; 0` * R : S 3 # D
-L P 0T0
-L P p` @T T3H 0@0 P
0 D c"&0$ P
00 S
3/0 00D00D @0@
-tpL @` 0 S
! S
P ڤ 0 S
Jm 000@^
0-PL @ P
0 S
00 000
0- P @L 0 0Ym K0h A 010 /@^
- Lb f
0-p0pP @ ML 0 @ @@@@X80 @ @ @@@
0K0+"^ 3"^
-LLM@p 0H0 0040 0$$ L 80 0 0""P $& <0 T !$K<0 P 0000
000 000 g 80 RM 0 XJ
000 QF T C $<0 Z? 4H0 Q; 8L0 Q7 <P0 Q3 LT0 Q/ @ \, Z
a $K Q P" H R Z R 40 S P R
2/ e 80 l \ \ R 00 PX0
000 Q T $<0 Z 4H0 Q 8L0 Q} <P0 Qy LT0 Qu @ Qr Z
Kl0 " S Rh l H Q
^a \
H ^ \ Z! ( H ^
l \0 c40 Q
l b4 h Ph l 4 h Ph8 R
h
2/h \
B
OH R\
D D H H H U X0e X
e ZG
K W \U W pP@
K80 V ` 0<0 T $000 T 00H0(40L0@`80P0<0T0L0
% P
D`H D H p p R Qp% p @ @ W
Z
(K@-00 S0 @ Q* : S
@ T 0 @ T! 0 S
@ T Q : 0 00 0 0 @ Q : Q:@0 S 00 0 @ 0
-L M<0 P0 ` Q8 P@` *80 8L Q
H Q 0 V00 3
- 0 K P
T V)
00000 T00
08 0P S : U 0 `8 K
0 p
P
V 000 0 S00 000 00e 00 0, K 0 00 `0
0 p
P
@ T
0 S :80 p V
Q * W
\ Q 5 : Q : W
Q
* Q * Q
Qp! p Q : R R
* V
R
\@!* R : W { S* V
e S8 S8 5 `@8 K
0 pg
P>
0 S:8 V0 08 K 0 0e80
0 pS
P0p J
0 S$ * V @@ V0 0 S
R :@ 0 S * V 00 V0 08 K 0 `0e80 @
0V p*
P
0@
0@ P
V00
S
000 00 V8 K 0 ` e8 0
7 p
0 S00 0 80< 0 (K
-L$M`p0&$ R @0 P
] P V p` 0 00K P 0 < 0圠s d
R
\ ᥡ 2 0 4 i4 ᙡꤐ 0 T @0 4 S *! W0
0 Q P 0P0 c 0 ` p! # (K^0X
-L8MLL0 0 0!0 ,0 0 00 $( 0 K "V
P :<0 Q R P RT / / /
-L,M `@p@0 :#:
IH
P0
P:L0 Pq * T
0 @ 1 0 R
11 AD0@@ 0 0#K*CK U TW
0
S @ PA SA 0@@P 6 4 0
0 @P
Z6
0
03/1 @@ T@ .
)
0 D0'& R P U
0<46 S H 0 0 0 0 @P
0 (K\@^DN /N /
-L M @ *< Dp( >0>0 Z| #6@0 0 P8 t 0 K P& 080 _
R\ *
R" : Z
1D 0 $` " H X
墒 V
垒D0 T# : V
X
ߒ00000 000 S6 P
Q QD T* 2JP X 0 D a P
0! V 00 S
00 "a 0} 2JP < D @ ` 8 (KL\
-L\M@ @ @ \ Ap !@H \ n(`` R 0n #K`
h *H P
| P
D 1 L0 3/H0 S
D @ PH %H0 5 PH H0 0<0 @0
b P X
0$ \R
@0K 0<0K080K0D0K 04K 00>0 44>0400 T4n`n U`
0e S *
ꠀp 0 S * P *| 1 4` dN@N@ T *( K. PH
( 0+J(0 K@X,#^U#^#^\
-L$M@0 x1 00 4 S< \
4 Q L0 X :<81 @ T01 P $*0 0 0 (Ko 0 Q P U `
2 X :`2 V80 8E≒p Z I @ @ J 8 P00< @04 0 0P 0 0 P(KD#^#^#^@X$^I$^|$^$^p@-\0\@ 0 S
Rb P : P * Q e p0C0 p@X
-LMK p 0 0P 0 K 8 /
-BL$M 0 P P ڄ0 S
bတ O pP X L1 U 8x A 0E 0 2 0< PQDP @0 8 P 08 4 K100 4p I0 KG ^T !H !0H00 SE
Q Q 8 4
Z
8* 08 4
0
Z
8* 0 8 0 \40@D 000p1P UD@4 Td U
< 弼 (KD|$^$@^x 0 N :㒭|
-L M `8 <0 P 儊p2p@ p80 #&0 1 S
$t l Q
? Rp x R _ RP , R r
( R ! Sk P U X
X 00K 0
0 pP X
T xd0K
0~ pP@
@!0 U
Q ҵ ĵ80I `(0<0#,00 S 0
p #
V
#d L U
# X #
8 L
05 pP 8 (K$@^D| %^@Xt
- p `L pBB@ t q $Ki
- L ` Xp@P
[ W
pB $KiO
-3L MP0 S
0 R 00 1 P
r 0< 0 80 0 `め P 2040 @ T
8 R P 0 P P @ 3 @ 孉8 P) [40 # R 40 @ R @ 00000000000K <ʉ P (@ (@8 P @ P @ $ $ u` Vk 0 R @00 0`< 000 S[ 00 (Ko/(K@^D$|
-LM K a K 3 S /r 3
-0C8L#8 S3 0 B D
-L @ Kh2
-3L @ S 0 303D3 S / 3038 3038 8"
- L
-8 L 0
-#L @ R/
P U
O303 0 S
3 B#
03' 00 03
93:#033 S
0 Sb $Ki P U
0 S
P@ _ P
t3 a S 030S0C0 08 p (!030%T!P 1 0 S1 A 0 U $ $ 0 0 "1 0! R!``A 04 000 R(00ӵ0$Ki5tD$|@^@X
-2BrLM @4 @ 㫇| 㧇p2 P 0A.D X S 0l 02 $$ R Pb E @ 1 h 00 R @
80 0 @ T80P wtAd T1 Y6 P0PbQ%&P0 `00 V%
P0 8 < @ D H L P
: P * 8 8` @| $. . $4. < 0( , 0(K@^ |($@X"%^DP x
-L p` P U A0D s
3
3 03
03 P
- 0L S 0 S
厇
-@LM 0P S
0 R d`0& 0K # p Q
& (0 KD0X
0-0LM @K@! @@@ h0 KdP 0 ▆@@ @P0@ 00 0 S
3/@ TK00XLX|\
-1L,MQ1 p 0`0U PsPHl1 h 6 8 @ <0 H1 U@,K 0! 8 0< [ P@&
U
t0 S
0 0 0 0 0岆 08 0
0 D0 [ D0 0 00P V
@ 0 x`FZ0 l0 (K@^|D D N%^V%^
-LMf p0P S0@ 0& R 0 0 e P( P 0K !
0 S
P0 Q N P
% K\D0 00 d]V|
-L MP 0@ 8 p00 R
Q`
c&a`` 0 @ ԅ|҅ U@
P
,(0 @#6 @
Ze 8 V<`
100
R 0 @ @ ᯅ孅00320<0 U!
@ 0 R3 03F
U 3 03303 V
00 P
,(0#6 0 0 3@
@030 00#
#! !# # V
0 S <0 S
寅00 & 0 K1 妅 ᤅ - V 8 $h 噅 ᗅ \ HP@ UL X00X0 U
U
. $10C$1(K(D
-$0LM K K \
- `pFf'z1
00Mp'L @
p P U0 P 0 W
0
RX C Z $K
x-|PL l0 P P @L 0,0 S@<@u P `( `s @ j D xDx
0-3L @ P
P
0 0
(0, #6 0P
3 0300
0-LM P 墄|0!x00 R l00 S ` \0 @A @L0L n 0 0, 0K0$@^|D`%^^T
-T0L < R 8 K hN@0 R M P PD
-L 03/
0-,@L P Q 0 PPK0h蕄$D
x- `L @ V
( U Q
e.
U
40 ! ! 0@
0 00xD
- @LP L @d, @ Q 0 0 KhX$D
x- `L @ V 0 P P ᙄ P
V 3 #03 B# x
-5LM!5儕 |5 00 d+ Xك0HE S
0 S
ڈ R
(5( 0 %08000 P0 S 0 R
4 00 岃P 嫃 0@ 0 S 00 S 0
X 1 pxp 0 1App `@ f $D 0T0p 0@ S V
; P
0 0 s PP
p Wڼ 0 np#
10 1 X!! !!# H夃"
1/L
\ #
P# ## !
(,
1010 S 00 ! o Xڀ X0t0X0 @R
Dx X
, K P j Py
| x p t #
#A F xp P
(,! pW
p ,0K p @/x K `ނ$10$1KH$x K4ӂ @0,Aa R T P0 R P V@ 0 c <0 R ~ 嶂0, Q 0 S 00 0 #0! 垂 0 c . d K#( #ᎂ
` Ղ@^|(D$] ^ Tl
x-3L @P
xi `P
3
@ ᲂ x
-L M P
H KK408@@0@c 0 0C2 S< T KDt
x-\`L P P@
; ` U @
0 5,0 @ U
/ @_ T x
- 1L \ ` ,8 0P4@8pD P AU @T LW BUIH`P Q P P TP0 P0 0 W@ \ p
U
Pp@ @pP0qPr@spp0D
0-3L @
x0 Q #,# B 3\ J00 P @ #,# 0
-0pL` @ P`b T
U 00 U V S
3
PPE V P
(1 `F0(1ҁ@D3
x0 Q #,# B / / 00 Q #,# B /
-L @ 0 0,0 @ #,#
-ALPp0 S 0`p0 t` VK
3 ` VE
0Lq t0 10 1! P
@0
1 01jh p W
0 R P
s0 S
0 0 S P
X |0 R q0 S
X$ 0$ `
r0 S
$" 0" D\PX\{ /3 / P00 0 Q00 0 /
x-@` P0PLd ! 0 P@
(
4 @ PL 2X KxhhV /0 0 P /00 h A@ Q /D
-x@Lt ( d 4 X @ L L @ X 4 ,d Kh%^%^%^%^%^%^%^
0- @LP R0!00 R000 h0 B # $ B$ ( 1 B 03 03 0 0 0 00 0 @ @ @0D
-LM< l h1hP< @ TH
0 R< 00 0 03sz ` 0 0"180 8'tp
!1 R A8 8 Q WA
0 $ $ 0 R 0 0ӵ0ŵ(Ko
$@^D|EX
-LLM`
SP!Z3p 0 V 0#02 S4 + NA 0@ e S$F
:0
U0 S
lh4(, 0 St &f'v*%V `f Hp < pE eP` 0 T 080 8 0 \[ 00 SR H0 SK < XG * P 0 00Hl \ 1p <L R 0
0T \ p` V l P(
^( L\0 \!p
4 R
P F"
00
0 P b D LT@ ( Q XPH
Al @T
8 P 8 0 R0 @lb 'v 4p *0 H
D2(, 0 S X (R $ 0 RM 0 SG 4 ` 0 \ p< Z: * `
V
`1pgP ' S 0! < V Q `C \ p S0!
P `!
`1pgP '
<` d0 h kY` d0h
`Pp0i0c` ` @T
P X
0@ 1 ~0 R
X
z0 TP( @0D S 6@ P @ 0 `c `_ b
b Y 30#(K$D@X%^
-L,M@ P` p@P 0K T0 8#8 80d#0 8 \~ 0 000 0ᖕ Pş
0 G5 0 "| `Q @8y Pp
pwy W
P p9 @ 4004P0 ` S 00! $D X4
y a P
RyH ȍ P Cy ! 0 ᵳ P
K .34` V X
X
!W pP
,Kᗗ p K!W pP 0 d0<0@0 S0D0?င4; (0 SpHp0 0 Wc 1 n0 1 1 V " dP X$B¢£
J ZLŤ0
Z40
pj$ I ">K P 0 S
! 0 S 0 !% P
儿1 pp(0,Zx0\000,1L L P pPpx p8 p p0 P
) 0 V
!+W W'
8x ~xH E PB 'x { P lxp 0 d exp
p p H # (KD ` u 춂.'^&^ .]&^4&^'^7'^W'^ q'^X~'^ V'^.\
-L K ㈡w P U)
@ T$
0
4` L P#
p
` .8 <0 R<00<08 0H BH V
H 8@ PT < w0 ,Ko輡 p w W
'^` '^D;,^
-TL MH0 `p SI 0 S QF
0 0 w1 P U3
@ T.
)
P# 0 00 j p 00
8 <0 R<00<08 0800<00 @800 00 0T 00T0w( 8@ P R W w (KD
-ppL 0 . 0&W
-L M@ P ` R 0p @ 40 0 N @ & 040 0 0p(Ko\W F -G
-LMp @P 0' `P 0
< # 0 0 0g `P/ Y =v E Z3
Y03 0 0 0O u
303 J# P010#0 S#0 `(K'^'^
-LM P0 ` @ p(
`Ip \1 09 S
Q
+
04 0 P40
`JTpL P0 R
\ Jp P W
04 0 h P40
`0 p(K
-鈀@L| M P 0 `ud X0
0
00
0 Qu DC(Kou
x- `L @PAu D KxhuH /H /H
;P s / /^ AAALAA`AsG 0@-CIJ T1 ! P 0\@P4 @ 4 @ 440 L0 0L00 0
@^X(
-L M @,
㶭$0B 0 N?6K脞V'^
@ -L P Q 峻 '^ 0( 0h0 0 0h ` 0P
R ud / /
0P -L
P
- QLM p0 | 4 Q e00 Y` 0 0h V 1h # Rv V Zq 0 帼0tQ0 @ TV
X S 3 R@H
K$ K ( K0 KKK KH K KL K K 0 @t K Cn s 0 R R
00S0
)tY0f Hr@\P U @ tG0 Y # (Klp\0` P / !`80 00 , 0 00 , ! /@^ȏ菃쏃0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃P 0%h % # 3 /h L01! 0 R000 R? 0 P 00 /p
0-@LP P Q 幹00_ Q l 岹X0_ 0 SP L b@ S d h0 S
P !0Xh(^.(^0X
-L 0P'3l %l 5l !p h
-3C#LLM rt rx n;h0P S 0 0
,K ! 0 K1 P `" @@P3 D3 @
X 00@0@ #3v3 00 @@@ 0 i䒟䢟 @t
W"'5"0`㔖&8 "28
W Q0 P) 0 P F@ ` TP H 0P# \0 @L0a1:l 2' "0 ! p̠0(0 L0 ,0 0 @ @$@0p< 1 㠑0 0!1P' 0 0 P @$@(P,0pHټP1< 0 0 0 0P @@$@(P,0p ļ 1 0 0!p0 0 0 P @$@(P,0p 尼0l` 0 P @ `$@(P,0pw 0(KHQhVH(^0XP(^*^p(^ v(^}(^QX<L(^`VD(^VX(^(^(^
- L N0 P ( dVh(^0 00 P 0@-P@DǑ Q
I U T \
t 0h
0- @L qP0
M: r 0
-p PL` qǗ 0 @ S *! R
Qt !!@ 0h q T
U\ P P0 < R 4 0I T`P V hl (]^(^
x-`L`BB@ @@@@@d@| 3 @0@$00 0 0P V 0 \ 0
nqT0 0T0 Kxhqx谴V
-\ @L` 9 H9 0"8 00 , 000 00l0| 0(^(^!Ce
-RL `p X 0p Se :l S 80 S
m p0l@ c! c3 T S %q8@ T @ T
0
00H]q 8
q X
$1! 10 R-
L t@
_9 9# 30000 0" 0#)$t0P Sx $x x0t U
p c# !q H q 㧲 @P
`0 00phl@^|
x-H` QL P 劲 @P
G UP 0t``0 xh
- @L 8` Kh8
-L @0 Kh虲h
0-0 @Ll805000
zp0 0;0p0 000 R
:0
3010 S Q 0 ST
0 S ڤ0
2
P P
9 03/ @p0P
= U0
" " ~p 0 S* 08 8@ R0<0 00$ ?$00 0 00000 @00 ? ` 0` 9000008 0 S
l0 C Sl L 0 K0h0 hp
x-,@L P` o J Kxh pl
0- @L o
0, C P U
0 0p 5/00
o K0h Y8 K0ho(^
0-DPL 1 S
A 0 R01 0@^
0-L @[ P
0 0@0 P! ! @A(0 K0h K0h@^h
x- `QL @P
eo UPf Q 0 S$00o Kxh Kxhox
x-@LP` T P $0 S@ @ T@ @ӣ Kxh
-L @ P Kh+ P
9 ( Q
0 3/0 p o o0 00T01h" h"! 4 Uo o0 <0Mo Khl@^
x-`L P V
0 Sd p P
9 S
9 (0 R
x @ 00$A@$@
40@
S
T
* 0* + 0+ 0 00&
n n0
=0f! n 01h" h" n0
=0 VT00T0 n T00 0 O T
@ xl@^
x- L = @P
X` P0 U0e0 `0` 0唫 0 0$0 x xh
x-8PL ` @ T p0 R P @ xh
-LM@K p ` P @1\` ^0K\0 0 0 K0 0 0\ P0 0 00 0
0GPu P3 PP U0 0 R 0d S) 0 0p R lb Qp l R pa Q l 叶P nD@ l0 P c P Gnw (KXhl
-LM @ `KP PU $C$0$` `40 VG
< 2萠0"8 8 k葟 0P00 p m _ P ! Q n b !x R B!Q6 m X
0 U 1 ! 0 X
p ª00 P,00m PfPl P U m P4
9 P
405/ ' Pp p R:l R ` @@ ^ A Ja!Q# & Q 1 R 1 R
< 4
< mk0 _m P(K)^@^h|^lD
0- PLp Km @P
0P P :07G Stt0xx ~@m0 0 > 0lhL
-P0 @L p+
Q(
50l0 U0l0
_m X `
o5 5l0 ` C Sl ^L0 U
l V 00 @^|lh
-L P`p l(
0 @P
0 P
p
L mK QP. @P
0 P
/E'7 t \txA7@`Dp 7`p x 8`0 0`p & d 0 18 1 p 00p `2 < Z
8 U 0 ? " 0"4 00 Z0p Q00 @%
W \<0c Q D V
` XD@ D@0 @ D 0
X 4 j Q
m
PE4 k$ 0$ᤀ 0 `P 00p V
< R
0 S p 㼬
`A00e0& ?&(K PԠ^^ӂ
0-(@L$P jH 0 >^3)^X j
-X L ^j
-,8ML0 P0 0D0 0 0!0(00,0 000$ 0״ K ;)^\V
- R`LTMP0 02
0O S - Pp t K= ղ@ \@?'KD _CK?&KH `@?&KL _CK?%KP d@?%KT _BK?$KX ?$K몲 p tK 0! K
-L0 M`$K P0! p& 0 0 A T
0 S 0 S P
X j0 S(0 0\0
Ej @ Kӂ
-L 0P X |! U pA i0001 Pa i
P j U i000 0X`y1
p W
X ( Y 0
# i i h: P
i000 i0 00i 0 p i0 00i i i 0 0 0i ! i @^
-L 0 W 0 0,1 R PA si0002 ` li
C P i U ai000 `X V W0 80 0Ri0 00i i Hi i 9 P
?i000 i 7i0 00~i ` @^
-tL Mp40 @`10 q P` i Z@
Xp i 00 R5 @ T2
T0
i$ $ Si40 S
04 0i S 0 0 Fi Di" ' 6 h 9i 7i 9 P @
40 S 0 0 0
'i h( ( i i (K@^
-LM`0 P p
V $$2$B 0 R h ( 0(_ h 傪 h y 0P
<0 1<0X hX0 80 h Y \ < P80 RH HL ᐠ YL
P R PT ᔠT TP ` @ `,KD @ `! o ` p ! R ! Y Y
R . R . R
Q 8 h h(K Ԡ^P
p-l1 M @L @0X1@@ L1 ` 0@1@Q@a0<1 0ᢨ h 0 嗓 0 呓0 @ 0@ 0 `0V @P
0 0 0傏0 0 0{0 0 t0t0 0t X0ml0l 0 <0fKp K)^VVԠ^^[\3)^pVR)^g)^X])^w)^)^x)^)^
0-L@ PL 0+ c ę 0 @C 0c@ }gA0^
-,AL M 40K" 00K P @ g40 000p`P0 0 S
R Q P U
R 0 S g 2 .(KԠ^
-L Mp P `Eg @ T
P0X
00 8g
g W00@ V @ T
Xp H%g mg D
@ @P
X `g 7 (KoZg
-|PL p gl0` @ T
XP @f0 S
d0 S =g@ $Ki6g
-(0LA f 0 0 0Kh&g@^
-(0LA f 0 0 0Khg@^ h
- LY
-L0ML 0@0 040 0(0 0:0 K )^VV^
x-0L w|0 @ 1 18P ` 5 P
7 P
7 P
7 1 100匐 x@^
0- 0 PL1 18@ y 8@0@^
-L @ | P
7 P
7 P
7 0 Kh`
0-80L @0 S P8 8P0
- @L80 P
Kh6 ,0 \ / R
20
-1QDM @L 0 @ @0 MX1`T 0 @ @ Bv e Ფ0@01 A0 0!p `0 (0 40K @@ @$@,@0p4` Z0 0 0!4 K00K @@ $@(p,` G'>X0 @0 0!@ $@(p,` 4 K00K5(K)^ )^X)^)^)^
x- @PL,
0 S` P'
Q
0 S 0 ǢPU` Q
0L S 0 巢 0 00 00 b xX
x- @L P T
L` v|e 04 R00 0 e Ꮲ 0 0x
x- @L P T
@ H 0 0S x`vQe 0 S0
Q 8 Q 0 @e @x
0-(@ PL +e0 0C0K0hpe
-L MP0 ` S@ 0 j
0 q 00 Q
0 S S RY
Q
S R 0@ S 0 0 R 1v40 d4000 0 R P
0 0 R 0 40 40 e b 4 40@ R 0 0
a `(KX
-鐀L p@P Xh 0 ` 0@ 000 S0 0` 00 000 X
-L `
P@9 0 0p Q
0 S S R 0 S 0 0 0C0 00C 000 B 0p Kh mX)^
x-L `P \@
\
R
R x x 0 S P
0 S 5: / / P /
-LIM ` P 1 @Q8 1(1 01 1 @ T4 @ 5 5 8 U 01 V 1 1 S C! / C (!B P ! Lpp" F KE/K0 P. q D d8 w4 ! RB /B a! V B n
Rl
V
d0 p4 WZ
4 q8 P`
Q4 R z 0 SO 0 U
K B P
}4 < 1 l2 pF KA/K 8 0 q p 3B j4 Z8:
q # Z b0 00 `` 0000A0$`(,`4 ᆫ0 H `0 ``` 㘡X0 L >@ < %
(Ko^u]*^>W*^Y*^\xV1]
0-(@ PL ``0 0C`0K0h.a
x-`L @| ` P U
P
dP\ 403/ 0 @ Sd d0h 0h``0@ @
a xX
- @L| ``0 Sp0 0 S
S d Rhhh d0 0<03/\ $ @ d0@ @ ` X
-h L``0 @ T
80 S
`0< 0`0`803/$ ~``00C`0d@ Kh`X
x-L `$# @P b T V
<0 V 00 P % x0 0<@xX
-L M P ~ ACK R P @ U$ R P @ U
A ` p U T
cK Tp ` p Y X
a Xp \
@ P Y X
A X`(@ @( P !K S R U T 6 cK Vp Y X
T , U T)
K R Y X"
U T
X` K T 0 U T cK Vp X 0 U T
, (K*^
p-LM$0 @K P `K 0$ ` 0d P
0 S
0 S( Kp (
- L' X
0-L @ P, P
48 Q8 0 8 4 (P@(0
-L @< L 0 Kh舡
-Aa W V L (a W V (0@T PA(0 @ P P '@ @'! 0!0,P00! R 0!(0(0(@(X
-LM$0 @ TD
$`K0&,pK p 0 @P9
, D P 3 XVtVVV V,0( (0 , ' , Aa W V ! 0! ( ,0( ,0( (0 , (@x,0A@T P( A( (@,! 0! $K
- &L$M @ D ! R R R @ @P @ 0 ` p
P 0 `p`V p `T p @P T 0y R
R
Rr I P8 n 8 P
P
Pe r 0 R
/ P U
D ^@0 P R: @0Aa$0! @(@ ,@0 R
R
R' 8K8" ؤ PPo
0 #@ @ ;
0@ @ 06
p S* d^0 S ʔ` ]^ Q
^ Y ^ ^ P ^ ^(0 @
@31 1 T
03 0 W @ 0
@ T 00 @ 0(P4000 D8000 4000&(0 @ S
48 Q8 0 804 0(0 T
| @0,PKp @0%0`K0 ` 0P W@4 @ 0 ( s 0 0C(@ Sl PV|VVVV0 S 0 S ? 00 0 R IU A! U T 40 0! 0(! 8 KG0 A 0 S 0 S
0 ,0 S
4 8 P808 4 (40 8 0 0400040 W0 00( ( 0( 0 40 p(@(! R 0!(040 W40 000 (0! 0! @ " P
A!A@ @ Pa W V @ P
A@VP@ P@@@@ @x ! @D ] X
8 P
@(KXX@^
0-\0ML 0P0 @ 0D0 @0@0@@ 㻝$P ] K0*^HV@V
0- L3 @P
D0 0 P P 00 $ 0 0
-L M80 3@`ሑ P 0 p
=
1<0 X 0 . 008 0 d 0 X
R'
= 8 1 Z <0x@ < 0 _/ * - 0 - 0 - 0 1 008 0 0 L0 ! 0 d0
- -
to1
Z L0
d04
- -
$[1
0K 0 =; P zw 0
7Sr
Z80 l 0 S
0c 0 0 00c 0 0 0 0 S09000 X
0
)= 0 $1 0 P
, 1 U
0 , ? 0 0 S3 , 0 c- 00 R
8 0. P U
pP0
X
- , X
< 0 - 0K p W
80 < $0 0 0
(K@^4 *^\0
- PL
P
P
0 P
$ @ P +^ D0 R
P *20 / R R20 /
-(0 @ L ޝ Kh
- @L ܍ P 0 @00
0-L P @P
+ 0 | P 0 # 0
x-L P` @P
+ 0{ PP @
x x
Q-L@ Kh P 0
- L @ R (0 S 0 00
0-PL @PE UP 0 mP0
-LM 0 0 P0 0
0 000 p0 P f
0$0 Q
0 0 L, 0 @` ? 1 18@ p DŽ` V
0
l? `0 0 0 H F P
0 @ / R
0 S@ 0 @0
S@@ ` 0, >a> P
,
0 S
0 1 `1` $ p 0 P
L> 0 S
0 S@ / p h@ p00 00 0 S 000< 00 0p 0/ S p0 00C 0 S& h0 0d@ 90 d R
0 S 0 d=0 S3 p0n p0 h 0 P 0v /+ d0h0 0d0 h d@ T d+ @@@E
n @/ T T @@ \ l / \@
/ ^
` ` R )) Q)) ) R . P . Q*
* hh Kd0K& @P
h + 000000 h P * + d + 0000@00 * R$
x0 0 S * R 0 0Ɨ x0 C x < D; x 0 0: x 0 0/ S
d h * 0pd0 0 0 SZh0p d0 0h 90d0 SX
S h P
P r* * 0h0 d * d * d d. p 0 S
h P
d dd Q
* d * 000d0 0p 00 0 S
: S; @i t 忠 R
0C S h0 S
d P
t* 4* 0h0 d n* 0000 @00K p0 d ?: p 0
h P
d0 P * S* 0h0 h0 @0d00I @. 00 0 0 Q0c 0w h0 0 <8 x A$0 S$ g d0402
0 ?8 P *
h "* d * @ 000 T
0 S
0
0000000 0 RK
0 F w `0K L0 0$K` 0 `L K\ 80 < H [n0 LK s9 P
<y 6 0 S
A
@ 帚0t /|0 p @@ Rt { R@}
/ Z
0 S
0 S *0
S P % \ t0/ Z @
@ / Z0 S
S *0
S ֽ P \ t / Z @@ 0/|0 E / Z0 S
S *0
S , 㴽 P 5 0 Sd t0/ Z @ @ 4{ / Z 0 S
S *0
S 㕽 P
\D t0/ Z @
@ x/ Z0 S
S *0
S L w P 1 3 \! t0/ Z@@ / Z 0 S
S *0
S U P
b \ t0/ Z @
@ {/ Z
0 S
S *0
S X
7 P D3 0 S t0/ Z(
@ @8 3 0/0|0 / Z0 S
S *0
S P
x \ t0/ Z@@ 9/ Z0 S
S *0
S d P 1 / Z0 S
S *0
S P 0!X KҞ \ / Z@ / Z0 S
S *0
S ¼ P 0 x!X KⲞ \l / Z@
@t0XK / Z0 S
S *0
S 㞼 P 0 X K⎞ \H t/ Z0 0XK0 0@t@ } Z { T" * p0i4@^9+^@ a+^Y#] >+^]C+^]8<]J ] ]J+^]]48]P ]X+^W+^io]]+^\+^ |0 S
t _ 80 t P0 ? ' x00 S0
x0 . R
. R 0/ S x 00 00 ( + 0 / Rx 0 0 00C 0> 00 SCF@ 000h ' @@0?@00 (K
-LM(0 0 0 $ 0 0$ K0V K
-(0LM 0 0 0 0 0 0 $ 0 0$ K0@ K
p-L$M0 @ P P? \ / PP V ` (0P4P,P (P 4@ 00 $P , 0 , ,( 0< 40P
Kd P -
Y o Pe7봔 P , Kt K F P K zF P
R 똔 ` E K@ PeVL놔 P (K@
- L @ 0 !""0&%$#p`P@x|((
0-LMH0L P@ P0t K` ? b U
. # Q00 1|0 Rx | h X \ t d $ t K0 S
, K0\Ho]].^wA]
-`ML00 @ PY PK 0 P , ,p KP U
0| ្300 K0 S
V nr P
P` K V `KT0 S
P K U
m Kl
/^&/^
-L Mp P` @
U
I
0 p@ 0(Ko
0-L PD #K@0 @ T
Pd@`00`0 `K 0XH0
P0-L @P%
p H 0 x000H0 0*%+&)%*& 6 2 + . KO +( 0|00
-L,M@ pP` 80 5 We
U 1810 SN
坌?, K00" 03 P D < @0 Vt@0 0 0< 0t1 0D t Z
㪌
H 0 < $1H< P 1!
@0 D 㕌@0D Z
/j 40K9/ P( 40
4 40K9/ P 4 +bY V
8 X0H@ RK D D 40K +bB (KX]A]A4 0 /@0 0 /\
-L @P P?
0 S
5P d`0 P 0d @Pd L0
e P
d E40X M8540 0340 @
M840Ed k T Y
? @ 0
P0dL04 \
20 S
80 -@
`P 0C @P P
:E40M( M8040040 800804 " 2 0040X 0 P U @
X p @8 40 8 040 T\04040MA 40 S Ȝ @ S
GE T4 \ d V.
@ 0 P&
D404 V @ 0 P
340040
00 `P
PK X0 @ @`0 S
P P
` U
v @ (K\d\T] }0^0^
-LM0 K
-LTM p hK P; h0 8 `0 < d 4 d K `P
h PPh d@, y 5% `` 0f
`P
" 40 L0 7 P K
-LM p AD0 @ T
K P l` 4D4P @040 !@ 40@040 qD K @ iD K
-L
-3L\MPt K ] P t0d` 0
S bWTbWbWbW cWdcWcWcWcW dW,dWdWdW,eW , d KP dK @P d K, d K0 d K @P d K $ d K0 d K @P d K$ } ( d K0 pK < @P pKd K @P d K( h pK < @P dK( < @P| pKd Kt dK < @Pq dKj d K @ P dK? dK@ < @P^ dKW pdK@ P< @PR dK 0 000 B pdK@ P< @P= dKp K @P7 p K = @P1 d K
PdK@ < @P' dK @P" d K@ = p @ P +w< @P @ < @ @t K\
-L M @ ,KU< P ,KK
-L$M ! p S@ 8H ! PP[ 0 S H `!; P UN
P Ʉ?,PK00% 03 ` 8 <0 l<0, 0 08 P l U
) 00 <0
P <0
P 00/ S
S d 0 SP
< +
㰄40o8 0 (K 4<+^
p-`\0LM P@ K P 0 0 0 d 0q @ + Kp\
x- `PLH t @ 0 `P < ` ~t x
p-LM @ KP` P
0 0 d 0!09 P Kp@^
x- `PLH Tt @ 0 `P < ` Ft x
-L$M P@80 < 4t p # B1 @ `@ V1
0K P* U T" * 80 D D 0P D0 0X X > `
0 @P 1 0 6 -@ P
B (K@^
-LM x K
p-LM@ `P0: P $ K P K$ @$ C T @
Kp
-LM@0K P K i8K
-LMP @p`0 P $ K P K$ P$ U 0 0 0 d 0 @ K
p-L M `@P o 0 P 00 `P #8 ` o Kp
-LMP p0 P B/K @P ) PP 00 1`A 1 ` A K @Pw X0, K8010:#:0 $K: S
S
S0
S0)
S0
0 0 0 0 $K` 0 0 s 3 Q S $K ` p S R ' R'
Q
) Q
Q1 A?K( 0K A?K(` ~ @P
A?K( 0K @P
@ @A?K ( P
X
@ $K
0-LM@@ 0 cEK0
0-LMA@ 8K00c 10 c: 8
p-LLM`0 1 1 d0K P; `K1 @P! 000 `0P\@ X0 4P \K, @P H0 S@ d0 S
D d0d R@
\0K( @` d c
@\0K(D > D H0 P W
H P
Q
Kp\\
-LM0 c 0 K
-LM0 K 0c 0 c 0 0
0-LHM XK P9 0P,P (0 X0T P0 $ T K @P
X ( @0 S (0 T0K(< < @0 P 4
@ P
X j T0K(@ < v PP
< <
X Y K0 c 0& 0# 0c
-LM p@ `P 1
(0 S) 0 S&
0 S
S
S @ @
x K Z JK@P@ P0@@ b
(K
-LM p { `P!
0 N (0 S 0 S
A@0BK0 @P ,0K ၜ @ 3 $K
-LM 0K c K
-LM p = `P!
0 (0 S 0 S
A@0BK0 o @P ,0K I @ $K
-LM 0K c 螝 K
-LLM`0 @p C hKPTP P; h08P < `0 d 4 P \ g] h dK4P e @P
h X h PpT V ` @ @ @ # `P
` @ K
- ML0 c K
-LM K
0-LHM@ XKPG P X0P, P0 (P T TK$ @P @ I @@ X K0
-LM 0 c K
0-LM@PK Pc @0 P 5K0
0-LM@PK Pc 0 P 4K0
0-LM 0PK P @0 0@ P 4K0
p-LLM @`KP P T000 `04 \ X0 , \ K `P
` H @H Y ` Kp
-LM0 c K
-LM0 K
0-L0LM P@ K P @ ) K0\
p-L M `@ K
P 0 P `
Kp
0-L0LM P@ K m P @
K0\
0-LMP0 @ D0D0 0K P @
K0\\
- ML0 c K
0-LM P@ K
P 0 P L
K0
-LM K
0-L0LM P@ K P @ X
K0\
0-LMP0 @ H0H0 0Kw P 0 ~ @ :
K0\\
-LM 0c K
0-T0LM P@ K P 0 0 0 U @
K0\
0-LM P@ K
P 0 0= P K0
-LM K
0-LM P@ K P
0 00 0 P K0
0-P0LM P@ K q P 0 @ K0\
0-T0LM P@ K X P 0 0 0 @ K0\
-LM@ S11 \ p `@K K P 0 S
2 P
\ K P0s 0s K P 0s 0 S ` 0K P`8 r
K! P
K%K P Q P ̀T0 X K0 sK 0 s
|K XK \K U,0K!0 ,0 P C V
" $K\\
0-LM P@ K/ 0P 0 c h P K0
-LM0 @
S K
-LM 0000c 0 0B K
-LHM p` P
0 S
DK a1 P D K<0 ! R@0/FK\0 ,0 ! RA0/EKL0 dK 00 0$K
-LM 0 @0 K
0-LM P@ K P 0 000 P [ K0
-LM 0 0 K
p-LMP R ` # 0 K P t} 0 S@
@P ! @P K )KK! @ Kp\
p-LMP R $ KS P 0 `
@h G 0 S`
x `P Kv )K0 K ` 5 Kp
p-L M P K& P 0L@ 0 0 ' ` Kp
-L M 0K P. 0 0 @&
00 "
0
A @ 0
`@P T0 `pH @`00
@ @ (K
p-L M @ K P 0 x PH 0 0 ` d Kp
- ML0 c 0+ K
- ML K
-0ML c 0 K
-LM c 0 K c 0 c c + 0
-LM `@ $KpY PP $ `
KD 0P P* < ` 0 Q
`o 0 0 K
- 1L`8@p P `1 0 0:1m`
p-LM @Pp K a ` V d0 P 0 `P Kp
-D0L M @ K P @ K\
-LM @a J 1 R0 R 0 0 0K P 00 @
L
0 S@
`
0H @
n @ (K
-LM @a$ J 1 R0 R (K P (0 @
P
0 S@
` 0( @ = $K
x- PL @ Ƚ `P
g80 `080 Kxhgx
x-L @ P T
P
`P3 P@x
0- @ PLp 50 S
` @00DP 0 S
R R 00 @PTh P
Q
P Q / /
-aL p$ i @ P U
P@
P
8
R Y P TC X?
$ i @ T>
0 S2
@@ T
0 S0$ 10i $ iP p5 T 5g @ 5 |0100@ S 0 \0 C 0W5$ i $ i p 4@P@^d
-(@ 00L Kh35P
-X@LT$ @i( 4 4 (/ ,~ 0 0PTW0^1^
0- L P @P f P
@ @@80 080 0 0
- `PLP/
800-
: 0 @ S0 0" ~ ` p # P
0 0P X0
L 4 P 4 @0 0P 4 0 0 PT
0- PPL
80
0 @ S 0C 00~ 0 0 S 0K0h~~$ Q4 0 0 K0h40Ph
0P -L 80
P
0 S
0P s
-L M p P` X 1
@ "4 ` E~ 0@ T
R R
00 P00
@d @ @P
`L < L4 X
X M V (KPhT 0 /
Q- @LT
4 P
3< 3 @P
"4 4 # x Ń
-L 4 K h4 Ńx
-80L P p
` e @P
p 0 0 S 0@ @`
-80L P `p
@ @ T
0 S 0 S
@ 0 S e T
-0L P [ P ;00 Sd` 4 ` V
80 0;0F 0 @ S00 }0 S
} I30 S
@00 3 00} ` V
0 3/ pP `0p;00 S0C0 ʋ}0 S
}4 3 00, x d3 0} PTh
0- P@L T
D P
@ 0 0 0P
R 4d / /
-LMPX2 @ U PP Uq
0 S 4 p 3 H0` * H
a H0 - P ` 1 0 0E ` 9 K 1^
-LK00$ 00 P$ 0U 0- U V 0 K 0\
-LFM p@ `G K 0^ PP |0 I/K ) PP GK 0 G/K >K00$ 00 P$m 0U 0- U V 0 K 0\
-LFM p@ `G K 0^ PP I Km PP $1GKPr 0 G/K >K00 00g P 0U 0- U V 0 K 0
p-LGM `@ PG K 0X^ P \0 .K P GKC 0P H G/K0 @ - T V Kp\
p-LGM `@ PG K 00^ P \0 .K P GK 0P H G/K0 e @ - T V Kp\
-LFM `@ PG K 0^ P K P 1GKp 0 PH G/K0 = P - U V K
-0L M p@ 0 KZ P* P@,0K 00 0 `P U,0 P T,0p0 @c(0K0 0z P
P ` ( (0, 0 00 - V V $K\
-0L M p@ 0 K P* P@,0K 00 0P `P U,0 P T,0p0 @c(0K0 0> P
P ` ( (0, 0 00 J- V V $K\
-L,M ` 8KV P. 80P@40K0 0@ pP@ U40 P T40 @c00K0 0 P
P p 0 004 0 0 - W V (K
0-LBM P@ E K 0-] P P0 F/K P EKE/K 0 @- T V K0\
0-LBM P@ E K 0 ] P P0 F/K { P EKE/K 0 @- T V K0\
p-LCM P@ G K 0\ P K P 1GK`0 G/K e P t- U V Kpk? k2
-P pL`@&. & Lt~̀:00 P 0 V`0 0 `0 0 0 0<` @0 ܅A / /
-LM0 ` h00~pN@L0Pd0p~ 0p $&x0vP0P dP0 S
H0( KD0Z 厝 ( 0Ĝ 0 庠 $K1^D8^ \
x-0L @ h h00n^`P``en` #40 嚠,0 0gvL000 0L0x1^\8^
-(0LM0 h0 0 K3/ K \
-,0LM 0 h0 0 K3/ K \
-LM(0 h0 0 K3/ K \
-LM(0 h0 0 K3/ K ,\
-,0LM 0 h0 0 K3/ K H\
-,0LM 0 h0 0 K3/ K d\
-,0LM 0 h0 0 K3/ K \
-,0LM 0 h0 0 K3/ K \
-,0LM 0 h0 $0 K3/ K \
-LM(0 h0 (0 K3/ K \
-LM(0 h0 ,0 K3/ K \
-LM(!K !Kh0 $ 00$ K3/ K \
-LM(!K !Kh0 $ 40$ K3/ K (\
-LM0 0( 0 h0$ 80$ K3/ K D\
-LM0 0( 0 h0$ <0$ K3/ K `\
-(0LM0 h0 @0 K3/ K |\
-(0LM0 h0 D0 K3/ K \
-(0LM0 h0 H0 K3/ K \
-,0LM 0 h0 L0 K3/ K \
-<0L M,0 !K !Kh0( $ P0, K3/ K \
-L M"K !K 0 ( 0 h0, , KT03/ K \
-,0LM 0 h0 X0 K3/ K $\
-,0LM 0 h0 \0 K3/ K @\
-L M0 00$ 0 0( 0 h0 ( K`03/ K \\
-LM(0 h0 d0 K3/ K x\
-,0LM 0 h0 h0 K3/ K \
-LM0 0( 0 h0$ l0$ K3/ K \
-L M0 00$ 0 0( 0 h0 ( Kp03/ K \
-,0LM 0 h0 t0 K3/ K \
-(0LM0 h0 x0 K3/ K \
-(0LM0 h0 |0 K3/ K \
-$0LM0 h0 K03/ K <\
-(0LM0 h0 0 K3/ K X\
-$0LM0 h0 K03/ K t\
-L M"K00( 0 0, 0 00 h0, K03/ K \
-(0LM0 h0 0 K3/ K \
-$0LM0 h0 K03/ K \
-$0LM0 h0 K03/ K \
-,0LM 0 h0 0 K3/ K \
-LM0 0( 0 h0$ 0$ K3/ K \
-,0LM 0 h0 0 K3/ K 8\
-L(M"K0H0 $0 04 0 0 0 00 00 00 h04 K03/ K T\
-L M"K !K 0 ( 0 h0, , K03/ K p\
-,0LM 0 h0 0 K3/ K \
-L M0 00$ 0 0( 0 h0 ( K03/ K \
-L M0 00$ 0 0( 0 h0 ( K03/ K \
-(0LM0 h0 0 K3/ K \
-LM(0 h0 0 K3/ K \
-LM0 0( 0 h0$ 0$ K3/ K \
- L @ R0
R8
RN ! !\ a05^
0-6ML 0(0 @P0 0 & K0DX X
0-40ML @P 0 0 K0DX X R
0 0 S
0 0 s
0S s / / / /\0` P / !`80 00 , 0 00 , ! /@^ȏ菃쏃0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
-LP p4`0 @ : PP6 6 6 41
0"P 0 U h P . . 5 03/ : : r= 0w4 4 d#X\$\
-0L ` p*
@F' $ P$ `| Q ^ @H0H0""$0?0$0$0?0 00000##$$00000Pp0L1 0 0 p 0DM$ 00t0 0- 7 S0 0 <
0(孯 ' 0 0 R<ֱ0<Ʊ@ < 0<0< 0<Q: 503/ P P P d0d 0$KkvL ` Ẩ P 00$0 0505X^XU5^
0-L @
4 P P
5 S
ڐ - P
5 W 0C5b0
-( @L": :#6!%# R P` $(p ᰯ Q 9 P 0 7 00I 3 P
$0 SB
( ": :#6 91 S q> : P1 ( Q :$ 0ሥ 0
7 : 8< 1#( ! Q
b 0$x ` }- z $Ki$0 0$KiIp^
-P@ `L( ": :#6!}% p00 R0
S$00 0 S C $ 0 R00? $@?PCD 0$4 @ 00* P 5 05 Kh;p^
x-L @d P Kxh,
-f/ @` L a !<(0p?0pP,P@
0 q> ?ڤ 0 8PS^P4
P000 ] ] q> P @ S R 0<0< ( ><404$ 0X00008(0 00 8
~5^]WEV
p-L MP @ -
0 40 S
4 2 ` 27#: : 0 k< P"
40 S
4 2 ` 27#: : 0 h M< P
XKph`40 S
b4 zX0
KphKp X:t]
x- @L R24P `d0d V ``^ U H ^D @U4
4 !^,@ T Kxh]T\5^5^1]#]>^#]
-LMO2T @ Uy
000 SO X X$XX XXTX `q
`q
0 S
1
`q q` 50 3/ dq `0 X 00 0 0;7 7 S 4]0] V
7 S 0 71! 0 Kh}t<@ 7 S )` 000 S$0
R0 a&778 r< l0 R ꍧ505 0 4 Kh Kw6^5^5^{6^5^V ]5^]^X5^X
-drL MP 0@ S : : #4 !# `Pw
(
c Qt 0$b @P T 0h
?#K0 ə ቑK 0 RU 0@ P Y 5 0` 3/4 04 0M<
#K@'P 0 R<ֱ0<Ʊ@ <0<(0
0젆0 503/ P
P
P ] Q @XXXXX | \ t \ d ]
H \ 0 (KYp^ #6^5^5^B6^[6^o6^6^6^]
x- 5L @0P3/ P `
P<
P8 40 S6 ( 6 [ @00;00000 0e664 0 q> !< 0?0S`$0\0 `0(07@ D00,0Ϣ ,0 P0 O8 3]` x~5^
6^6^
-LM @`0 p`!s @* 0# 505 0@4 4 % z^` _ P
@^ S0K P R _B R
\ 0 0( QD Q
Ka P@ X00 R
? `x" K8 l K^f5 \ S00 ]H20 7<7420 7@077
]2 @8 PP]>0P 10H @q>@1 =087 @
]1=0 ]1!010 ?q 7Ǘ 4; K !A7@
414!0 q> ?ἡ 1 1 0 0000<0q> ! K 0q^ /@ 6 500 / : 8 d | x0 P h^ KX]6^*s]\6^7^ 7^ j D7^ W7^h7^
]Y#XD%X$]
- :` :L#f!! @Pc
/ Pa
q> ]
Ytp0 Qx0 S
U`K P0 S
P0 S7 503/ `P= 0
, a P
]" 7 07 U
0( U 20 S
X
XH0 UHP L0 ULPH L0 0P0 ` `P0 S 5 03/ p^6^
-LM@/K P P0 K0 C(r 0 (0 K 0 00
0 0K
-LMp/K P @P6 0 K0 C(r1 /
00 S+ ( K+ 02K0oK 2 000 K 5 K03/ P
d]
0
0R 'K< 嬇 4'.K ]@ -@ K 0u y7^\7^
p-LMd @P0 S 00
8 S
( K 0 K0 ; S000K0K@0Y0K0K0ZX0 5%XXK03/ P
p\ 8[
0[ S
[
([ 0R p K0 W (p K\ Kp 7^\7^
-Lu. 5 @03/ P 5 03/
-L^. @7 07 5 03/ *
*-P "VL !p; 0t`Y @ Q~
W
WH0 UHP L0 ULPH L00 SP0 p^ :
-:@ #FpL M P!
P % i0aP0@F
0" R `( b `$ @ :C P
T @ : P Kp^
0-LP- 5 @03/ P
0 0 S - 0
-LM Q p@P
00@ P E$40$80$<0E4H @0 `P ( K٠ 00K09K9K@00K0K0L` 0 9[@
09K 5K03/ P
[ D D9[
0[ S
[
)[ 0R x K$ J x K[ K0u 7^\8^
- :L: #ƌM !0 V 5 03 ) 00
7 !
` 0 0` p̙D KTቑ4\;pd ` Vf X ?
0 b P0`
(Kp^Z
-L @ $0 R @@0
0-L @ 0P S 0 ឡ K0h
0-L P$0 @ T
0 U @ 0
-L,M P @P Xw L K ( $p 1 W
zX0l a 0(ጨ Qc P^ ! R[
0 [
[K [8 /K 3[LK:3K3[03K0@0K04 ,?$K04K04K@0>0K=0K8040 ,000 503/ P01 0' 3[=
3[ 01B0[ 1 3[ 01 10
@0[?[B [04[ 0L0 !0 #4? 00 00$00 K$8^_8^
-@ :`: #&L6,M#8 @ (<0 8 C 7 p P 4p 0D 3 pD 6 V
. 6 V
6 Vu
0C V 6 Vo
6 VQ
t6 V
h6 VD
0 V @6 V
0 V| <} 6 V 0C VO *6 V5
5 V=
5 VN
g 50 S@ b 5 V/
5 V
Z 5 V
5 V
S U
,@ _ 0 X X G f/T B f g P `4
f/I 8 S} E/B px 80) 001 200$ $
40 S
fC P p4 \
E/% @t 7 07 0$6 pP 40 S
`4 x$4D$ V V < 0$0
6 #:: 0 $S6 p7 074 P' 7 P00
7 P
07 07 f P `4
8 S 4KE/ɞ p " 0
Q ` 0P SC
@
Sp *0 S < 0 % 0000 1 D0000000 P0 0- 0
060 0 06 02 @00p 03 Y 0 S p
}
p 0 080,0 0# 1 P0p E E
* i `]> ;
* _ ^4 ^/ ,
_' ` $ MY $p
0 S 00 K &$ pP l@ `0 $00 0 $ (Kp^wdrdAd@}d(@edAmdedAudgd{dЀhd~d(~|dnd Q ydgd X4)XDX
-L M @, (
p\P `` 5 0 pတ ,$ 0 30 <^<^*\ - R /- B-- B R- .#+# /
x-=L @ SP` " s P U = S
4 = P S xx蠆
-LMP! @` P ( p p (0K P [ Q-
[ \
d 0\I 0A S 4 PI 0 K<^<^
-L M@0K@# P P K
p-L M P@ = S 09
000 09 S @= 00 K0 P $=[ S
Q Q
Q ` 9 S qXqXqXqXqXqXqXqXqX KpD
-L4M0 @p Phh Q PrXrXrXrXrXt7 S
:]`7<`7@=0@=v x y @=X K0@= 0{XK XK
Z K0 n5[!6 Q" P%[ pF01001t7G S (
0 ! ߍ 10?0?`7 0? P K"0 9P0[
S 00P0K Ǎ 0 㾍 t7 S
0
m
u p 0 \t7 S 0X s h = 3/(KB =^ A ^8lX
p-ML M @` PB K|# P p3 K00C0 S$4 S;$4 H3 K<3 Q<
'0C Q@
Q
QJ
g 3 Q
0 Q
` 2 Q
>0C Q =
" Q0
T ?;A0C S O T`: AK @ N $4S S$d = S
@= @ p2] S
@= 9 X2\ = S
@= 1 <2N = S
@= ) 2L S
@= " 2? 9 S\
> S$ m 1 $4 Sg L S * CLԔ L 0$4 A>K 0C > = S
A.K B 0B+ PL : d1 Q
#0C Q
0 Q
+ 1 Q
0 Q(1
# > 1 1 K 1 0 K 0$4 `-$0 Q! :$4 0? K00A>K 0C Č $$D0 K / ("( BK Kp - ^
N
\
V
R
* T
Z
0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
-LόMpP p (0K `@KK
P U 0 o P 0 P
K!
-L 0KM c 0 K
- @L `0p P=3/`7
5`7" W )9 0 ") Kh@
p-L M$= P S00C S@x 0@ӕ Sd @0.@ӕX0 ` R
3
8 80/D0 @Kph Kp \X
,=^c\
-LtM @ P = S
= S @ h`Kτ < 嗋 ͔>0| hK ˄(0 p = S
|> S 3;3i 9 S
i V
0 S99 0090C9hK.0 02K p 0P 9 SK P
s ` P
V@
P
h` V
0 S00 0000C0 P
& 0hK& .0Z( P
4 003/ pP
2
0 s `P ' 0'
P
3 003/05K9 S .05K0@
P5[05K T
' 0 W'f
(0̇t0 L2 9 S
@= L2x #
G t0 D9 S
X 0=00 S x <
P
0p 1 0:0!
"$ 01 0 0#4
0d2 0$p0 t0| |>p (KDG=^s\
- =L @ S
3/` ] U' X _ pP
`V |DP 0-4=8 R2 d X 0K `-0C ⵈ B.K B+ P 3 U @= 3 U @= p3 U @= \3 U @= = S" 3$ K4#0 S5
# B S6
S)
B S2$K 2 " S
S
V B S2$ K 2 B.K B0 P x2$K 2 d2$ K |2 L2$K h282$ K X2$2$K >2$ K0 S 0:
B. S
` V i j = S|
1 : S0/ӥ[ Rp
9 Sm
$= S
S
S ! 1$ K) 0 B>K0C C X0 H1 $ K @B>K0C C 0{ P/ 0>03A R2 '
9 S# # BK ` @ 0 P
`9 S 9 09' - R N B.K BM P
$K % F - * V
\
R
T
^
Z
X
-L M p`P @ @T
0 S
#
40 0 '.0 T ?40 %P 4 @ 0@
T0 (K_=^
- @L ` = S?
3 p 3/= S _ ] U 0-4=8 R X2 d 0 ?989 ? ? $= S ? $ $- R 9
: S u닎> n: P ("( a : C(!= 㰆 0 0\'9
) D% E> 0 @(5 $ ;@=
5 3@=
4 +@=
4 #@=
4 4 : S0/ӥ9.`= 9 S $= S >l \ $= S" .D B 0 S
0 A Q\ѕ 3 9 S
3 9
: 3 0======$= S\3
V
0|>>0. % 03= ℝ
P
@ p 0-4=8 R0 ` ( 02 3;@03 099 S R S 0-4=8 RX 2 d 0 S
0C S>02
#=' 0 'K0h> S
0C S> $= S ( > S02K0hj0=H]
-LM @ p` E P
D # P $2 V 0C V? *2 V_
2 V
_ 1 V.
1 V>
W 1 V&
0 VQ # PPZ # =
SQ
9 S
@I S PE A .0t/ P: ,4 P P3 3@
'0 1 ` 0ᇼ PP" Q4 P P 3@
$= SP
) =09 94 P P4 = = S
$K2iii6i(9i5i @^
-L,M↝ @ ( , F0-4=8 RX2 d p 0AQ>A0BQ3 ! *: S
$= S
@=
F K 0 P$[
d 3 @= @-$- R
R9
RB @-x,- Rb?@=
d R ژ0@=T3 R98<ð9Ű9 <9( /@-$,- R j>0@= 3 R 2R 9;998<99 <9> 2
H0,-@=2 R9 <ð9> F K0 P 4[ S909
0@0 X8 K@0Ky `P_ @0 S\ ڸ[80Ky Z
= ,>. + 0 B0C 0Ⳡ0Ⳡ0Ⳡ Q | ᏼ3 =4!=131:1:141<1<1<1<*|1 > 0 X ^;>^ O>^Z4]Z>^n>^ ' v' N $ ] >^>^>^>^>^zXhXX0X X ">^ >^F N
? _ e u' ( N O 8XpXrX(hXgXyXpdXdXdXXD 0 * >^
-=L @ S(
p }P ` S m(P HT0,` pDp0 S
ᴻ 1 ᐻ ! !
-@L
T -
-LlM = @ S !
P
3@
4
08 0-X R2 d 0|^3;3
0-4=8 R$ H ( 0|~3;3
0-4=8 R ( S # P
9 S @=0@=} 9 Sz 3 3/t U l0K 6[ P
06K6[00>. > 0(Y $- 0W[ Rp0
R
R
,W9I p0K>p` Dp 2p`P fe 1 P 1 # l K> 7~ ^P
X) > W01>0# 0 l0K 6[ fK0 z~ 6[&[ 06[ `00c05[l K@06[LP03[05[ S 0000 `~ 0>=0-4 8 RX 4 h #88 ?^Z?^\0[v?^?^?^?^?^?^] @^ 0 p
P / P
/ / /$0l1(0p10P1 /
-\0LM
K R
R
R
K 07 0 S i5 P .7` V
0 s $7 0400 000 0 0 Kh'004 0 S
| R
\ R D 0+
R
E(r 0 (03/ 0 R
K;
S
0 0 / /
Q-L @ 0 0 Q 0 .0! / 0. 10 .00 .0 /5 Q0 .0! / /
-LM3A @ Qn XXtXXXlX `R d0 S P`a
0 U * ` 0 0A S h0 S l0
!0Al
h00h0 h00
S
0h0Q XT 0b Q + R 5` R
R
d B Q / d /
-LM<0 @`@
d0 3 QH i _ Q ] Q *O Q Pz
M Qz
N Q0u
9 P Q
[ Q5 hP( l Io PP 0o Q_
c Q
n Q0Z
# } QT
~ QO
| Q T <0<<00000@00D00H00L00P0001010 101000 1 0<0
00000@00D00H00L00P01010 101000 1 <00 <00<0 00 B\ 0000000000T b R ` 0C0 R
0 S
0d00 00C R0 d 0 hP( l n 0 00 0,0A0 0 0 0 0
0-LMd@ 00 P0 0 0 80\0`0d000000 K0
-LMP Pp`@
E0 0 0 @000 80\ 0d0` C K
Q-L @
: Q
KhKh- < 0< @0;
S
<3 0 /
<8S A 3=8S A@A 31 0 />08S 2 AAP0 <0 0
P 2 A0A`0 Q
@ Q
Q
! @ Q `2 \ Q
: Q
Q<2
42 02 ,2} (2{ $2y 2w
QY
( @ QU
@ Q[
@ QQ
Q\
e Q\
QQ
^ 1 Q=
0C Q=
0 Q>
S 1 Q1:
0 Q4
K t Q2
@ Q6
@ Q&
Q+
< < Q/
Q0
5 $1 Q
0C Q
0 Q1m
) 0 Q
0 Q0
! 0b0 0 0 0 0 0 0 / 00
00 00 00 0 / / \+ /E^- KE^3E^7E^;E^?E^CE^GE^ eE^ OE^ jE^UE^[E^`E^oE^tE^yE^~E^E^E^E^E^E^E^E^E^
0- QL @<0 Q ? Q
Q :
Q
Q
* Q+
0 ! R0
, R0 ! R0
, R0 ! R 0
, R 0 ! R@P
, RP @P U
0 @ 0b @ .> D d0 @ 3 D 0 @ 0 4/K
-L$M0 8 @40g S
: J Sv
B S
@ S
A Sf l0 T S0a S0!0c D S
H S
V P SP
K S]
M S5 N c Sl
f S
X SH dl0 S00 b S 0!D , P <5/5 ( Ss
m Sd
h S,
l S ` P J ? u& YF^l ? p$? h ? GF^SF^1]<+^8]`F^cF^qF^F^lF^zF^F^
0-PL @ U&
U \ h 0
R / Q
:9 Q0A# S\0PC 0 S\ 0 C ! 000F^
x-p0 `PL @
P U
@ Qg P000
P(P@ T
Cg P x[[00 0 S
P B /0 /[
- @L 4 @ 0 0 R [\X0 0 S
P
P R 0 0 /0 / /[@-P 0 S
S ," c 0"@(@, Q!<#"
0-80L P S
$@ #, K0hh0@{
S -L
S 0 K h .! F^ \\0` P / !`80 00 , 0 00 , ! /@^ȏ菃쏃0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
0-PPL @0 S00
R0 K0h
0-<0L @ SP @00 0 < O,P 0 0 8 Y
-<0L @ S
O< 0 0<0Kh
-L M@p0 @ W SP( 3L :x
`0 V Z
# > 4
00 `P0
| 0 0 S0%lf2`f s @ ao <0 V ` 0 0 2 000 S 0 0f X`` V P
S` `< 0 `(K F^
-LP @p!AP `
0 R N P 1
x- `L P V@ (0H0P 00@ x x8\
- @L N40 S
040 80 S
0 Kh
-LM 0p @` R <"0b S 3 :4PK l) ` V
0< 0 `0 0000 K 0P
Q @ Q @ / /(0 0 S
R 0 /
x-`L P V @0P0"
( ( f 0` 0 $ f $ b P ` b ! 0 ` 0 00 @@x" /
0-00L P @ T
0 5/ @0@-X0 Q D
P
@ ̌
\
x-L `P@ V x
S
P R
V
T
U Q
d p 3x x x
-t0LM P @ `p T
P 0 P
0 0 @ $K
x-00L P @` T
5/ @x
p-0M PL @` PP0 P
#, 0< 0 0"00 Kp
-LM @ (
PPm
a ` p l p0 p pq `PG
0G <0 0 Q3 0 $02( 00 S& * S ! b4 " 8 R *0 ¡ 瀀X
<后.4 8 0 $`p0 000l P
(KF^
-L M @ ( PPb
oa ` p @r p0 p pq o `P<
0 Q) 0 $08(0 R *100 0^3040 0 S *á ^
0圠)L c,4
0 $`p0 000 P
M K (KF^
- LM`Q` U@p ʀ0 !0`1 0 0 00 , ! 0 !1`Q 0 00 , ! V
V Y 0P
x $K@^ȏ菃쏃
- L @P
0 R 0$ 0 0 R$ 0
-L M` P @PU @P U
0H Sp
0 000 p 03 @ X
0 X
$ 0 !!0 S 5 7 4:0 W
0 W
R 0 p $ P: H b Y QA B P 0 0 00 0(KF^H\
0- L P9 P
@ T 8 @D T @ 0
X 0 0 G^p@- \4 @PA$ `0 R+ `` R' @0c R1 \!
S
P P b R
R
R0 0 0 0q 03 P 0 S p pH\ 0 p
P / P
/ /
0- 0L P @@ @ @ 0@ S
l T
d h 2/ 0l@0
-L@+ T00
-L" 00 2
-L M @K $ PpP d ` P
0 4 Q0 V8 80 R V0 P KRW SW
x-L ʠ ʠ\ ,`P0 @ S
0 00L 00C S0 x^
0-L ʠ ʠ4 ,@PL P
K0h 0^
- : :L, #@L P
Kh ^ 0 00 0 /
- L`P ` 0 @p0 00000 b 0p 0 S p W 0 S1`0
$ ` 0 0` 0 딐 1 h r2`0 @0d0 0h0 0000 0l0`0 o P
`0t 0000 (00,00000 0 S
0 $@ P P
W P
l\ d 0K PT
P @ $KkK nEG^ p2YMG^ n`G^{D^]sG^T Y$]G^
-LM`p@D4 P V
44 V
(4 V
4 V
4 V 5 4 Vi
4 V
3 Vc
3 V
3 V
0C Vl
0 V
3 V 3 V8
0C V
3 VO
3 V 0 R 0 0
O
d0 h @t
0( x | 0 0 00 0d0 h 0 `0 0
:
S7 P P4
4 W $ W *0C W
=G Q' " 4 W 0 W |$ W P$ W 8$ W W 0| 0op p0
Q Q
@@a D(R D( R T R
@DH$H @ @,D(oR *
R
>+
R , R
R
R T; 000 R ; 000A T
0 S
c0C S@0 0 @; 0 t;
S%
00
@ D( T:R @ 2 T@
3 D(R@DH$H 8 T@
/ T @
0 01A @H$HA $K 1 % # ( * $ '
-@LM( P0
$0 S
P*
Pp40 C S4 ,0 0, <@8oS:
S
>;
S
0$K 0 K3/$4`
Q 0 0
04 ,0 K n
-L`CpP VP` U @, VPp
W' WP$
0P0 R
0 -d0 0h 3/ PP` PPp X @
0 P G^H^0 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
-LM `T0 @ S
P - Z-p0 S0 $ LP U%
,0 S"
0 p0C S0 0 4K 40 00 P
t0< 0d ; P
H < s @ 0 K ^G^G^\
x-L @L0 ` S#
0 S
0P@S : e P0 S P
0 U`0P 04P e , Kxhc^
0-P0L @ SP R
0 ,d0h 03/0 0
- @LL@ :
: - L#`9 @PP
P UP ` V
T0 S
Lp WP 0` L`p PP
Lp ^
- : :L4 # L@ T
L ^ R L R L / /
Q -L
i G^
x-<@ `L P: `P@0(0x .Y'YX'Y
0- @ PL PPP8(P0
-LM p`P0 @ S
00 V, A0 S)
` PP< P P 0 S
5 `0` U`0P ZSP@P : d d , L P
00 04` S0P S0ŅP000 4K P
Q K^G^
0-HPL @0 T 0 \ P
P0 S
@ 0 0^
-$ L$@ T
P
- 0L@D : P
T R L R Kh ^
0-L@P-P@ 0
-L% 000
0-L@PP@0
<8S @ /<@8oS /:
S />;
S / P / 0 0 S / \
0-L@ Q( $9Y89YT9Yl9Y9Y<000 PP P
0 0 000000 0000000000@G- 0 S0
@0P00000`Q
*!0@ TPᶠ0 0 pS UpSpg
pg WภpᲠⲠ0C⸠P 0`O@!p W p X
#3 Q0C?@ 0 Ѝln
-<00000L \
0P U @ T
0 @` T? *P@|ExoWz
WZ%
Q A oP
P
>
P = P
Q
P P P P *@lDhoV J
T Q , Kh
H^
x- 0L P P@`
S
P
< P 0 0 0 0 0x
-L,Mp \
0@ T @ Tt
0`HT K1XK S
@@ Q* \@XoUZ
U
\ TK vP
@8
P 00 UF *
P = P
Q
P 0 P P *A
oZ
Q \ t "n`F
X 0 TK1x
X
(KVH^
,H^
0-d@LPL T
0 03/X@0
-L
0-d@L P T
0 03/LPX@0
- @L@L
-LM`p! Pd@ T
0 \
0 pP p ` L 0 P , `P
0 as{H^ ]H^
p-L M PP@ 5
0TPX0h0\0h0 X0h0P0 S 00 S
3/` l0 S
0 ` `l 0 K0' \0` P / !`80 00 , 0 00 , ! /@^ȏ菃쏃
0-LM 0 P@1 K p00 20 K 0{ p0 0 0 0 0 0 0 0 0 000 00 K a p00 0K00 !<0 `40 00 , 0 00 ! /@^ȏ菃쏃
Qx-L @`t SP P Vj lNYNYPYNYOY0 S0< 00] 0 S0; UT NYt1 x 0:
S mX1
4P q= "% A p0 X 00 T
X
T 0 |0 W/
0|p Ƞ R R Q
C0 @dP bb @= 00d ;= 0d X0 R R 0 0 (Ko(K: 0\^@\
-LM p= ` @ p $4P 1% $ *% ]WYWYWYWYWYPECB``___
-L @[d Kh
-L @d [
-L @,S P0 000 0@ 0 p 3 /P / / / /@0 Q
1C Q
-1C Q 0 0 / / / W@ /
0- @L P 2 S
Z PPZ P P, D- 0
-LM p 3 @ p Y P0` XPA# # 0*
R 2 0P0 0!00
0-0_010 1 a0 2 `02 2 |" S t2-P 0P0 0 00 0 1 122<2 h0 $"0 P 0 P /0 $ S 0 $0 ( S 0 U 0 p
05ZPp P0 U 0a v
'Z 0*
R @ 41 S (1 @ YP P @ 0Y P @ 0Y P @ 0Y P @ 0Y0 0 S
h >040 h0 (@ 00 h0,0 4KX d $KP]\Y \Dt` \Lt\Y$]`Y`YTXY\XYXY8^Tt`t 5Y
-L
-,L @` X ʀ0 !0`1 3 2 0 00 ! P0 U
0a v
Y YP
Y P0 U( 0q w"
Y Y
J `0 V 0 p
Y P
,0 S
-0 U (05# ` Y
.P P0 U
0a v
Y YP P0 U 0 p
YP(0 `P] T0 R Q S0 0 81 0 U 0 S Q
0(0pl0` S $00 S" P V0@
0 6: ! !0 !t0` h0 d 0 00 !X0 W S`P\ d j$0p@^ȏ菃쏃P^
x-X0LP @ 0``0\00X0`0 s 垞 X 0\0 0xP'
-L @0 4" P
-L / /
p-L M P`$1 P @ 0 x :
S Q0 |0X|
0|0!00 X | X 0X @x 0#X Pt
04@800 <00@0|0D00H0c P
` t W 0t0 0 P 4 Kph KpbY0I^`YbYbYdbYZI^$]
-L| X
-Lx X p 3
-L @x X 6d
-L@
0 0*
R
x S ~X Q
I H
00 0*
R J S oX` {I^ 0 p 3 /X /
p-L M 0 @K `0$ Px P
0- KpcY
-0L @ T KhU N0 \ $0J^
-LM @Q p+
tP U P( :M P
5M P Rt 0 `d0 ( K j PP (0 t0< 0 k P $KmJ^qJ^J^\4]
-L MP
,88 S Ƞ Ġ B B B \B @ 0 U5 P `p`Vp0 L 0 \ 00 \L 0 (K R / R /
-' QL M P`c T P^ < 0 ``0 @ 0 K$N 0 0 K N 0p p0 KN 00 K$$ N 00 X(00 X,`% *0,0 Y0 Y030#-0- ,`(0 0P -V Qa0 6& S` : V :` V :
P V < W
08 90Y$ P
4: ;0R (KP\ /
- 0L @ Q` *,p r P m U 0 P 00 Pe 0 P
-LMp$0 ` S@
80K( r3 48:$ !; @c4>320c480 Le88h04 Le9>" P-@` 0 / *
%0 0 B8 e19 1 a0 (K
- 0L @ S
3/ <Kh 0@- 0 S
P@0@% | 30
- 0L 03/ t
-L M R @l 04/K
-L M@ n 0 0 S: 0 S i 6 K R 0 U 10 " B P A ` R V
u @ P @ A \ R
U @ 00 u 0 S0 c T
@
U 0 S 0 S 030C 0A `(K
-L M p P000 0 Sl
@ ` 0 !
X Q 0 S 0 1Z
a 1 40 @40 UN V` T 0 00G
X !8 11- 0"0 88 00 ,0 88 00< ! !
0 T"Ġ T
0 R@@
0 0 0,<00 0 000 (K /00 S R08 0 / /
- QLMP@ z Rw
`bX"
0რ Zj'
* 8 <0 9/8 <0 Ppc" 8 9/ P8 0 0 S
0e"00 40 0 0 0 S 04 0 SPEp㇀ X% h#
* <0 8 9/8 P<0 0g' Qp <0 8 9/ P<08 Qpᧀ Wg#h, Q U
d (K 0 SC R
P0 /[\ Rp@-
0A@C T @P PA`D V @ U
dp S
R p p p0@- 0A C R @ @APB U T S 0 b0
0-L M @ P P*
0 S0 R
R
d 4 K H lPE0 S
K!0 0R0 0B8 0 S
PK1 0S dK0w\p@- 0M ` S * RA 0 ܍p@G @ QT U *P U Q R 1DL0 "C0 R
L \ \* \ \܍p R /- `
P R JP 5l
R\ JPt
P 0 >
0 ;
08
06 0⃑ iP5I K
038P0 0C0C
P 0C! P2 H RJ@G
5IP 0
0
00H0 SP RJ@.
0S5YR 0<P R 0< @@PP!R
@ 0!2P@@@ 2
R @H P / / R0@-
0 @ TP@ UP
PlP U@ 0 00
0-L M @P R K0h.D 0 S 0 Q
Q 4 K G lPE0 S
K!0 0R0 0B8 0 S
PK1 0S
dK0\8@- @PC D 8 R
0 \ / S
/ /
-'LM @ G
8 G <*O* 0 S 4 7 0:=B>0CS ) <:0<: 0 S * ! ""! 0ɒ0 S@@B P,1#" 0$"E @ "P 0 Q P ! 0 E ! `p 0E ) 0
<:0<: @ P C U0 * P`\vp W
R
0`) 0 <: 00<: R $$A: 0:@`V * R 0 ) h<: 0<: R 0$$A:Ā0:@Qa p 0㗣#: S( ؔ ڐ S 0 0) C<:0<:p W@ T @ F <
(K\J^ 2 ?f'C J^J^\2K^\wK^
x-<@L8 P4` @ O. 0` P@ xt A R0 : c / \
@- Q : l @@
-L M Q4K X0K `@W 0 Q ZW
Q
V S R * 0 S"0 0
S R 0 S"0 0(K
-L M Q4K X0K `@ 0 Q ZW
Q
V R 0 S"0 0
T 0 S"0 0(K
-0BL M R" S p 0 C` L \ X 0- \`
+ \`
0w 030 \ X RH p` S
p ? @ #KoD #KK jD @ 0 @ P0L P aL QWL AL Q 7L \ K U T 00 \ 00 S 0045%0 @_0 0 @ P
@t P Z
SF Sp (KK^\
-0BL,M R" SP 8 pP0 hh` F V Z 0- V`
+ V`
0w 030 V X Rp `p S
p Z @Q @Q ? #KC #KC Z @P
Y @ g P i 0 F0 S` a F RW`F A F R7 7`F V4 Z
P< Q P 00 V 00 S3 004 1!,$KH K P T & Q P 00 V 00 S 0041!,$KH K `8 R
\H P80
Sp 8 \(KK^\
0-L @ P 00 00 b" 2 /UUUU3333 @--A /
0 S A S /0 -$(0@#
A
A
A
A0 / Q 1 / Q ! / Q 1 / Q ! / P / P / P / P /p@- @P`+ V P p R 0 0 @ B-`
PP 5
R
` Rg JPe
P 0
0
00C 0⃑ i`P5I 0
038P0 0C0C P 0C+ P: H RJ@5
5IP 0
0
00H0 SP R Z 0P @ < 0S 08 5Y 3 R 0<P R 4 @@PP& r R T P @ 0!2P4@@@
P 5 `P
A /
- pL @ W
` .@ P0 S
S
@ P p@- R
0@`P U T 0 0 U p QA-
D3 R @P,3
B , d P @ ,, q, a ,̠ ( Ġ ̌ q Ƞ ̌ a ̌ , ,,,, q, a ,̠ ( Ġ ̌ q Ƞ ̌ a ̌ , ,,,, q, a ,̠ ( Ġ ̌ q Ƞ ̌ a ̌ , ,,,, q, a ,̠ ( Ƞ ̌ a | ̌ q ' ,,j 00 P@` d P , Ƞ ̌ q ̌ ( ,, P
, 00,01 Q,# \0@-P 0@0A8F @$$SxPx 0 C A@0@$$ R9 $1!04& "000"90߰o , @0 ! !1!0'Sel0C-P0@0@$O$4$0'S@̀'RP!'^30 @PU :p '' p' pa'\`` `@ 0` T @0\@'. R
P! !!l'\ 0010Cz+el
f eX]0@- 0A,S !W !! !p R c 'QB" c ! 1! !0 00!00V, n ߰
0-9L @
0 09Y PepU 0 "0
0 /
0-
L P J @
J 0
-LM @R(@K 0 P`* S
SW P P Z ? S
[ SN p 0^W pxp W` + PE J 0 S 0 P R 0 ? p P
P5
P) p P0 S W p ' ] Q"
S0
` Q - Q R[ X
] Y
P X 00` P 0r0 S P S $K @- " 0@ Pc U P%\% %Pc U Pp `XTP`\%\%0 %0 S
S
S 0("0$" 0 "0 &" [
-L M @ 0K c A K
- @PL
( A @ ( 1A 0" ]
-L4M(0@0 0< 8 P X @H D0 p@H0 0 KT hA 00@ Dc(#("$c4"0T8 p@ W0e#%","0 " <0
#
0 "f16#f;# 0
D8P <D < P`@H `(X P L @ x y'!'X(@ 8c!p ! ' LD *
b,b, < H@ Q
8< 8P P`D 0 ` `
8000P 0P0 0(K]
-L M pP@>
$(`QE ?P U
0 8 S() 7 e @ S
) ? eb@ 3 8 [@ 8 V@ 0(0 ` @ !( P U
1(Kc(#("$c4" (0 P@ h 9@ K
-L M R `pC
?
@@` Y( 4 : z@ 1 ( dp 0(
? Zj BL PB@J? Sc
@
00 X@
B00L PB@0C?? Y
( ቑE@ B @ PB (K `
- @PL
( 4@ @ ( ? 0" ] J
- @PL
,@ @ P ? 0$$ 8]
-LM@PƟDK@bDKAEKAFKBFKCEKCGK P Q 4 K
? Kj &970 '970 &790 '790 IK(K "KD@ KD@ 0#IK " 0#0FKK@ @$P@P%PK KDKK !%KDK DK 0DP @ !?"10 ?%1@0 %>2 0 $>20 JK*K0#DP "L@PC@ LDPC@ KK " 0#0FKK @P ZK
K%KfKKK`p'KEKFKDKEKDKKDK
10, # t0 K,K !Kt0à 2 0 ">20 K/K0#< "8 ̠ KÌ ̠< Ì "0#K K%KK 0%K&K 0P Z
Kᔠ fKKK`pEKKKKK#KK$ 0 K 0 K! 0!K! 0!K" 0"" 0"#FK 0## 0#(Kx]
x- @@ LDQ P UP`
0 p SPQ o e S
Q e= ? ~ = p = 0P0H D> @ @> Kxh'
-L M R `pi
@
` YP Q :A '> P Q P *$ 0$ P hp 0P(A P, ! 0 Zj) 0 40 D0 40K P U TD D@ PDဠJ
40 =
Q P40 0C Sc Y
P ቑ= 0 Q P *$ 0$ (K
x- `PLP
E @ @@ T [= x
- @PL
,@ = P M= 0$$ ]`
x- `PLP
@ @0 T 1= x
-LM@ l K~= 0@ 0@0 l0 Pcc4800 p0 ? % "h `b b p
d a !t
`̠` "g!
"
` ` `` 蝉h`̠`TXPP (|P P P\mia atx pp)@ @! @X ]fab bĠ & "T MeQb b % " P ͌dAbb $ "`L`
lff$( `,x ` `&P HP `eledl
P@ P P P%@DP吠 -eledl
aP P!P P%@P唠 Meledl
b!P P"PP% 005 0? S` P @P` 8 ?0 S * @P e Kh8
p-L M P@ 0$`K S !1" 0 Sh 0 ~?
SL U
0# !1" 0 SKpK^8] 0!0 00 /#EgܺvT2
-LTM @l K@ 7 P ` l p pph %0(e 芇 0d
)j i 0`(` `&h`hP)0\pP%iPeZ &0X,fk ͈0%T 0#
e[h0,0#P0lˠ霆` 0(Lp 0#h`k0)H0#PiPZ 0&D 0#
fkɈ0% 0#@0e[h0,
pmvmzNSpp\̀pfk p ph ` pe[ p p`plˠ` pp@`fip` PppPeYpa ppll̀pfk p pX ` pe[ p p<a plˠ` ppd`kp` Ppp8PeZpa ppHˀpfk p pP `
pe[ p pD plˠ` pp`4ph` 0Pp0<0a0c<P&P%fkl̀P# D P%c;
,\P "lˠa hp "`` `k !X "0a0c: & "L fk̀PP # "c; ` P,Tp P%lˠa P dP%`` `fl P!8 P%0a09P&P%4Pfkl̀ P#lp P%c;
,` "lˠHP ` "` `)tp0 P!P%a0Pg[P |`pP@:P"!PP
| tP8 d x0pp`p
`p(`b+f=0 (K
- pA? 1@@`` P RLA `3 : P `
2 J@PH@@ T C` V * f$Kk1
0-LM 0@" K"K K"#, K#( K 0K#$1?0 K@ c R c PK | B K U 0 ` K0hq1 ! B!B!B0 S:] 0 S *@,Ġ@,Ƞ@0,̠@ /
-LLM 0 p0 PPP\lPB @ R l` pph X P
Pd PȟeZ` ``ȟp ```\pȟfeX p `ȟ p P Tp@XlʁPP pP P XpP` PPPLp heUH`p``g p` ``Dplʁ)kGO`F p@ਇ` ``g P
p 0 P3 : . ;?0 S * 5@P e Kh.
0-LM@ P K L!? 7 R8 bx b K X K0hY. z] 0 S *@,Ġ@,Ƞ@0,̠@ /
-LLM ` pp 0 @Pl KHDP@P^L @ @ Rp@l h @@@N P PdP\`芠 \@X@N PPT\P芠 L@H@ P@@DP\ @@@@J< 8鞠 P 4P\ @@0J
l
\
P L PX]
@ < @0K
h
X
P H Pณ]
@ 8 @K
d h
T @
P D P]
@ 4 @K
` Ȓ
P ࠒ
P @ Px]
@ 0 @PK
l ,$ L*
P\ .*
P[<!@ԑ*
@J %(d嬁.$) D *PTp
P[!)@ @P4J%h4*
$) H .)P PX[!)@ @Ѐ8J%) ఀ`$) @ .)P PpP[%!)@ @0HJ* p
Ȍ `p ` p , (KyZn 000 0 /#EgܺvT2
-` 1 @ R05? @P`02050 VL>p 0 P3 : , ?0 S * @P e Kh,
0-LM@ P K L!? 7 R8 bx b K X K0h2, ]a8!` 8a#!` ,4 0@-@P 0
-`h @h&d 0L`d&0P.p
4 0D
)4 pP D
4 0D
4 0P00 D D0DPU@@@&d`C- 0 Pp0 C R_ 0 S @
` 0 X R0 @` @` 0C Y V 8@C TY 2"0 BR VD
. S U<
R: 0P S
P1 C S \A T >
pgp W
W
W R05,1 : R *0 < 8 R 0 < 8 4 Q
b8"8#4b$# "40"8",0 AI Y
a0C SA0a0 0c"0@ Ѝ
-LMK{ P K /
- LK^-M
Ѝ
-LMK 2 K K
-LM 2 K Q : P : / / /
-L @ p /@- ȠH h,Ƞ$H"X'H x 'xx!'Ȍx$H'x,H
-OLoMP$Kp "0# ! P R0e2 K ! P K Q P : / / /
-L @ B?Q R / bQ20" / P Q
a o@ ` / ` o ` / / P 0a P o a / Qoo /@-p @/ ?!B C @ @- p@ P` !L NE3 !@ A 8 02 31 32 32 00 Q 0c /o /
Q - 0L a P$ P ! 7 K^]
0- @PL@TP R P00 P ! 0!L^]0 00 b"0 2 ? /UUUU3333 |0@-P`@@P P``\p AO !Q@ @PP$".0 ,@%2P @P@$H$ UUUU3333 !
P -L ` cL^]
Q P -L p L^]
Px-L @P Q x Q P xx %t /? `"#`bc Q V ʕ x R V( 0 a V 5L^"]
- @PLMU T`p W V $
W V U T < % o X/K0""XK܂K X ԃK X \
5# Q P
#K ( ܂K P D 0 #K r 0( ܂K P 5$K)M^,]
Px-LP Q 0 /? "# @bc Q T R a T0 0 xQ P
-L B, MQ PCK0 ' S R 0 O `(p(`V pP "0# R0 V R Q Y X ' P00K 0(KS R Q P r 0 ' P@
Q - 0L P$ P ! kM^6]
0-@LP R T00 T ! 0M^@]
P -L ? # c M^J]
Q P -L $ /0 ! P 1N^T] / R C /A 0 \ R# R!
R / ` o ` /` `! / / /
- L Mp `P
@ T# * Y!
0 4 d 040 P
0 P
Q
! Q @P 0 W V S @(Kyaratcid0 S /0 S /
0-L P | @P
0P 0
x-L ` m @P
$ g PP
$ P UP ^ x00 0 x /
0- 0L @0C S 0 0 S P k$ @ p K0h: 0
-H L2 @P
0 0`
- @PL
0 S
C 0 Q P /0 S 0 / P /0 Q27 # 0502 05 / /
- PL@p PP
T * `P
@
0-L P W @P
P 0 0
0-L P T @P
P o 0 0
0- @PL 00 S
0Q0 S ( P
00 S 0
0- @PL 00 S
0Q0 S P
00 9 0
-L @K P
0 C0 Q *! !
-L M 0 @ S ,0, , 0( (0g 0 0 0KK ]1]sN^N^
p-L M 0 @ S l0l l 0h h0M PPE U P`
0` U * Pn HKph8 KpW ]1]sN^N^
-LM P 0`,0 p @ T
( K00KM PX
00 S WG > , K40K ? P( 0 , , 0X s R
R
> X U00 , Z # S P, , X U00 , 2 P, , P X
, ,P @ n V,
P P
$K
-L M PS@ p` @
0 P@
V S XO@ 0k @ K
- ML0 K
0-LM 0K@ 0 K 0KP P 0 R 0 R
R j P K0
x-L `P V @ P v x
x-L P ` @ P e x
x-L P `/ @ P T x
x-L `P I @ P B x
x-L `P @ P 0 x
- 0LM@ 0 K 0K5 P
0 R
R P K
-LM @R `P
0 P
p WO P K
0- @MLP @ 0 P
U K0
0-LP@ P [ PO 0
0-LM P K P 0K P
0@ T
T K0
p-L M` 0 P@ P
+ PO Kph Kp 0>
-LM@ Pp 0 ` P
PO Kh K 0gnts 0atad 0rbmn 0rbmn 0loob
- @L `P 0 Khy
0- @L P K0h<
0-LM@00 Kh PP T
K0loob loob
-L P@ `( 0 KhE
0- P@L K0h
0-LMP@ K@02 P U
v T
L K0atad
0-LMP@ K@0 P U
A T
2 K0atad 1atad
-L P@ ` 0 Kh
0- P@L K0h
0-LM@D0 K P PPO T
K0atad rbmn
- @L `Po 0 Kh
0- @L Pa K0h{
0-LM@00 K PP T
K0gnts
0-LM@00 K PP T
K0gnts gnts
-L P@ `< 0 Khq
0- P@L - K0h3
0-LM@D0 K_ PP
; PO
T
s K0atad xrbmn
-0 ` 0Lp P( * 3 PP%
@P
F 0@p0 W
h0 W V@ ` 3 V ` T tyaratcid
-0LM1 P @ qk P
P! a T P @
* K 0. `0! q pP ` ӏ pP 0H V K@^yaratcid
p-D@DPD`LM T *0 B 0KpP^Q^Q pyara ltcid Q g /yara Q ` /tcid
/
/
- @L ㊌ P 0 000 @蟌 / / / /
0- 0L pP@0 S!
0 ` V
0 3/ P
0 0 0 0 P
S
0 0 @
0-L@ PP 0 0 P P 0tcid
0-L@ P 0 P \ 0 0loob
x- PL `? @PP
P x
0-LP @~ X0 P
0 P P 0 $ Q Prbmn
0-LP @^ X0 P
0 P
P 0 P 0rbmn
x-PL ` @PP
P x
x-PL ` @PP
P x
-LpO ` `0 P
P P @ P Q Prbmn
0-LP, @ X0 P
0 f P
e P 0 P 0rbmn
x-PL ` @PP
. P ; x
x-PL ` @PP
P ' x
-Lp ` `0 P
P P J Q A P Q Prbmn
0-LP @ X0 P
0 P
P 4 0 # P 0rbmn
x-PL ` @PP
P
x
x-PL ` @PP
P
x
0-LPz @A X0 P
0 P @ P 0 P 0rbmn
0-LPZ @! X0 P
0 P
@ P 0 P 0rbmn
x-PL ` K @PP
\ P i
x
x-PL ` F @PP
H P U
x
0-L@ P
$0 P 0 0gnts
x- PL ` @PP
" P /
x
0-L@ P
$0 P 0 0gnts
x- PL ` @PP
P
x
0- @RL
P 0 0
0-L@ P
0 P 9 0 0loob
x- PL ` @PP
P x
0-LP @[
X0 P
0 P P 0 Q Prbmn
0-LPs @;
X0 P
0 P
P 0 P 0rbmn
x-PL ` e @PP
c P x
x-PL ` ` @PP
O P o x
0- PL > @PP
k P ] 0
0- PL , @PP
Y P K 0
-Lp ` `0 P
B P A P n u @ P Q Prbmn
0-LP @ X0 P
0 P
P W 0 F P 0rbmn
x-PL `
@PP
P x
x-PL `
@PP
P x
0- PL
@PP
P 0
0- PL
@PP
P 0
-Lpx `@ `0 P
P
P
A P Q Prbmn
0-LPV @ X0 P
0
P
P
0
P 0rbmn
x-PL ` H
@PP
F P f x
x-PL ` C
@PP
2 P R x
0- PL !
@PP
N P @ 0
0- PL
@PP
< P . 0
0-LP @ X0 P
0 %
P $
@ P Q
0 X
P 0rbmn
0-LP @ X0 P
0
P
@ P =
0 ,
P 0rbmn
x-PL ` @PP
P
x
x-PL ` @PP
P
x
0- PL @PP
P
0
0- PL @PP
P
0
0-L@^ P& $0 P 0 0gnts
x- PL `Y @PP
\ P |
x
0-L@8 P $0 P 0 0gnts
x- PL `L @PP
6 P V
x
0- @QL
Y P K
0 0 P0 /`]1]@- @ P T PB
P
P 0 P# : t t@P@ P UPD T U @@ P+
P
P%
@ P! : T! :$$0
Q
Nn T0 V0 Nn U T : W V :x x0 P
-LDMP@ ` Z @0
L@ L0
R
R
R< < <<0 0 < SPE @P T E"` `0Z
Q Z <040 0K0Cp8 D
H0 <040 0 p0C8 0 H0 L0 Y
I L0
0
0 R 3 " Q$
\
800 ` bp0 S>03p 05`2 W * 0 0< gd ]d `pp W` <03 05`2 40L p< S 80 Q080 00 0 W00 405`20F51 XF - Y/
H R, : \8 `0 bp R> 3p 5`2 W
* < g`0 d d`0 ` Xp` p W 05 `2 0 S p W 05 `2,0 40
0 Q <0 40 L bL0F \000 L0
: \ \ Rf = \
0 00000 0 S' 00L0 L0 \ = \
R b \
f \
M I
0 X 3 " R%
Y
80 `hD0p00 0 S>03p 05`2 W * 0 0< gd d`pp W`<03 05`2 40L p< S 80 R080 D0 0 WD0 405`20F5 Z
0 00 Z0 u
\&
H X# : Y
8D `hp0 R> 3p 5`2 W * 0< g`0 d Zd`0` Yp`s p W 50 `2L0 d 000 E L0K L P 0K 0 K 00 T0 0d X 3 " R%
Y
80 `hD0p00 0 S>03p 05`2 W * 0 0< gd d`pp W`<03 05`2 40T L p< S 80 R080 D0 0 WD0 405`20F5/ Z + 0 S(
H0 X% : Y
80 `hD0p00 0 S>03p 05`2 W * 0 0< g` Zp`
p W=03 05`2 p W=03 05`2 <040
Q+
H X( : Y
8 D ` hp0 R> 3p 5`2 W * < g`0 d d`0` Zp` p W 05`2
p W 05`2 0 0 S0
T0 S
H0 X : Y
80 `hD0p00 0 S>03p 05`2 W
* < gd Ud` Yp`o p W 500`20 \0 T 0 R
H X : Y
80 `hD0p00 0 S>03p 05`2 W * 0 0< g"` Yp`= p W=03 05`2K< g PG T 0 p W `0 X
Z ,040 &H0 XJ : Y80 `hD0p 00 0 S>03p 05`2 W * 0 0< g` Zp`3
<040 40< S
p W>03 05`2 p 0 0 P0 % # 0
F \00 s kp W= 3`2 5p W#03 05`2 p W#03 05`2,040
(K2O^']^
0-LM 0@0@K0 /
x-L P` @ = Px
-L `p @ P / P
-p-L` P @ PKp
0-L P @ D P0
-L `p @ P P
-p-L` P @ PKp
-L `p @ P P
-p-L` P @ PKp
-LM K ) K
- L M @(cPe
cpP W) 0 00 ` 00 @PPfP`V%```ed& efআ(PfPh(V%`h`eh&efং(PfPhQ%`h`ee&efই( pG W
W
W
0 00 ` W W
W
W 0l0h0d0` PR WP
W
W
W 0\0X0T 0@ \" 0 L`0 0PPfPhV%`h`ed&efআ(PfPh(V%`h`eh&efং(PfPhQ%`h`ee&efই( \
0 L !000 \ 0L !00` 0 \
0L ! 00P0f0h6#hc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a" 0(Ky7]0 -P@
P
0 S R P0 / P 0
P P 0 / 0 /
- -(0LM 0 S K Ȧ B 01 R / b120" / B 0 R / b20 / QJ : / P /1o?o 0CL /P@ P@ P@ P@
P
@
P
@ P @ P @ P @ P @
P
@
P
@ P @ P @ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P @ P @ / b! @-p@ / ?!B Ch @ 0 S /i
- L0 l8O^
-0 L @P
00 00 x]
- @L0 P
G x
P -L
0 R 00 P Q p 3 1]
0- 0PL S @H K0h P
( P
K0h 0KO^
-L p @P
* P < `P 7 ` P
0-L P @P
P 0 00 0
x- PPL x p0 Rq @P
0000 `P 0 Q ` x]1]
x- PPL x X0 RI @P
`P 0 Q ` x]1] P / 0 R /] P / 0 R /]
0- @PL 0 80 R Ⳁ PP
0 Q 0]1] P / 0 R 0 P / /]1]
-L M @PP % 0 S Q
R ` 0`p ~ P
0D R S 0, C ` P
K]1]#]
-L M @Pp |0 R = PP` M P
0< p S 0, P P
Z K]1]#] 0P
0$ S Q
R /]
P -L
,0 R 0 P t p 3 ]1]
-LM$0pP S
f- ` V+ ` $0K P#
$ @P
0 0 $ 0K P
0$ S ` @ P
? P$0@ 0 KKO^ 0 R
- R - R > R 0 0 /0 /0 0 / /
0-P L @ Q P
0< 0 P0
0-L P@A Q
P 0
x-L @` P 0 U * P
P< P
P
> Kxh x
0-LP< @ P
/ P
P
> P
K0h 0
x-L @` P 0 U * P
P< P
P
/| P
>w P
Kxhp x
0-L @PA Q
< Q
> Q
& Q < 8 s P 0 Q 0eO^[O^`O^
-@L @^ P
(h P
Kh9 ]kO^
-(L @w P
Kh(O^
0- L ~ @P
~ P 0, P 0 0 ~ 0 0~
- QL @P
p 0 `L \ V ``
\
< \ 0 R
! R - R - R U
00 P / R PE Uz Rw
0(0 q (` 0 P0 L \ R 0a Xp0
\
/ \
> \
\W YU PP 0/ S 0$0 (0 SH 0$0P0> SB 0 > R 6 R5
0 B R P
R
R0 '
B R \ 0c00" S
R
= R
R 0 S
0 " P
P b > R 00` p@-` @ PU
< PK
& PA Pa U
Pm U Pp UD P; UA 3 l U t P: ; P7 < ( g U t P/ ; P, > p U' o P$ s P! ; P ' q U u P o P t P ; P
" Q
T * @ S @ V p p
Q -L p 3
-LM @IK> `P pE R
0 P P
P PIKM KJ/KK?KL P(
PIKM K ,1( S S T } P @@X P
@@ C} x xO^O^O^;}
-LM0 IK 0a 00 S
3/@0 P
P
U7
5/5 0IK K03/ U `
5/ V*
V
V$ 01 p(1 (Q 00 S
3/`0 @
P 0J K03/ P T
4/ T
4/
p 0 03/ IK K0 P K
x-LP\ @P)
P P $0 S P
t 0 P
P
PP
0 `P {P | x xO^[] P 0 /
p-LKM8 IK@< T 0 0 041 01 8!<1 0 Q
: ^K 0K/K J/K 8<M/K0 ` Kh @]
-0 Lㅹ @P
00 00 ]
P -L
0 R R
v p 3
- @L0 P
8u ݺ
- 0PL S @l ,Kos PR
`LqP V$ 0 !#1
" ?6 P=
0 P7
* P1
$ PP*
`F V ,Ko` V pP p(1 P
' P
VpQ = P
= P }]]
-4 `LP @ p Q A Q P
Q
< Q=
= QD
P
V@}Zh}Z}Z}Z U `
T* h U
R* h @` U
R* h @` U
T* h @ ` V0 Y @ S R
V$ ~Z~ZP~Z~Z0< Rp
R
B R Q
R 0 = R < R
R
0B R S
R L]
-LP p P U @
t `P
` P
0-L @P P0@ P000
x- PPL x p0 R @P
0000 0 S
s `P
` x] P / 0 R /]
0- @PL
H0 R P
s PP
0 0 0] P / 0 R /] 0P
0$ S Q
R ^ /]
P-L
@, T \ p 3 ]
-LM$Pp@ UI Q
0! P?
0 S<
K 0$ 0 R1 $0K P)
$ Rs PP#
$ 0 0 0K P
$0 R \ u P
@P Ts ` VP Ms`$0 0 @ KN]}] /
0- P4 L R
$_ 0 U @@ 0uZ
0-0@0PL F0 0A 0 <]0 QO^O^ P / 08 S Q
R 0P s / / /<]
- @PL
0 R <] P / 0 R /<] 0P
0$ S Q
R /<]
-0L@ S $0 S
0 O^00C0 / 0 P R
/ /
- `PL
r PP PX 㾶 @P
Hp p䳤 0 P`00 0 U
r\]
- L@ Kh
P-L `Pp,
@ T P * ᒤ ፤ ኤ0 S @ T
0 0 0 0 !0 0!0 @ ߤ ݤ
0-@L @ P d z P ˤ 0
p-L M @P 0 R
S
&r L` ɷ !Ba P `
0 P
0 0C0 ` Kp
-L @ P`q pP
T
! T p`
q
-LM P p` @ P 0 0 H 0 P
( R
@ @ 0H P
K^xZ
0-L P q @P
,0 0$00v 0P0 0 0 0輆ZZ
-`PL @ ɣ0 S 0 Kh# P @/
P
0 R pP
00 0 PP
0 03/ PP + ( 00C 0 0 U * P
P @ ^\]
0-0L @ P
00 Q
0 Q 00 003 P
0-P @LP Z0 0 0K0h轣 xw
- @PL
0 R p A h `P P
0 U * 0 0P000 ᘣ \]
-L P000
0- @PL
00 R P @x 0 0\]
0- @PL
00 R P @c 0 0\]
x- @PL`
L0 R P 0 V@ @ F x x\]
0-P @L ͢ T
$0 R @ @ - 0\]
0-P @L 㶢0 00K0h
0-@L P ᦢP PP% 0
x- @PL`
@0 R P 㑢0 V 05 @#A7 x x\]
- @PLP`!
0 R p v0 @ 0 U @ 0 0 a 00 0@ Ȣ \]
x- @PL`
<0 R P I @ ᯢ x x\]
-LP p@ U`
P Kh 0 0
- @PL`'
0 R# P 0
Khw 0q0a S * 0 ` 0 B 0 0b Kh\] 0P
0$ S Q
R f /\]
0-L P @P
P o 0 0 03/ P
P
P 0
x-0L ` SP@ e P
$0 S Kxh x ^
x-L ` @ P P x
0-L P @ P0
x-L ` @ PD P x@-@1 !@@1A RA@@ @, @,@00,00001 S
Q 1 0
x-L@`1 SO P&1 R
R
1 0 S4
@``@
S
Q
Q
x! R
11 Kxhx0
x 0 00 0 /
-P @Lp T
` `f7/ P
A
-` @L P T
p pg8/ P
P A U
`
-` @L P T
p pg8/ P
P A U
`
-L M ` P p @ 0 V
0 0c00 :/ P00T
Ϡ0 a \ S @ @ ! S@ R A-
00`` S r ( P
0 S
0 0
@ T 0 (K@- Q0@" Q
0 c 1 S 0 S
T l ! R0 l
- L P`@0
S R R 10000` V \ 0 P00c R s 31 ` V , 1 " 1
P R0000 , 0p ` V" p Pp'
0 V
, 1 000 \ 0 W00
$Ki V
R p p
0 S R P /0
P /- `
PP 5W
PP 0 :
0 7
04
02 0⃑ iP5I 0
038P0 0C0C P 0C H@5IP 0
0
00H0 SP @ 0S 0 5Y
0<P \ 4 @@PP /
-0BL M R" S p 0 S` L \ X 0- \`
+ \`
0w 030 \ X RH p` S
p ? @ #K #KK z @ 0 @ P0L P aL QWL AL Q 7L \ K U T 00 \ 00 S 0045%0 @_0 0 @ P
@t P Z
SF Sp (KK^]
-0BL,M R" SP 8 pP0 hh` F V Z 0- V`
+ V`
0w 030 V X Rp `p S
p Z @Q @Q ? #K #K Z @P
Y @ g P i 0 F0 S` a F RW`F A F R7 7`F V4 Z
P< Q P 00 V 00 S3 004 1!,$KH K P T & Q P 00 V 00 S 0041!,$KH K `8 R
\H P80
Sp 8 \(KK^]
-0B R" SL pP 0 TT.`@ D T Y 0- T`@
+ T@`0
0u 030 T X R3 @P` S
P ]
00 D \ @ a D PW@D A D P 7@D T
S T
S RC# @
0 0c X
RpF p SP K^]
0 S
S / P /$(0# @ / / / / / / / H-M 0Ѝ H-M 0Ѝ
-L `p@ A#HP0@VP@
-oOLM pP ! "0# P R0 && ! P $K 0 R R!
R / P /0@ 0A0 S * Q : /@- R ( 2 R R @-PPPP R rPP B@ PP R R00 B R000Ѥ000l \000Ѥ000 R
\6
R B0 -.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0 -.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0 -.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R ' 0 R @- R P1P P1P R rP1P B P1P B@ R010 1 B / R0q0`0q0`0q0` / \0q0`0q0`0q0` R
0 \6
R B0@-81, Ġ%̌T$\D#L0P R0@ Ġ01#̌ R R B0@-81, Ƞ%ȌX$XH#H0P R0@ Ƞ01#Ȍ R R B0@-81, ̠%Č\$TL#D0P R0@ ̠01#Č R0 0 Q > 4 4 8A0 Q" Q Q ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ / Q ̠ ̠ ̠ ̠ / ̠ ̠ /Q0 / / Q00̤ 0 / b0 R0̤A0 Q Q /0 Q0̤ 0 / R. 0
\ B BѴ Bôr - B R5 @P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R @P`p@@P` R@ /@@t @P B@@P B@@P R@ / R / R Ѥ ä / - \{ F
,DP`pL%T\&dl't |@P`p B R R ,DP`pL%T\&dl't |@P`p R / RAn ,D R L@Af ,HP`pH%XX&hh'x x@P`p B R R ,HP`pH%XX&hh'x x@P`p R / RA: ,H R H@A2 ,LP`pD%\T&ld'| t@P`p B R R ,LP`pD%\T&ld'| t@P`p R / RA ,L R D@A / R Ѥ ä / /
0 R / ! 0O / 0 #4< 0 / 0 8 0 / 0 #<4 0 / "4" 0 / 0 0 / 0 "$$#4 0 / 0 0 / "80 / 0"",$ / 0 0 / 0 #4"<0 / "4" 0 / 0 0 / 0 "$$ #40 / 0 0 / ! 0O 0 0 / 0"$,#4 0 / 0 #( / 0",$# / 0 # 0#<4"$0 / 0 0 / !<0!40"440 / 0 0 / 0(#(0 / 0 #$#, / 0 0 / 0 4 "0 / "$,! / 0 0 / "$$! / 0 0 / ! 0O 0 0 / 0 #4< "$ 0 / 0(#88 0 / 0 4",$ 0 / 0 0" ##<40 / 0 0 / 0 !Ġ"ĠČ#4<0 / 0 0,8( / 0" (#8 0 / 0"" #< 40 / 0 0 / 0 #<"4$0 / 0 # # "$, / 0 0,80 ( / 0 "ĠČ!$ # / 0 0 / ! 0O 0 0 / 0,,$ ,#$! / 0( #8 8,0 / 0 $ #< 4, 0 / 0" " $# ,̠ / 0 0 / 0 "$$ #$ <,$,!0 / 0 0#8 8,ȠȌ!0 / 0 ,#88"(0 / 0"Ġ ",$#< 4, 0 / 0 0 / 0"Ġ ,#$<,4 0 / "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0 / 0 "$$#< 4,̠Č! 0 / 0 0 / R4
R0< / B$ 0A00 0 P / R / 0 P / R / 0 P / R / R
: 0 R P!
@ P /LA 0 R P!
@ / 0 P0 / S0 / P0 / S0 / P0 / C / 0 11 /
-L @` \pP
Tb P
P1 0 P 10 1
0- QL@ U#
\
Q R S T0 0Fb PE Q Q R S T 0 0 0 0
-L,M Q p` S V
# 0 V RA S V
0 P V
0C
V j
o `1p00 t o?o c P V pj @ `P 7<8 0 4 ԃKX K p 5 S& B V 0 YQ
0i o i8 0i7YCK ?oo c! \
@P
0
\
@ 0`C3 8P
01 o?o c P \ @P 0 \
0?က႐ᇠ$K R0L ïP < 8 ԃK#K 0P P0
/LLp@P V
@ (K Qm : / P 3 /1o?o 0C͏LL 0 /P1"@ P1"@ P2"@ P2"@
P3"
@
P3"
@ P4" @ P4" @ P5" @ P5" @
P6"
@
P6"
@ P7" @ P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0" @ P0" @ / ~ -M
Ѝ Qs :o
Pj :o?o 0C͏LL 0 /P1"@ P1"@ P2"@ P2"@
P3"
@
P3"
@ P4" @ P4" @ P5" @ P5" @
P6"
@
P6"
@ P7" @ P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0" @ P0" @ / / 0 0 /
- L$K^
p-LM 1@ `xP Q
R&
_? 0 $0` 0 840(L 0 2L088 0 00 * Kphɚ,^J]J]J]K]0K]
-LM@p~ P { ` x$@ ` 0֯ KԪW]
- `Qp P L {r P W @( T k PD
0<00+8@40 400 0@0H0 0 P L00
0 V 0
p P { Px ` 0 l``
#R 8 < QD`P ``` Ue
\ *. Q | X S : Y P C \* P P l
` V `` Y < . V`A> V6 p pApG W0 ` pApG W 0`F V( `p 0A0C S 00G S - W
A0G S0 p 0 QpF` P * . QP c P0 X c 5u \<;0 84 0 < S
$ S
$ S
` S
$ S
/ Q
0 0 / Q
0 / / / P P0 84 0 < S"
$ S
$ S
p S
$ S
$ S / / Q
0 0 / Q
0 / / /
-L M@ T
00 S$
@ 0@ $9 S
0 @0 @DB I@S@ I@S@!I@S$B"I@S S#I$ K d]d]
0-L P @ 妭 | K0h蟭$d]]
-LCM P @ K ` Kᔬ00K 00K#03 0 00 0 40 l 0Kp ᭻ P 2 0 S H
E T
P 2 0 S :
2 @0Kp @ T
T
ቻ P0[
X2 0 S#
X 0G X K K,2 K( CKKK 1!0 000#0K1 0 S
(1 0 S
[0[ [ [ [ [ ~ [ } [ 0K G @P
@K \q0[0KTK 0\0K 0 K EKX@ D@ , ( β 0P
/ S
R
@*
0 Kn0KP P ȯKK K 0K 0 0 S 0[ K00K 00 0 " P K `% @ K *])]`O]8 Af1;i | 0J똁kqkmE0
A08S `L\Dsz]',@3 @ @40P040 N3 P ikݤWa뼉미 C #i럄 j& n2 @ @ 2p0 0N P9 b`p!\ghBhR Q P-
T0 00 S R": : #69 ߞ d@ y1@B1 @1 d0 1S P7
婫iQ:k~14@KJ_ 8
l1 ud1 X
odK<0 , <@0@ T
ad0 S
d0 D d$A d 0 0 0R P @@d@@ 0 P k 1d @, xd^ȶ ~@^4XԠ^@][]^xpFԶq]00u{]@{`^[\],bV]@ض{]Q]̔]t`Vǔ]
x- 4 0@ @LP c Q
` Kxh>d ~
40- 04 PL@ c Q
g K0h(d ~0 0 S / 0=Ȧh^[\]
p-L M80 @` S
0 0 0 V ` [ PP [ PP
,000 ` 0` 040 0` S@502:8P KpY
]1],]D] 0@-DG DG EH@ EH FI CF CF 0
-L M` @ PB@A@0 p T Ḙ T 0 K ]ZF ]ZL ]ZT ]Z\ ]Zc ]Zj ]Z]Zo ]Zt ]Z| ]Z ]Z ]Z ]Z ]Z E s ^ lt ^ `Y t O t t M @P K O L M PJ pP Y ^ ^ @n [ ^ Y 0KX^ ^ ̭^ W J ^ P l^ ^ x^ X^ ,^ tN D D x^ P^ (^ ] ] ]c ] ]
]j ]}], ] ] ] ]T ]o ]o ] ]t ], ] ]5 ] ] > ]j ] ] ]0 ]0 ]^p^P^0^^^П^^^p^P^0^^^О^^^p^P^0^^^Н^^^p^P^0^^^М^^^p^P^0^^^Л^^^p^P^0^ Z Z Z 0Z Z Z Z LZ lZ Z 8Z PZ ZZ Z Z Z Z C ] ] ] " ]?]
] E ]?] ] ^?]N]?]U] ] K ]?]V ]?]0 ] ^?]N]N^ mV]?]] ]?]}] c ]?]o ] ] ] c]?]5 ] k ] > ] ] n]?]q ] ^ ] ]?]N]N^ x ]?]} ]?] ]?]N^?], ] n]?]t ] ^ @@"]"]"](@@VIVI @VI @VIp@VI 5@9@VIVI2@VI GRVIGVI @@KXP[XSX*@@@@@l0@(T@S@ |@y@$@Gx@m@@w@G k@VIVIVIVIVI GRVIGVI bpf_detachd w@Xk@') @d ] )] )] *] 3*]
V*] y*] . *] *] *] +] (+] K+] n+] 4 +] +] +] 5 +] 6 $,]
H,]
k,]
,]
< ,]
? ,]
, ,]
- -]
(-]
P-]
s-]
= -]
: -]
-] -] " .] 6 ?.] $ c.] .]P .] # #
1 @ @ܜ@T@@@T@@@T@@ĭ@T@ 2 2
*
# h h u
h h h .]@ .]@
_bus_dma_busaddr_to_paddr PX @P@ TF @@ PN t@ RR @ CE ,@ ST @ NM @@ CL \@ 0 PL \@ 0 RE @ @ RR @ CE ,@ ST @ SL t@ RR @ CE ,@ ST @ ER X@ CE ,@ ST @ /C PZZZ ') @#1] 4Z\V\W\W,\WH\Wd\W\` A\ A\,A\W\W \W(\W`\d+CD\W|\W\W\W\W\W\W$\W@\W\\Wx\W\W\W\W\W\W \ @<\d@X\-Ct\/C\W\W\@ A\0/C \W \W\Vp\W 8Z\V\,cP\x+C,\x+CH\ ePd\ pP\` A\ A\,A\hP\jP \+C(\$mP`\d+CD\dP|\mP\nP\,C\nP\nP\+C$\x+C@\x+C\\x+Cx\x+C\x+C\x+C\x+C\x+C\x+C \ @<\d@X\-Ct\/C\@cP\doP\@ A\0/C \xcP \rP\VT\dBp\C /_@[ ,Κ;q Lr!oADSgEmV1JBچ8{ B":]0:]0:];:]I:]W:]j:]:]:]:]:]:]:]:]:]
;] VA #;][2 PVA 3;][2 VA >;][2A VA <][3 VA <][3 VA <][3 p A &<][3 q A -<][3 qA 4<][3 qA <<][3 qA D<][3 A N<][4 D
U<],[4 D
\<][4 i
d<][4 `Rf l<][4 i
r<]l[4 qA z<][4T rA <][4T tA <][4T tA <][4T A <][4T A <][4T A <][4T PT <][4T `A <][5TE `A <][5TE `A <][5TE %V <][5TE WV <][5TE i =],[5TE $i =][5TE 0$i !=][5TE ,i =][5TE 0,i !=][5TE .i /=][5TE 0.i ==][5TE Ai K=][5TE !i R=]l[5TE !i Y=]l[5TE )i R=]l[5TE )i Y=]l[5TE -i `=],[5TE -i Y=]l[5TE Ai k=][5TE Ai y=][5TE Ai =][5TE A =][5TE A =][5TE `A =][5TEJ `A
=][5TEJ `A =]l[6J `A =]l[6J `A =]l[6ZK A =][6K PA =]l[7A pA >]l[7A A >]l[7A /A >]l[7A ?A ,>]l[7A A 9>]l[7A /A F>]l[7A ?A S>]l[7A /A `>]l[7A ?A n>]l[7A XV |>][ `A |>][ X V |>][ ?A |>][ @X V >][ A >][ @X/V >][ ,^ #;] ;](;]/;]>;]:;]G;]C;]P;]L;]Y;]U;]f;]b;]k;] t;]|;];]|;];];];];];];];];];];];];];];] <]<]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]?] ?]?] ?]'?]>]>]>]>]>]>]>]>]>]>]>]0?]>]>]?]>]?]?]>]>]>]>]>]>]>]>]>]?] ?]?] ?]6?]'?]>]>]>]>]>]>]>]>]>]>]?]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]?]?]>]>]>]>]>]>]>]>]>]>]>]>]>]>]?] ?]?]'?]??]>]>]>]>]>]>]>]>]>]>]>]H?]Y?]>]j?]{?]?]?]?]>]>]>]>]>]>]>]>]?]>]>]>]?] ?]6?]?]?]?]>]>]>]>]>]>]0?]?]?]>]>]>]>]>]?]?]?]>]>]>]>] 0?]@]@]@] @]>]>]>]>]>]>]>]>]>]>]>]$@](@],@]0@]4@]8@]<@]@@]D@]H@]L@]Q@]V@][@]`@]e@]0?]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>][ [\|A\+C\AH\Ad\+C\A\A \+C(\+C`\+CD\ȆA|\ІA$\؆A@\ A\\DA\ A\+C\+C \A<\+CX\,Ct\-C\A\ȇA\A\0/C\+CT\8Ap\A lsl lsr asr ror )B]r] -B]r] 6B]1] D]CD] P FD]CD] KD]PD] TD]PD] XD]PD] ]D]PD] aD]D]fD]D] kD]D]0pD]D] uD]D]zD]D] D]D]0D]D] D]D] D]D] D]D] D]D] D]D] D]D] D]D] eq ne cs cc mi pl vs vc hi ls ge lt gt le nv da ia db ib ed ea fd fa fa fd ea ed s d e p p m z 0.0 1.0 2.0 3.0 4.0 5.0 0.5 10.0 AAtQdkdump AA\A0AAAA AAAA0AVI GRVIGA ܴAA@ ܴAA@ xor8 xor7 xor6 xor5 xor4 xor3 xor2 iscsi-crc32c copy fill8 zero v G]v G]n` G] DAAxjJNetBSD PaX ') XA] ') pAH] *>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ > ~ ? BvT@C(wTjBXlBnB BBBBLBPB [$[[ ') BS] T[\V\W\W,\WH\Wd\nT\TT\UT\WT\nT\LnT \W(\WD\W`\d+C|\W\W\W\W\XB\W$\W@\W\\Wx\W\W\W\W\W\W \1T<\BX\-Ct\/C\W\W\ lT\0/C \W \W\Vp\W\XB\`B\hB\pB\xB\B X,[\V\,cP\x+C,\x+CH\ ePd\mT\TT\UT\WT\lT\LmT \+C(\$mPD\dP`\d+C|\mP\nP\,C\nP\LB\+C$\x+C@\x+C\\x+Cx\x+C\x+C\x+C\x+C\x+C\x+C \1T<\BX\-Ct\/C\@cP\doP\ lT\0/C \xcP \rP\VT\dBp\C\XB\`B\hB\pB\xB\B \[\V\7T\rT8\_T,\psTH\,TTd\lTT\TT\UT\WT\B\B \+C(\+CD\,C`\d+C|\8+C\0C\,C\/C\XB\D+C$\ ]T@\^T\\ RTx\aT\dT\tT\fT\iT\\+C \1T<\BX\-Ct\/C\|,T\\jT\ lT\0/C \nT \oT\VT\dBp\C\XB\`B\hB\pB\xB\B CcW] \] &\] E\] d\] tCĈCȉC ieee80211_setmode @ P ,
$
0 H ` l
$
0 H ` l ieee80211_media_status , $ 0 H ` l ieee80211_media_change $0H`l $0H`l _ieee80211_crypto_delkey ieee80211_crypto_register ieee80211_crypto_unregister ieee80211_crypto_newkey qa]za]a]a]a]ieee80211_crypto_setkey ieee80211_crypto_encap ieee80211_crypto_decap ccmp_setkey ib] ̰CİCDC CC(C0Cieee80211_hdrsize b] C CCCq^h ,`@ yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(y v;VdNt ے
lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa
B|qؐ _jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ {m:, 0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z-tkip_setkey tkip_decap c] 4C,Cjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z-c] |CtC|CCc dY `Av `>c`a` f `dXY `c`a` f
`dXY XO. XO 0D d ceXOA `x `|c`da`F܄ ́ d ` eD @^
c`XNpx>D @^
c`XNpx /X .X 0D d@@C `exDĘ 0D ` `@` q`>exDĘ
`cexDĘ`d`Av?`d`ddD+ P`d`dЀ`d`#dЀ`dѺ`EdЀcG `C`d`vA < wD`W@J*D D@@/ @@ D`A` daD@@ @@dD? dDd`d`d`d?uD&& &
& @& `e` d$g`\` d`d@E+ @E `XOxXOJ fPeRaQ
@g&E@F`dP R~q&\` dٶ `e` d$g`\` d`d@E+ @E XO< XO fPeRaQ
@g&E@F`dP R~q&\` d %F&ADcՁ c `FB aDŁcEŁ`E dԄeD/X%DЀЀ ЀЀH %Fg/X` q ̃eD` u?ga#X@DDEDFDG? $D g $D? ` dDXCaC`E$D?' `
d`du? `(b`4d$E'= `dga@ D ߴ@@` f `d`AcXY `&d`AcXY d@Pced@Pg` f`c`dЀۃ D@@d@Pce d@P `x` dȁ>c dY `Av#X~`d$Ega#%E+ `pca$D' ӣԀ́$dXa d"%DZ g
ӾԀ́$dXga#XbCdC`A܄"ZbDɁX g a#X"bC̄ dAՀdCeAFdXɁ g a#X` d@KK`A"%D#fEHcȄ+FXeFɁ g a#X d@E` d@Fw`
/`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU` g a#Xw` `XNx`XN{x~`XNx ~`XNx`XN{x~`XNx/`b` aa\`XNx`G`E`XNx́Z`XNx`XNxU` g a#X`` .X`` .X c?@& σ.Xc`@* ` ` `?@& d d .Xc?@&܄ ` ` .X t
c7 ~ @AA Ł@
A ρ@
ʁ@ AA ہ@ ށ@ A ԁ@AA с@01A 3@2 6@754A <@=?>A:;A 9@8 (@)+*A./A -@,$%A '@& "@#! A`aA c@b f@gedA l@monAjkA i@h x@y{zA~A }@|tuA w@v r@sqpA P@QSRAVWA U@T\]A _@^ Z@[YXAHIA K@J N@OMLA D@EGFABCA A@@ c
< t
8
\ "T$&j(* , . 0 246z8:$<> @ B DFHJL
NP R TVX Z\^&`[b , .,.,.,., ., .,$.,(.,.. ,4.
,8. ,<. ,?.
,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,. ,. ,. ,. ,.`_d`,d E`dG`d@ A B C D E
~
G ` d N` @99SA01000000 Primary F's F3.10-04 01/17/2002 ~ ~ &~ ~
~
~ ~ ~ FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54
~
`c܀ ` d `~d`d `#x`d$Ega#Xd@Pa "*2:BJRZbhpz ``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`x i h^ d@@ d@A@B@T@U@^@Z@[ `b`4dЀ `bU`dЀ `Pb`.d `RbƂ `Pb d `Rc d a`c `>a` f`dXY `c`~a` f`dXY J`c `a dY c `*c `@a`~dXY `a˃YYӤ `c` eEK`a` e`deFX+FY `c`Na`deFX+FY `c` a`deFX+FY i` d
`"b` eԀ ̄ eD eD̄|c`F܄Ѐ `F `F܄Ѐ d cD܄P3D `|a`XOxFE`XOx `bfD ed@* ``vc d ` e`cd`4b`~beD `0 `P `y````EĄ$`0d%`E)``d-1 `d&*`d.2 `d'+ `d/3 `d(, `d04$Ą57 d@Pc d@T@U@A@B@^ d@R`:e `@* & `b `zbdD> `\e`@ & `bdDL `bdDF d@A@F@G `c`d `fc dY `Av`_xu``*b`d``0`x 0D bcdefl@AC@I`x0D drD`Rd@@ ܀d@@H`@ : g`ed@ : dpmd@K d@M@G" d@L&D@Fe`@& : hh ddV`Tl@`DdFGg`\bdۜ d@&D@F'D" @Gd! d!=D@]D|@^=D @]`>D @^FG`d0D d@@@D@C@B@A`d@N<`jd@M`Vx0D ` d@@
d@K `ed d@\` x0D ` ` O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+ t@:\+ t@:\+ t@t@:\+1` ` :\' 1` ` g`d:\0` g`d:\:\@' ` ` ` 0` g`d;\;\@' g`d:\٘` d>@g`Lb d
d@H`d@Kg`Jb`d d@Li` q d@@`x0D (`edd d@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av ` |`dٮ0`x,E?A0D 4C)D" &: * Dt )D@I$A `eŔ A@d>D& Ad>D* b dg`Vb܄g`bd d@IrR2{MD )D@I e* `xd@; `_x`tDt@^E^@^ |`"bXO XO XO XO |XO XO
=D@]@]-`xe`Gc=D$@]4 @]`G`Ac=D$@]4 @]`G`Ac=D$@]4 @]d@& Dt@^|`FbƂXO `d`T2D+ D @^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN% dKt` x aFG`x>D@^F` }`>D @^FG&C*P CF*D# D d@@rE܄`UeR$܄'܄(*D܀X2@* ]`x-D &
&D@F6 ]'D* @G-DX67 d!& *$ @Gd! *D܀X'D* @G'D* @Gd! 'D* @Gd!`x&D* pDЀddP`xd"F)`dd d!`xdFG
d@L) : `d`E`dĄ܄? k>D @^=D@]>D@^=D@]d̄>Dw@^"c* c(D&
%D`Fa^+!F
(D6
cD|@^=D @]` }>D @^FG`xd `fFB` |E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@* fi hD `E|i hD `G e|i hD ЀdD`G%
6 676n6& |"5dW.DlC!~iÔg`^b܄d'D@G`xd@ 6 `x |@En65 76& 6
6 Z`d܄ڂ܄!c'D@G`t`xLH LH LHDžǃ DžメLHǃ'σ HCCLN |МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP* &D @F ЀlDąЀ a(D* @' alDąЀ2D*' (D6 : d8d`x@LlDlD a(D+ a`@@'ANlD(D6 6 6 `xa@"1 lD(D: Ha 6 (D: Ma IaAMFNd@L e-D*
-DI6 H: e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A & -D"2@* P@M d`d܄'D" @Gd!H'D@G .D$@AF p@MlD a(D+ a`@@+
`eC(D@H)d"#DAN &(@@'@C8lD#D+ d@C8#G?eEL!pEԀd`PlD.D"& #AlD4T lD.@ * lDlD.@& #AlD7? lD72D* bFEڂlDڂlD#Ax|eaCрFE7 dCс||; H #D Ѐ`C `xlDlD]>#A>||e%DՀaCE5 6 `x bрFEa@&a\ a dCсDZ # ՀaC7 bрFEDa@&a\ a dCDс Dz
lD |FE dlDZڷdA(D@+ 2D& lDD}@^d̄=D@] ` k=D@]>D@^(D@+> :D+ ` :\+ t@:\+ t@:\+ t@t@:\+1` ` :\' 1` ` dg`d:\0` ` }`>D @^FG/Xd? ;D@' @`@* `xA`@' d@* g`c ew + d@*
g`c0en @+ d@* g`cee ` `xd@* g`c UT`*e0/`AdC DaG D냓`eD`Ncǃe`@+ \aнPYЀYЀЀ eDT`Nc~e`@+ \aнPYЀYЀЀeD
=`LdăgD e""dD@[dG@[dD@[`G`AE 7 cBcd@:
cZ݁`Ea_@[eG݁a_@[ Z݁a_@[` ` d@: ` `3` d?8 (d@IFJd0D@Q`x@*F`@&e )C'D `A;@+ `Ww_Ɂ`Ww_% & c @J`F; =F8*F`@* c@& c `F+FJ `Ww_`G c@& c @JCIAG d0D@Q> |>=FDG`@& `x=F`edC`x`x`xL/~ =F>`x d0D@Q ` 0` ` d>>@:D;D=F` c`|`xwD`W@J*1 $D $F , @D`F`\` ddD:D& u ;D@[
-EԀ Z`pd܄ڂ܄*D* #D <`@d@GXOS FCfC`\`"ddD:D& u ;D@[*D"K "D `FF d@B@ <`Fd@GXO+ FB7"fC @* `$d:D& u$ ;D@[ * `$d:D& u ;D@[ 'B `F /X*D* !D `F<`pd@GXO FAfC`d:D& u ;D@[4@&;*D :D* ;D `U d@Z@[= d@J5@* $A @U,
GXO (FDf\` d:D& u ;D@[ 5@* #A @U`}x5@* "A @U`x5@& 4@* !A @U@T ?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`A d۾eC%D aD
aF%D %D'C`F fD.X(AXO .X(A@XO (AXO& XOV .X|c @E eeD܅ `F@E 3DT3D`|d d Ѐ/XfC%FaDg <~d d# acY /XL|aXO c,F%F,F %F dЀ
dFgXO .X'C %F %D
`F%D ܄/XLXO( GXO .XLXO GXO^ .XLXO G'D %C cF'C
fCdDX `F%D
.X%F @G
dC 'Bڂ$ ʂ `F cF(
%F d
'B̄/X%F # `F xgg%F d %DXO XO' .X'C %F %D `F%D
%F d
%D/X %D %F|d/X a %D `F fC ݁3EE3D/X%FЀdC`Fg d dFFEXO .X fFE)CfD%D dae<`cCI ́`Vx& Ԁ`EѽDGDHDE`dD3A @E`F`|dM3D d Ѐ/X
Xee
0DP@Q0D}@Q?* F\g`Xbd`.d@D0DA@Q?0D@Qg`Xb dB e`A #`E `A 6aDd@& d 89 89܄8dD$܄`\aD9da\Ad@& `@* g`c0 d@* `@* g`c' d@* `@* g`c F\"d `x`@* eG 6 `EąŅ=`NdăagD g`c ` ` 8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:a eG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z ` g`b*= d ` :\+ t@:\+ t@:\+ t@t@:\+1` ` :\' 1` ` :\+ dg`d:\0` :@@' g`\b dE` d@Z3` ?? `2xd8~ `G SQ`\ PQRS dT ) : SdD cc cUF\"`@&@ !`EELĄ!,D ) dd@:O ' Vc))`Gd@* . "bcL4L)`@:v `@ 6n !̄`A d́ SUdA6dE bá $Ƃ(ւ́(*Ƃ`C `e ddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ
dD 68 aEĄsEԀ.h`b` d
d@\"d` x& (E`@ : `dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nb dg`Zb `b* `dѕdA ) `@: q݁݁݁%`G`Ca@" #`XOJx `dݸ#`XOIx `d)`Eh`b``dh`beD"`dڎF\fD `x dhh`b`adF\`@* g`Xbd`id@D0DA@Q?0D@Qg`Xb dۙ:D+ P'
g`\b dE` d@Z3` `xL?~ )`@: Z`Zd܄ `e"d `x dD`A`G `EaD 脤 `AeGaE.XdD`A`G `EaD `AeGaE.X`G `E @M`G `A-D ́`EaG .X"`kx0D* G!XG?2D&W dEGS
2D&N ' `T `:d@B0D @Q?2D&6 dEG2
2D&- O :c >D@^@^ `dd@B0DD]@Q?2D& dEG
2D& !`;x `d@@ `d@A0D@Q?(``b g`bd"dڙ0DY@Q` d@@ `xg`bd"dڙ0DY@Q` d@@ `x!` d@@ `d@B0DD]@Q2D& d EG
2D& `e >D@^@^? 2D& dEG)
2D&$ g`bd"dڙ0DY@Q` d@@ `x `e ̄'% `x `ux (``b g`bd"dڙ0DY@Q` d@@ `x `x g`bd"dڙ0DY@Q` d@@ `x)`@@+% >`@& :\d@@' d@+ 3` `x:\d@+ & t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@& dh? d (``b d !*
!dN `e"``@& `@* ;D+ @' `x& g`bd `@* `x<`db `F d@ : pdg`bb d@>>=Fd@)@+ g`Xd F~ `CEeDF`@* #`xde k>Dp@^=D@]e `>c`"e dHdG `A`J׀h@g`b |`@* @eD @^$`x D @@d& dG?dD+ `HeD`J eI dh^`\`
d die@Q d D * 666 Dش@@ D@* $@@<`bڃ aۂZڃ aۂZڃ aۂZڃ a ۂZڃ a`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD %C CE D @@dCӽ@D+ `HdD `Jh@ dIhEԀ%C <`a c Y1Y c Y,Y c Y'Y c Y"Y c Y Y c YY c YY c YY c Y `x'`x'`xI`@6 6 6( : ZӜ۸ ` q ̄eD` usD `b
`b '`xf`b ̄:D@Z;n`G# ̄`G" dnh sAIՀ'pEą`XdĄ@M`AsEԀ
dD 60 aEĄsEԀ
g`|b d dh -DpEԀ
`P`Eh`b`1dh`beDdf`d ̄v`EwԀԀ(``bd d=`b ̄ =`c`dЄ2D*0 h`b;h`ā3 @@* d- dd`A D@@@$`daDd e
* `bЀ @@* g`|b ̄1/dA"D 1@* ^DB!DL!EԀXO ?<`4b `F@FH`bFg`rbd@7d@7 g a#X(`c d۽۽d## d"%D#$%&' g a#X"(`c $%۽۽d# g a#X8d8`G?(`G q 9+:,;-./0<1=2>3)R P<.Ѐ=/Ѐ>0Ѐ`AaDB= JCd@* (d@* d@& 8`\ dD`G@`G)9!9+:,;-123 1:2;3+,- /X d `eQd@* D c)s`d+c)d@@'CK!Vad@'ba8DM`@&" ÁрcE dCׅELӀe e c-D,E`AԄ߃aD)d`G),C -D
-D+Eāрd.X+L`@&9 +`AZ`AZ`AL:`XNx N
D @^
cXOv~ F =D@]
cXO> >Dw @^
cXO4 D`夅 @^ k`>D` `\`d٘ g#X<`bʂ"d;`x<`bd;`x<`bʂ d;`x<`bd;`xe e`Fce@* d;`x g#Xg`Pb g#X g#XCDw @^
cXOl m>D @^` k
cXO_ =D@]=D @]`\` dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M `CdD`L cFCO?`G`\e/FdC bڂɁ`L b`M /Xj` x `bр` d+ t` ` `b ` d dtu du `b `d
?Wg`b& eEHN `aAM@`XOx-A`XOxOd"` dZ(DZe<`b<`pdfDZ
dZ+ET;7Xa `FN `.aAM@`XOx-A`XOxO!a dX`.cd"` d#He dѽۥ́څ<`b<`pdfDZ
dZ+eET; 6E`dD d1D@Q `b ` d=`/x>`x`cӽѽѰ 1D@Q
|`
d>`x`Gā>`x1D@Q & `|b`@: ec `@: ec ce`@6e`lb `|b`@: ec `@: ec ce`@6eg`rb`Nb`A& e^a@& c^Z de`Dbd>`XNx & `c`xa`dXY `rc`@a`dXY `c` a dY `d<`bʂ d-
`d2@& `bӥ`A 6 ́`bNB`XO`xO=`/xfD W d@FNFE<`b dfDZ
dZ+`XOxO7X *4 `Db`E `b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb `Fb`G7: 6 6
`bF `d<`b dfDZ
dZ+ NFE<`b dfDZ
dZ+`XOxOY`d܄ڂ܄ۻ <`b<`FdfDZ
dZ+Y`d܄ڂ܄ۢ :=`/x `b ` d `e
a XOdX cZڅ ́ `b `e?`c dZրZZZ `e dZրZ /X `d@A `c dЀ áۣ `c dЀ
adD́ @BCD ACXO`X"D#A$C !C `e׀ѽ CA?`ddX@O)`@& @`.x`@6 `DdXOdD`" 12Ѐ Ѐ3ЀA`vx `eԀdЀ dЀ&F" g Ѐ&F"@g &F)`@ * \c`@+bcҽЀ\Ѐ҃XЀU d`XOZxA`Lx&F) &G cӀ`@: Z`d܄# : Z`d܄ 0: Z`d܄ : Z`d܄ : Z`d܄ `HdXO- `@:
h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO
@: Z`d܄ `JdXOA`rx: A`XN}x `RdXOZ`d܄ :n @@&2 )12ЀЀ3Ѐp܄p dq
`dnd@6P Z`d܄ `LdXO `NdXO= `PdXOA`rx`Bb) 1Ѐ2Ѐ3 Ѐp܄p dq
`dn Y` d`@" h`XNxN&Fg`XOxO&FV )=`e
dd@+h`b`0dA`XN}x^`EsDd@* Ԅ砖Z`d܄ `LdXO `NdXO f`b#A`XNx&Ff`bdۺ <`b<`jd&DZ
dZ+ d@F fD >`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ `b `dD`dZ/X `\(`~d<`b(`zddJ `b `dD`dZ/X `b d f`b܄ dd
e=`XN2x ` cd |̄g`ve`@"3 * `cf`e`EĄЀ%
g`ve`E D@@Y`d܄NR`XOxO `b` dE` dZ/X `b dD`IxdG dDJ `b d `b@` dE`-dZ/X<`b*Dʂ d- `b ` dE`SdZ/X `b d۾ `b@` ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dw d"8d(` dd)f`b`4erDf`c d۽ۣqpG`dӆf`cdds9`b d^h`b`df`cd(`c9`|e dGӀG`Dd[NR`XOxO `b` dE`dZ/X `b dY`d܄9`b K`XN+xF`x Y` bc`@ :n
af`b@` e c$́d(`~b<`b(`zddJ `b `dF`#dZ/X `b d dn9`b `Egf`b̄ۼY` b f`bs.dD :* eD &`bd@&`C(`~b<`b(`zddJ `b `dF`mdZ/X `b dE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&c a`E66 66eD̄`EaD a`E:`(ce@* d݁e@* d݁e@* d݁e@* d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeD e`@&e`@&e`@&eY`hbeD`c`cن d`dbvf`XN:x`b* d * d * d dw./0123f`cd dDJ `b d `b@` dG`bdZ/X<`b*Dʂ d- `b ` dG`dZ/X `b d۾ `b@` dddh`b`pd D& e=`XN2x D@@ `b `d `b `dG`dZ/X `b d=` ba c`EeD&߃́cD
=` b2db`@ 6 `b d=` b ̄=` b`be djkmod@& J`x `b `df`e" l^d `b`d `b` dH`0dZ/XI`x `b`dی `b`aZJۡZn`@&2 vd) c8" d!d `b d<`b<`.dfDZ
dZ+ `b `dH`rdZ/X `b`aZJۡZۆ /<`(b `F%@H d@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D `F
I`xdmI`x,D* (F+* <`b<`(dfDZdZ+<`(b `F+*1 K`XNx `b d<`b<`.dfDZ
dZ+ `b `dH`dZ/X `b`aZJۡZw"& dmdo<`(b `F@H `FI`xlЀ+w `Ck*c i`XNxji`XNxefDiK`XN
x `b d<`b<`.dfDZ
dZ+ `b `dI`RdZ/X `b`aZJۡZw"iFHi`XNx d! i`XNx#f`b܄ @H<`b<`LdfDZ
dZ+(D do i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ `b `dI`dZ/X `b dmm djdf`b < E@@f`d܄ی d* `b`d `b` dI`dZ/X `b`dی `b`aZJۡZE`xg`ve`@"= * `cf`e`EĄЀ&
g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO `b` dJ`JdZ/X `b d `Pbg`dqpddqf`b vDd* `b`d `b` dJ`dZ/X `b`dی `b`aZJۡZh`b`qdf`d d dpe=`XN2xf`e`ddC߃ЀHf`b d@|
e=`XN2x `PbV`Sd ` cd |̄E`x"f`b dpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)G c8" d!dd.X:`bC`A脐
aD dD * dG .XL`?xxQ`XN(xQ`XNxg)Q`XNxc8 d":`XNxfE a} dd@&dcY dYڧ(`~b<`b<`.d~ eDZ
dZ+d]<`b(`zddJ `b ` dK`dZ/X `b `d.<`b(`zddJ d] `b dZ&F8 `A L`0x}L`xe8ՀL`0xC &FQ`XN(x ~d(g@g)+..+,//,-00- d":`XNxfE adcYK`qx.&F>`XNx DL`xO`x `d d] `b dZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx `c'`da`cӽa`b `c`eӥЀ@GR`XNx `b dZf`e dD`x'C`XNx
`Fb`EՄ`E
e>`XNx g`bd `b d `b@` dL`wdZ/X'<`bʂ d- `b ` dL`dZ/X `b d۾ `b@` d D@@K`JxyQ`XN(x d)Q`XNxG b `dcaYP`XNxy-D8 d":`XNx<`b<`.dfDZ
dZ+d]<`b(`zddJ `b ` dM`$dZ/X `b `d!<`b(`zddJ c] `b dZ&F =&F>`XNxL`Yx `d<`b(`zddJ &F>`XNx d] `b dZL`x `d d] `b dZQ`XNxL`Yx `b `dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY` d́X&F>`XNxddgde=`XN2xR`XNtx `b `d `b `d d] `b `dM`dZ/X `b `da`bd `@da`b d `dIa`b
d^ `b `d `b` dN` dZ/X `b dZ d] `ba`b `ba`bN`XN]xde=`XN2xf`ed`Xb dۥD`x ` d
c] `b dZ M`x/X<`b(`zddJ d] `b dZd.XdGF `e `cӣۧ(`~bٌ eԀ `b` dN`dZ/X `b dZ `c'`dd`Zb da`cӽa`b `c`edAЀI@GXՀ`Ea`b eD:d@*7 Հ4 a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x `b d `b@` dO`dZ/XFG `c<`bʂ d- `b ` dO`/dZ/X `b d۾ `b@` dd`Zb<`(b `F `b `dc `b `dM`x'C<ЀN`x'C@`A>`XNx
`Fb`EՄ`E
e>`XNx `b d `b@` dO`odZ/X'<`bʂ d- `b ` dO`dZ/X `b d۾ `b@` dyQ`XN(x ` d)Q`XNxQ`XNx aGddYځYYYP`XNxy-D8 d":`XNx<`b<`.dfDZ
dZ+d]<`b(`zddJ `b ` dP` dZ/X `b `d d] `b dZQ`XNxd`ZbdN`x `d<`b(`zddJ d] `b dZP`x `d"<`b(`zddJ d] `b dZ&F &F>`XNxN`x `b `dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc `b `d `b `dM`x D@@K`Jx])dA`@:
1 `b `d' :
" `b `d : e : e 0: e
`b `d f/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G ~`E ́.Xg`Hb* d * d * d d.X`ef`c'B>|Ԁa ae\f`baDf`b.X'B2 a c $: :
`@+ e׀c :
`@+ e׀c ,: `@'c Y`hbY`jc`@* cd * cd * cd cdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``b d.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed ́a`c&F123.X'D`AC腔&& * `@* a\Ga`b P'Aa`cӽYЀYЀЀ d d .Xf`c ddۣg` c ddۣ'D'DЁ af`caDۣf`bс af`baD.XY`bf`*c d۽۽۽g`b d.X d]<`c!D d `b dZ `*c `@a`~dXY /X `b `d/Xz./0 `bg`cӣ e~ g`bd|d
(|`E-d`dxd `b d D& d'`d
@* `bӱ=`Lb deDq @@&n ` ez@~)`d[ `Ce @& |dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @& dD,A `G ~`E ́z-D8f`bf`b `Zcq\`G `VbeA`EaDԀԄ `E `TbĄ@J `Xb d `ddT`xdR`~ x `Xb `Zb *D܄d *D̄d@J `c @@& dD6 : `6c*DG `b d `b@` dS`dZ/X<`b*Dʂ d- `b ` dS`dZ/X `b@` d
dW D@* `b `d D@" T`rxz{ d":`XNx<`b<`.dfDZ
dZ+ `b dۯ(`fb<`b(`bddJ `b `dT`%dZ/X `b `d <`b(`bddJ g`b(``bd dS`|x `b d۱(`fb<`b(`bddJ `b `dT`fdZ/X `b dW .S`|x `b d۱(`fb<`b(`bddJ `b `dT`dZ/X `b dS`|xR`x(`fbٲ(`rb<`b(`bddJ <`b(`nddJ `b ` dT`dZ/X `b `d<`b(`nddJ S`|x `dW
d <`b(`bddJ S`|xW<`b(`nddJ `bg`cӣЅg`bԀeD g`bAd `bf`c Y`d܄ `b d `b@` dU`$dZ/X~<`bʂ d- `b ` dU`JdZ/X `b@` d D" e=`XN2xV`x ``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG
eЁG aaD,BZZD (BJJBHD (D'`cf`be eELDH(E׀6Z>`Edԅ,DdGcBeF(Eր bF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB `Cf`be eELDH(E׀6Z>`Edԅ,DdGcBeF(Eր bF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@ `b` d `b dZ/X<`b(`bddJ `b dZ/X `b `d/X `b `d/X @& ``c`d# =`Lc `EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dD dG 123`|8 D
`Bb`@: d@*; W`XNYx`dЀ2- 6 f`d `C X`XNx`deDЀ`>`CaD`dЀf`b dۇeă ddG`E ;F ܄dX́d@Mae@*dD -ZdG -́Z2cÃae@&Y Ȳ dYYYЀ2eă a`@" * `@: $ : : 6 `XNx `Va ` c `Tba ē dD|̄ eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx` dԀ9cD" `G eԀ*X`XNxe\X`XNxgAX`XNx-D EMX`XNxeAX`XNxf`beDX`XNxf`beD-E `|dA ef`b@N.Xf`b.Df`bZZ `C6ZdE`A cD" `G `\cD" `G `EdDɁՁaDǃ ߃X`XNx`dԀX`XNx ef`b@N.XcD" `G `EcD" `G `G.X/X `b `d/X(`b<`b(`ddJ `b ` dX`dZ/X `b `d Gg`Bbo` dXO) O `b`aZJۡZ`zb* Gg`Bbf` dXO g`Bbi` dXO O HNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:Y P[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&A g(F d d .+/,0-./0Cd@* `G@`G) c(":`XNx ~<`b<`(dfDZ
dZ+ d@FHo`_x+gDЀ8{ܠ x`e Ԁ` dpЀg`clg`
d܄Ѐ`Ѐ ]\` d c a&eҡСdDՀف&FC`Gd@&@`G) ~(d8 d"(+,-./0 `E&F3dD2eD1:`XNx<`b<`(dfDZ
dZ+g` d܄o`x&Fk`x `dfE FK FI0eF0/Ѐ)F/.ЀeF.Ѐ)F.X d h`b)`@ 64 : dD eԀ/+ dD DdD6& 6' 6( 6) @6* 6+ 6, 6- 6( 06) P6' 6( 6 6$ 6" h`bh`c dۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`c dۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`c dۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`c dۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`c daѥрp`xh`eh`c daѣрp`xh`bh`c dۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8( `DbdGЀ `Ac `Fd`EХЀeD́d@' H РdD `EdD Ԁ*Fp`xh`bh`c dۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`c dۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOx h`bdp`xh`bh`c dۣ)+: +Ѐ,Ѐ-Ѐ@h`bBh`b @G Veh`aeCPҡЀҡЀҡЀ 'D̄@G)' .Ѐ/Ѐ0Ѐ\es`XOx +& h`bdp`xh`bh`c dۣ8FJ`Ah`b6 h`b6 aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b @G"\eh`aeCPҡЀҡЀҡЀ'D̄@G
h`b: s`x8 s`xh`b6 `DbdG <9c`A`FdР́d@+* Р' `DbdGЀl`Ac `Fd`EХЀeD_́d@+
РdD `EdD ԀMe ~`GāaE& ~ `G ā& `G Ѐ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`b h`b@Gh`aeCPҡЀҡЀҡЀ'D̄@G H/X`*b`d`` c` f `{d̄`*b`d` `x ! Secondary F's ~ 8
$
F @ p 4 '' d d ' /
d
# + `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@ `xA `x %`-xC `x $`xE %`ux `x =`%x?`Gx y=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo
h0313DD031303132323 x==3F446 45" 45 46" 45 45 45" 45 4~7
45 45
45 45^ 45p 45 45: 45D 45F 45 407 44f 45j 45 45vg 45 499
45 45 45a !4 5a $57 %57 &57 '57 #45 (77 *45 +44x ,48f -48 .45f :45g )5<5^X 45 45 45 407 4 7 Y 45| 45z 454 45 45 4-8~ 47t 4r7 45 45 /45 04K8 148 44J 64L 64Z A64 448 44$ 44` 44\ 44v 44r 44> $44 %44 &64t '648 E44 G44N H64l I64n J44 K44 M64\ P44Y O64X 64` 44 64 64b 44
h64: !h64B
"h64
#h640
@44 A44 Y" B45 C64 D64 F44 L44 44 44 44f 64d 64f * 555 96^m Y0$\$Y$z#\$\$ b$b$b$ $%{# w$ HH
\ "t$&
(* , . 0 246z8
:$<> @ B D F&H[JL)NP R TVXZ\ ^`b , .,.,.,., ., .,$.,(.,.. ,4.
,8. ,<. ,?.
,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,. ,. ,. ,. ,. 8
\ "T$&j(* , . 0 246z8:$<> @ B DFHJL
NP R TVX Z\^&`[b , .,.,.,., ., .,$.,(.,.. ,4.
,8. ,<. ,?.
,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,. ,. ,. ,. ,. e g \ 2 e ~ Z ~ n * > R f z " 6 J z ;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z [>
[>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZ hYjY,28DJhn̘ a a ` $ P[ <_x bd a *g8 Y g 4UY Y Y Y Z Z Z BZ ZZ pZ tZ xZ |Z Z Z Z Z Z Y Y >g Y Y Y Y Y Y Y Y Y Y lY FY >g 8 Y Y Z Z Z Z Z Z f~ @
$ L~
F @ P X~ Z~ &~
8
č ~ ! Zin4_cksum ^ ^) L|F BlBxB ^ |
T E E\T ^ R EE,\ES
S ^ XO_OEE \ ^: C dC_OEE \ IC ^< pA ^+ O ^, B ^ C hG_OEE \pG ^) C hG_OEE \pG ^g C LF_O E \F ^ C XO_O E \VO `^ NG :GDGCGDG `^ T FF\`T `^ \R FF,\RS
S `^ DOdLOFF̔\ `^ C 4GdLOFF̔\DG `^ C GdLOFF̔\pG `^) C GdLOFF̔\pG `^ C nEdLOFF̔\LmEwEwE `^ C DOdLOFF̔\IO ,]]]] U Q] U o] U 2 ] U 3 ] U 1 ʘ] ``F^FxjJ ] U 5 ] cFaFxjJ (@AAA==(A * } E # ( D ( @ A A A = = A * deadcv ') GA] VIVIVIVIGVI GRVIGVI GVIVIVIVIVI GRVIGVI GGVIVIXGG GGG GG GG V@tGG dG`GG tG GGTGexec_init ]g];"]]Ơ]Ҡ]assert_sleepable mutex_vector_enter self ,Z\?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????
!"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ! #$%&'() + - 0123456789 @ABCDEFGHIJKLMNOPQRSTUVWXYZ ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{ }~ ϾǎԐѥ噞᷵ǎԐѥJJ /CJ@CJ U e\ ') J:] . .. e\\V\J\`J,\+CH\+Cd\ K\J\4K\J\J\,J \+C(\+C`\d+CD\,C|\8+C\0C\,C\/C\8K\D+C$\\J@\+C\\Jx\ K\J\+C\tJ\+C\\+C \|J<\JX\-Ct\/C\\J\LJ\\J\0/C \J \J\VT\dBp\C nd6_rtrequest nd6_cache_lladdr nd6_storelladdr THIS is A memory TEST pattern earm zaurus ') XK]]nfs_boot_delroute `xLhuL `xLpyLnfs_sillyworker t|L|L,}L @ k\k\rk\^k\Rk\@k\,k\k\j\j\j\j\j\lj\Dj\"j\j\i\i\i\i\i\
?BEF
F '' F F '' F F '' F ''
F '''''
F ''''
? E F '''
? B E F '''
? B F '''
? F ''
? E F ''''
? E F '''
? E F '''
? E F '''
E F '''
F '''
F ''' F ''
? F ''
E F ''' F ''
$o\m\\l\ ') L0^ 5dl\\V\W\W,\WH\Wd\M\<M\L\02M\L\DL \W(\W`\d+CD\W|\W\W\W\W\M\W$\W@\W\\Wx\W\W\W\W\W\W \L<\ԀLX\-Ct\M\W\x+C\M\0/C \W \W\x+Cp\W 5m\\V\,cP\x+C,\x+CH\ ePd\
M\<M\L\02M\HL\L \+C(\$mP`\d+CD\dP|\mP\nP\,C\nP\nP\+C$\x+C@\x+C\\x+Cx\x+C\x+C\x+C\x+C\x+C\x+C \L<\ԀLX\-Ct\M\@cP\doP\M\0/C \xcP \rP\VT\dBp\C 5,o\\V\(M\M,\MH\Ld\M\M\L\02M\@L\$&L \+C(\+C`\d+CD\,C|\8+C\zL\,C\/C\M\D+C$\M@\L\\@Mx\PM\L\ԳM\pL\L\\+C \L<\ԀLX\-Ct\M\pL\pM\M\0/C \M \tM\x+CT\=Lp\C ] MMM ] ]
] ] DMM(M 5 ,\ ~\ 5 }\|\ = ,\ ~\ = }\|\ V D|\8{\ V z\y\ԇ]ه] \y\Px\]/]}:] w\v\P tv\hu\]91] u\s\ s\r\%
8
@ ! ! @ ! ! # / ' ' w 0 g ' ' c 0 c @ ` ` ` ` ` ` ` ` pmap_map_chunk EX 9 _] N@NxjJ]4N~]dN]N;]N]N]Ns[ m[ h[ pxa2x0_i2c_intr_sub ] O@OO @ ` p x | ~ 0 8 < > ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ???????? @ ` p x | ~ 0 8 < > ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? @ ` p x | ~ 0 8 < > ? ? ? ? ? ? ? ? ? @ ` p x | ~ 0 8 < > ? ? ? ? ? COCOCOQOBOHOBOHOHOCO COBOHHOHOBOBOPOBOGOBOhOSO,ROXUO4RO|TO>>>ffffHHHHaaaa5555WWWW iiiiَ UUUU((((ߌ
BBBBhhhhAAAA----TTTTQP~SeAä:^';k EXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk +pXhHElR{#srKW f*U(/µ{ӥ70(#j\+ ϧyNieվ b4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG
||B 2H+ plNrZV8= ծ6'9-
dh!\T[$:.6 g
WҖOa ZiKw
*h8,4$_@r %(IXq'Of ɴ:}Jc1`3QESbwdk +XhHpElޔ{R#sKrW *Uf(µ/{ņ7(0#j\+ ϊyiNeվ b4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG
|B| H+2p NrZlV8 ծ='9-6d
!\hT[:.6$g
WҖO aiKwZ
*C"<
Nj-ȩ WLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/ 0R
wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:,
xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL ,QeF^]5st.A Z gRے3VGmaךz 7Y<'5a h,4$8_@r %⼋I<(A
q9 ؐVda{p2t\lHBWЧQPeA~S^':k;E XK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk +hHpXElޔ{Rs#Kr WUf*(µ/{ņ7ӥ(0#j\ ϊ+yiNe;b4 ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y
|GB| +2Hp rZlN8Vծ= 9-6'
d\h!T[.6$:g
WґO aKwZi
*"4$8,@_ r% I<(
A9q Vd{a2p\lHtWBQPA~Seä':^;k EXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk +HpXhEޔl{Rs#Kr WUf*(/ņ{7ӥ(0#j\ϊ+ yiNeվ4 bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G
B| +2H pZlNrV8= -6'9
d\h![T6$:.
gWҖOa wZiK
*"$8,4_@ r %<(I
A9q Vd{a2plHt\BWccƄ||ww{{
kkֱooTőP00`gg}++Vb櫫MvvEʏ @ɉ}}YYGG 쭭AgԳ_E#Srr[·u ᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07
/ 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ ,` @ ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa
ppB>>|ĵqffHH aa_55jWWйiX' :'8볘+3"iip٩3-" < I·UUx((PzߥY
ڿe1BBhhAA)w--Z ˰{TTֻm:,ƥcc||ww{{
ֽkkޱooT`P00ΩggV}++bM櫫vvE @}}YYGG A쭭g_E#Srr[u· =Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7
/ $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh ,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88cwuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y^^ v;dV22tN::
II
Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$ WsǴQ#|tt>! KKaܽ
pp|B>>qĵ̪ffHH £aaj_55WWiйX:' '8+"3һiip3-<" IΪUUPx((zY
eڿ1BBиhhAA)Zw-- {˰TTmֻ,:ccƥ||ww{{
kkֽooޱőT00`PggΩ++V}bMvvʏE ɉ@}}YYGG AԳg_Eꜜ#Srr[u =&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7
/ $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh , @` y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋
pp>>|Bqff̪HH aa£55j_WWiІX :''8+"3iiһ٩p3- <" ·IUU((PxߥzY
e1BBhhиAAÙ)--Zw {TTm,:cƥc||ww{{
kֽkoޱoőT0`P0gΩg+V}+bMvvʏEʂ ɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u· =&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7
/ $6=&'Ni'Ͳuu ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh , @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP! KKaܽ
pp>|B>qĵf̪fHH a£a5j_5WWiйX :' '8+"3iһi٩pَ3- <" ·IUU(Px(ߥzߌY
eڿ1BBhиhAA)-Zw- {˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث
XXXXEEEE,,,, ????kkkk::::AAAAOOOOggggꗗsssstttt""""筭55557777 uuuunnnnGGGGqqqq ))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZ ݨ33331111YYYY''''____````QQQQJJJJ
----zzzzɜ;;;;MMMM****뻻<<<QVI?QVI =QVIh?QVI |/-\ 0123456789ABCDEF 0123456789abcdef vmem_rehash_start (Ń\\Vd\+C\pQ \4Q<\,QX\p/Ct\x/C\PQ\/Cp\/C Q HQ 4Q Q Q 4Q Q Q ') (Q?^ R LR d R R R R 'R #R 'R $R GGGGlRR RGG ') R^ X \R\R]R ]RP]R]RX]RT]R hRcRgR dRcRhRcReReRcRjRiReRpjR0iR @ @ @ @ @ @ @ S S!S#Stcp_ctloutput WS _SRSTSLSSS SS^Sx_SNSp3S&S RSQSNSMSPSPSPOS3S""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwvtw_control_init @@@@@ @@@@@@@@@@@@@@ @@@@@@@@@@@@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ SS HSS ttyout ttyin ttybg ttyopn ttycls ;^ C^ H^ O^ T^ X^ ^^ VIVIVIVIVIVI GRVIGVI PShS SHSSSSXS8S(SSSVISVI S8SSS8SVISSVISVI SVIS SSVI SVISVI (T\S\S TdSP TlSSS$S,StSSS|SSS0SdS,THTT0TPTT TT TTTTTTlTTTh#TTTT GT\GTGTU 9U;U >UAUD0UL0UP8U48U ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ %% $ $
$
$ $%% %%<%## %## %$%4%,%%d"e"`"
" %" #!#%#
# # #
"" *# d"`"e"+"4" " " ""<"C" !!a" """)"*"'"(" " !!!! E^E^E^E^E^E^E^F^ F^F^F^ F^#F^)F^OE^UE^/F^5F^;F^AF^E^E^E^E^E^E^E^E^E^E^E^E^E^E^wsevent_copyout_events
YY @ `P0pH(hX8xD$dT4t L,l \<|B"bR2r
J*jZ:zF&fV6vN.n ^>~A!aQ1q I)iY9yE%eU5u
M-m ]=}C#cS3s K+k[;{G'gW7wO/o _?8\ & h] & \ & \ \ o \ /\
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ `\ \ a \ ) t\ 2 \ \ \ ͳ ɿپ ̴ ް
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ 3Yp4Y YVI&YVI YVI YVI ABCDEFGHIJKLMNOPQRSTUVWXYZ IY@Y$AYVIHYVI pAYVIAYVI < d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !
[ " $ & ' X 4 g k l r ' / 5 7 < ? B C E G H I J K L M N O R U V W Z [ \ ^ _ : ; < = > ? @ A B C D E F G H I J K L M / 5 7 < ? B C E G H I J L M N O P Q R S U V W X Y Z [ \ ^ _ \ \ m1 ! 2 "
q w W ^ a
z
'3 # &4 $ e E = s d D ` x 5 % r R + t T [ f F \ c - - @ 6 & !y Y ] "g G ; #v $b B _ % &
'(7 ' )8 ( *u U { +h H : ,n -, / < .09 ) 1i I } 2j J * 3m 4. ? > 680 ~ 9o :k ;l L | =>@ Ap D
FKT]
1 ! 2 "
q w W ^ a
z
'3 # &4 $ e E = s d D ` x 5 % r R + t T [ f F \ c - - @ 6 & !y Y ] "g G ; #v $b B _ % &
(7 ' )8 ( *u U { +h H : ,n -, / < .09 ) 1i I } 2j J * 3m 4. ? > 680 ~ 9o :k ;l L | =>@ Ap D
FPQSTXY]
zssp_init zssp_ic_start zssp_ic_stop zssp_read_max1111 zssp_read_ads7846 NBCDB
@ @ Z g g }
j (sF K #( % strtoumax strtoimax 0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z- A1b62S-+ldEw}ZVǖAOIъ OM~- QJ#SpxAaU.7 Y -6]]w ll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* , m8 6F߲]qTp0ek*1u 4yީ%8 S1bSWĔՖ k1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$ ,52F* sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL 8^#ܖ TZ1ObbSyOIV~P-{ b-R4 ٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ
?&~?$pi;FBzw[keZ~7 Sv8H 3?r$ 7jnԄYFܨ |OQ;օ
U d S
-
=G\ p& G w ) ` /a߫i5&LsZ<#0zMzFM8,9; :R:( q-v,.7/pXqY s3r %w+OQvrtEux܉~OK
}!b|ty Bxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HIN SKyuJcO NZLݘMFGN@E$DD2AsX@*IB CPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^
iϏ은BI#ƈdX ܁T̓cQ:
rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"_HS1 ^Z4 eg Wb27_k%8ם(ŊO}doJj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg;
i8P/ _Y=чe:ZO?(3wwXR
@hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?# 1jvʬ`p^ Y<L~i/{kHwâ
hs)aLoD~Pf7VM'(@ﰤ ہg9x+ n&;f?/X)T`D1 ߨM ߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$ !AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3
m:@/)IJNv"2x+ ٗ Kx.HҥfAj ^y9*O]#kM`~b_R 7zF h!1߈Vc0a"j6nS Nr )Υ{t*F8#vufz`rs"WG9^EMvc&DAdQy/4 Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫϩ7~8A]&nv|o Y
yKiw\¹9~$ 66nQ fq>,o,IӔ 渱{I
.H>C-Yn馑gQ z taf w0a, Qmpjc5dۈ2yܸ و L+~|- dj qHA}mԵQӅlVdkbze\Ocl=c
;n Li^`Agqr<KG
k5Blۻ֬@2lE\u
ϫ=Y&0Q :Qa!V#Ϻ(_ ٲ $/o|XhLa f-=vAq *q 3xɢ 4 j
m=-dlc\kkQ labe0b Nl{WeP|b -I|LeMaX:QΣ tԻ0JߥA=ؕפmCij4ngF`D-s3
L_
|Pq<'A Wh% of a^)ɘИ"רY=.
\;l tҚG9w&sc d;
mj>zjZ
'}D hibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K
+گ
L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮ d°c&ujm
6?rg WJz{+ 8Ҏվ
| !Bhݳ ڃn&[owGwZjpf; \ebiaklE
x
NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮SG0齽 ʺS0$6TW)#gfz.aJ]h*o+ 7 Z- 1A26b+-Sdl}wEVZOAي»IˬO ~M- JQS#xpaA.U7 Y -۩6˚w]]ll A?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z , 8mF6]pTqke0*1¶ u4%y<8syjHA}X* ݹ 1SbSW§ٖծ 1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8, $5 *F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8 #^T O1ZbbySIOP~V{-b -4R ^~GelHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb#
&??~p$iBF;[wzek~ZS 7H8v ?3$r j7nFY |OQ;
U dؓS
-
\G= &p G w ` )/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+ )`F(>
q-q ,v.Ț/7pqXs Yr3w% vQO+tru՛E~xKO}
|b!ytxB z{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKS NJuyOcN LZMݥFĚGE@ND$A2D@XsBI*C ThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z
&J8 좞V`a/6i\lU,zB\u H=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_
^ϋiBۉI#dX фTQc:r
Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފ Z^ھ4 ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[
;g /P8i_ Y=嗇e:ϏOZw3(?RXw@
Qh+HZ"0*WOIo@}m5N#+'*GA |HX=#?X1 vjʨ`^p YL'! $UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n
:m@I)/NJ2"v+x xKH.jAf^ O*9y]#Mk~`bю_ Rz7h Fм!10cV"ajحn6 S rN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA 4S&ֿ EbLil!>aDƋΪ~7A8n&]|vY oᡱ
Kyiw¡\~9$66 Qnf>q,o,ӹI 散
I{. C>HnY-Qg̰ t zfa g jgrn<:ORQhك [/BD7q۵[V9Y?^ [1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg))
'8!.m,M
8STs
e
jv.,r迢KfpK£Ql$օ5pjl7 LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6 _:OтRQ l>+hkAك y!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^ BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= %
GoQcpn
g))/F
'&&\8!.*Zm,M߳
8ScTs
ew<
jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7 LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj( c#齂lPyƲ+SrxqƜa&>'!Ǹ }xnO}orgȢ}c
?G 5 q}#w($@{2
˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd
. ۤO HG __subvsi3 __subvdi3 __negvsi2 __negvdi2 __mulvsi3 __mulvdi3 __addvsi3 __addvdi3 __absvsi2 __absvdi2 N^5 ]N^N^N^N^N^S]:]%O^N^N^#1]]N^N^N^]N^N^\ ]O^T]
O^O^O^ O^#O^` ])O^1] gntsIZ IZ\IZ x RO^
^ lZO^ tZO^ tZ}] \Z@] yZO^ HeZKO^ OZ `Z$`Z rbmn(_Z aZ0`Z ^Z _Zx( O^tcidiZhZlZxZ0hZ gZ gZgZgZ yekdhZ lZfZ ` O^0 O^H< O^`, O^atadzZ {ZlzZ ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ O^loobZ `ZZ yaraZĄZ(Z܅ZZ O^strtoull strtoll strtoul Copyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005,
2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015
The NetBSD Foundation, Inc. All rights reserved.
Copyright (c) 1982, 1986, 1989, 1991, 1993
The Regents of the University of California. All rights reserved.
INSTALL_C700.201610210724Z NetBSD 7.0.2 (INSTALL_C700.201610210724Z)
@(#)NetBSD 7.0.2 (INSTALL_C700.201610210724Z)
7.0.2 NetBSD crypto fss pps ptm atabus drvctl tap veriexec fw ucycom utoppy bthub amr lockstat putter srt drm bio altmem twa cpuctl pad zfs tprof isv video hdaudio uhso rumpblk npf dtv filemon iscsi tpm mfi seeprom dtrace spiflash lua swap ctty physcon ptc qms ofcons wd fd ccd cgd bpf tun filedesc vidcconsole opms ipl ofrom scr rnd fcom joy midi sequencer vcoda wsdisplay wskbd wsmouse usb uhid ulpt scsibus raid ugen wsmux ucom urio uscanner openfirm biconsdev isdn isdnctl isdnrchan isdntrc isdntel sacom mly wsfont agp pci iop altq mlx plcom clockctl irframe cir radio kttcp ixpcom sysmon dmoverio apmdev sscom ksyms isdnbchan epcom tslcd twe nsmb brgphy nsphy nsphyter qsphy inphy iophy exphy lxtphy icsphy sqphy dmphy pnaphy ukphy wdc pxaip pxaintc pxagpio saost pxadmac pxapcic pxartc pxamci ziic zssp w100lcd lcdctl zkbd zapm ld_sdmmc wi_pcmcia ne_pcmcia pxauart com_pcmcia wdc_pcmcia wsdisplay_emul cpu_mainbus pxapcic_scoop zmci pxaiic sdmmcbus mii ata_hl pcmciabus wsemuldisplaydev wskbddev apmdevif i2cbus drive controller socket index channel atapi kbdmux dack irq intrbase apmsuspend power management disabled real mode interface already connected interface not connected 16-bit interface already connected 16-bit interface not supported 32-bit interface already connected 32-bit interface not supported unrecognized device ID parameter out of range interface not engaged unable to enter requested state no pending events no APM present unknown error code APM reserved APM: %s event code %x
get event apmstandby apmev ioctl get power status apm at %s Power Management spec V%d.%d unable to create thread, kernel APM support disabled
reserved system reserved device OEM defined booted_device booted_kernel console_device cpu_arch powersave cpu_id fpu_present hwdiv_present neon_present id_isar id_mmfr id_pfr id_mvfr simd_present simdex_present synchprim_present printfataltraps machine_arch Warning IRQ's disabled during boot()
%s%s total memory = %s
avail memory = %s
single -s kdb -k -d ask -a quiet -q -v atabus at %s channel %d wd at %s drive %d %s: unknown child %p ataspl atainitq atadown can't alloc drive array
qidl ataact atdrn unable to create kernel thread: error %d
couldn't establish power handler
%scnf unable to create config thread: error %d
atath ata_thread: queue_freeze %s(%s:%d:%d): using PIO mode %d 32-bit data port
drive supports PIO mode %d %s DMA mode %d %s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133) SATA port multiplier not supported
atapibus at %s not configured
%s:%d:%d: bad state %d in wdc_ata_bio_intr
wdc_ata_bio_intr: bad state %s:%d:%d: device timeout, c_bcount=%d, c_skip%d
%s:%d:%d: read intr before drq
atacmd_to48: illegal 32-bit command: %d %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x
%s:%d:%d: not ready, st=0x%02x, err=0x%02x
recal piomode setmulti %s:%d:%d: %s timed out
%s:%d:%d: %s drive fault
error (%x)
wdc_ata_bio_kill_xfer: unknown reason %d
wdc_ata_bio_kill_xfer match_bootdisk: can't get label for dev %s (%d)
no mainbus found WARNING: double match for boot device (%s, %s)
boot device: %s
bpf_change_type bpfattach bpf_mcpy %s: descriptor not in list maxbufsize peers %s: bpf_setdlt: ifpromisc failed (%d)
bpfops : Media interface
: %s, rev. %d
bge bnx phyflags failed to get phyflags
chipid failed to get chipid
shared_hwcfg failed to get shared_hwcfg
port_hwcfg failed to get port_hwcfg
2500baseSX-FDX, BCM5400 1000BASE-T media interface BCM5401 1000BASE-T media interface BCM5411 1000BASE-T media interface BCM5421 1000BASE-T media interface BCM5462 1000BASE-T media interface BCM5461 1000BASE-T media interface BCM54K2 1000BASE-T media interface BCM5464 1000BASE-T media interface BCM5701 1000BASE-T media interface BCM5703 1000BASE-T media interface BCM5704 1000BASE-T media interface BCM5705 1000BASE-T media interface BCM5706 1000BASE-T/SX media interface BCM5714 1000BASE-T/X media interface BCM5750 1000BASE-T media interface BCM5752 1000BASE-T media interface BCM5780 1000BASE-T/X media interface BCM5708C 1000BASE-T media interface BCM5481 1000BASE-T media interface BCM5482 1000BASE-T media interface BCM5708S 1000/2500baseSX PHY BCM5709 10/100/1000baseT PHY BCM5709S 1000/2500baseSX PHY BCM5709CAX 10/100/1000baseT PHY BCM5722 1000BASE-T media interface BCM5754/5787 1000BASE-T media interface BCM5755 1000BASE-T media interface BCM5756 1000BASE-T media interface XXX BCM5761 10/100/1000baseT PHY BCM5784 10/100/1000baseT PHY BCM5785 1000BASE-T media interface BCM5717C 1000BASE-T media interface BCM5719C 1000BASE-T media interface BCM5720C 1000BASE-T media interface BCM57765 1000BASE-T media interface BCM57780 1000BASE-T media interface BCM5906 10/100baseTX media interface disksort fcfs %s: curaddr %#lx not in range _bus_dmamap_load_raw: not implemented _bus_dmamap_sync: mix PRE and POST _bus_dmamap_sync: _BUS_DMA_BUFTYPE_RAW _bus_dmamap_sync: _BUS_DMA_BUFTYPE_INVALID _bus_dmamap_sync: map %p: unknown buffer type %d
_bus_dmamem_map: size botch cd9660nopl cd9660_reclaim: pushing active RRIP with incorrect NM flags?
RRIP without PX field?
RRIP with incorrect flags? IEEE_1282 IEEE_P1282 RRIP_1991A SP fhtovp: lbn exceed volume space %d
fhtovp: crosses block boundary %d
fhtovp: bread error %d
fhtovp: directory crosses block boundary %d[off=%d/len=%d]
cd9660 utf8_joliet CD001 %/@ %/C %/E root_device cd9660_strategy: spec tag VT_ISOFS, isofs vnode
org.netbsd.kauth.system %s: %d silo overflow%s, %d ibuf flood%s
device enable failed
' ns16550, broken fifo ns8250 or ns16450, no fifo ns16550a, working fifo Au1X00 UART, working fifo ns16650, no ERS, working fifo OMAP UART, working fifo is_console can't re-init serial console @%lx
txfifo disabled
unable to allocate ring buffer
couldn't establish interrupt
configure failed, error=%d
MEGAHERTZ MODEM XJ2288 compat config_hook: invalid hook type config_hook: incompatible mode on type=%d/id=%ld != %d config_hook: type=%d/id=%ld is replaced config_hook: type=%d/id=%ld is already hooked(%p) config_hook: malloc failed config_connect: malloc failed config_connect: can't connect with shared hook, type=%d id=%ld cnopen: no console device cnopen: cn_tab->cn_dev == dev cnopen: unable to get vnode reference
%s@%d NetBSD-CORE crypto self-test failed: %s crypto_core_constant32[0] == le32dec(&sigma[0]) crypto_core_constant32[1] == le32dec(&sigma[4]) crypto_core_constant32[2] == le32dec(&sigma[8]) crypto_core_constant32[3] == le32dec(&sigma[12]) block[i] == le32dec(&out[i*4]) expand 32-byte k %dKB/%dB %d-way %s L%u %cI%cT Unified cache
%dKB/%dB %d-way L%u %cI%cT Instruction cache
%dKB/%dB %d-way %s L%u %cI%cT Data cache
isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x
mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x
pfr: [0]=%#x [1]=%#x
Processor failed probe - no CPU ID
%s%s%s (%s V%s core) unknown CPU (ID = 0x%x) : %s %s
%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled %s does not fully support this CPU.
This kernel does not fully support this CPU.
Recompile with "options %s" to correct this.
arm700swibug vector abort terminal abort external linefetch abort (S) external linefetch abort (P) external non-linefetch abort (S) external non-linefetch abort (P) external translation abort (L1) external translation abort (L2) alignment abort (0) alignment abort (1) translation abort (S) translation abort (P) domain abort (S) domain abort (P) permission abort (S) permission abort (P) undefined insn traps undefined cp15 insn traps : disabled
: disabled (uniprocessor kernel)
write-through write-back **unknown 3** **unknown 4** write-back-locking write-back-locking-A write-back-locking-B **unknown 8** **unknown 9** **unknown 10** **unknown 11** **unknown 12** write-back-locking-line write-back-locking-C write-back-locking-D CPU_ARM2 ARM2as CPU_ARM250 CPU_ARM3 CPU_ARM6 CPU_ARM7 CPU_ARM7TDMI CPU_ARM8 ARM9TDMI ARM9E-S CPU_ARM9E ARM9EJ-S ARM10E CPU_ARM10 ARM10EJ SA-1 CPU_SA110 XScale CPU_XSCALE_... ARM11J CPU_ARM11 ARMv4 CPU_ARMV4 Cortex CPU_CORTEX Marvell CPU_PJ4B ARM600 ARM610 ARM620 ARM700 ARM710 ARM7500 ARM710a ARM7500FE ARM810 SA-110 SA-1100 SA-1110 FA526 IXP1200 ARM710T ARM720T ARM740T (8 KB cache) ARM740T (4 KB cache) ARM920T ARM922T ARM940T TI ARM925T ARM946E-S ARM966E-S Sheeva 88SV131 Sheeva 88FR571-vd i80200 i80321 400MHz i80321 600MHz i80219 400MHz i80219 600MHz PXA27x PXA250 PXA210 PXA255/26x IXP425 533MHz IXP425 400MHz IXP425 266MHz ARM1020E ARM1022E-S ARM1026EJ-S ARM926EJ-S ARM1136J-S r0 ARM1136J-S r1 ARM1176JZ-S r0 ARM11 MPCore Cortex-A5 r0 Cortex-A7 r0 Cortex-A8 r1 Cortex-A8 r2 Cortex-A8 r3 Cortex-A9 r2 Cortex-A9 r3 Cortex-A9 r4 Cortex-A15 r2 Cortex-A15 r3 Sheeva 88SV581x Sheeva 88SV584x step 0 rev 1 rev 2 rev 3 rev 4 rev 5 rev 6 rev 7 rev 8 rev 9 rev 10 rev 11 rev 12 rev 13 rev 14 rev 15 step A-0 step A-1 step B-0 step B-1 step C-0 rev 0 step B-2 step D-0 (IXP1200 step A) (IXP1200 step B) (IXP1200 step C) (IXP1200 step D) (IXP1240/1250 step A) (IXP1240 step B) (IXP1250 step B) step B-3 step B-4 step B-5 step B step C step D step E rev 10step G step J step K step S step T *p0 *p1 *p2 *p3 *p4 *p5 *p6 *p7 *p8 *p9 *p10 *p11 *p12 *p13 *p14 *p15 eabi oabi No support for this CPU type (%08x) in kernel cpu.branchpredict cpu.cache cpu.nocache xscale.branchpredict xscale.cache xscale.icache xscale.dcache dead fs operation used dead tag VT_NON, dead vnode
m_pulldown malfunction , rrx , %s r%d , %s #%d thumb insn
#0x%08x [r%d] [r%d #0x%03x #0x%02x { r%d-r%d } ^ f%d #%s .%c%d , #0x%04x spsr cpsr p%d f%d, c%d, c%d, c%d, c%d r%d, c%d, c%d, %d %d, r%d, r%d, c%d [%c - unknown] und%s %08x
imb imbrange yield wfe wfi swi blx bl Snms mla Snmsd umull Sdnms smull umlal smlal strt daW ldrt strbt ldrbt ldr strb ldrb pop stm YnWl ldm XnWl ldrex ldrexd ldrexb ldrexh strex dma strexd strexb strexh ldrsb ldrh strh ldrsh swp dmo swpb mrs msr pFm pF2 bx clz bkpt movw dZ movt Sdn2 adc sbc rsc Dn2 teq cmn mov Sd2 mvn adf PRfgh muf suf rsf dvf rdf pow rpw rmf fml fdv frd pol fpbop mvf PRfh mnf abs sqt lgn sin cos tan asn acs atn fpuop stf QLv ldf PRgd fix PRdh wfs rfs wfc rfc cmf PRgh cmfe cnfe mcr2 #z mcr mrc2 mrc cdp2 #y cdp mcrr #& mrrc ldc2 L#v ldc stc2 stc vand vbic vorr vorn veor vbsl vbit vbif vshl SINuqw vqshl vrshl vqrshl vadd vtst vsub %s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu)
dkdrn %s at %s (%s) deleted
%s%u: unable to attach pseudo-device
%s at %s: %s
%s: %llu blocks at %lld, type: %s
WARNING: double match for wedge name %s (%s, %s)
wedge:%s dkwedge: unable to attach cfdriver dkwedge: unable to attach cfattach dk-method-%s: method "%s" already exists at priority %d
%s: unable to compute pdev, error = %d
%s: unable to find vnode for pdev, error = %d
%s: unable to lock vnode for pdev, error = %d
%s: unable to open device, error = %d
%s: unable to close device, error = %d
WARNING: double match for boot wedge (%s, %s)
dmover_backend_unregister dmover dmreq dmses dmover_session_destroy no media present DM9101 (AMD Am79C873) 10/100 media interface DM9102 10/100 media interface : failed to clear NIC buffer at offset %x - check configuration
dp8390_start: no header mbuf Ethernet address %s
%s: device timeout
%s: NIC memory corrupt - invalid packet length %d
ELF #! exec_script vmcmd kills extends calls : 3Com internal media interface
ignoring this PHY, non-zero instance
no media present
exphy_service: can't isolate 3Com PHY Fatal %s mode data abort: '%s'
trapframe: %p
FSR=%08x, FAR= Invalid, Fatal %s mode prefetch abort at 0x%08x
trapframe: %p, spsr=%08x
r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x
r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x
r8 =%08x, r9 =%08x, r10=%08x, r11=%08x
r12=%08x, usp=%08x, ulr=%08x ssp=%08x, slr=%08x , pc =%08x
Fatal abort
Kernel mode double abort!
%d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x
r0=%08x r1=%08x r2=%08x r3=%08x
r4=%08x r5=%08x r6=%08x r7=%08x
r8=%08x r9=%08x rA=%08x rB=%08x
ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x
Non-emulated page fault with intr_depth > 0
uvm_fault(%p, %lx, %x) -> %x
UVM: pid %d (%s), uid %d killed: out of swap
%s: Misaligned Kernel-mode Program Counter
%s: invalid size (%zu) Vector Exception Alignment Fault 1 Terminal Exception Alignment Fault 3 External Linefetch Abort (S) Translation Fault (S) External Linefetch Abort (P) Translation Fault (P) External Non-Linefetch Abort (S) Domain Fault (S) External Non-Linefetch Abort (P) Domain Fault (P) External Translation Abort (L1) Permission Fault (S) External Translation Abort (L2) Permission Fault (P) start = %d, len = %d, fs = %s
offset=%d %ld
cg %d
ffs_alloccg: map corrupted bno = %d, fs = %s
ffs_alloccg: block not in map uid %d, pid %d, command %s, on %s: %s
dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s
%s: bad size bad block %lld, ino %llu
bad block cg = %d, irotor = %d, fs = %s
ffs_nodealloccg: map corrupted ffs_nodealloccg: block not in map ifree: dev = 0x%llx, ino = %llu, fs = %s
ifree: freeing free inode dev = 0x%llx, block = %lld, fs = %s
blkfree: freeing free block blkfree: freeing free frag file system full
%s: write failed, file system is full
trimwq trimwqcv ffs_discarddata drain timeout
dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s
ffs_realloccg: bad bprev bad blockno %s: optimization changed from SPACE to TIME
%s: optimization changed from TIME to SPACE
dev = 0x%llx, optim = %d, fs = %s
ffs_realloccg: bad optim ifree: range: dev = 0x%llx, ino = %llu, fs = %s dmode %x mode %x dgen %x gen %x
size %llx blocks %llx
ino %llu ipref %llu
ffs_valloc: dup alloc free inode %llu on %s had %lld blocks
out of inodes
%s: create/symlink failed, no inodes free
ffs_balloc: blk too big Could not unwind indirect block, error %d ffs_indirtrunc: bad buffer size itrunc: newspace snapblkfree: inconsistent block type ffs_snapshot_mount: vget failed %d
ffs_snapshot_mount: non-snapshot inode %d
ffs_snapshot_mount: read_1 failed %d
ffs_snapshot_mount: read_2 failed %d
ffs_snapshot_mount: %llu already on list ffs_isblock: unknown fs_fragshift %d ffs_isfreeblock: unknown fs_fragshift %d ffs_clrblock: unknown fs_fragshift %d ffs_setblock: unknown fs_fragshift %d ffs doclusterread doclusterwrite doreallocblks log_changeopt ffs_modcmd: can't listen on system scope.
ffsino ffsdino1 ffsdino2 , not mounting ffs_reload: dirty1 appleufs %s: unknown ufs flags: 0x%08x%s
ffs_reload: dirty2 ffs_mountfs: block size (%d) > MAXBSIZE (%d)
%s: options QUOTA2 not enabled%s
%s: file system not clean (fs_clean=%#x); please fsck(8)
%s: lost blocks %lld files %d
%s: `-o softdep' is no longer supported, consider `-o log'
update: rofs mod %s: nonsync dir write ffs_write %s: type tag VT_NON , fifo with %d readers and %d writers fiford fifowr /usr/src/sys/miscfs/genfs/genfs_io.c genput genfs: bad op addr 0x%x iicintr : I2C bus
unable to create intr thread
i2c-indirect-config i2c-child-devices cookie compatible WARNING: ignoring bad device address @ 0x%02x
%s at %s addr 0x%02x WARNING: intr handler list not empty
WARNING: proc handler list not empty
i2cexec iic at %s icmp6_mtudisc_timeout: bad route to timeout icmp6_redirect_timeout: bad route to timeout (src=%s dst=%s tgt=%s) inet6 icmp6 rediraccept redirtimeout nd6_prune nd6_delay nd6_umaxtries nd6_mmaxtries nd6_useloopback nodeinfo errppslimit nd6_maxnudhint mtudisc_hiwat mtudisc_lowat nd6_debug nd6_drlist nd6_prlist maxqueuelen sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d
/usr/src/sys/netinet6/icmp6.c icmp6_reflect: source can't be determined: dst=%s, error=%d
ENOBUFS in icmp6_error %d
ICMP6 redirect sent from %s rejected; must be from linklocal
ICMP6 redirect sent from %s rejected; hlim=%d (must be 255)
ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s
ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s
ICMP6 redirect rejected; no route found for redirect dst: %s
ICMP6 redirect rejected; redirect dst must be unicast: %s
ICMP6 redirect rejected; neither router case nor onlink case: %s
icmp6_redirect_input: invalid ND option, rejected: %s
icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s
ICMP6 checksum error(%d|%x) %s
icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d)
ICS1889 10/100 media interface ICS1890 10/100 media interface ICS1892 10/100 media interface ICS1893 10/100 media interface invalid vap id %d vap id %d not allocated invalid channel freq %u flags %x
invalid channel (NULL)
%s: mode %u not supported (caps 0x%x)
Unexpected mode %u %s: no channels found for mode %u
Bad IBSS channel %u bad channel ignored; freq %u flags %x number %u
vap table full .5 %s: %s rates: %s%d%sMbps %s: no 802.11 instance!
11a 11b 11g FH turboA turboG AMRR increasing rate %d (txcnt=%d retrycnt=%d)
AMRR decreasing rate %d (txcnt=%d retrycnt=%d)
No cipher! %s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u
%s: driver did not delete key index %u
%s: cipher %s has an invalid cipher index %u
%s: cipher %s registered with a different template
%s: invalid cipher %u
%s: unregistered cipher %u, load module %s
%s: unable to load cipher %u, module %s
%s: no h/w support for cipher %s, falling back to s/w
%s: no h/w support for TKIP MIC, falling back to s/w
%s: unable to attach cipher %s
%s: no h/w resources for cipher %s, falling back to s/w
%s: unable to setup cipher %s
%s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u
%s: cipher %s rejected key index %u len %u flags 0x%x
%s: no key index; should not happen!
[%s] no default transmit key (%s) deftxkey %u
%s: WEP data frame too short, len %u
[%s] unable to pullup %s header
wlan_wep wlan_tkip wlan_aes_ocb wlan_ccmp wlan_ckip %s: Invalid key length %u, expecting %u
%s: control frame [%s] Missing ExtIV for AES-CCM cipher
not enough data in following buffer, m_len %u need %u
[%s] AES-CCM decrypt failed; MIC mismatch
AES-CCM [%s] key id %u is not set (decap)
[%s] key id %u is not set (encap)
NONE out of buffers with data_len %zu
[%s] missing ExtIV for TKIP cipher
[%s] discard frame due to countermeasures (%s)
[%s] TKIP ICV mismatch on decrypt
[%s] Discard frame due to countermeasures (%s)
TKIP [%s] out of data for WEP (data_len %zu)
[%s] WEP ICV mismatch on decrypt
WEP [%s:%s] discard %s frame, %s information element, WME too short, len %u [%s] discard %s frame, ssid mismatch: too short (1): len %u wrong version %x not to bss too short (2): len %u duplicate seqno <%u,%u> fragno <%u,%u> tid %u data too short: expecting %u unknown dir 0x%x multicast echo unknown src unassoc src [%s] power save mode on, %u sta's in ps mode
[%s] power save mode off, %u sta's in ps mode
[%s] flush ps queue, %u packets queued
multicast fragm? demic error decap error unauthorized port: ether type 0x%x len %u %s: unable to allocate VLAN tag
mgt too short: len %u received %s from %s rssi %d
WEP set but not permitted WEP set but PRIVACY off ps-poll unassociated station aid mismatch: sta aid 0x%x poll aid 0x%x [%s] recv ps-poll, but queue empty
[%s] recv ps-poll, send packet, %u still queued
[%s] recv ps-poll, send packet, queue empty
bad frame type 0x%x [%s] extended rate set too large; only using %u of %u rates
[%s] shared key challenge alloc failed
reassoc WPA RSN , protection , QoS ie too short ERP bad len %u unhandled id %u, len %u no scan.rates bad scan.rates len %d no scan.ssid bad scan.ssid len %d invalid channel %u for off-channel %u bogus beacon interval [%s] erp change: was 0x%x, now 0x%x
[%s] capabilities change: before 0x%x, now 0x%x
no rates bad rates len %d no ssid bad ssid len %d no ssid with ssid suppression enabled [%s] recv probe req
recv'd rate set invalid [%s] recv auth frame with algorithm %d seq %d
disallowed by ACL TKIP countermeasures enabled shared key auth PRIVACY is disabled bad sta auth mode %u ie %d/%d too long no challenge bad challenge len %d bad operating mode %u bad state %u [%s] shared key %sauth request
shared key response unknown station no challenge recorded challenge mismatch [%s] station authenticated (shared key)
bad seq %d [%s] shared key auth failed (reason %d)
open auth [%s] station authenticated (open)
[%s] open auth failed (reason %d)
unsupported alg %d wrong bssid [%s] deny %s request, sta not authenticated
[%s] no WPA/RSN IE in association request
not WPA, flags 0x%x bad version %u mcast cipher mismatch; got %u, expected %u ucast cipher data too short; len %u, n %u ucast cipher set empty key mgmt alg data too short; len %u, n %u no acceptable key mgmt alg not RSN, flags 0x%x [%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x
[%s] deny %s request, capability mismatch 0x%x
[%s] deny %s request, rate set mismatch
[%s] %sassoc failed (reason %d)
[%s] %sassoc failed (rate set mismatch)
[%s] %sassoc success: %s preamble, %s slot time%s%s
[%s] recv deauthenticate (reason %d)
[%s] recv disassociate (reason %d)
subtype 0x%x not handled [%s] %s
link-layer statistics and controls ieee80211 IEEE 802.11 WLAN statistics and controls %s: sysctl_createv failed, rc = %d
client/peer stations %s: sysctl_createv failed (rc = %d)
vap%u parent inact_run inact_probe inact_auth inact_init driver_caps bmiss_max %s: 802.11 mgt frame too large: %u bad beacon boundary bss %snode %s join
%snode %s leave
notify scan done
[%s] %s replay detected
[%s] michael MIC verification failed
%s: load the %s module by hand for now.
bogus aid %u, max %u %s %p<%s> in %s table
0x%p: mac %s refcnt %d
scangen %u authmode %u flags 0x%x
associd 0x%x txpower %u vlan %u
txseq %u rxseq %u fragno %u rxfragstamp %u
rstamp %u rssi %u intval %u capinfo 0x%x
bssid %s essid "%.*s" channel %u:0x%x
fails %u inact %u txrate %u
%s: IEEE80211_LOCK not held %s: remove %p<%s> from %s table, refcnt %d
%s: %p<%s> clear key map entry
[%s] scan candidate purged from cache (refcnt %u)
%s: free all nodes in %s table
%s %s table
%s: %s[%u] still active
???? ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set: %s%u start chan %u
passive %s: end %s scan
refcnt(ni) == %d ic != NULL %s: fixed rate %d (%d.%d Mb/s) not in rate set %s %p<%s>
%s: add key map entry %p<%s> refcnt %d
[%s] no node, discard frame (%s)
%s %p<%s> refcnt %d
%s: %p<%s> clear key map entry neighbor %s: creating ibss
%s: merge failed, capabilities mismatch
%s: new bssid %s: %s preamble, %s slot time%s
%s: no scan candidate
%s
macaddr bssid chan rssi rate flag wep essid %s: chan %d->%d
begin %s scan in %s mode, scangen %u
new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02x key map out of sync, ni %p nikey %p %s: delete key map entry %p<%s> refcnt %d
%s: scan aborted %u
[%s] station with aid %d leaves
unexpected operating mode %u bogus long slot station count %d [%s] long slot time station leaves, count now %d
%s: re-enable use of short slot time
bogus non-ERP station count %d [%s] non-ERP station leaves, count now %d
%s: disable use of protection
%s: re-enable use of short preamble
%s: %s scangen %u
[%s] discard frame, age %u
[%s] discard %u frames for age
probe station due to inactivity station timed out due to inactivity (refcnt %u) [%s] station needs long slot time, count %d
[%s] station is !ERP, %d non-ERP stations associated
%s: enable use of protection
[%s] station needs long preamble
[%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s
unable to setup inital BSS node %s: no memory for AID bitmap!
%s: no memory for TIM bitmap!
%s %s table, inact %u
Cannot allocate key index map with %u entries
scan no WPA/RSN! RSN IE too big, %u > %zu WPA IE too big, %u > %zu ena [%s] send null data frame on channel %u, pwr mgt %s
no ethernet header! %s: cannot expand storage
not enough room, need %u got %zu
[%s] enmic failed, discard frame
mbuf already chained? pktlen %u mtu %u fragment size %u too big! %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x
ieee80211_ref_node (%s:%u) %p<%s> refcnt %d
rcvif not null [%s] send probe req on channel %u
[%s] request encrypt frame (%s)
[%s] send station deauthenticate (reason %d)
[%s] send station disassociate (reason %d)
[%s] invalid mgmt frame type %u
[%s] encrypting frame (%s)
[%s] send %s on channel %u
%s: cannot get buf; size %u
no space for 802.11 header? %s: traffic %u, disable aggressive mode
%s: traffic %u, enable aggressive mode
tim bitmap empty! %s: TIM updated, pending %u, off %u, len %u
[%s] pwr save q overflow, drops %d (size %d)
[%s] save frame with age %d, %u now queued
wlan: %s acl policy registered
wlan: %s acl policy unregistered
wlan_acl 0x %s: %s -> %s
no recent beacons from %s; rescanning
%s: invalid transition
%s: bogus xmit rate %u setup
associated synchronized with %s ssid channel %d start %uMb
NODS %s ->%s TODS %s FRDS %s DSDS %s ->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d %s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u]
%s: %s log2(cwmin) %u
%s: WME params updated, cap_info 0x%x
%s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u]
%s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u]
beacon miss wlan_internal wlan_xauth WME_AC_BE WME_AC_BK WME_AC_VI WME_AC_VO WME_UPSD INIT SCAN AUTH ASSOC RUN reserved#0 reserved#1 reserved#2 reserved#3 reserved#5 reserved#6 reserved#7 reserved#8 reserved#9 ps_poll rts cf_end cf_end_ack reassoc_req reassoc_resp probe_req probe_resp beacon atim disassoc deauth reserved#13 reserved#14 reserved#15 rssadapt expavgctl %s: dst %s threshold[%d, %d.%d] %d < %d
%s: src %s rssi %d avg %d -> %d
ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds
%s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d
%s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds
%d-byte , T[%d.%d] = %d external sdl if_ %s: warning: unable to delete rtentry @ %p, error = %d
inet ip6 ifq maxlen drops org.netbsd.kauth.network %s%d if_detach: WARNING: AF %d not purged
too many interfaces %s: could not attach sysctl nodes
sndq %s: ifioctl_attach() failed invalid argument to %s host is not on local network could not allocate llinfo gateway route is not ours arplookup: unable to enter address for %s@%s on %s (%s)
keep refresh log_movements log_permanent_modify log_wrong_iface %s: arp: link address is broadcast for IP address %s!
duplicate IP address %s sent from link address %s
%s tried to overwrite permanent arp info for %s
%s on %s tried to overwrite arp info for %s on %s
arp info overwritten for %s by %s
arp from %s: new addr len %d, was %d
arp from %s: addr len: new %d, i/f %d (ignored)
arp_rtrequest: bad gateway value
arp_rtrequest: malloc failed
%s(%s): sockaddr_dl_init cannot fail arpresolve: can't allocate llinfo on %s for %s
arpintr revarp %s: discarding oversize frame (len=%d)
%s: can't handle af%d
ether multicast looutput: no header mbuf ifmedia_add: can't malloc entry ifmedia_set: no match for 0x%x/0x%x
ifmedia_set failed can't alloc mem for enet addr
can't map mem for enet addr
can't get subregion for asic
can't match ethernet vendor code
cannot set power mgmt handler
unable to establish power handler
PCMCIA AmbiCom Inc AMB8002T AmbiCom,Inc. Fast Ethernet PC Card(AMB8110) PMX PE-200 UE2212 D-Link DE-660 DE-660+ RPTI LTD. EP400 RPTI EP401 Ethernet NE2000 Compatible ACCTON EN2212 EN2216-PCMCIA-ETHERNET SVEC FD605 PCMCIA EtherNet Card Seiko Epson Corp. P/N: EEN10B Rev. 00 TAMARACK CNet CN40BC Ethernet PCMCIA-ETHERNET-CARD UE2216 ASIX AX88190 DFE-670TXD MELCO LPC2-TX LINKSYS E-CARD DE-650 I-O DATA PCLA corega K.K. corega Ether CF-TD LAN Card corega Ether PCC-T corega Ether PCC-TD corega Ether PCC-TL corega EtherII PCC-T corega EtherII PCC-TD corega FastEther PCC-TX corega FEther PCC-TXF corega FEther PCC-TXD corega FEtherII PCC-TXD (CG-LAPCCTXD) (HardwareFirmwareVer.) SMC 8041TX-10/100-PC-Card-V2 LNT-10TN CF 10Base-Ethernet 1.0 NDC DYNALINK L10C wiinit couldn't load firmware
failed to attach controller
SMC2632W NANOSPEED HFA384x/IEEE NEC Wireless Card CMZ-RT-WP NTT-ME 11Mbps Wireless LAN PC Card Wireless LAN PCC-11 Wireless LAN PCCA-11 corega_K.K. Wireless_LAN_PCCB-11 WL PCCL-11 WLCFL-11 INTERSIL Intersil PRISM 2_5 PCMCIA ADAPTER PLANEX GW-NS11H Wireless LAN PC Card D-Link Corporation D-Link DWL-650H 11Mbps WLAN Adapter igmppl igmp inmltpl subnetsarelocal hostzerobroadcast %d.%d.%d.%d in_control invalid argument to in_lifaddr_ioctl %s: mbuf %d too short for IP header %zu %s: offset %d too short for IP header %zu in6_unlink_ifa: autoconf'ed address %p has no prefix
Couldn't unlink in6_ifaddr from in6_ifaddr
ADD DELETE in6_ifloop_request: %s operation failed for %s (errno=%d)
in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d
in6_are_prefix_equal: invalid prefix length(%d)
in6_prefixlen2mask: invalid prefix length(%d)
in6_if_down: %s marked detached
in6_update_ifa: a destination can be specified for a p2p or a loopback IF only
in6_update_ifa: prefixlen should be 128 when dstaddr is specified
in6_update_ifa: valid lifetime is 0 for %s
in6_update_ifa: the prefix length of an existing (%s) address should not be changed
in6_update_ifa: failed to remove a route to the old destination: %s
in6_update_ifa: in6_setscope failed
in6_update_ifa: addmulti failed for %s on %s (errno=%d)
prefix ioctls are now invalidated. please use ifconfig.
invalid argument to in6_lifaddr_ioctl nd6_prelist_add succeeded but no prefix
in6_control: failed to create a temporary address, errno=%d
in6_if_up: %s marked tentative
in6_if2idlen: unknown link type (%d)
in6_cksum: offset too short for IPv6 header in6_cksum: mbuf too short for IPv6 header generate_tmp_ifid: never found a good ID
%s: got interface identifier from itself
%s: got interface identifier from %s
%s: borrow interface identifier from %s
%s: interface identifier generated by random number
%s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x
in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d)
in6_ifattach: %s has too small MTU, IPv6 not enabled
in6_ifattach: %s is not multicast capable, IPv6 not enabled
in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d)
%s: cannot assign link-local address
%s: didn't unlink in6ifaddr from list
in6pcbpl internet6 inpcbpl internet /dev/console warning: no /dev/console
warning: lookup /dev/console: error %d
init: couldn't allocate argument space init path (default %s) halt reboot use absolute path, "halt", or "reboot"
/sbin/init init: trying %s
exec %s: error %d
Detecting hardware... fork init cannot mount root, error = %d
pgdaemon fork pagedaemon ioflush fork syncer fork aiodoned %s %s (%s) /sbin/oinit /sbin/init.bak /rescue/init maxvnodes maxproc maxfiles argmax hostid clockrate hardclock_ticks profiling posix1version ngroups job_control saved_ids boothowto boottime maxpartitions timex rtc_offset msgbufsize ipc sysvmsg sysvsem sysvshm synchronized_io iov_max mapped_files memlock memlock_range memory_protection login_name_max defcorename logsigexit fscale ccpu cp_time msgbuf maxphys monotonic_clock labelsector labeloffset labelusesmbr forkfsleep posix_threads posix_semaphores posix_barriers posix_timers posix_spin_locks posix_reader_writer_locks dump_on_panic root_partition drivers cp_id coredump setid owner group no_sa_support configname buildinfo posix semmax machine model ncpu byteorder physmem usermem pagesize alignbytes cnmagic physmem64 usermem64 ncpuonline ostype osrelease osrevision hostname domainname rawpartition kern vfs hw ddb vendor security i82555 10/100 media interface i82562EH HomePNA interface i82562EM 10/100 media interface i82562ET 10/100 media interface i82562G 10/100 media interface i82553 10/100 media interface ip6flowpl cannot forward from %s to %s nxt %d received on %s
cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s
forwarding redirect maxfragpackets accept_rtadv rtadv_maxroutes rtadv_numroutes keepfaith log_interval hdrnestlimit dad_count auto_flowlabel defmcasthlim kame_version NetBSD-current use_deprecated rr_prune v6only auto_linklocal anonportmin anonportmax lowportmin lowportmax use_tempaddr prefer_tempaddr temppltime tempvltime maxfrags use_defaultzone mcast_pmtu anonportalgo available selected reserve neighborgcthresh maxifprefixes maxifdefrouters maxdynroutes ip6_init ip6_nexthdr: m == NULL ip6_input: packet to an unready address %s->%s
pim6 register_mif add_m6fc: %s o %s g %s p %x dbx %p
multiple kernel entries ip6_mforward: ip6_mrouter socket queue full
assumption failed: hdr not split icmp_redirect_timeout: bad route to timeout icmp_mtudisc_timeout: bad route to timeout icmp maskrepl returndatabytes bmcastecho ICMP: redirect failed to register timeout for route to %x, code %d
icmp_error icmp len ttl forwsrcrt directed-broadcast allowsrcrt mtudisc mtudisctimeout checkinterface random_id do_loopback_cksum ipfrenpl Accounting resumed
Accounting suspended
Accounting started
Accounting terminated
actwat acctwatch Accounting: write failed %d
kcredpl org.netbsd.kauth.cred org.netbsd.kauth.generic org.netbsd.kauth.process org.netbsd.kauth.machdep org.netbsd.kauth.device org.netbsd.kauth.vnode hardscheddiv clockinterrupt Condition variable %.*s pid %d (%s): %s write of %zu@%p at %lld failed: %d
cpu%d fdclose increase kern.maxfiles or MAXFILES fdfile file2 dup2 EVFILT_READ EVFILT_WRITE EVFILT_AIO EVFILT_VNODE EVFILT_PROC EVFILT_SIGNAL EVFILT_TIMER execargs should not happen pspawn lwpwait kernel mapping failed %d
netbsd init died (signal %d, exit %d) orphaned traced process increase kern.maxproc or NPROC forkmx forkulim %s: WARNING: powerhook_establish is deprecated
dopowerhooks %s: %s (%p)
dopowerhooks: %s done
softresume softsuspend softstandby idle/%u create_idle_lwp: error %d kthrwait unnamed WARNING: kthread `%s' (%d) exits with status %d
kthread_exit curcpu holds : %18d wanted by: %#018lx
softint %s: %s caller=%p Kernel lock lwppl maxlwp sigwait vfork (zombie) swapper WARNING: module error: can't find builtin dependency `%s' too many required modules %d >= %d builtin module `%s' failed to init, error %d link_set_modules `link_set_modules' section not present, error %d `link_set_modules' section wrong size %zu != %zu DEBUG: module: TRUE FALSE unload requested for '%s' (%s) module `%s' not found module `%s' busy (%d refs) cannot unload built-in secmodel module `%s' cannot unload module `%s' error=%d unloaded module `%s' module `%s' declined to be auto-unloaded error=%d builtin module "%s" init failed: %d mod_unld /stand/%s/%d.%d/modules builtin %s failed: %d
module autotime kern.module.path=%s
modunload module_init: %d module_rele: gone unable to load `%s' pushed by boot loader, error %d dependent recursion too deep for `%s' %d > %d use -f to reinstate builtin module `%s' %s module `%s' already loaded out of memory for `%s' cannot fetch info for `%s', error %d module `%s' built for `%d', system `%d' forced load, system may be unstable incompatible module class for `%s' (%d != %d) dependency name mismatch (`%s' != `%s') circular dependency detected for `%s' required module name `%s' longer than %d self-dependency detected for `%s' recursive load failed for `%s' (`%s' required), error %d unable to affix module `%s', error %d module properties failed for %s modcmd function failed for `%s', error %d module `%s' loaded successfully %s/%s/%s.kmod Cannot %sload kernel object `%s' error=%d .plist plist load returned error %d for `%s' noautoload autoloading is disallowed for %s owner field : %#018lx wait/spin: %16d/%d
locking against myself mutex_init: impossible type Mutex mutex physiod physio Devices without power management support: %s: %s is suspended by %s (delegator %s)
%s: %s-suspended by %s (delegator %s) already
%s: %s assumes %s-suspension by %s (delegator %s)
%s: newly %s-suspended by %s (delegator %s)
resume failed
%s: %s suspension %s (delegator %s) removed by %s
class Powering devices: (failed) Shutting down devices: shutting down %s, skipped. failed. success. %s-self %s: class suspend
%s: driver suspend
%s: bus suspend
%s: suspend enter
%s: suspend exit
Flushing disk caches: Suspending devices: %s: bus resume
%s: driver resume
%s: class resume
%s: resume enter
%s: resume exit
Resuming devices: %s: PMF event %d dropped (no memory)
%s: PMF event %d injected
Input idle handler called
pewpl pmfevent couldn't create pmfevent workqueue pmfsuspend couldn't create pmfsuspend workqueue procpl proc2 proc_args %s (pid %d) changing logname from %.*s to %s
ras plimitpl pstatspl curproc rlimit cputime soft hard filesize datasize stacksize coredumpsize memorylocked descriptors sbsize vmemoryuse stopfork stopexec stopexit rndread rndsample Anonymous printf autoconf rnd: source "%s" failed continuous-output test.
rnd: source "%s" failed statistical test. rnd: detaching source "%s". rnd: bad seed length %d
rnd: bad seed checksum
requesting entropy from dead rndsink: %p rndsink %p in unknown state: %d rndsink destroying dead rndsink: %p cacheht_time balance_period min_catch timesoftints kpreempt_pri upreempt_pri sched_cpuattach: could not allocate the runqueue runqueue pull runqueue push runqueue stay runqueue localize owner/count : %#018lx flags : %#018x
Reader / writer lock rwlock sigacts ksiginfo sorry, pid %d was killed: %s
sigexit 1 sigexit 2 sendsig: bad version %d
WARNING: softint_establish: table full, increase softint_bytes
softdis soft%s/%u softint_init_isr: error %d %s block/%u softint_init_cpu: cannot allocate memory softint_picklwp use one of: %s[a-%c] none halt reboot
wedge: parsedisk md0 Cannot open "md0" (root) (default %s dump device (default %sb) file system (default %s): use one of: generic unknown device major 0x%llx
%s%llu device %s (0x%llx) not configured
root on %s can't determine root device
dumps on %s sched_unsleep lbolt kpreempt defer: critical section defer: kernel_lock immediate setrunnable: lwp %p state was %d WARNING: negative runtime; monotonic clock has gone backwards
pid %d is killed: %s
exceeded RLIMIT_CPU pid %d, command %s, is killed: %s
kernel %sassertion "%s" failed: file "%s", line %d p->sysctl_child == NULL /usr/src/sys/kern/kern_sysctl.c %s: rnode %p wrong version
sysctl_create: rnode %p wrong version
sysctl_create: attempt to add node to aliased node %p
sysctl_destroy: rnode %p wrong version
sysctl_query: rnode %p wrong version
sysctl_locate: pnode %p wrong version
sysctl_dispatch: rnode %p wrong version
sysctl_mmap: rnode %p wrong version
sysctl_createv: rnode NULL
sysctl_createv: sysctl_locate(%s) returned %d
sysctl: log %p root mismatch (%p)
sysctl_createv: sysctl_create(%s) returned %d
sysctl_create succeeded but node not found?!
sysctl_free: rnode %p wrong version
root %p left %d size %d content len %d: end
!!SYSCTL_NEEDFUNC!!
timecounter choice hardware timestepwarnings %s%s(q=%d, f=%lld Hz) timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u
timecounter: Timecounter "%s" frequency %ju Hz quality %d
tcdetach Time stepped from %lld.%09ld to %lld.%09ld
timecounter: Timecounters tick every %d.%03u msec
dummy ptimerpl ptimerspl nanoslp pid %d attempted to set the (obsolete) kernel time zone
callout_init_cpu (1) callout_init_cpu (2) late/%u callout wait/%u todr_attach: TOD already configured
WARNING: preposterous time in file system
WARNING: preposterous TOD clock time
WARNING: no TOD clock present
WARNING: clock lost %lld days
WARNING: clock gained %lld days
WARNING: using default initial time
WARNING: using filesystem time
WARNING: CHECK AND RESET THE DATE!
Cannot set TOD clock time
tstilepl tstile turnstile_unsleep uidinfo proccnt lwpcnt lockcnt %08x-%04x-%04x-%04x-%04x%04x%04x bind failed
%s: this kernel is not support SL-C1000
couldn't register event handler
fictitious %s: unable to flush cache
%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors
lddrn lddtch %s: not drained
: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x>
%sattach couldn't create thread
%d-bit width, bus clock %u.%03u MHz
%u KHz
blkno 0x%llu exceeds capacity %d
task timeout 100baseFX, 100baseFX-FDX, LXT970 10/100 media interface LXT971/2 10/100 media interface The operating system has halted.
Please press any key to reboot.
rebooting...
REBOOT FAILED!!!
ffuart btuart stuart glass cpu not recognized! initarm: out of memory initarm: Failed to align the kernel page directory base 0x%x -0x%x irq %d drq 0x%08x core %d mainbus_bs_alloc(): Help! mainbus_bs_free(): Help! mdidle %s: cfattach_attach failed
md%d: internal %s image area
mfs_initminiroot() called more than once mfs mfsidl mfs_root mfs_ioctl not VBLK tag VT_MFS, pid %d, base %p, size %ld
mfs_inactive: not inactive (mfs_buflist %p) mfs_strategy: bad dev warning: mfs read during shutdown
mfs_close mii_attach: phyloc and offloc specified mii_detach: phyloc and offloc specified OUI 0x%06x model 0x%04x rev %d at %s phy %d miiverbose miiaut mii_phy_setmedia: MASTER on wrong media HomePNA1 10baseT 10baseT-FDX 100baseTX 100baseTX-FDX 100baseT4 1000baseSX 1000baseSX-FDX 1000baseT 1000baseT-FDX couldn't establish power handler multicast_kludge in6_savemkludge: no kludge space msdosnopl msdosfhpl loadvnode(): pcbmap returned %d
deextend: file too large detrunc(): can't truncate root directory, clust %ld, offset %ld
msdosfs_reclaim(): pushing active . .. doscheckpath(): .. not a directory?
msdosfs_sync: rofs mod msdosfs RRaA rrAa msdos msdosfs_write(): bad file type rename: lost dir entry msdosfs_rename: updating .. in root directory? msdosfs_strategy: spec tag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu regen_tmpaddr: failed to create a new tmp addr, errno=%d
nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu
unspec nd6_lookup: failed to lookup %s (if = %s)
nd6_init called more than once(ignored)
ndopts == NULL in nd6_option uninitialized ndopts in nd6_option ndopts == NULL in nd6_options uninitialized ndopts in nd6_options duplicated ND6 option found (type=%d)
nd6_options: unsupported option %d - option ignored
too many loop in nd opt
ln->ln_rt == NULL ln->ln_rt->rt_ifp == NULL rt_llinfo(%p) is not equal to ln(%p) dst=0 in nd6_timer(ln=%p) Cannot enable an interface with a link-local address marked duplicate.
%s: failed to set scope %s (errno=%d)
%s.%d: sockaddr_dl_init(, %zu, ) failed on %s
nd6_rtrequest: bad gateway value: %s
nd6_rtrequest: malloc failed
%s.%d: sockaddr_dl_setaddr(, %d, ) failed on %s
%s: failed to join %s (errno=%d)
nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p)
from == NULL in nd6_cache_lladdr %s: something odd happens
%s: sdl_alen == %u, dst=%s, if=%s
scope error in router list (%s)
scope error in prefix list (%s)
nd6_ns_output: source can't be determined: dst=%s, error=%d
nd6_na_output: source can't be determined: dst=%s, error=%d
nd6_newaddrmsg: RTM_GET operation failed for %s (errno=%d)
nd6_dad_start: called with non-tentative address %s(%s)
nd6_dad_start: ifa->ifa_ifp == NULL nd6_dad_start: memory allocation failed for %s(%s)
%s: starting DAD for %s
nd6_dad_duplicated: DAD structure not found
%s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d
%s: DAD complete for %s - duplicate found
%s: manual intervention required
%s: possible hardware address duplication detected, disable IPv6
nd6_ns_input: invalid hlim (%d) from %s to %s on %s
nd6_ns_input: bad DAD packet (wrong ip6 dst)
nd6_ns_input: NS packet from non-neighbor
nd6_ns_input: bad NS target (multicast)
nd6_ns_input: invalid ND option, ignored
nd6_ns_input: bad DAD packet (link-layer address option)
nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d)
nd6_ns_input: duplicate IP6 address %s
nd6_ns_input: src=%s
nd6_ns_input: dst=%s
nd6_ns_input: tgt=%s
nd6_na_input: invalid hlim (%d) from %s to %s on %s
nd6_na_input: invalid target address %s
nd6_na_input: a solicited adv is multicasted
nd6_na_input: invalid ND option, ignored
nd6_na_input: duplicate IP6 address %s
nd6_na_input: ND packet from non-neighbor
nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d)
nd6_dad_timer: called with null parameter
nd6_dad_timer: DAD structure not found
nd6_dad_timer: called with duplicate address %s(%s)
nd6_dad_timer: called with non-tentative address %s(%s)
%s: could not run DAD, driver problem?
%s: DAD complete for %s - no duplicates found
in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d)
rtpref: impossible RA flag %x
nd6_rs_input: invalid hlim (%d) from %s to %s on %s
nd6_rs_input: invalid ND option, ignored
nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d)
defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d)
defrouter_select: more than one router is installed
nd6_prefix_onlink: %s/%d is already on-link
nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s
nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d
nd6_prefix_offlink: %s/%d is already off-link
nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d)
nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d)
pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d
pfxlist_onlink_check: failed to make %s/%d onlink, errno=%d
prelist_remove: failed to make %s/%d offlink on %s, errno=%d
prelist_remove: negative count on %s
nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d)
in6_tmpifadd: failed to find a good random IFID
in6_tmpifadd: failed to find a unique random IFID
in6_tmpifadd: ifa update succeeded, but we got no ifaddr
defrtrlist_del: negative count on %s
nd6_ra_input: invalid hlim (%d) from %s to %s on %s
nd6_ra_input: src %s is not link-local
nd6_ra_input: invalid ND option, ignored
nd_ra_input: lower CurHopLimit sent from %s on %s (current=%d, received=%d), ignored
nd6_ra_input: invalid option len %d for prefix information option, ignored
nd6_ra_input: invalid prefix len %d for prefix information option, ignored
nd6_ra_input: invalid prefix %s, ignored
prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d)
prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p
prelist_update: IFID undefined (%s)
prelist_update: invalid prefixlen %d for %s, ignored
in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d)
in6_ifadd: %s is already configured
in6_ifadd: failed to make ifaddr %s on %s (errno=%d)
prelist_update: failed to create a temporary address, errno=%d
nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring
nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring
nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d)
ne2000_write_mbuf: negative len %s: remote transmit DMA failed to complete
where did the card go?
setup failed
ext2fs compat_netbsd32 compat,exec_elf32 /emul/netbsd32 msgcontrol msghdr loadavg nfsvinval nfs_doio: type %x unexpected
nfsbioread: type %x unexpected
ifupdown: socreate, error=%d
ifupdown: GIFFLAGS, error=%d
ifupdown: SIFFLAGS, error=%d
nfsbif setaddress: socreate, error=%d
setaddress, error=%d
nfsbtd %s: del route, error=%d
nfs_boot: '%s' not found
setmtu: socreate, error=%d
setmtu: GIFMTU, error=%d
setmtu: SIFMTU, error=%d
deladdress: socreate, error=%d
deladdress, error=%d
nfs_boot: timeout...
nfs_boot: sosend: %d
nfs sndunlock short receive (%lu/%lu) from nfs server %s
%s (%d) from nfs server %s
impossible packet length short receive (%lu/%d) from nfs server %s
Egad!!
receive error %d from nfs server %s
nfsreply nil is alive again nfstrylater mtime ctime %s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u)
%s: re-enabling wcc
nfsiod nfsio nfsiorm nfsauth1 nfsauth2 nfskqpw nfskqpoll nfskqdet %s: vp=%p error=%d
nfsnodepl nfsvapl nfssilly nfs_node_init nfs_reclaim: pushing active nfs send error %d for %s
nfsd send error %d
timer timer start timer stop nfscon sotype nfscn2 nfs rcvunlock Bad kerb verifier
Not fullname kerb verifier
Kerb nickname short
Kerb nick verifier bad
nfs server %s: %s
not responding nfsrvdescpl build > MLEN nfsstats iothreads nfs_vfsops: nfs_statvfs would lose buffers
nfs_args: retrying connect
nfscn3 nfsrcv nfssnd nfsaio nfsdis nfs%u nfs_mountroot: mget soname for %s nfs_mountroot: mount %s failed: %d
root on %s
nfs_mountroot: getattr for root nfs_readdir: lost in space nfs physio/async tag VT_NFS, fileid %lld fsid 0x%llx writerpc readonly vp %p nfsmblk nfs: sillyrename dir .nfsAxxxx4.4 nfs_remove: bad v_usecount DP83840 10/100 media interface DP83843 10/100 media interface DP83847 10/100 media interface DP83849 10/100 media interface DP83815 10/100 media interface pcmcia_childdetached: %s not found
%s: error %d detaching %s (function %d)
(manufacturer 0x%04x, product 0x%04x) function %d: %s
pcmcia_function_init: function is enabled %s: card appears to have bogus CIS
pcmcia_function_enable: function not initialized %s: couldn't map the CCR
pcmcia_io_map: function is enabled!
pcmcia_io_unmap: function is enabled!
pcmcia_intr_establish: function is enabled!
pcmcia_intr_establish: already done
interrupt establish failed
pcmcia_intr_disestablish: function is enabled!
pcmcia_intr_distestablish: already done
Drats! I need a skew!
Cannot allocate cfe entry
CIS checksum failed
%s: CIS version PCMCIA 1.0
PCMCIA 2.0 or 2.1
PC Card Standard %d.%d
unknown (major=%d, minor=%d)
%s: CIS info: %s: Manufacturer code 0x%x, product 0x%x
%s: function %d: unspecified multi-function serial port parallel port fixed disk (ata) video adapter network adapter auto incrementing mass storage SCSI bridge Security services Instrument unknown (%d) , ccr addr %lx mask %lx
%s: function %d, config table entry %d: memory card I/O card card type unknown ; irq mask %x ; iomask %lx, iospace %lx -%lx ; memspace @%lx ; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio %s: %d errors found while parsing CIS
%s: using CIS quirks for pcmcia_check_cis_quirks: malloc pf pcmcia_check_cis_quirks: malloc cfe PCMCIA MBH10302 pktqsync pktqrenq UNKNOWN CASIO Compaq HP HP Jornada kmpages pmap_bootstrap: No PTP for va %#lx
pmap_enter: failed to allocate L2 bucket pmap_enter: no pv entries pmap_init_l1: can't get PA of L1 at %p fixup: pm %p, va 0x%lx, ftype %d - nothing to do!
fixup: l2 %p, l2b %p, ptep %p, pte %#x
fixup: pdep %p, pde %#x, fsr %#x
pmap_bootstrap: No L2 for va 0x%x, pa 0x%lx pmap_bootstrap: out of static L2s pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p
pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx
pmap_alloc_specials: no l2b for 0x%lx pmappl pvepl l2dtblpl l2ptppl Cannot allocate L1 KVM Cannot allocate L1 physical pages pmap_map_entry: no L2 table for VA 0x%08lx pmap_map_entry: can't find L2 table for VA 0x%08lx pmap_map_chunk: no L1 table provided %s: no L2 table for VA %#lx %s: can't find L2 table for VA %#lx xscale_setup_minidata: can't find L2 table for VA 0x%08lx Am79C901 HomePNA 1.0 interface random_start random_pick doublehash randinc addr 0x%lx -0x%lx intr %d PXA270 Kernel is configured for %s, but CPU is %s
: Onchip Peripheral Bus
pxaip_attach: failed to map CLKMAN pxaip_attach: failed to map MEMCTL pxaip_measure_cpuclock: can't map RTC %s: CPU clock = %d.%03d MHz
%s: kernel is configured for PXA250, cpu type is %s
pxaip_attach_critical: failed to attach INTC! pxaip_attach_critical: failed to attach GPIO! pxa2x0_memctl_read: not bootstrapped pxa2x0_memctl_write: not bootstrapped pxa2x0_clkman_config: not bootstrapped : can't map registers
Stray DMAC interrupt for unallocated channel %d
: DMA Controller
Can't map registers!
dmac_pxaip_attach: bus_dmamem_alloc failed dmac_pxaip_attach: bus_dmamem_map failed dmac_pxaip_attach: bus_dmamap_create failed dmac_pxaip_attach: bus_dmamap_load failed dmac_dmover_attach: bus_dmamap_create failed dmac_dmover_attach: bus_dmamem_alloc failed dmac_dmover_attach: bus_dmamem_map failed pxa2x0_dmac_abort_xfer: channel %d failed to abort pxagpio_reg_read: not bootstrapped pxagpio_reg_write: not bootstrapped : GPIO Controller
failed to hook main GPIO interrupt
unhandled GPIO interrupt. GPIO#%d
pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0 pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1 pxa2x0_gpio_intr_establish: bad pin number: %d pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN pxa2x0_gpio_intr_establish: bad level: %d pxa2x0_gpio_intr_establish: illegal shared interrupt pxa2x0_gpio_set_intr_level: bad level: %d unable to map register
%s: Bus Error Detected
Interrupt not handled 0x%x
: Interrupt Controller
stray interrupt %d
intr_establish: bogus irq number %d intr_disestablish: bogus irq number %d pxamci_dmac_ointr: non-zero completion status %d
pxamci_dmac_iintr: non-zero completion status %d
mmclk clock stop timeout
data not a multiple of %u bytes
too much data
couldn't start dma xfer. (error=%d)
mmcmd unsupported bus frequency of %d KHz
: MMC/SD Controller
couldn't establish MMC interrupt
using DMA transfer
couldn't alloc rx dma xfer
couldn't alloc tx dma xfer
couldn't attach bus
pxapcic_mem_map: bogus kind pcic_attach_card: already attached %s,%d unable to create event thread for %d
pxapcicev pxapcicss : %d slot%s
can't attach
failed to map MEMCTL
: Real-time Clock
%s: couldn't map registers
%s: using wristwatch register
pxa2x0_io_bs_alloc(): not implemented
pxa2x0_io_bs_free(): not implemented
QS6612 10/100 media interface Mask for route not entered
rn_addmask: mask impossibly already in tree
Non-unique normal route, mask not entered
rn_delete: inconsistent annotation
rn_delete: Orphaned Mask %p at %p
rn_delete: couldn't find our annotation
rn_delete: couldn't find us
radix already initialized rn_init: radix functions require max_keylen be set
rn_init rn_init 2 delayed rn_inithead failed rasops_init: fontwidth assumptions botched! rasops_init: font table is empty
rasops_init: couldn't lock font
fontwidth not 8/12/16 or RASOPS_SMALL - fixme! rip_usrreq rip_abort rip_accept pcblist rip6_usrreq raw6 raw_usrreq %d %llu %u urandom%u rndtemp rndctx rtentpl rttmrpl rt_init_done == 0 /usr/src/sys/net/route.c rt_timer_add: rtq_count reached 0
rt_timer_queue_remove_all: rtq_count reached 0
rt_timer_remove_all: rtq_count reached 0
rt_timer_timer: rtq_count reached 0
rtinit: wrong ifa (%p) was (%p)
rtfree 2 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto
10base2
10baseT-FDX
10baseT
route_purgeif route_abort route_accept route rtable %s: message too long %s: Cannot map registers SA-11x0 OS Timer
clock: hz=%d stathz=%d
saost_count rtts : PCMCIA/GPIO controller
%s: invalid CF slot %d %s: failed to map memory %x for scoop scoop_pcic_read: bogus register scoop_pcic_set_power: bogus power state scoop_pcic_write: bogus register sa6_recoverscope: assumption failure (non 0 ID): %s%%%d
couldn't create dma map. (error=%d)
mmctaskq couldn't create task thread
" %s( manufacturer 0x%x%s product 0x%x%s standard function interface code 0x%x %sat %s function %d couldn't alloc memory (sdmmc function)
couldn't supply bus power
couldn't supply clock
couldn't enable card: %d
couldn't identify card
no functions
i/o init failed
mem init failed
bad CIS ptr %#x
CIS parse error at %d, tuple code %#x, length %d
CISTPL_FUNCE(common) found in function
CISTPL_FUNCE(common) too short
CISTPL_FUNCE(function) found in common
CISTPL_FUNCE(function) too short (v1.00)
CISTPL_FUNCE(function) too short
bad CISTPL_FUNCID length
bad CISTPL_MANFID length
CISTPL_VERS_1 too short
unknown tuple code %#x, length %d
%s: CIS version %u.%u
couldn't supply voltage requested by card
couldn't send I/O OCR
couldn't set I/O RCA
couldn't select I/O RCA %d
couldn't read CIS
can't change bus clock
can't read EXT_CSD (error=%d)
unrecognised future version (%d)
unknown CARD_TYPE: 0x%x
can't change high speed
can't re-read EXT_CSD
HS_TIMING set failed
unknown SD CSD structure version 0x%x
unknown MMC CSD structure version 0x%x
unknown MMC version %d
couldn't set mem RCA
mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x
SD_SEND_SCR send failed.
can't change bus width (%d bit)
switch func mode 0 failed
switch func mode 1 failed: group 1 function %d(0x%2x)
write-protected
copy-cred-on-fork models Traditional NetBSD: 4.4BSD org.netbsd.secmodel.bsd44 secmodel_bsd44_modcmd::init: secmodel_register returned %d
secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d
secmodel_bsd44 suser,securelevel,extensions org.netbsd.secmodel.suser is-root org.netbsd.secmodel.securelevel is-securelevel-above org.netbsd.secmodel.extensions Traditional NetBSD: Extensions extensions_modcmd::init: secmodel_register returned %d
curtain usermount user_set_cpu_affinity extensions_modcmd::fini: secmodel_deregister returned %d
Traditional NetBSD: Securelevel securelevel_modcmd::init: secmodel_register returned %d
securelevel_modcmd::fini: secmodel_deregister returned %d
Traditional NetBSD: Superuser suser_modcmd::init: secmodel_register returned %d
suser_modcmd::fini: secmodel_deregister returned %d
spec_ioctl spec_read type spec_write type spec_fdiscard: not a device
spec_close: spurious pgrp ref spec_close: not special dev %llu, %llu
spec_node_init: unable to allocate memory spec_node_destroy: corrupt hash using Seeq 84220 isolate/reset hack
Seeq 80220 10/100 media interface Seeq 80225 10/100 media interface Seeq 84220 10/100 media interface
dump to dev %u,%u not possible
dumping to dev %u,%u offset %ld
dump area unavailable
device bad
device not ready
area improper
i/o error
aborted from console
succeeded
configure: `%s' driver %s failed: %d configure: attachment `%s' of `%s' driver %s failed: %d %s with registered handlers %s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x
cfgmisc detachall configintr configroot %s: thread %x joined with error %d
config_devalloc: %s (%zu < %zu) config_devalloc: memory allocation for device softc failed config_devalloc: memory allocation for device_t failed %s: could not expand cd_devs config_devalloc: device name too long pmfsusp device-driver device-unit attribute-name loc-name locators interface-attributes config_detach: forced detach of %s failed (%d) %s: unable to allocate callback config_defer: can't defer config of a root device config_defer: unable to allocate callback config_interrupts: unable to allocate callback config_attach: allocation of device softc failed Found %s (root) %s at %s WARNING: power management not supported
root device %s not configured
done.
WARNING: %d error%s while detecting hardware; check system log.
detaching %s, unable to detach instance
init rollback fini config_cfdata fini rollback failed fini rollback unsupported
blist_meta_alloc: allocation too large blst_radix_free: freeing free block blst_meta_free: freeing already free blocks (%llu) %llu/%llu blst_meta_free: freeing unexpected range blist_meta_fill: allocation too large blst_meta_fill: filling unexpected range bufq strategies bufq_alloc: sort out of range bufq_alloc: no strategy ureadc: non-positive resid ureadc: non-positive iovcnt cprng %s: reseeding with partial entropy
cprng %s: NIST CTR_DRBG reseed failed urandom arandom cprng %s: NIST CTR_DRBG instantiation failed cprng %s: creating with partial entropy
sysctl cprng %s: NIST CTR_DRBG failed bdevsw_attach: block majors exhausted cdevsw_attach: character majors exhausted writ %s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld) disk_attach: can't allocate storage for disklabel no raw partition and disk reports bad geometry no raw partition and partition table is full sectors-per-unit sector-size sectors-per-track tracks-per-cylinder cylinders-per-unit disk-info dos partition I/O error mbr partition exceeds disk size BEA01 NSR0 disk label read failed disk label corrupted disk label write failed iso partition bad sector table I/O error bad sector table corrupted %s: can't alloc vnode for %s %s: can't open dev %s (%d)
%s%d%c evcnt /dev/null set{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed
extent_print: NULL extent extent `%s' (0x%lx - 0x%lx), flags = 0x%x
0x%lx - 0x%lx
extent_free: start 0x%lx, end 0x%lx
extent_free: region not found hashdone: invalid table type KMGTPE kMGTPE %qu%s%c%s disknames iostatnames iostats iostat_alloc: cannot allocate memory for stats buffer iostat_free: iostat_count == 0 %s: busy < 0
iostat_unbusy ipi WARNING: ipi_register: table full, increase IPI_MAXREG
kcpuset kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS
kmem-2048 kmem-4096 kmem-8192 kmem-16384 kmem-8 kmem-16 kmem-24 kmem-32 kmem-40 kmem-48 kmem-56 kmem-64 kmem-80 kmem-96 kmem-112 kmem-128 kmem-160 kmem-192 kmem-224 kmem-256 kmem-320 kmem-384 kmem-448 kmem-512 kmem-768 kmem-1024 not modular %s error: %s: %s
lock address : %#018lx
current cpu : %18d
current lwp : %#018lx
lock error klog runonce percpu pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p)
pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p)
page %p, nmissing %d, time %u
%s: too large itemsperpage(%d) for PR_NOTOUCH poolbusy phpool-%d pcgnormal pcglarge pcache pcachecpu pool_get: %s: page empty pool_put: %s: page header missing Must specify a pool to print.
POOL CACHE POOL %s: size %u, align %u, ioff %u, roflags 0x%08x
alloc %p
minitems %u, minpages %u, maxpages %u, npages %u
itemsperpage %u, nitems %u, nout %u, hardlimit %u
nget %lu, nfail %lu, nput %lu
npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu
empty page list:
full page list:
partial-page list:
no current page
curpage %p
cpu layer hits %llu misses %llu
cache layer hits %llu misses %llu
cache layer entry uncontended %llu contended %llu
cache layer empty groups %u full groups %u
full cache groups:
group %p: avail %d
%p, 0x%llx
%p
empty cache groups:
(null) Skipping crash dump on recursive panic
panic: %s: table is full - %s
%s: table is full
pserialize exclusive access psrlz specificdata_domain_delete: not implemented specificdata_setspecific vmem %s-%zu vmem-va vmem-meta vmembt vmem_size vmem_rehash %s: workqueue_create %d
static_bt_inuse static_bt_count xclocv xchicv crosscall unicast xcall xcall/%u filedelay dirdelay metadelay syncer vnode
aio_process: invalid operation code
aiowork aiodone aio_jobs_pool aio_lio_pool posix_aio aio_listio_max aio_max sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s
parked mqmsgpl posix_msg mqueue mq_open_max mq_prio_max mq_max_msgsize mq_def_maxmsg mq_max_maxmsg mqsendcv mqrecvcv pset psets_max %d:1 ,%d:2 posix_sched pri_min pri_max direct_select newreno cubic TCP: invalid wscale %d, assuming %d
tcpipqepl tcp_pulloutofband synpl Connection attempt to TCP %s:%d from %s:%d
(unknown v6) Connection attempt to TCP [%s]:%d from [%s]:%d
tcp_output REXMT tp->t_lastm == NULL tcp_output sackholepl tcp_init tcpcbpl tcp_new_iss tcp_usrreq rfc1323 sendspace recvspace mssdflt minmss msl syn_cache_limit syn_bucket_limit init_win mss_ifmtu sack congctl win_scale timestamps compat_42 cwm cwm_burstsize ack_on_push keepidle keepintvl keepcnt slowhz log_refused rstppslimit delack_ticks init_win_local keepinit recvbuf_auto recvbuf_inc recvbuf_max sendbuf_auto sendbuf_inc sendbuf_max ecn enable maxretries globalmaxholes globalholes local_by_rtt drop iss_hash abc aggressive mslt remote remote_threshold vtw %s: af %d tcp6 %s: could not allocate %zu bytes for hash anchors %s: could not allocate %zu bytes for fatp_t array %s: could not allocate %zu bytes for vtw_t array ttyrub: would panic c = %d, val = %d
not a controlling terminal
no foreground process group
empty foreground process group
load: %d.%02d cmd: %s %d [ %#lx/%d %ld.%02ldu %ld.%02lds %d%% %ldk ttypause ttyraw ttyrawf ttycan ttycanf ttyout ttyoutf tkstat nin nout cancc rawcc qsize ttyldisc_init: termios_disc ttyldisc_init: ntty_disc termios ntty tablet slip ppp strip hdlc increase kern.maxptys putc: required clalloc
b_to_q: required clalloc
udp6_output: IPV6_V6ONLY option was set for a connected socket
udp6 udp6_usrreq udp_usrreq udp_abort udp_accept udp checksum ufs_reclaim: pushing active %s: bad dir ino %llu at offset %d: %s
bad dir First bad, reclen=%#x, DIRSIZ=%lu, namlen=%d, flags=%#x, entryoffsetinblock=%d, dirblksiz = %d
Second bad
mangled entry i_size too small ufs_direnter: newblk ufs_direnter: compact1 ufs_direnter: compact2 hard-linked directory ufsdir ufs_whiteout: unknown op ufs_strategy: spec tag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d
mode 0%o, owner %d, group %d, size %qd accf accf_ stream seqpacket dgram %s: source too long, %d < %d bytes (unknown socket family %d) unix: inet: inet6: msize mclbytes nmbclusters mblowat mcllowat mbpl mclpl m_copydata: off %d, len %d m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d) m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d) m_copym: off %d, len %d m_copym: m == 0, off %d m_copym: m == 0, len %d [!COPYALL] m == NULL in m_pulldown() unix psem ksem somaxkva sbmax sokva sopendfr bad initial sb_max value: %lu sopendfree soinit1 %d netio sbappendaddr sbappendaddrchain sbappendcontrol semi-panic: sbcompress
sbdrop(%p,%d): cc=%lu %s: message too large %d
mbsoname mbfree mbdata mbheader mbsopts mbftable mbcontrol mboobdata piusrreq unp_thread unp_connect1 unp_disconnect1 uipc 1 uipc 2 unp_attach unpgc uipc_init %d uipc_usrreq uipc 4 : %s (OUI 0x%06x, model 0x%04x), rev. %d
: OUI 0x%06x, model 0x%04x, rev. %d
undefined instruction %#x in kernel at %#lx amappl cownow cownowpage anonpl livelock uao_getpage uao_get uao_create: hashinit swhash failed uao_create: swslots allocation failed uaoeltpl uao_flush: strange, got an out of range flush (fixed)
uao_put %s: impossible uao_det ubc_fault ubc_init: failed to allocate ubc_map ubc_init: failed to allocate inactive queue heads ubc_init: failed to map ubc_object ubc_alloc %s: error=%d
udv_detach udv_fault udv_attach flt_noram5 flt_pmfail1 flt_pmfail2 anonget1 anonget2 flt_noram1 fltamapcopy fltagain1 flt_noram2 fltagain2 flt_noram4 uvm_fault_unwire_locked: address not in map uarea uvm uvm_init: page size not set uvm_km_bootstrap: could not reserve space for kernel uvm_km_bootstrap: could not reserve kernel kmem %s: unable to allocate space in parent map uvm_km_suballoc: unable to create submap uvm_km_suballoc: submap allocation failed km_pgrm km_getwait2 plpg loanagain loanzero loanuopg user_va0_disable vmmpepl vmsppl vm_map %s: kernel object %p %p
vmmeter uvmexp uvmexp2 maxslp uspace idlezero minaddress maxaddress uobjwirepg uvm_setpagesize: page size %u (%#x) not a power of two uvm_page_physget: called _after_ bootstrap uvm_page_physget: out of memory! uvm_pageboot_alloc: out of virtual space uvm_pageboot_alloc: pmap_growkernel() failed uvm_pageboot_alloc: out of memory uvm_page_physload: page size not set! uvm_page_physload: bad free list %d uvm_page_physload: start >= end uvm_page_physload: unable to load physical memory segment
%d segments allocated, ignoring 0x%llx -> 0x%llx
increase VM_PHYSSEG_MAX
uvm_page_physload: tried to add RAM after vm_mem_init WARNING: unable to allocate %ld page color buckets
uvm_pagealloc_strat: bad strat %d uvm_page_bootstrap: no memory pre-allocated emergva pager_map pagedaemon: deadlock detected!
anonmin filemin execmin anonmax filemax execmax inactivepct pdpolicy reactanon reactfile reactexec pglalloc ractx %s: swapdev not in list %s: vnode type 0x%x %s: swap to sparse file %s: can't get vnode for swap device %s: can't lock swap device %s: can't open swap device swapmap %s: vmem_create failed swp vnx swp vnd swapctl: miniroot copy failed swapctl: copystr swap_on: miniroot larger than swap? swap_on: unable to preserve miniroot Preserved %d pages of miniroot leaving %d pages of swap
swapdrum_add swapiod %s: workqueue_create failed turning of swap... stopping swap on %s failed with error %d
uvn_fp1 uvn_fp2 vfp fpscr traps buf mem pool index %d forcing bufcache %d -> 5 forcing bufcache %d -> 95 needbuf bufinit: cannot allocate submap biopl buf%uk buf%ub bufcache bufmem bufmem_lowater bufmem_hiwater bufinit2: can't establish soft interrupt bflush biolock biowait biodone2 already allocbuf: buffer larger than MAXBSIZE requested cachegc namecache_stats ncache nchinit %d namecache entries scanned entries collected over scan target under scan target forced reclaims cwdi dirhpl dirhepl dirhash memused maxmem dirhash_remove couldn't find entry in hash table
operation %s not listed in %s.
vfs_op_descs vfs_opv_init: bad operation vfs_opv_init: operation vector without default routine. fstypes magiclinks pnbufpl lf_findoverlap: default lockf chrooted pid %d uid %d (%s) detected outside of its chroot
namei_simple_convert_flags: bogus sflags
/../ earm zaurus kernel_ident ruid rgid Invalid nameiop
relookup: null name relookup: lookup on dot-dot %s: failed to start extattr: error = %d
unmount: dangling vnode %sunmounted %s on %s type %s
forcefully unmount of %s failed with error %d
unmounting done
WARNING: some file systems would not unmount
unmounting file systems...
syncing disks... vfs_mountroot: root device unknown vfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu) vfs_mountroot: rootdev not set for DV_DISK vfs_mountroot: can't get vnode for rootdev vfs_mountroot: can't open root device
%s: inappropriate for root file system
root file system type: %s
WARNING: No file system modules have been loaded.
Supported file systems: no file system for %s (dev 0x%llx) cannot find root vnode, error=%d mount: lost mount Unmounting fresh file system failed vnode @ %p, flags (%s)
tag %s(%d), type %s(%d), usecount %d, writecount %d, holdcount %d
freelisthd %p, mount %p, data %p lock %p
vflushbuf: not dirty, bp %p vflushbuf: dirty VNON VREG VDIR VCHR VLNK VSOCK VFIFO VBAD VT_UFS VT_NFS VT_MFS VT_MSDOSFS VT_LFS VT_LOFS VT_FDESC VT_PORTAL VT_NULL VT_UMAP VT_KERNFS VT_PROCFS VT_AFS VT_ISOFS VT_UNION VT_ADOSFS VT_EXT2FS VT_CODA VT_FILECORE VT_NTFS VT_VFS VT_OVERLAY VT_SMBFS VT_PTYFS VT_TMPFS VT_UDF VT_SYSVBFS VT_PUFFS VT_HFS VT_EFS VT_ZFS VT_RUMP VT_NILFS VT_V7FS VT_CHFS symlink-target %s: failed to start extattr, error = %d %s: failed to stop extattr, error = %d fdesc kernfs afs fstchg fstcnt %s: cannot reclaim vnodepl vcachepl vdrain vrele %s: bad ref count dead but not clean vndsbusy %s: holdcnt vp %p vcache %s: neg numoutput, vp %p xattr-name xattr-val xattr-list system. user. security. trusted. vmapbuf vunmapbuf vop_setextattr vop_deleteextattr vop_openextattr vop_listextattr vop_getextattr vop_closeextattr vop_putpages vop_getpages vop_whiteout vop_advlock vop_pathconf vop_islocked vop_print vop_strategy vop_bmap vop_unlock vop_lock vop_reclaim vop_inactive vop_abortop vop_readlink vop_readdir vop_symlink vop_rmdir vop_mkdir vop_rename vop_link vop_remove vop_seek vop_fsync vop_mmap vop_revoke vop_kqfilter vop_poll vop_fcntl vop_ioctl vop_fdiscard vop_fallocate vop_write vop_read vop_setattr vop_getattr vop_access vop_close vop_open vop_mknod vop_create vop_lookup vop_bwrite : ATI Imageon100 LCD controller
failed to map config (errorno=%d)
failed to map register (errorno=%d)
failed to vram register (errorno=%d)
unable to create new screen (errno=%d) Sharp Zaurus frame buffer Sharp Zaurus LCD std standby immediate command didn't complete
wd_standby: status=%s
wdstart1: bad return code from ata_bio() ST506 %s: ( error not notified device fault device timeout channel reset , retrying soft error (corrected)
wddump: try again wddump: polled command has been queued wddump: unknown atacmd code %d wddump: device timed out wddump: drive fault wddump: DMA error wddump: wddump: unknown error type %d ESDI wd_get_params: bad return code from ata_get_params IDENTIFY failed
SPLIT_MOD15_WRITEFORCE_LBA48 quirks %s
drive supports %d-sector PIO transfers, LBA48 addressing
LBA addressing
chs addressing
wd_setcache command not complete
wd_setcache: status=%s
flush cache command didn't complete
wd_flushcache: status=%s
trim command didn't complete
wd_trim: status=%s
wdioctlstrategy: No matching ioctl request found in queue
physio split wd ioctl request... cannot proceed
address mark not found track 0 not found aborted command media change requested id not found media changed uncorrectable data error bad block detected obsolete (address mark not found) no media/write protected interface CRC error ST3120023AS ST380023AS ST360015AS atarst %s:%d: %s
%s:%d:%d: %s
%s channel %d: reset failed for drive 0 drive 1 __wdccommand_kill_xfer: unknown reason %d
__wdccommand_kill_xfer lost interrupt type: %s tc_bcount: %d tc_skip: %d
missing untimeout atapoll atadrdy atacnf wdccmd atardl can't subregion I/O space
memory mapped mode
i/o mapped mode
wdcattach Digital Mobile Media CD-ROM PCMCIA Portable CD-ROM Drive NinjaATA- EXP PnPIDE F1 SHUTTLE TECHNOLOGY LTD. PCCARD-IDE/ATAPI Adapter FREECOM PCCARD-IDE IO DATA CBIDE2 LOOKMEET IDE CARD Lucent/Prism/Symbol 802.11 controls timeout in wi_seek to %x/%x
%s: failed in wi_seek to %x/%x
command timed out, cmd=0x%x, arg=0x%x
command failed, cmd=0x%x, arg=0x%x
detect auto increment bug, try again
wi_cmd: busy bit won't clear.
xmit failed
%s: %d tx cmds pending!!!
record read mismatch, rid=%x, got=%x
record buffer is too small, rid=%x, size=%d, len=%d
%s: invalid channel %d
%s: tx rate %d -> %d (%d)
%s write fid %x failed
%s: cleaning outstanding rssadapt descriptor for %s
failed to allocate %d bytes on NIC
timeout in alloc
%s: interface not running
tx buffer allocation failed
Lucent Symbol could not get mac address, attach failed
802.11 address %s
%s: using Unknown PRISM2 chip Unknown Lucent chip
%s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u)
using default channel list
no available channel
no supported rate list
%s read fid %x failed
%s: null node %s bad idx %02x
%s null node, rssdesc %02x
%s txpending[%i] wraparound tx failed , retry limit exceeded , max transmit lifetime exceeded , port disconnected , invalid format (data len %u src %s) , status=0x%x wi_scan_result: unknown firmware type %u
Lucent Technologies, WaveLAN/IEEE Sony WaveLAN/IEEE Lucent Embedded WaveLAN/IEEE RF:PRISM2 MAC:HFA3841 RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.B RF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.A RF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.B RF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVAL RF:PRISM1 MAC:HFA3841 CARD:HWB1153 RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flash RF:PRISM2.5 MAC:ISL3873B(PCMCIA) RF:PRISM2.5 MAC:ISL3874A(Mini-PCI) RF:PRISM2.5 MAC:ISL3874A(PCI-bridge) RF:PRISM3 MAC:ISL3871(PCMCIA) RF:PRISM3 MAC:ISL3871(Mini-PCI) %s: emergency X server detach
added (%s , %s emulation wsdisplay_switch1: not switching
wsdisplay_switch1: invalid screen %d wsdisplay_switch1: screen %d disappeared
wsdisplay_switch3: not switching
wsdisplay_switch3: invalid screen %d wsdisplay_switch3: screen %d disappeared
wsdisplay_switch3: giving up
wsdisplay_switch2: not switching
wsdisplay_switch2: invalid screen %d wsdisplay_switch2: screen %d disappeared
wsdisplay_switch2: giving up
wsdisplaytty() on status device wsdisplaytty() on ctl device wsdisplay_common_attach: no memory kbdmux %d : console (%s, %s emulation) , using %s wssw screen %d deleted
wsdisplay at %s wsdisplay: event queue overflow
wswait wsdisplay_noemul EDID dumb wsemul_vt100_output_c0c1: ESC in kernel output ignored
vt100 OI OM Oj Ok Ol Om On Oo [28~ [29~ [1~ [2~ [3~ [4~ [5~ [6~ [7~ [8~ OA [A OB [B OD [D OC [C Op Oq Or Os Ot Ou Ov Ow Ox Oy OP OQ OR OS [11~ [12~ [13~ [14~ [15~ [17~ [18~ [19~ [20~ [21~ [23~ [24~ [25~ [26~ [31~ [32~ [33~ [34~ [>24;20;0c P2$u P0!u%5\ [?62;6c [0n [%d;%dR [?13n [?21n [?27;1n wsemul_vt100_handle_dcs: bad type %d %s: unknown version %d wsevent_read ccw wsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d
wsfont_unlock: font not locked Boldface mux %d cannot load keymap : console keyboard attach error=%d
couldn't register as input device
connecting to %s
wskdet wskbd_detach: %s didn't detach
wskbd at %s %s: event queue overflow
wskbd_get_mapentry: %d(%d): bad entry wskbd_load_keymap: %d: recursion too deep wskbd_load_keymap: %d(%d): bad entry wsmux_getmux: no memory for mux %d
wsmux: attach out of memory
%s: disconnecting from %s
: pseudo power management module
: I2C controller
unable to attach PXA I2C controller
unable to establish nSD_DETECT interrupt
unable to attach MMC controller
%s: zmci_set_power(): unsupported OCR (%#x)
%s: not configured.
can't map bus space
%s: not configured
zssp: zssp_ic_send: invalid IC %d
%s: dir offset too large on fs %s (mounted from %s)
%s: dir offset too large for emulated program
/usr/libexec/ld.elf_so %s-%s Kernel RNG "%s" monobit test FAILURE: %d ones
Kernel RNG "%s" poker test failure: parameter X = %lld.%lld
Kernel RNG "%s" long run test FAILURE: Run of %d %ds found
Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d < %d)
Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d > %d)
%s: invalid base %d divide by 0 /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvsi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvdi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvsi2.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvdi2.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvsi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvdi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvsi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvdi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvsi2.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvdi2.c p->p_refcnt != 0 /usr/src/sys/lib/libkern/../../../common/lib/libppath/ppath.c unused v6 v7 sysv v71k v8 other hpfs ados hfs filecore ntfs raidframe jfs2 vinum udf sysvbfs efs nilfs minixfs3 0%llo %s:%d: abort in %s string propstng < > & plist version="1.0" ?xml !DOCTYPE plist %s%s
SIOCDIFPHYADDR deletetunnel bad hexadecimal digits hexadecimal digits too long strings too long "%.*s" address: %s: getifaddrs %s: ioctl %s %s
SIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ]
valid only with vlan(4) interfaces vlantag SIOCSETVLAN vlan: %d parent: %s
%s: getvlan -vlanif VLAN tag fatal signal: %s cannot get kernel security level: %m can't open %s: %m can't get %s for controlling terminal: %m cannot change kernel security level from %d to %d: %m /dev/constty /dev/console /usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin can't exec `%s' for single user: %m can't fork single-user shell: %m, trying again wait for single-user shell failed: %m; restarting shell stopped, restarting single user shell terminated (%x), restarting ./MAKEDEV /etc/MAKEDEV initial setsid() failed setlogin() failed /dev -MM MAKEDEV exit status %d
Unable to run MAKEDEV invalid major number invalid minor number too many fields for format usage: %s [-rR] [-F format] [-m mode] [-u user] [-g group]
[ name [b | c] [major | driver] minor
| name [b | c] major unit subunit
| name [b | c] number
| name p ]
%s -l [driver] ...
kern.drivers invalid format: %s %s: invalid group name %s: invalid user name lrRF:g:m:u: character major %d block major %d format is meaningless for fifos node type must be 'b', 'c' or 'p'. unknown driver: %s invalid number: %s %s: uid/gid not changed invalid unit number invalid subunit number 386bsd 4bsd bsdos freebsd hpux linux osf1 solaris sunos svr3 svr4 ultrix @ C g h h @ h ,h 4h 1 D 2 S @ _ p ~ @ ffs o Rm o %s,%s Usage: %s [-Aadfruvw] [-t type]
%s [-dfruvw] special | node
%s [-dfruvw] [-o options] [-t type] special node
%s on %s type %.*s %sunknown flag%s %#x %smounted by %sfsid: 0x%x/0x%x reads: sync %llu async %llu , writes: sync %llu async %llu getargs , [%s: %s] realpath `%s' union puffs| %s on %s type %.*s: %s
already mounted force mount_puffs rump rump_%s mount_%s exec: Cannot create pipe Cannot open fd to mount program %s not found for %s statvfs %s Only one -t option may be specified. Aadfo:rwt:uv from_mount Unknown file system %s Unknown special file or file system `%s' Unknown file system type for `%s' :@ WARNING: autoselecting nfs based on : or @ in the device name is deprecated!
WARNING: This behaviour will be removed in a future release
asynchronous extattr hidden nocoredump relatime soft dependencies symperm exported read-only NFS exported exported to the world anon uid mapping kerberos uid mapping non-reserved ports WebNFS exports with quotas root file system being updated reload filesystem data force unmount or readonly change retrieve mount arguments ados filecore ntfs udf sysvbfs efs nilfs strdup \ h ] : 6h ! 7r @ ( / 4 = G K P W b norrip bgens bextatt bnojoliet bnocasetrans brrcaseins usage: %s [-o options] special node
getmntopts egijo:r userquota groupquota rdonly extatt gens maplcase casetrans nrr rrip joliet rrcaseins Warning: realpath %s "%s" is a non-resolved or relative path. using "%s" instead. \ h ] : 6h ! g @ g 7r < "h @ g @ C o: mount table full incorrect super block specified device does not match mounted device %s on %s: %s softdep \ h ] : 6h ! g @ g 7r @ b shortname blongname bnowin95 bgemdosfs bmntversioned b ronly b waitonfat b fatmirror usage: %s [-9Gls] [-g gid] [-M mask] [-m mask] [-o options]
[-t gmtoff] [-u uid] special mountpath
Gsl9u:g:m:M:o:t: stat %s uid=%d, gid=%d, mask=0%o, dirmask=0%o, flags=%s
unknown %s id: %s invalid file mode: %s \ h ] : 6h ! 7r @ 9 ` e o u @ ~ @ @ b soft bwsize brsize btimeo bretrans bmaxgrps bintr bnoconn bnqnfs b nfsv3 b
kerb b dumbtimr b leaseterm b
readahead bdeadthresh bresvport brdirplus breaddirsize bxlatecookie bnoac usage: %s %s
%s
%s
%s
%s
[-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-I readdirsize] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node conflicting version options illegal -a value -- %s illegal -D value -- %s illegal -I value -- %s wsize rdirsize leaseterm readahead deadthresh timeo retrans illegal -R value -- %s illegal -r value -- %s illegal -t value -- %s illegal -w value -- %s illegal -x value -- %s 23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UX getnameinfo: %s sotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d
addr=%s, port=%s, addrlen=%d, conn dumbtimer nfsv3 rdirplus mntudp resport nqnfs soft tcp nfsv2 maxgrps Unsupported socket family %d recvrpc: reject, astat=%d, errno=%d
getport: %s callrpc: error = %d
sendrecv: short write! (%zd < %zu) no : or @ spec can't get net id for host "%s": %s P w O 0 D d B c 6 [ %s: can't read disk label; disk type must be specified %s partition type is not `%s' W T W T b S S %s `%s' is not a valid number. `%s' is not a valid suffix for %s. %s `%s' is too large to convert. %s `%s' (%lld) is less than the minimum (%lld). %s `%s' (%lld) is greater than the maximum (%lld). usage: %s [ fsoptions ] special-device mount-point
usage: %s [ fsoptions ] special-device%s
[disk-type] where fsoptions are:
NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u: B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v: -mfs WARNING: -G may create file systems which cause kernel panics
sector size `%s' is not a power of 2. unknown gname %s expected files per directory free space % number of inodes unknown optimization preference: use `space' or `time'. invalid quota type %s bad mode `%s' unknown user %s Apple UFS volume name cannot contain ':' or '/' Apple UFS volume name cannot be zero length in-filesystem quota is incompatible with -O0 mount `%s' failed base=%p, size=%ld
can't open file %s can't fstat opened %s %s: open for read %s is a block device. use raw device %s: open for write %s: getmntinfo %s is mounted on %s no default sector size %s partition is unavailable Unable to determine file system size size %llu exceeds maximum file system size on `%s' of %llu sectors can't ftruncate %s to %lld can't fstatvfs `%s' can't malloc buffer of %d Creating file system image in `%s', size %lld bytes, in %d byte chunks.
writing image Warning: chosen fsize of %d is less than Apple UFS minimum of %d Warning: chosen bsize of %d is greater than Apple UFS maximum of %d %s %s %d%% Warning: changing optimization to space because minfree is less than mfs:%d %s: mount: %s abnormal termination -B byteorder byte order (`be' or `le') -F create file system image in regular file -G make sanity calculations non-fatal (testing only!) -I do not check that the file system type is '4.2BSD' -N do not create file system, just print out parameters -O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2 -S secsize sector size -T disktype disk type -V verbose output verbosity: 0 ==> none, 4 ==> max -Z pre-zero the image file -a maxcontig maximum contiguous blocks -b bsize block size -d maxbsize maximum extent size -e maxbpg maximum blocks per file in a cylinder group -f fsize frag size -g avgfilesize average file size -g groupname group name of mount point -h avgfpdir average files per directory -i density number of bytes per inode -m minfree minimum free space %% -n inodes number of inodes (overrides -i density) -o optim optimization preference (`space' or `time') -q (user|group) enable specified quota -p perm permissions (in octal) -s fssize file system size (sectors) -u username user name of mount point -v volname Apple UFS volume name rdfs: read error for sector %lld: %s
setblock bad fs_fragshift %d
wtfs: write error for sector %lld: %s
cg 0: bad magic number isblock bad fs_fragshift %d
internal error: can't find block in cyl 0 clrblock bad fs_fragshift %d
first cylinder group ran out of space fsinit: inode value out of range (%llu).
illegal expected average file size %d
illegal expected number of files per directory %d
block size must be a power of 2, not %d
fragment size must be a power of 2, not %d
fragment size %d is too small, minimum is %d
block size %d is too small, minimum is %d
block size %d is too large, maximum is %d
block size (%d) cannot be smaller than fragment size (%d)
Maxcontig raised to %d
fragment size %d is too small, minimum with block size %d is %d
ilog2: %d is not a power of 2
Too many fragments (0x%llx) for a FFSv1 filesystem
Filesystem size %lld < minimum size of %d
CGSIZE miscalculated %d > %d
%s: %.1fMB (%lld sectors) block size %d, fragment size %d
using %d cylinder groups of %.2fMB, %d blks, %d inodes.
Cannot allocate I/O buffer preposterous size %lld
super-block backups (for fsck_ffs -b #) at:
Too many cylinder groups to fit summary information into first cylinder group Panic: cylinder group too big %s%*llu, ... Error making filesystem usage:
%s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval]
[-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host
Cannot resolve "%s" (%s) %s only supported with IP
Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s
TCP: from port %u, to port %u
UDP: from port %u, to port %u
ID=%u icmp_seq=%u for icmp_seq=%u 0.0.0.0
----%s PING Statistics----
%d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets! %.1f%% packet loss round-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms
%.1f packets/sec sent, %.1f packets/sec received
Can't turn off special IP header failed to clear cached route Can't set special IP header sendto wrote %s %d chars, ret=%d %d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms Cannot create socket Cannot shutdown for read setuid Bad/invalid number of packets: %s Bad/invalid interval: %s Bad/invalid preload value: %s Only one of -P and -p allowed Bad/invalid packet size: %s packet size is too large bad tos value: %s ttl out of range: %s -g Bad/invalid maxwait time: %s ac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw: Must be superuser to use -f Must be superuser to use < 1 sec ping interval Must be superuser to use -l Sorry, no audible output for flood pings Can't allocate %d bytes "-p %s": patterns must be specified with 1-32 hex digits
%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x PATTERN: 0x Can't turn on socket debugging SO_DONTROUTE Can't disable multicast loopback Can't set multicast time-to-live Can't set multicast source interface Can't set source interface/address PING %s (%s): %d data bytes
Cannot set the receive buffer size poll recvfrom packet too short (%d bytes) from %s
remote host does not support record route
remote host does not support source route
wrong total length %d instead of %d [*** sequence gap of %u packets from %u ... %u ***]
wrong data byte #%d should have been %#x but was %#x Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set. Next MTU=%d Source Route Failed Unreachable unknown net Unreachable unknown host Unreachable host isolated Net prohibited access Host prohibited access Bad TOS for net Bad TOS for host Communication prohibited Host precedence violation Precedence cutoff Bad Destination Unreachable Code: %d Source Quench Redirect Network Redirect Host Redirect Type of Service and Network Redirect Type of Service and Host Redirect--Bad Code: %d New router addr: %s Echo Request: ID=%d seq=%d Router Discovery Advert Router Discovery Solicit Time To Live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Address Mask Request Address Mask Reply Bad ICMP type: %d
LSRR: (same route)
RR:
NOP
unknown option 0x%x usage: %s [-dln%sqvxz] [-- ]
(can't restart init): poweroff dlnpqvxz halted by %s powered off by %s rebooted by %s: %s rebooted by %s SIGTSTP init SIGTERM all processes SIGKILL all processes WARNING: some process(es) wouldn't die reboot()
J 9 9 9 J 9 8 8 J 8 8 8 usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno]
%s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno]
%s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno]
%s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file]
[-s fileno] [file ...]
%s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file]
[-M mtreefile] [-s fileno] [file ...]
option requires an argument -- %c illegal blocksize -- %s block size must be greater than 0 unknown digest algorithm: %s %c and %c options are mutually exclusive can't open %s illegal dump number -- %s dump number must be greater than 0 b:cD:df:himM:NRrs:tuvxy none of i, R, r, t or x options specified Begin incremental restore
./restoresymtable Calculate node updates.
Begin level 0 restore
Calculate extraction list.
Verify the directory structure
command lines cannot be continued
missing %c
Warning: undefined file type %d
%s > %s: %s: no filename match.
glob() aborted.
unknown error!
%s: not a directory
%s: not on extraction list
%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s Available commands are:
ls [arg] - list directory
cd arg - change directory
pwd - print current directory
add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted
extract - extract requested files
setmodes - set modes of requested directories
quit or xit - immediately exit program
what - list dump header information
verbose - toggle verbose flag (useful with ``ls'')
help or `?' - print this list
Debug - turn on debugging
If no `arg' is supplied, the current directory is used
ls: out of memory
directory reopen failed
%s%s: name exceeds %d char
/
verbose mode off
verbose mode on
setmodes Debug debugging mode off
debugging mode on
%s: unknown command; type ? for help
restore interrupted, continue |NIL |ONTAPE |INOFND |NAMEFND |MODECHG dir %10llu %s
%s: not on the tape
./%llu Mark entries to be removed.
Delete whiteouts
%s: REMOVE
corrupted symbol table
name/inode conflict, mktempname %s
[%s] %s: %s
deleted hard link %s to directory %s
[%s] %s: %s|LINK
cannot KEEP and change modes NODE and LEAF links to same inode [%s] %s: Extraneous name
%s: (inode %llu) not found on tape
[%s] %s: inconsistent state
[%s] %s: impossible state
Find unreferenced names.
%s: remove unreferenced name
unreferenced with flags Remove old nodes (directories).
cannot remove, non-empty Continue extraction of new leaves
Extract new leaves.
%llu: bad first
%s: not found on tape
expected next file %llu, got %llu
unknown file on tape
unexpected file on tape Extract requested files
Add whiteouts
Add links
Check the symbol table.
incomplete operations Warning: missing name %s
type should be LEAF missing inumber %llu
Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d
Extract directories from tape
%s/rstdir%d %s/rstdir%d-XXXXXX cannot mkstemp temporary file %s cannot open temporary file %s %s/rstmode%d %s/rstmode%d-XXXXXX opendirfile: %s
Root directory is not on tape
no memory directory table
error reading directory
corrupted directory: bad reclen %d
corrupted directory: bad inum %d
%s/ Warning: `.' missing from directory %s
Warning: `..' missing from directory %s
%s%s: name exceeds %lu char
Set directory mode, owner, and times.
modefile not defined
directory mode, owner, and times not set
fopen: %s
cannot open mode file %s
cannot find directory inode %llu
error setting directory modes
Cannot find directory inode %llu named %s
write error extracting inode %llu, name %s
read: %s
cannot find entry in parent list addino: out of range %llu
duplicate inum deleteino: out of range %llu
deleteino: %llu not found
%s is not a directory
%s: pathname too long
bad name
no space for string table
no memory to extend symbol table
bad name to addentry %s
link to non-existent name
duplicate entry
not marked REMOVED freeing referenced directory freeing non-empty directory lookupino failed link not found cannot move ROOT Checkpointing the restore
cannot create save file %s for symbol table
fwrite: %s
output error to file %s writing symbol table
Initialize symbol table.
no memory for entry table
cannot open symbol table file %s
stat: %s
cannot stat symbol table file %s
cannot allocate space for symbol table
cannot read symbol table file %s
Incremental tape too low
Incremental tape too high
initsymtable called from command %c
Checksum error %o, inode %llu file %s
unallocated block in symbolic link %s
symbolic link name: %s->%s%s; too long %d
Cannot have multiple dumps on pipe input
ioctl MTFSF: %s
seek error extracting inode %llu, name %s
lseek: %s
Warning: %s %s
End-of-input encountered while extracting write error extracting inode %llu, name %s
write: %s
Cannot allocate space for tape buffer
cannot open %s: %s
the epoch
[unknown] #Dump date: %s #Dumped from: %s #Level %d dump of %s on %s:%s
#Label: %s
/set uname=root gname=wheel
error writing to mtree file Changing volumes on pipe input?
You have not read any tapes yet.
Unless you know which volume your file(s) are on you should start
with the last volume and work towards the first.
(Use 1 for the first volume/tape, etc.)
You have read volumes Specify next volume #: Volume numbers are positive numerics
Mount tape volume %d
Enter ``none'' if there are no more tapes
otherwise enter tape name (default: %s) Cannot open %s
header read failed at %d blocks
tape is not dump tape
Volume mismatch: expecting %d, tape header claims it is %d
Wrong dump date
got: %s wanted: %s read %ld recs, tape starts with %ld
Skipping %d duplicate record%s.
active file into volume 1
mid-media short read error.
partial block read: %d should be %d
Tape read error while trying to set up tape
trying to resynchronize
restoring %s
skipping over inode %llu
continuation failed: %s
End-of-tape encountered
Note: Doing Byte swapping
gethead: unknown inode type %d
Volume header (%s inode format) begins with record %lld Dumped inodes map header Used inodes map header File header, ino %llu File continuation header, ino %llu End of tape header ; predicted %ld blocks, got %ld blocks unexpected tape header
unknown tape header type %d
resync restore, skipped %ld blocks
ran off end of tape
not at beginning of a file
Missing address (header) block for %s at %d blocks
%s: unknown file mode 0%o
skipped socket %s
unextracted directory %s
extract file %s
%s: zero length symbolic link (ignored)
extract special file %s
%s: cannot create special file: %s
extract fifo %s
%s: cannot create fifo: %s
fifo %s: cannot create file: %s
%s (%s) = %s
no memory for %s
%s: inconsistent map size
%s: map size changed
Verify tape and initialize maps
tape read error: %s
Tape block size (%ld) %s (%ld)
is not a multiple of dump block size Tape block size is %d
Tape is not a dump tape
Converting to new file system format.
cannot stat .: %s
bad block size %d
Tape is not volume 1 of the dump
no header after volume mark!
Cannot find file removal list
MD5 SHA1 RMD160 warning: cannot rename %s to %s: %s
rename %s to %s
warning: cannot create whiteout %s: %s
Create whiteout %s
|REMOVED |TMPNAME |EXTRACT |NEW |KEEP |EXISTED %s is not on the tape
dump core symbolic hard warning: cannot create symbolic link %s->%s: %s
warning: cannot create hard link %s->%s: %s
linkit: unknown type %d
Create %s link %s->%s
bad entry: %s
parent name %s
sibling name: %s
next entry name: %s
next link name: %s
next hashchain name: %s
entry type: %s
inode number: %ld
flags: %s
not on ino list %s%ld%llu RSTTMP mktempname: called with TMPNAME newnode: not a node warning: %s: %s
Make node %s
removenode: not a node removenode: non-empty directory Remove node %s
removeleaf: not a leaf Remove leaf %s
delwhiteout: not a leaf warning: cannot delete whiteout %s: %s
Delete whiteout %s
%s type=%s uid=%d gid=%d mode=%#4.4o flags= nodump %suchg %suappnd %sopaque %sarch %sschg %ssappnd Lost connection to remote host. Protocol to remote tape server botched.
(rmtgets got "%s").
Protocol to remote tape server botched (code "%s").
shell/tcp: unknown service who are you? invalid user name: %s /etc/rmt O%s
%d
C
R%d
W%d
L%d
%d
I%d
%d
DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG GV ZV sV V V V W *W JW jW W W W X 4X fX X X X UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC
ALLMULTI OACTIVE SIMPLEX
LINK0LINK1LINK2MULTICAST UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING
XRESOLVE LLINFO STATIC
BLACKHOLECLONEDPROTO2PROTO1 pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtu U G H R B D M @ d m C X L S 1 @ 2 c p 0123456789abcdef atalk hopcount inet6 llinfo lockrest nostatic proto1 proto2 recvpipe rtt rttvar sendpipe show ssthresh x25 xns xresolve flushall nocloned nocloning noblackhole noreject mpls %s: inet %s; %s: link %s; %s: (%d) %s; not in table entry in use routing table overflow prefixlen is not supported with af %d %s: bad value
sockaddrs: routing message version %d not understood
#%d: len %d, if# %d, %s, flags: metric %d, flags: if# %d, what: re-associate disassociate scan complete join michael (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llx arrival pid %d, seq %d, errno %d, flags:
locks: inits: route-sysctl-estimate actual retrieval of routing table Examining routing table from sysctl (address family %s)
writing to routing socket: %s write to routing socket, got %d for rlen %-20.20s botched keyword: %s Usage: %s [ -fnqSsv ] cmd [[ - ] args ]
Internal Error dfnqSstv Cannot allocate memory %s, %s old usage of trailing 0 assuming route to if old usage of trailing digit assuming route via gateway missing destination specification missing gateway specification -host and -net conflict soup->so_dst soup->so_gate soup->so_mask soup->so_genmask soup->so_ifp soup->so_ifa : gateway %s RTM_ADD: Add Route RTM_DELETE: Delete Route RTM_CHANGE: Change Metrics or flags RTM_GET: Report Metrics RTM_LOSING: Kernel Suspects Partitioning RTM_REDIRECT: Told to use different route RTM_MISS: Lookup failed on this address RTM_LOCK: fix specified metrics RTM_OLDADD: caused by SIOCADDRT RTM_OLDDEL: caused by SIOCDELRT RTM_RESOLVE: Route created by cloning RTM_NEWADDR: address being added to iface RTM_DELADDR: address being removed from iface RTM_OOIFINFO: iface status change (pre-1.5) RTM_OIFINFO: iface status change (pre-64bit time) RTM_IFANNOUNCE: iface arrival/departure RTM_IEEE80211: IEEE80211 wireless event RTM_IFINFO: iface status change RTM_CHGADDR: address being changed on iface link#%d %-*.*s %-*.*s %-6.6s
Gateway Flags AppleTalk Encap Internet
Protocol Family %d:
%-6.6s %u.%u.%u.%u/%d (%d) %s af %d: %s sysctl of routing table Routing tables %6s %8s unspec PF PF 0* X X X , , x < < Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -]
illegal time format FINAL %s -n /usr/bin/wall %s: Can't find `%s' (%m) *** %sSystem shutdown message from %s@%s ***
System going down at %5.5s
System going down in %ld minute%s
System going down in 30 seconds
System going down IMMEDIATELY
/etc/nologin
NO LOGINS: System going down at /sbin/reboot /sbin/halt %s: Not super-user b:Ddfhknprvxz Incompatible options -f and -n Incompatible options -%s and -r now TZ time is already past Shutdown at %.24s.
Shutdown NOW! shutdown: fork shutdown: [pid %d]
%s by %s: %s
System shutdown time has arrived
but you'll have to do it yourself
/fastboot fastboot file for fsck
About to run shutdown hooks...
. /etc/rc.shutdown
Done running shutdown hooks.
-v -x -z -d Can't exec `%s' (%m) Can't exec `%s' hw.disknames usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto]
%s -a [-p priority] path
%s -q
%s -c -p priority path
%s -D dumpdev|none
%s -d path
%s -l | -s [-k|-m|-g|-h]
%s -U [-n] [-t blk|noblk|auto]
%s -z
could not set dump device to %s %s: setting dump device to %s
WARNING: %s is readable by the world WARNING: %s is writable by the world %s: adding %s as swap device at priority 0
%s: removing %s as swap device
%s%s%c sw priority= nfsmntpt= empty mountpoint /sbin/mount_nfs %s: mount failed /sbin/umount noblk %s: adding %s as swap device at priority %d
%s: failed to add %s as swap device
%s: failed to remove %s as swap device
%s: umount failed swapon usage: %s -a [-t blk|noblk]
%s ...
ADUacdfghklmnop:qst:z could not get dump device no dump device set dump device is major %llu minor %llu
%s: no swap or dump devices in /etc/fstab
%s: there are swap or dump devices defined in /etc/fstab
KBytes MBytes GBytes no swap devices configured SWAP_STATS SWAP_STATS different to SWAP_NSWAP (%d != %d) %-*s %*s %8s %8s %8s %s
Device Used Avail Capacity Priority %-*s %*ld %8ld %8ld %5.0f%% %d
%-*s %*s %8s %8s %5.0f%% %d
%s/%s swap space
%ld/%ld %s swap space
total: %s allocated = %s used, %s available.
total: %ld %s allocated = %ld %s used, %ld %s available
%-*s %*s %8s %8s %5.0f%%
Total %-*s %*ld %8ld %8ld %5.0f%%
Usage: %s [-fR] special | node
%s: not currently mounted fR fetch_url f sendrequest recvrequest | $ ( , 0 4 8 *************************************************************************************************************************************************************************************************************************************** TYPE %s %s TYPE %s %s: unknown mode.
Continue with %s %s [anpqy?]? %s; %s aborted
Prompting off for duration of %s.
Interactive mode: off.
confirmation options:
a answer `yes' for the duration of %s
n answer `no' for this file
p turn off `prompt' mode
q stop the current %s
y answer `yes' for this file
? this help list
nmap: unbalanced brackets.
Using %s mode to transfer files.
changetype: unknown type %d binary tenex We only support %s mode, sorry.
We only support %s format, sorry.
We only support %s structure, sorry.
STOR APPE STOU local-file remote-file local-files Glob pattern `%s' not found Restart is not supported by the remote server.
RETR r+ remote-files mreget Skipping non-relative filename `%s'
Can't open source file %s
Version: %s %s
NetBSD-ftp 20141026 %s %s.
Bell mode Editing support not compiled in; ignoring command.
Packet tracing mark: bad bytecount value `%s'.
Hash mark printing %s (%d bytes/hash mark) Verbose mode Use of PORT/LPRT cmds Progress bar Interactive mode (none) Disabling gate-ftp mode - no gate-ftp server defined.
Gate ftp: %s, server %s, port %s.
Globbing Preserve modification times %s: bad debugging value.
Debugging %s (ftp_debug=%d).
remote-directory CWD command not recognized, trying XCWD.
XCWD %s Can't chdir `%s' Local directory now: %s
Unable to determine local directory
DELE %s from-name to-name RNFR %s RNTO %s MLSD NLST MLSD is not supported by the remote server.
nlist pager output to local-file: mls SHELL Can't execute `%s' Can't fork a subshell; try again later username USER %s Password: PASS %s Account: ACCT %s Login failed.
Unable to determine remote directory
Remote directory: %s
Local directory: %s
directory-name MKD command not recognized, trying XMKD.
XMKD %s RMD command not recognized, trying XRMD.
XRMD %s command line to send arguments to SITE command SITE SITE CHMOD %s %s SITE UMASK SITE UMASK %s SITE IDLE SITE IDLE %s HELP HELP %s QUIT Account: ?Ambiguous command.
?Invalid command.
?Invalid proxy command.
Not connected.
Case mapping Carriage Return stripping Ntrans off.
Nmap off.
mapout Passive mode: %s; fallback to active mode: %s.
EPSV/EPRT on IPv4 EPSV/EPRT on IPv6 Store unique Receive unique Get transfer rate throttle: %s; maximum: %d; increment %d.
Put transfer rate throttle: %s; maximum: %d; increment %d.
CDUP CDUP command not recognized, trying XCUP.
XCUP restart: Invalid offset `%s'
No restart point defined.
Restarting at %lld for next get, put or append
SYST Limit of 16 macros have already been defined.
macro name Enter macro line by line, terminating it with a null line.
macdef: end of file encountered.
Macro not defined - 4K buffer exceeded.
%s %lld
%s %s STAT STAT %s Local file "%s" is newer than remote file "%s".
sndbuf rcvbuf xferbuf %s: size must be positive.
Socket buffer sizes: send %d, receive %d.
No such option `%s'.
Setting `%s' to `%s'.
%-*s %s
Unsetting `%s'.
FEAT is not supported by the remote server.
FEAT MLST is not supported by the remote server.
MLST MLST %s OPTS is not supported by the remote server.
OPTS %s OPTS %s %s ebcdic anonpass ftp_proxy http_proxy https_proxy no_proxy rprompt account bye cdup disconnect edit epsv epsv4 epsv6 features fget idle lcd lpage lpwd macdef mdelete mget mlst modtime mput msend newer nmap ntrans passive pdir pmlsd quote recv remopts rename reset restart rhelp rmdir rstatus runique sendport site struct sunique throttle usage '%s' macro not found.
%s: HTTP fetch aborted.
%s: HTTP fetch timeout.
parse_url: invoked with NULL argument! http:// ftp:// file:// Invalid %s `%s' Unknown port `%s' in %s `%s' Invalid URL `%s' ;type=a ;type=i ;type=d Directory listing via a URL is not supported Invalid suffix `%s' in URL `%s' *?[]{} Can't connect or login to host `%s:%s' fetch_ftp: unknown transfer type %d
ftp: The `CWD ' command (without a directory), which is required by
RFC 3986 to support the empty directory in the URL pathname (`//'),
conflicts with the server's conformance to RFC 959.
Try the same URL without the `//' in the URL pathname.
localhost No support for non local file URL `%s' Invalid URL (no file after host) `%s' No file after directory (you must specify an output file) `%s' copied Can't open `%s' Can't seek to restart `%s' Copying %s (restarting at %lld) retrieved , Can't restart via proxy URL `%s' proxy URL Malformed proxy URL `%s' Scoped address notation `%s' disallowed via web proxy Can't LOOKUP `%s:%s': %s Trying %s:%s ...
Can't create socket for connection to `%s:%s' Can't connect to `%s:%s' Requesting %s
%svia %s:%s ( GET %s HTTP/1.0
Pragma: no-cache
GET %s HTTP/1.1
Host: [%s] Host: %s Accept: */*
Connection: close
Range: bytes=%lld-
restarting at %lld Cache-Control: no-cache
FTPUSERAGENT User-Agent: %s
User-Agent: %s/%s
Writing HTTP request Receiving HTTP reply: %s Content-Range: Received unexpected Content-Range header Last-Modified: Location: Transfer-Encoding: Bogus transfer encoding `binary' (fetching anyway) chunked Unsupported transfer encoding `%s' Proxy-Authenticate: Basic WWW-Authenticate: Not expecting partial content header No redirection Location provided by server Too many redirections requested Redirected via %s
Redirected to %s
Error retrieving file `%s' Unknown error retrieving file already done
Size of `%s' differs from save file `%s' /usr/src/usr.bin/ftp/fetch.c rcvbuf_size > 0 Unexpected EOF reading chunk-size Invalid chunk-size Chunk-size `%.*s' Unexpected data following chunk-size Writing `%s' Unexpected EOF reading chunk CRLF Unexpected data following chunk Reading file Can't change modification time to %s Improper response from `%s:%s' Content-Length: Unsupported URL scheme `%.*s'
remote abort aborted; closing connection.
receive
send abortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort.
421 Service not available, %s.
No control connection for command Can't lookup `%s:%s': %s Can't determine my address of connection to `%s:%s' Can't fdopen socket Connected to %s.
PASV EPSV Can't create socket for data connection wrong server: return code must be 229
Passive mode refused.
Passive mode AF mismatch. Shouldn't happen!
wrong server: return code must be 227
Passive mode address scan failure. Shouldn't happen!
LPSV wrong server: return code must be 228
%u,%u,%u,%u,%u,%u,%u,%u,%u %c%c%c%d%c parse error!
Can't set SO_REUSEADDR on data connection Can't bind for data connection Can't determine my address of data connection Can't listen to data connection EPRT |%u|%s|%s| PORT %d,%d,%d,%d,%d,%d Poll timeout waiting before accept Can't poll waiting before accept Can't accept data connection Can't access `%s' runique: can't find unique file name.
Lost control connection for abort Can't send abort message %cABOR
proxy server does not support third party transfers.
No primary connection.
PORT %s REST %lld local: %s remote: %s
Error aborting proxy command sent local: %s %s: not a plain file.
/usr/src/usr.bin/ftp/ftp.c sndbuf_size > 0 Reading `%s' Writing to network Can't chmod `%s' Reading from network WARNING! %d bare linefeeds received in ASCII mode.
File may not have transferred correctly.
Can't change modification time on %s to %s Usage error
Error resetting connection remote server timed out. Connection closed user interrupt. Connection closed remote server has closed connection usage: %s [-46AadefginpRtVv] [-N netrc] [-o outfile] [-P port] [-q quittime]
[-r retry] [-s srcaddr] [-T dir,max[,inc]]
[[user@]host [port]] [host:path[/]] [file:///file]
[ftp://[user[:pass]@]host[:port]/path[/]]
[http://[user[:pass]@]host[:port]/path] [...]
%s -u URL file [...]
Proxy c %sommands may be abbreviated. Commands are:
?Ambiguous %s command `%s'
?Invalid %s command `%s'
ftp> prompt: no such option `prompt' rprompt: no such option `rprompt' Sorry, input line is too long.
anonymous http FTPSERVERPORT ftpgate NETRC $NETRC `%s': %s FTPMODE Unknown $FTPMODE `%s'; using defaults pftp FTPSERVER Neither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp TERM dumb INET6 support is not available; ignoring -6 Bad quit value: %s Bad retry value: %s Bad throttle value `%s' 46AadefginN:o:pP:q:r:Rs:tT:u:vV Can't lookup `%s': %s %s/.netrc: %s /.netrc FTPANONPASS PAGER FTPPROMPT FTPRPROMPT Retrying in %d seconds...
getoptionvalue: invoked with NULL name getoptionvalue: invoked with unknown option `%s' %lld byte%s %s in %d day%s %2d: %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) xsignal_restart: called with signal %d
%s: transfer aborted because stalled for %lu sec.
%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETA KiB MiB GiB TiB PiB EiB Token in .netrc too long Can't read `%s' Error: .netrc file is readable by others Remove password or make file unreadable by others Remove account or make file unreadable by others Missing macdef name argument.
Macro definition missing null line terminator.
Unknown .netrc keyword `%s' 4K macro buffer exceeded.
machine MDTM REST STREAM TVFS
Remote system type is %.*s.
unix 215 TOPS20 Remember to set tenex mode when transferring binary files from this machine.
ftpXXXXXXXXXX Unable to create temporary file `%s' Can't find list of remote files SIZE is not supported by remote server.
SIZE %s MDTM is not supported by remote server.
MDTM %s 191 Y2K warning! Incorrect time-val `%s' received from server.
Converted to `%s'
Can't parse time `%s'.
%Y%m%d%H%M%S %a, %d %b %Y %H:%M:%S %z
Can't convert RFC 2822 time: buffer too small %a, %d %b %Y %H:%M:%S GMT %a, %d-%b-%y %H:%M:%S GMT %a, %b %d %H:%M:%S %Y Unable to determine real path of `%s' crankrate invoked with unknown signal: %d Unable to determine rcvbuf size Unable to determine sndbuf size Unable to set sndbuf size %d Unable to set rcvbuf size %d
EOF received Error encountered Input line is too long Sorry, arguments too long.
(%s) %s; %s aborted.
operation Can't bind to `%s' Can't %s socket flags for connect to `%s:%s' Can't set socket non-blocking for connect to `%s:%s' Unable to allocate %ld bytes of memory Unable to allocate memory for stringlist Unable to add `%s' to stringlist ftp_strdup: called with NULL argument Unable to allocate memory for string copy Name (%s:%s): Name (%s): Login failed $init Already connected to %s, use close first.
main: gateserver not defined Connecting via pass-through server %s
non-print stream NetBSD gzip 20150113 malloc failed failed to read stdin %s: unexpected end of file %s: trailing garbage ignored input not gziped (MAGIC0) input not gziped (MAGIC1) unknown compression method 1.2.3 failed to inflateInit Z_NEED_DICT error data stream error internal stream error memory allocation error unknown error from inflate(): %d error writing to output truncated input invalid compressed data--crc error invalid compressed data--length error decompression error deflateInit2 failed deflate failed deflateEnd failed %c%c%c%c%c%c%c%c snprintf compressed uncompressed ratio uncompressed_name read of uncompressed size %12llu %12llu %2.2d. %5s%% can't read stdin (stdin): unexpected end of file (stdin) 123456789cdhlV usage: %s [-123456789cdhlV] [ [ ...]]
can't stat: %s %s is a directory %s: unknown suffix -- ignored can't read %s couldn't close input couldn't close output %s: uncompress failed couldn't open (leaving original): %s couldn't stat (leaving original): %s stat gave different size: %lld != %lld (leaving original) could not create output: %s %s is not a regular file .gz D " D # D % D ' Ԋ" " " S-
SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS
Commands marked with * may be preceded by a number, _N.
Notes in parentheses indicate the behavior if _N is given.
A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K.
h H Display this help.
q :q Q :Q ZZ Exit.
---------------------------------------------------------------------------
MMOOVVIINNGG
e ^E j ^N CR * Forward one line (or _N lines).
y ^Y k ^K ^P * Backward one line (or _N lines).
f ^F ^V SPACE * Forward one window (or _N lines).
b ^B ESC-v * Backward one window (or _N lines).
z * Forward one window (and set window to _N).
w * Backward one window (and set window to _N).
ESC-SPACE * Forward one window, but don't stop at end-of-file.
d ^D * Forward one half-window (and set half-window to _N).
u ^U * Backward one half-window (and set half-window to _N).
ESC-) RightArrow * Left one half screen width (or _N positions).
ESC-( LeftArrow * Right one half screen width (or _N positions).
F Forward forever; like "tail -f".
r ^R ^L Repaint screen.
R Repaint screen, discarding buffered input.
---------------------------------------------------
Default "window" is the screen height.
Default "half-window" is half of the screen height.
---------------------------------------------------------------------------
SSEEAARRCCHHIINNGG
/_p_a_t_t_e_r_n * Search forward for (_N-th) matching line.
?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line.
n * Repeat previous search (for _N-th occurrence).
N * Repeat previous search in reverse direction.
ESC-n * Repeat previous search, spanning files.
ESC-N * Repeat previous search, reverse dir. & spanning files.
ESC-u Undo (toggle) search highlighting.
&_p_a_t_t_e_r_n * Display only matching lines
---------------------------------------------------
A search pattern may be preceded by one or more of:
^N or ! Search for NON-matching lines.
^E or * Search multiple files (pass thru END OF FILE).
^F or @ Start search at FIRST file (for /) or last file (for ?).
^K Highlight matches, but don't move (KEEP position).
^R Don't use REGULAR EXPRESSIONS.
---------------------------------------------------------------------------
JJUUMMPPIINNGG
g < ESC-< * Go to first line in file (or line _N).
G > ESC-> * Go to last line in file (or line _N).
p % * Go to beginning of file (or _N percent into file).
t * Go to the (_N-th) next tag.
T * Go to the (_N-th) previous tag.
{ ( [ * Find close bracket } ) ].
} ) ] * Find open bracket { ( [.
ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>.
ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>
---------------------------------------------------
Each "find close bracket" command goes forward to the close bracket
matching the (_N-th) open bracket in the top line.
Each "find open bracket" command goes backward to the open bracket
matching the (_N-th) close bracket in the bottom line.
m_<_l_e_t_t_e_r_> Mark the current position with .
'_<_l_e_t_t_e_r_> Go to a previously marked position.
'' Go to the previous position.
^X^X Same as '.
---------------------------------------------------
A mark is any upper-case or lower-case letter.
Certain marks are predefined:
^ means beginning of the file
$ means end of the file
---------------------------------------------------------------------------
CCHHAANNGGIINNGG FFIILLEESS
:e [_f_i_l_e] Examine a new file.
^X^V Same as :e.
:n * Examine the (_N-th) next file from the command line.
:p * Examine the (_N-th) previous file from the command line.
:x * Examine the first (or _N-th) file from the command line.
:d Delete the current file from the command line list.
= ^G :f Print current file name.
---------------------------------------------------------------------------
MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS
-_<_f_l_a_g_> Toggle a command line option [see OPTIONS below].
--_<_n_a_m_e_> Toggle a command line option, by name.
__<_f_l_a_g_> Display the setting of a command line option.
___<_n_a_m_e_> Display the setting of an option, by name.
+_c_m_d Execute the less cmd each time a new file is examined.
!_c_o_m_m_a_n_d Execute the shell command with $SHELL.
|XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command.
v Edit the current file with $VISUAL or $EDITOR.
V Print version number of "less".
---------------------------------------------------------------------------
OOPPTTIIOONNSS
Most options may be changed either on the command line,
or from within less by using the - or -- command.
Options may be given in one of two forms: either a single
character preceded by a -, or a name preceded by --.
-? ........ --help
Display help (from command line).
-a ........ --search-skip-screen
Search skips current screen.
-A ........ --SEARCH-SKIP-SCREEN
Search starts just after target line.
-b [_N] .... --buffers=[_N]
Number of buffers.
-B ........ --auto-buffers
Don't automatically allocate buffers for pipes.
-c ........ --clear-screen
Repaint by clearing rather than scrolling.
-d ........ --dumb
Dumb terminal.
-D [_x_n_._n] . --color=_x_n_._n
Set screen colors. (MS-DOS only)
-e -E .... --quit-at-eof --QUIT-AT-EOF
Quit at end of file.
-f ........ --force
Force open non-regular files.
-F ........ --quit-if-one-screen
Quit if entire file fits on first screen.
-g ........ --hilite-search
Highlight only last match for searches.
-G ........ --HILITE-SEARCH
Don't highlight any matches for searches.
-h [_N] .... --max-back-scroll=[_N]
Backward scroll limit.
-i ........ --ignore-case
Ignore case in searches that do not contain uppercase.
-I ........ --IGNORE-CASE
Ignore case in all searches.
-j [_N] .... --jump-target=[_N]
Screen position of target lines.
-J ........ --status-column
Display a status column at left edge of screen.
-k [_f_i_l_e] . --lesskey-file=[_f_i_l_e]
Use a lesskey file.
-K --quit-on-intr
Exit less in response to ctrl-C.
-L ........ --no-lessopen
Ignore the LESSOPEN environment variable.
-m -M .... --long-prompt --LONG-PROMPT
Set prompt style.
-n -N .... --line-numbers --LINE-NUMBERS
Don't use line numbers.
-o [_f_i_l_e] . --log-file=[_f_i_l_e]
Copy to log file (standard input only).
-O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e]
Copy to log file (unconditionally overwrite).
-p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n]
Start at pattern (from command line).
-P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t]
Define new prompt.
-q -Q .... --quiet --QUIET --silent --SILENT
Quiet the terminal bell.
-r -R .... --raw-control-chars --RAW-CONTROL-CHARS
Output "raw" control characters.
-s ........ --squeeze-blank-lines
Squeeze multiple blank lines.
-S ........ --chop-long-lines
Chop (truncate) long lines rather than wrapping.
-t [_t_a_g] .. --tag=[_t_a_g]
Find a tag.
-T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e]
Use an alternate tags file.
-u -U .... --underline-special --UNDERLINE-SPECIAL
Change handling of backspaces.
-V ........ --version
Display the version number of "less".
-w ........ --hilite-unread
Highlight first new line after forward-screen.
-W ........ --HILITE-UNREAD
Highlight first new line after any forward movement.
-x [_N[,...]] --tabs=[_N[,...]]
Set tab stops.
-X ........ --no-init
Don't use termcap init/deinit strings.
-y [_N] .... --max-forw-scroll=[_N]
Forward scroll limit.
-z [_N] .... --window=[_N]
Set size of window.
-" [_c[_c]] . --quotes=[_c[_c]]
Set shell quote characters.
-~ ........ --tilde
Don't display tildes after end of file.
-# [_N] .... --shift=[_N]
Horizontal scroll amount (0 = one half screen width)
........ --no-keypad
Don't send termcap keypad init/deinit strings.
........ --follow-name
The F command changes files if the input file is renamed.
---------------------------------------------------------------------------
LLIINNEE EEDDIITTIINNGG
These keys can be used to edit text being entered
on the "command line" at the bottom of the screen.
RightArrow ESC-l Move cursor right one character.
LeftArrow ESC-h Move cursor left one character.
ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word.
ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word.
HOME ESC-0 Move cursor to start of line.
END ESC-$ Move cursor to end of line.
BACKSPACE Delete char to left of cursor.
DELETE ESC-x Delete char under cursor.
ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor.
ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor.
ctrl-U ESC (MS-DOS only) Delete entire line.
UpArrow ESC-k Retrieve previous command line.
DownArrow ESC-j Retrieve next command line.
TAB Complete filename & cycle.
SHIFT-TAB ESC-TAB Complete filename & reverse cycle.
ctrl-L Complete filename, list all.
--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t) ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t ?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t ?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t HELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done Waiting for data LESS LESSSECURE VISUAL LESSEDIT %E ?lm+%lm. %f @/\less/\help/\file/\@ WARNING: terminal is not fully functional No filenames allowed with -t option LESS_TERMCAP_DEBUG <%s> LESS_TERMCAP_ LINES li kr kl ku kd kP kN kh @7 kD hc xn da ti cm vb |^ Nothing in top line Nothing in bottom line No bracket in top line No bracket in bottom line No matching bracket ch_ungetchar overrun Warning: log file is incomplete seek error read error Finishing logfile seek error to 0 invalid chardef chardef longer than 256 invalid charset name LESSCHARSET LESSCHARDEF LC_ALL LC_CTYPE LANG UTF-8 utf-8 UTF8 utf8 latin1 LESSBINFMT *s<%02X> LESSUTFBINFMT ESC ^%c ANSI_X3.4-1968 US-ASCII iso8859 ISO-8859-1 latin9 ISO-8859-15 latin2 ISO-8859-2 ISO-8859-3 latin3 latin4 ISO-8859-4 cyrillic ISO-8859-5 ISO-8859-6 arabic ISO-8859-7 greek IBM9005 greek2005 ISO-8859-8 hebrew latin5 ISO-8859-9 latin6 ISO-8859-10 latin7 ISO-8859-13 latin8 ISO-8859-14 latin10 ISO-8859-16 IBM437 EBCDIC-US IBM1047 IBM-1047 KOI8-R koi8-r KOI8-U GEORGIAN-PS georgianps TCVN5712-1 tcvn NEXTSTEP windows windows-1252 CP1251 windows-1251 CP1252 CP1255 windows-1255 8bcccbcc18b95.b 8bcccbcc18b95.b126.bb 8bcccbcc18b95.33b. 8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b. 8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b 8bcccbcc18b95.33b4.2b4.b3.b35.b44.b 8bcccbcc18b95.33b14.b35.b44.b 8bcccbcc18b95.33b.b29.32b28.2b2.b 8bcccbcc18b95.b. KOI8-T 8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b. 8bcccbcc18b95.3b11.4b12.2b. b..b...bcccbccbbb7.8b95.b48.5b. TIS-620 8bcccbcc18b95.b.4b.11b7.8b. 8bcccbcc18b95.bb125.bb 8bcccbcc12bc5b95.b. 8bcccbcc12bc5b95.b24.b. 8bcccbcc12bc5b95.b.b11.b.2b12.b. 8bcccbcc12bc5b95.b.b8.b.5b9.b.4b. 5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b. 4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.b LESSHISTFILE .lesshst LESSHISTSIZE "%s
LESSSEPARATOR .less-history-file: .search .shell Non-match First-file EOF-ignore Keep-pos Regex-off &/ (P) Pattern not found !done |done less %s (N-th) [Press 'h' for instructions.] There is no --%s option There is no %s option Command not available Examine: Cannot edit standard input WARNING: This file was viewed via LESSOPEN No next file No %snext file No previous file No %sprevious file No next tag No previous tag No such file goto mark: |mark: Brackets: Warning: some commands disabled Warning: some edit commands disabled Warning: environment variables from lesskey file unavailable Cannot use lesskey file "%s" /usr/bin/.sysless LESSKEY_SYSTEM /etc/sysless LESSKEY .less Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s" @/\less/\empty/\file/\@ "%s" may be a binary file. See it anyway? Missing filename ("less --help" for help) LESSMETACHARS ; *?
'"()<>[]|&^`#\$%=~ LESSMETAESCAPE %c%s%c lessecho LESSECHO %s -p0x%x -d0x%x -e%s -n0x%x %s* Invalid LESSOPEN variable LESSCLOSE Invalid LESSCLOSE variable ...skipping...
Cannot seek to that file position Cannot seek to beginning of file Cannot seek to line number %n Cannot seek to end of file Determining length of file Don't know length of file LESSANSIENDCHARS LESSANSIMIDCHARS 0123456789;[?!"'#%()*+ [m Line numbers turned off Calculating line numbers (press RETURN) Cannot seek to start position Invalid mark letter Mark not set Mark not in current file log file support is not available Input is not a pipe Log file is already in use No log file Log file "%s" j Invalid line fraction Invalid line number Position target at screen line %d .%06d Position target at screen position %s Invalid column fraction Invalid column number Horizontal shift %d columns Horizontal shift %s of screen width tags support is not available Tags file "%s" less POSIX regular expressions)
Copyright (C) 1984-2012 Mark Nudelman
less comes with NO WARRANTY, to the extent permitted by law.
For information about the terms of redistribution,
see the file named README in the less distribution.
Homepage: http://www.greenwoodsoftware.com/less
Tab stops and then every %d spaces -" must be followed by 1 or 2 chars quotes %s Use "h" for help Value is required after %s --%s -%c (--%s) Number is required after %s The %s option should not be followed by = %s is an ambiguous abbreviation ("less --help" for help) There is no %s option ("less --help" for help) No such option Cannot change the %s option Cannot query the %s option Cannot use "-+" or "--" for a string option Can't use "-!" for a numeric option Negative option is invalid LESS_IS_MORE Search includes displayed screen Search skips displayed screen Search includes all of displayed screen Max buffer space per file (K): Max buffer space per file: %dK Don't automatically allocate buffers Automatically allocate buffers when needed Repaint by scrolling from bottom of screen Repaint by painting from top of screen Be less helpful in prompts Be helpful in prompts Assume intelligent terminal Assume dumb terminal Don't quit at end-of-file Quit at end-of-file Quit immediately at end-of-file Open only regular files Open even non-regular files Don't quit if end-of-file on first screen Quit if end-of-file on first screen Don't highlight search matches Highlight matches for previous search only Highlight all matches for previous search pattern Backwards scroll limit: Backwards scroll limit is %d lines Case is significant in searches Ignore case in searches Ignore case in searches and in patterns Target line: 0123456789.- Don't display a status column Display a status column Interrupt (ctrl-C) returns to prompt Interrupt (ctrl-C) exits less Don't use the LESSOPEN filter Use the LESSOPEN filter Short prompt Medium prompt Long prompt Don't use line numbers Use line numbers Constantly display line numbers log file: Log file: prompt: Ring the bell for errors AND at eof/bof Ring the bell for errors but not at eof/bof Never ring the bell Display control characters as ^X Display control characters directly Display control characters directly, processing ANSI sequences Display all blank lines Squeeze multiple blank lines Fold long lines Chop long lines tag: tags file: Display underlined text in underline mode Backspaces cause overstrike Print backspace as ^H Don't highlight first unread line Highlight first unread line after forward-screen Highlight first unread line after any forward movement Tab stops: 0123456789, Send init/deinit strings to terminal Don't use init/deinit strings Forward scroll limit: Forward scroll limit is %d lines Scroll window size: Scroll window size is %d lines quotes: Don't show tildes after end of file Show tildes after end of file Horizontal shift: 0123456789. Use keypad mode Don't use keypad mode Use new bottom of screen behavior Use old bottom of screen behavior F command follows file descriptor F command follows file name Use backslash escaping in command line parameters Don't use backslash escaping in command line parameters use-backslash follow-name old-bot no-keypad tilde quotes window max-forw-scroll no-init hilite-unread underline-special tag-file chop-long-lines squeeze-blank-lines raw-control-chars quiet silent LOG-FILE log-file line-numbers long-prompt no-lessopen quit-on-intr lesskey-file status-column jump-target ignore-case max-back-scroll hilite-search quit-if-one-screen quit-at-eof clear-screen auto-buffers search-skip-screen Invalid pattern No previous regular expression Please re-enter search pattern Nothing to search tags LESSGLOBALTAGS %s -x%s %s GTAGS GRTAGS GSYMS GPATH No tags file No such tag in tags file unknown tag type Tag not found \
%lu: %s: \ can not be used as a string delimiter %lu: %s: newline can not be used as a string delimiter %lu: %s: unbalanced brackets ([]) %lu: %s: whitespace after %s %lu: %s: RE error: %s %lu: %s: unterminated regular expression %lu: %s: expected context address %lu: %s: undefined label '%s' %lu: %s: unexpected EOF (pending }'s) 0123456789/\$ %lu: %s: command expected %lu: %s: command %c expects up to %d address(es), found %d %lu: %s: unexpected } %lu: %s: extra characters at the end of %c command %lu: %s: command %c expects \ followed by text %lu: %s: extra characters after \ at the end of %c command %lu: %s: filename expected w command read command branch %lu: %s: empty label %lu: %s: duplicate label '%s' %lu: %s: substitute pattern can not be delimited by newline or backslash %lu: %s: unterminated substitute pattern %lu: %s: \%c not defined in the RE %lu: %s: unescaped newline inside substitute pattern %lu: %s: unterminated substitute in regular expression %lu: %s: more than one number or 'g' in substitute flags %lu: %s: overflow in the 'N' substitute flag %lu: %s: no wfile specified %lu: %s: bad flag in substitute command: '%c' %lu: %s: transform pattern can not be delimited by newline or backslash %lu: %s: unterminated transform source string %lu: %s: unterminated transform target string %lu: %s: transform strings are not the same length %lu: %s: extra text at the end of a transform command %lu: %s: invalid command code %c %lu: %s: unused label '%s' setting line buffered output failed setting unbuffered output failed Usage: %s [-aElnru] command [file ...]
%s [-aElnru] [-e command] [-f command_file] [-I[extension]]
[-i[extension]] [file ...]
EI::ae:f:i::lnru ..." -I or -i may not be used with stdin rename() fclose() %s: %s %s in-place editing only works for regular files %s/.!%ld!%s malloc(%zu) realloc(%zu) calloc(%zu, %zu) first RE may not be empty \%c \%03o %lu: %s: \%u not defined in the RE \abfrtv
disconnecting... unknown ACU type can't open phone number file unrecognizable host name missing phone number
call aborted hayes
timeout error (%s)
[sh]
!
can't execl can't fork can't create %s
[cd] %s: bad directory
%s
[EOT]
%d %s%c
%d
write error
lines transferred in Local command? can't establish pipe
can't fork!
List command for remote system? can't execl!
chars transferred in
timed out at eol
can't find `%s'
away for [set] ~{[*?$`'"\ echo %s "Echo" failed
"%s": No match
Buffer overflow expanding "%s"
Local file name?
%s: cannot create
[take] usage: from [to]
cat %s;echo %s: cannot open
[put] usage: from [to]
cat>%s
stty -echo;cat>%s;stty echo
second minute hour receive file from remote host send file to remote host take file from remote UNIX put file to remote UNIX pipe remote file pipe local command to remote host connect program to remote host change directory exit from tip suspend tip (local+remote) suspend tip (local only) set variable get this summary send break Usage: cu [options] [phone-number|"dir"]
Use cu --help for help
BSD tip/cu
Usage: cu [options] [phone-number|"dir"]
-E,--escape char: Use this escape character
-F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control
-f: Use no flow control
--nostop: Do not use software flow control
-a, -p,--port port: Use this port as ACU/Dialer
-c,--phone number: Call this number
-h,--halfduplex: Echo characters locally (use "half duplex")
-e: Use even parity
-o: Use odd parity
-P,--parity {even,odd,none}: use even, odd, no parity
-l,--line line: Use this device (ttyXX)
-s,--speed,--baud speed,-#: Use this speed
-t: Connect via hard-wired connection
only one escape character allowed bad flow setting even bad parity setting more than one line specified more than one parity specified E:F:P:a:p:c:l:s:hefot0123456789 more than one phone number specified cu%d all ports busy link down unsupported speed %ld Connect failed escape phone halfduplex nostop HOST no host specified REMOTE /etc/remote unknown host %s can't open host description file possible reference loop in host description file du %s: missing device spec
%s: missing phone number
tb pr dl dv cu pn di usage: %s [-v] [-speed] system-name
%s [-v] [-speed] phone-number
n
r t fEb %c
%2s %-2s %c %s
Lost carrier. %s: unknown parity value
Connected
connected
%s: must be interactive
%s, unknown option v0123456789 phone number too long (max = %d bytes) tip%d link down
PHONES bad baud rate %d %s
[EOT]
can't clear O_NONBLOCK access denied
out of core
%s=%-5d n
r
t bf record %s: unknown variable
%s/.tiprc set %s beautify baudrate ba dialtimeout dial eofread eofr eofwrite eofw exceptions framesize phones raise raisechar rec script tabexpand verb echocheck linedelay ldelay chardelay cdelay etimeout rawftp hdx localecho hardwareflow AT
Cannot synchronize with hayes...
timeout waiting for reply
ATH0
03 cannot hang up modem
please use 'tip dialer' to make sure the line is hung up
ATv1
dialing... ATv0
ATTD 01234 RING NO CARRIER ERROR in input CONNECT 1200 Unknown Modem error: %c (0x%x) Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command]
no such group `%s' G:g:u: no such user `%s' too many supplementary groups provided setgroups setgid -i ] \ + w 4c + 9\ B\ 6+ O\ | X+ W\ | \+ c\ l\ ,+ {\ \ ++ \ \ 8+ \ \ 5+ \ g *+ \ | H+ \ | G+ \ | + \ ] 8+ ] + ] ] |+ (] | + 2] o + ;] ] 7+ E] V] + b] o] h+ t] }] p+ ] l\ <+ ] ] ;+ ] ] 7+ ] g :+ ] | X+ ] | W+ ] l\ + ] | + ^ ^ p+ ^ g + ,^ | + 8^ | + 0` of ,` f u ;c Ec Oc Xc _c nc uc {c [ c c c Ԏ c c c 4H c c c c c c c c #A c hw.disknames 2I чHo ZI чHRm I чHq =rGy=iG}$k 3Dh&-k SFH 0eCr
SFU 0eC쬭c - чH k I чH#A - чH1k
(s* K >;5k
Hah!IdontNeedEFI
!"#$%&
X 8I6 Y HD6 [ ԉ6 \ TI6 /bin/ksh /bin/csh mdnsd+nsswitch No aes-cbc 3des-cbc blowfish-cbc encblkno1 encblkno8 pkcs5_pbkdf2/sha1 pkcs5_pbkdf2 storedkey urandomkey shell_cmd re-enter Additional packages /sbin/halt -q /sbin/reboot -q %c: <: page up, >: page down %-25s %.50s Could not initialize menu system, please check your terminal type.
Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s"
Screen too narrow (%d + %d > %d) for menu "%s"
Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s"
Help: exit: x, page up: u <, page down: d > Exit Zeroconf run mdnsd only run mdnsd and resolve local names do not run mdnsd google-public-dns-a.google.com (IPv4) google-public-dns-b.google.com (IPv4) google-public-dns-a.google.com (IPv6) google-public-dns-b.google.com (IPv6) 512 1024 2048 4096 8192 16384 32768 FFSv1 [ MSGTXTS msg_prompt_win: newwin(%d, %d, %d, %d) failed
usage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg]
Installation messages in English en_US.ISO8859-1 Yes Some None On Off unchanged Delete? reinstall sets for upgrade NetBSD/zaurus 7.0.2
This menu-driven tool is designed to help you install NetBSD to a hard
disk, or upgrade an existing NetBSD system, with a minimum of work.
In the following menus type the reference letter (a, b, c, ...) to
select an item, or type CTRL+N/CTRL+P to select the next/previous item.
The arrow keys and Page-up/Page-down may also work.
Activate the current selection from the menu by typing the enter key.
Thank you for using NetBSD!
You have chosen to install NetBSD on your hard disk. This will change
information on your hard disk. You should have made a full backup
before this procedure! This procedure will do the following things:
a) Partition your disk
b) Create new BSD file systems
c) Load and install distribution sets
d) Some initial system configuration
(After you enter the partition information but before your disk is
changed, you will have the opportunity to quit this procedure.)
Shall we continue?
Ok, let's upgrade NetBSD on your hard disk. As always, this will
change information on your hard disk. You should have made a full backup
before this procedure! Do you really want to upgrade NetBSD?
(This is your last warning before this procedure starts modifying your
disks.)
Ok, let's unpack the NetBSD distribution sets to a bootable hard disk.
This procedure just fetches and unpacks sets onto a pre-partitioned
bootable disk. It does not label disks, upgrade bootblocks, or save
any existing configuration info. (Quit and choose `install' or
`upgrade' if you want those options.) You should have already done an
`install' or `upgrade' before starting this procedure!
Do you really want to reinstall NetBSD distribution sets?
(This is your last warning before this procedure starts modifying your
disks.)
Mounting %s failed. Continue?
I can not find any hard disks for use by NetBSD. You will be
returned to the original menu.
I found only one disk, %s.
Therefore I assume you want to %s NetBSD on it.
On which disk do you want to %s NetBSD? Available disks average file size (bytes) mount point (or 'none') sec MB NetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk
into multiple BSD partitions. You must now set up your BSD disklabel.
You can use a simple editor to set the sizes of the NetBSD partitions,
or keep the existing partition sizes and contents.
You will then be given the opportunity to change any of the disklabel
fields.
The NetBSD part of your disk is %d Megabytes.
A full installation requires at least %d Megabytes without X and
at least %d Megabytes if the X sets are included.
Choosing megabytes will give partition sizes close to your choice,
but aligned to cylinder boundaries. Choosing sectors will allow you
to more accurately specify the sizes. On most disks, there is little
to gain from cylinder alignment. On very old disks, it is most efficient
to choose partition sizes that are exact multiples of your actual
cylinder size.
Choose your size specifier You can now change the sizes for the system partitions. The default is
to allocate all the space to the root file system. However, you may wish
to have separate /usr (additional system files), /var (log files etc)
or /home (users' home directories) file systems.
Free space will be added to the partition marked with a '+'.
MB Cylinders Sectors Filesystem
Mount point? Size for %s in %s? Change input units (sectors/cylinders/MB) NetBSD partition Whole disk Boot partition Add a user defined partition Accept partition sizes. Free space %d %s, %d free partitions. Reduce partition sizes by %d %s (%u sectors). The start value you specified is beyond the end of the disk.
With this value, the partition end is beyond the end of the disk.
Your partition size has been truncated to %d %s.
Type enter to continue
This disk is too large for a disklabel partition table to be used
and hence cannot be used as a bootable disk or to hold the root
partition.
We now have your BSD disklabel partitions as:
This is your last chance to change them.
Start %3s End %3s Size %3s FS type Newfs Mount Mount point
--------- --------- --------- ---------- ----- ----- -----------
%9lu %9lu %9lu %-10s %-5s %-5s %s Show all unused partitions Partition sizes ok The current values for partition `%c' are,
Select the field you wish to change:
MB cylinders sectors
------- --------- ---------
FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9s Toggle Restore original values Select the type other types %s
Special values that can be entered for the size value:
-1: use until the end of the NetBSD part of the disk
a-%c: end this partition where partition X starts
size (%s) %s
Special values that can be entered for the offset value:
-1: start at the beginning of the NetBSD part of the disk
a-%c: start at the end of previous partition (a, b, ..., %c)
start (%s) Badly formed sector number
Select file system block size Select file system fragment size Please enter a name for your NetBSD disk Ok, we are now ready to install NetBSD on your hard disk (%s). Nothing has been
written yet. This is your last chance to quit this process before anything
gets changed.
Shall we continue?
Ok, the first part of the procedure is finished. Sysinst has
written a disklabel to the target disk, and newfs'ed and fsck'ed
the new partitions you specified for the target disk.
Ok, the first part of the procedure is finished. Sysinst has
written a disklabel to the target disk, and fsck'ed the new
partitions you specified for the target disk.
Could not open %s, error message was: %s.
mount of device /dev/%s%c on %s failed.
The extraction of the selected sets for NetBSD-7.0.2 is complete.
The system is now able to boot from the selected hard disk. To complete
the installation, sysinst will give you the opportunity to configure
some essential things first.
The installation of NetBSD-7.0.2 is now complete. The system
should boot from hard disk. Follow the instructions in the INSTALL
document about final configuration of your system. We also recommend
reading the afterboot(8) manpage; it contains a list of things to be
checked after the first complete boot.
At a minimum, you should edit /etc/rc.conf to match your needs. See
/etc/defaults/rc.conf for the default values.
The upgrade to NetBSD-7.0.2 is now complete. You will
now need to follow the instructions in the INSTALL document as to
what you need to do to get your system reconfigured for your situation.
Remember to (re)read the afterboot(8) manpage as it may contain new
items since your last upgrade.
Unpacking additional release sets of NetBSD-7.0.2 is now complete.
You will now need to follow the instructions in the INSTALL document
to get your system reconfigured for your situation.
The afterboot(8) manpage can also be of some help.
If you unpacked the etc set, you will need to edit /etc/rc.conf to get a
multi-user system. At a minimum, you will need to change rc_configured=NO
to rc_configured=YES.
Your disk is now ready for installing the kernel and the distribution
sets. As noted in your INSTALL notes, you have several options. For
ftp or nfs, you must be connected to a network with access to the proper
machines.
Sets selected %d, processed %d, Next set %s.
The NetBSD distribution is broken into a collection of distribution
sets. There are some basic sets that are needed by all installations
and there are some other sets that are optional. You may choose to install
a core set (Minimal installation), all of them (Full installation), or a custom
group of sets (Custom installation).
The following are the %s site, directory, user, and password that
will be used. If "user" is "ftp", then the password is not needed.
e-mail address Enter the nfs host and server directory where the distribution is located.
Remember, the directory should contain the .tgz files and
must be nfs mountable.
Enter the floppy device to be used and transfer directory on the target
file system. The set files must be in the root directory of the floppies.
Enter the CDROM device to be used and directory on the CDROM where
the distribution is located.
Remember, the directory should contain the .tgz files.
Available CDs Multiple CDs found. Please select the one containing the install CD. The installation sets have not been found at the default location on this
CD. Please check the device and path name. Enter the unmounted local device and directory on that device where
the distribution is located.
Remember, the directory should contain the .tgz files.
Enter the already-mounted local directory where the distribution is located.
Remember, the directory should contain the .tgz files.
I can not find any network interfaces for use by NetBSD. You will be
returned to the previous menu.
The following network interfaces are active: %s
Does one of them connect to the required server? Which network device would you like to use? Available interfaces To be able to use the network, we need answers to the following:
Your DNS domain Your host name Your IPv4 address Server IPv4 address IPv4 Netmask Your name server IPv4 gateway Network media type The following are the values you entered.
DNS Domain: %s
Host Name: %s
Nameserver: %s
Primary Interface: %s
Media type: %s
Host IP: %s
Netmask: %s
IPv4 Gateway: %s
The following are the values you entered. Are they OK?
DNS Domain: %s
Host Name: %s
Nameserver: %s
Primary Interface: %s
Media type: %s
Host IP: %s
Server IP: %s
Netmask: %s
IPv4 Gateway: %s
IPv6 autoconf: %s
Are they OK?
Waiting while network interface comes up.
Could not create /etc/resolv.conf. Install aborted.
Could not change to directory %s: %s. Install aborted.
Delete after install Release set %s does not exist. All selected distribution sets unpacked successfully. There were problems unpacking distribution sets.
Your installation is incomplete.
You selected %d distribution sets. %d sets couldn't be found
and %d were skipped after an error occurred. Of the %d
that were attempted, %d unpacked without errors and %d with errors.
Aborting installation. Please recheck your distribution source
and consider reinstalling sets from the main menu. Your choices have made it impossible to install NetBSD. Install aborted.
The distribution was not successfully loaded. You will need to proceed
by hand. Installation aborted.
The distribution was not successfully loaded. You will need to proceed
by hand. Upgrade aborted.
Unpacking additional sets was not successful. You will need to
proceed by hand, or choose a different source for release sets and try
again.
There is a big problem! Can not create /mnt/etc/fstab. Bailing out!
Help! No /etc/fstab in target disk %s. Aborting upgrade.
Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade.
I cannot save %s/bin/X as %s/bin/X.old, because the
target disk already has an %s/bin/X.old. Please fix this before
continuing.
One way is to start a shell from the Utilities menu, examine the
target %s/bin/X and %s/bin/X.old. If
%s/bin/X.old is from a completed upgrade, you can rm -f
%s/bin/X.old and restart. Or if %s/bin/X.old is from
a recent, incomplete upgrade, you can rm -f %s/bin/X and mv
%s/bin/X.old to %s/bin/X
Aborting upgrade. There was a problem in setting up the network. Either your gateway
or your nameserver was not reachable by a ping. Do you want to
configure your network again? ("No" allows you to continue anyway
or abort the install process.)
Would you like to continue the install process anyway, and assume
that the network is working? ("No" aborts the install process.)
Making device nodes ...
It appears that /dev/%s%c is not a BSD file system or the fsck was
not successful. Try mounting it anyway? (Error number %d.)
target root is missing %s.
The completed new root file system failed a basic sanity check.
Are you sure you installed all the required sets?
Floppy file system type Could not find the file on the floppy.
The floppy was not mounted successfully.
Please load the floppy containing the file named "%s.%s".
If the set has no more disks, select "Set finished" to install the set.
Select "Abort fetch" to return to the install media selection menu.
Is the network information you entered accurate for this machine
in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used.
Distribution set Selected
------------------------ --------
Base Configuration files (/etc) Compiler tools Games Manual pages Miscellaneous Kernel modules Test programs Text processing tools X11 sets X11 base and clients X11 configuration X11 fonts X11 servers X11 programming Source and debug sets Kernel sources Base sources Share sources GNU sources X11 sources Debug symbols X11 debug symbols %-27s %3s Select all the above sets Deselect all the above sets Install selected sets There was an error in extracting the file %s. That means
some files were not extracted correctly and your system will not be
complete.
Continue extracting sets? There must be a single partition marked to be mounted on '/'. partitions %c and %c overlap. No bootcode for specified FS type of root partition Sorry, the root file system can't be FFSv2 due to lack of bootloader support
on this port.
You can either edit the partition table by hand, or give up and return
to the main menu.
Edit the partition table again? Could not open config file %s
Please choose the timezone that fits you best from the list below.
Press RETURN to select an entry.
Press 'x' followed by RETURN to quit the timezone selection.
Default: %s
Selected: %s
Local time: %s %s
Back to main timezone list The disk that you selected has a swap partition that may currently be
in use if your system is low on memory. Because you are going to
repartition this disk, this swap partition will be disabled now. Please
beware that this might lead to out of swap errors. Should you get such
an error, please restart the system and try again. Sysinst failed to deactivate the swap partition on the disk that you
chose for installation. Please reboot and try again. The root password of the newly installed system has not yet been initialized,
and is thus empty. Do you want to set a root password for the system now? You can now select which shell to use for the root user. The default is
/bin/sh, but you may prefer another one.
There is no defined root file system. You need to define at least
one mount point with "/".
Press to continue.
Enter slattach flags
Pick an option to turn on or off. Scripting Logging Status: Command: Finished Command failed Command ended on signal NetBSD-7.0.2 Install System Exit Install System Install NetBSD to hard disk Upgrade NetBSD on a hard disk Re-install sets or install additional sets Reboot the computer Utility menu Config menu Back to main menu NetBSD-7.0.2 Utilities Run /bin/sh Set timezone Configure network Partition a disk Logging functions Halt the system yes or no? Hit enter to continue Choose your installation Set sizes of NetBSD partitions Use existing partition sizes Megabytes Cylinders Sectors Install from FTP HTTP NFS CD-ROM / DVD Floppy Unmounted fs Local directory Select your distribution Full installation Installation without X11 Minimal installation Custom installation ** hidden ** Base directory Binary set directory Source set directory Transfer directory User Password Proxy Get Distribution Continue What do you want to do? Try again Set finished Skip set Skip set group Abandon installation Abort fetch File system Select DNS server other Perform autoconfiguration? Root shell User shell Color scheme White on black Black on white White on blue Green on black Sendmail is no longer in this release of NetBSD, default MTA is
postfix. The file /etc/mailer.conf still chooses the removed
sendmail. Do you want to upgrade /etc/mailer.conf automatically for
postfix? If you choose "No" you will have to update /etc/mailer.conf
yourself to ensure proper email delivery. To use the network interface %s, you must agree to the license in
file %s. To view this file now, you can type ^Z, look at the contents of
the file and then type "fg" to resume. To configure the binary package system, please choose the network location
to fetch packages from. Once your system comes up, you can use 'pkgin'
to install additional packages, or remove packages. Enabling binary packages with pkgin requires setting up the repository.
The following are the host, directory, user, and password that
will be used. If "user" is "ftp", then the password is not needed.
Making backup of rc.conf failed. Continue? rc.conf backup saved to %s. Restoring backup rc.conf failed. Deleting old %s entry failed. Package directory configure a prior installation of password set YES DONE Abandoned ***EMPTY*** Timezone Change root password Enable installation of binary packages Enable sshd Enable ntpd Run ntpdate at boot Enable mdnsd Enable xdm Enable cgd Enable lvm Enable raidframe Add a user Configure the additional items as needed. Finished configuring Install pkgin and update package summary Your system is now configured to use pkgin to install binary packages. To
install a package, run:
pkgin install
from a root shell. Read the pkgin(1) manual page for further information. Fetch and unpack pkgsrc Installing pkgsrc requires unpacking an archive retrieved over the network.
The following are the host, directory, user, and password that
will be used. If "user" is "ftp", then the password is not needed.
pkgsrc directory Fetch and unpack pkgsrc for building from source Network configuration failed. Retry? Quit without installing pkgsrc Quit installing binary pkgs Installation of pkgin failed, possibly because no binary packages
exist. Please check the package path and try again. Operation not supported! Mountpoint or 'raid' or 'cgd' or 'lvm'? Extended partitioning Edit BSD partitions Edit and save MBR Switch to GPT Switch to MBR Set disk name Format as RAID Format as LVM PV Encrypt Bootable flag Safe erase Undo changes Unconfigure Edit Force umount Fill with zeros Fill with random data Fill with crypto data 0 - No parity, only simple striping. 1 - Mirroring. The parity is the mirror. 4 - Striping with parity stored on the last component. 5 - Striping with distributed parity. Remove Add This removes all partitions on the disk. Do you want to continue? Save changes before finishing? Changes cannot be saved. No root partition defined. Cannot continue
Device is blocked. Editing it may cause problems.
Do you want to force unblock it and continue? Do you want to try? Create cryptographic volume (CGD) Create virtual disk image (VND) Create volume group (LVM VG) Create logical volume Create software RAID Update device list Save changes BLOCKED UNCHANGED USED (mounted) (unused) GPT-labeled disk Finish partitioning Limit for the device count was reached! Invalid device! Available disks: Cannot allocate device node! This is the extended partition manager. All disks, partitions, etc. are
listed below. MBR partitions, if desired, must be created before editing
the disklabel. To use RAID, LVM, or CGD: 1) Create BSD partitions with the
appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save
changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM. raid%d (level %1d) on %-34s %11uM EMPTY RAID! Disks: %33s Spares: %32s RAID level: %22d numRow: %22d numCol: %22d numSpare: %22d sectPerSU: %22d SUsPerParityUnit: %22d SUsPerReconUnit: %22d Multi-dimensional arrays are NOT supported! numRow? numCol? numSpare? sectPerSU? SUsPerParityUnit? SUsPerReconUnit? Disks in RAID: PATH NOT DEFINED! vnd%1d on %-51s ASSIGN vnd%1d on %-45s %11uM File path: %29s Assign exist image: %20s Size: %22sM Read-only: %22s Set geometry by hand: %18s Bytes per Sector: %18s Sectors per Track: %18s Tracks per Cylinder: %18s Cylinders: %22s File path? Bytes per Sector? Sectors per Track? Tracks per Cylinder? Cylinders? DISK NOT DEFINED! cgd%1d %-48s %11uM Base device: %24s Encryption: %24s Key size: %24d IV algorithm: %24s Key generation: %24s Verification method: %17s Disks in VG: %-44s %20sM EMPTY VG! PV's: %34s Name: %34s MaxLogicalVolumes: %20s MaxPhysicalVolumes: %20s PhysicalExtentSize: %20s Name? MaxLogicalVolumes? MaxPhysicalVolumes? PhysicalExtentSize (MB)? Logical volume %-35s %11uM Size: %33dM Read-only: %27s Contiguous: %27s LogicalExtentsNumber: %18s Minor number: %26s Mirrors: %27d MirrorLogRegionSize: %18s Persistent minor number: %14s ReadAheadSectors: %18s Stripes: %27s StripeSize: %27s Zeroing of the first KB: %13s LogicalExtentsNumber? Minor number? Mirrors? MirrorLogRegionSize? ReadAheadSectors? Stripes? 8 character username to add Do you wish to add this user to group wheel? Delete partition Installing boot blocks on %s....
We now have your NetBSD partitions on %s as follows (Size and Offset in %s):
Kernel (GENERIC) Kernel (C700) We are now going to install NetBSD on the disk %s.
NetBSD requires a single partition in the disk's MBR partition table,
this is split further by the NetBSD disklabel.
NetBSD can also access file systems in other MBR partitions.
If you select 'Use the entire disk' then the previous contents of the
disk will be overwritten and a single MBR partition used to cover the
entire disk.
If you want to install more than one operating system then edit the
MBR partition table and create a partition for NetBSD.
A few hundred MB is enough for a basic installation, but you should allow
extra for additional software and user files.
Allow at least 5GB if you want to build NetBSD itself.
Which would you like to do? Edit the MBR partition table Use the entire disk Total disk size %lu %s.
Start(%3s) Size(%3s) Flg Kind
---------- ---------- --- ----------------
%10d %10d %c%c%c You have not marked a partition active. This may cause your system to not
start up properly. Should the NetBSD partition of the disk be marked active?
You will be prompted for the geometry.
Please enter the number of sectors per track (maximum 63)
and number of heads (maximum 256) that the BIOS uses to access the disk.
The number of cylinders will be calculated from the disk size.
Sysinst could not automatically determine the BIOS geometry of the disk.
The physical geometry is %d cylinders %d sectors %d heads
Using the information already on the disk, my best guess for the BIOS
geometry is %d cylinders %d sectors %d heads
real geom: %d cyl, %d heads, %d sec (NB: for comparison only)
BIOS geom: %d cyl, %d heads, %d sec
Your disk currently has a non-NetBSD partition. Do you really want to
overwrite that partition with NetBSD?
Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s %ssize (maximum %d %s) Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s)
%s%sStart (in %s) Partition kind (0..255) There can only be one extended partition The Current MBR partition table is shown below.
Flgs: a => Active partition,
I => Install here.
Select the partition you wish to change:
Partition table OK Don't change Other, input number
Do you want to re-edit the MBR table (or abandon the installation)?
There is no NetBSD partition in the MBR partition table. There are multiple NetBSD partitions in the MBR partition table.
You should set the 'install' flag on the one you want to use. Setting up the DOS partition table ...
Rewrite of MBR failed. I can't continue. Log ended at: %s
# Script ended at: %s
sysinst terminated.
/usr/share/sysinst/catalog/ /usr/share/sysinst/catalog sysinstmsgs. sysinst: environment variable TERM not set.
%u:%u Dr:f:C:p sysinst: screen too small
xfer dir /usr/INSTALL ext dir ext src dir ftp host ftp.NetBSD.org ftp dir pub/NetBSD/NetBSD-7.0.2 ftp prefix /zaurus/binary/sets ftp src prefix /source/sets ftp user ftp pass ftp proxy nfs host nfs dir /bsd/release cd dev fd dev /dev/fd0a local dev local fs local dir targetroot mount /targetroot dist postfix .tgz diskname mydisk pkg host pkg dir pub/pkgsrc/packages/NetBSD pkg prefix /zaurus/7.0.2/All pkg user pkg pass pkg proxy pkgsrc host pkgsrc dir pkgsrc prefix pub/pkgsrc/stable pkgsrc user pkgsrc pass pkgsrc proxy /bin/X .old /usr/X11R6 /usr/X11R7 /tmp/sysinst.sh #!/bin/sh
# Script started at: %s
script file ------------------------------ sysinst: failed to allocate output window.
openpty() failed fork() failed executing: %s
&& chroot(%s) for %s execvp %s select select failure: %s
select(2) failed but no child died? /tmp/sysinst.log Log started at: %s
could not open /tmp/sysinst.log: %s
Dynamic menu creation failed.
vasprintf(&scmd, "%s", ...) realloc(argv) for %s :% %.*s%s %%%02X ipw iwi /sbin/ifconfig -l 2>/dev/null Aborting: Could not run ifconfig.
Could not run ifconfig. hw.%s.accept_eula %s=1 manual /sbin/ifconfig %s media %s /sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done /sbin/dhcpcd %s -d -n %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; done cat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; done cat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; done cat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done 0xff000000 0xffff0000 0xffffff00 /sbin/ifconfig lo0 127.0.0.1 /etc/resolv.conf cat </etc/resolv.conf
;
; BIND data file
; %s %s;
Created by NetBSD sysinst on search %s
nameserver %s
EOF
/sbin/ifconfig %s inet %s %s up -s 115200 -l /dev/tty00 /sbin/slattach /sbin/ifconfig %s inet %s netmask %s /sbin/ifconfig %s inet %s /sbin/route -n flush -inet /sbin/route -n add default %s /sbin/ping -v -c 5 -w 5 -o -n %s -_.+!, -_.+!,/ %s://%s%s/%s -a /usr/bin/ftp %s%s/%s%s /sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2 /mnt2/%s hostname hostname=%s
/etc/ifconfig.%s cat <>%s%s
%s netmask %s media %s
%s netmask %s
/etc/hosts cat <>%s/etc/hosts
#
# Added by NetBSD sysinst
127.0.0.1 localhost.%s
%s defaultroute defaultroute="%s"
dhcpcd=YES
dhcpcd_flags="-qM %s"
/libdata/firmware/if_iwi/LICENSE.ipw2200-fw /libdata/firmware/if_ipw/LICENSE eon gre ipip gif faith lo lo0 nsip ppp tun %s -p -b 16 -c 4 /dev/r%s%c %s -p -c 3 /dev/r%s%c /sbin/fsck_%s %s -p -q /dev/r%s%c %s -f /tmp/disktab %s '%s' disklabel -w -r -i /sbin/newfs %s%.0d -tffs -o async /sbin/newfs -V2 -O %d -b %d -f %d%s%.0d -tffs -o log /sbin/newfs_lfs -b %d -tlfs -tmsdos %s /dev/r%s /mnt ,dp ,log ,noauto ,async ,noatime ,nodev ,nodevmtime ,noexec ,nosuid /etc cat <%s/etc/fstab
Making %s/etc/fstab (%s).
Failed to make /etc/fstab!
# NetBSD %s/etc/fstab
# See /usr/share/examples/fstab/ for more examples.
/dev/%s none swap sw%s 0 0
%s/dev/%s %s %s rw%s%s%s%s%s%s%s%s %d %d
/dev/%s%c /tmp mfs rw,-s=%lli
swap /tmp mfs rw,-s=%lli
kernfs /kern kernfs rw
ptyfs /dev/pts ptyfs rw
procfs /proc procfs rw
/dev/%s /cdrom cd9660 ro,noauto
hw.usermem64 %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25
/kern /proc /dev/pts /cdrom /var/shm /dev/%s%c dkctl %s delwedge %s gpt show -u %s 2>/dev/null Pritable Sectable :no_mbr %s (%s, %s) %s (%s, %s %s) sh -c 'gpt show %s |grep -e Pri\ GPT\ table' Cannot process disk %s: too big size (%d)
/dev/%s %s ffs %s /dev/%s %s ufs %s cd0a raid windows, hfs efi bios /sbin/mount -rt cd9660 /dev/%s /mnt2 /bin/sh MAKEDEV all vasprintf(&spatterns, "%s", ...) sed -an -e '%s;H;$!d;g;w %s' %s /sbin/mount -rt %s /dev/%s /mnt2 %s/%s/%s /sbin/umount /mnt2 /sbin/mount -r -t %s %s /mnt2 sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s' /dev/rcd%d%c CD001 /etc/localtime UTC zoneinfo /etc/rc.conf cat <>%s/etc/rc.conf
/etc/sysctl.conf cat <>%s/etc/sysctl.conf
s/^rc_configured=NO/rc_configured=YES/ /.sysinst /usr rm -rf usr/X11R7/lib/X11/xkb/symbols/pc progress -zf %s tar --chroot -xhepf - rm %s fsck_lfs mount_lfs newfs_lfs preposterous clock time
Can't convert to localtime 0x%jx (%s)
/usr/share/zoneinfo/
Please consult the install documents. /usr/share/zoneinfo/%s mkdir -m 755 /mnt2
/usr/sbin/postinstall -s /.sysinst -d / check mailerconf /usr/sbin/postinstall -s /.sysinst -d / fix mailerconf /usr/sbin/postinstall -s /.sysinst -d / fix /etc/rc.d/random_seed start /var random_file=/etc/entropy-file
/boot.cfg sh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp' /tmp/boot.cfg.tmp /etc/rc.d/random_seed stop /etc/rc.conf.tmp.XXXXXX /etc/rc.conf.bak.XXXXXX /netbsd /sbin/init /etc/rc /etc/rc.subr /sbin/fsck /sbin/fsck_ffs /sbin/mount /sbin/mount_ffs kern-GENERIC kern-C700 games tests xbase xcomp xetc xfont xserver syssrc sharesrc gnusrc xsrc xdebug - async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %s cd to %s
cd %s
/bin/cp %s %s mv %s %s cp -p %s %s /sbin/mount %s %s %s%s /sbin/umount %s%s if [ $? != 0 ]; then echo "%s does not exist!"; fi
/dev/r%sa NetBSD60 /usr/sbin/useradd -m -s %s -G wheel %s /usr/sbin/useradd -m -s %s %s passwd -l %s s,^%s$,%s=%s, adding %s=%s
replacement pattern is %s
pkg_add %s/pkgin s,^[^#].*$,%s, /usr/pkg/etc/pkgin/repositories.conf /usr/pkg/bin/pkgin -y update /usr/pkg/bin/pkgin -y install %s %-50s %-10s chpass -s %s root passwd -l root source for 3rd-party packages chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwd getent passwd root | cut -d: -f2 chroot %s getent passwd root | chroot %s cut -d: -f2 buf %s strlen(buf) %zu
XXX Help String ntpdate /tmp/checkrc.sh Could not open %s for writing #!/bin/sh
. /etc/defaults/rc.conf
. /etc/rc.subr
#!/bin/sh
. /etc/rc.conf
. /etc/rc.subr
if checkyesno %s
then
echo YES
else
echo NO
fi
chroot %s /bin/sh %s 2>&1 var %s is %s
%dM lvm pvremove -ffy /dev/r%s lvm pvcreate -ffy /dev/r%s %s -l %d %s -p %d %s -s %d lvm vgcreate %s %s %s %s -C %c %s -M %c %s -p %s %s -Z %c %s -n %s %s -l %s %s --minor %d %s -m %d %s -R %d %s -r %d %s -i %d %s -I %d %s -L %uM lvm lvcreate %s %s Partman device: %s
lvol%.2d vg%.2d gpt remove -a %s -t %s gpt add -i %u -b %u -s %u %s %s Cannot create GPT partition #%d on %s
dkctl %s addwedge HACK%d %d %d unused dkctl %s listwedges dkctl %s addwedge dk%d %u %u %s %s (%s) Cannot create wedge dk%d for %s.
dkctl %s delwedge dk%d /tmp/%s%c /sbin/mount %s /dev/%s%c %s mkdir -p %s dd if=/dev/zero of=%s bs=1m count=%d progress=100 msgfmt=human vnconfig %s vnd%d %s %d %d %d %d vnconfig %s vnd%d %s lvm pv %-33.32s %-22.21s %12.12s dk%d: %s %-30.29s %-22.21s %11uM %s%c: %s %s %-33.32s %-22.21s %11uM (%s-%d) on %s VG '%s' on %d/%u gpt create -f %s gpt destroy %s partman Special disk %s preparing error
Disk %s preparing error
/tmp/raid.%d.conf Could not open %s for writing
cat <%s
START array
%d %d %d
START disks
/dev/%s
START spare
START layout
%d %d %d %d
START queue
fifo 100
raidctl -C %s raid%d raidctl -I %d raid%d raidctl -vi raid%d raidctl -v -A yes raid%d RAIDframe configuring error #%d
cgdconfig -g -i %s -k %s -o /tmp/cgd.%d.conf %s %d cgdconfig -V re-enter cgd%d /dev/%s /tmp/cgd.%d.conf CGD configuring error #%d
LVM configuring error #%d
VND configuring error #%d
%s (%s, %s-%d) %s (lvl %d, %d disks, %d spare) dd of=/dev/%s if=/dev/zero bs=1m progress=100 msgfmt=human dd of=/dev/%s if=/dev/urandom bs=1m progress=100 msgfmt=human sh -c 'cgdconfig -s cgd0 /dev/%s aes-cbc 128 < /dev/urandom' dd of=/dev/rcgd0d if=/dev/urandom bs=1m progress=100 msgfmt=human cgdconfig -u cgd0 umount -f /dev/%s cgdconfig -u %s vnconfig -u %s raidctl -u %s dk eject -t disk /dev/%sd raidctl vnconfig cgdconfig gpt dkctl -t null raidctl -v -A root %s Error writting RAID bootsector to %s
gpt biosboot -i %d %s Error writting GPT bootsector to %s
Error writting bootsector to %s
dkctl %s makewedges %s.
%s can't delete extended main-extended mixup User answered no to destroy other data, aborting.
Unknown (%d) %*s %*s (%s) Extended partition, LBA FreeBSD/386BSD Linux swap DOS FAT16, <32M DOS FAT16, >32M Windows FAT16, LBA Windows FAT32 Windows FAT32, LBA NTFS volume set PReP Boot Unknown (%lli) %6lli%8s%10lli%10lli %c %s %lli%s dlsize=%lld ptsize=%lld ptstart=%lld
disk %c /tmp/disktab.%s Creating disklabel %s in %s
cat <>/etc/disktab
%s|NetBSD installation generated:\
:dt=%s:ty=winchester:\
:nc#%d:nt#%d:ns#%d:\
:sc#%d:su#%u:\
:se#%d:%s\
nparts limited to %d.
:p%c#%u:o%c#%u:t%c=%s: b%c#%u:f%c#%u: sh -c 'cat /tmp/disktab.* >/tmp/disktab' *************************************************************************************************************************************************************************************************************************************** | $ ( , 0 4 8 usage: %s [-ez] [-b buffersize] [-f file] [-l length]
%*.s [-p prefix] cmd [args...]
input size b:ef:l:p:z gzip -l %s reading compressed file length closing compressed file length pipe gzip pipe fork for gzip exec()ing gzip malloc for buffersize fork for output pipe could not exec %s writing %u bytes to output pipe ] f M U m} -%u usage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count]
[-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr]
[-s packetsize] [-h hoplimit] [-g gateway] [hops...] host
sendmsg ping6: wrote %s %d chars, ret=%d
nxt %u, len %u (%lu bytes)
Jumbo Payload Opt: Length %u
Router Alert Opt: Type %u
Received Opt %u len %lu
--- %s ping6 statistics ---
%ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms
IP6 Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x
%s-> HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d
ESP TCP: from port %u, to port %u (decimal)
UDP: from port %u, to port %u (decimal)
Unknown Header(%d)
invalid socket buffer size illegal number of packets -- %s Must be superuser to flood ping illegal hoplimit %s illegal hoplimit -- %s illegal timing interval %s %s: only root may use interval < 1s too small interval, raised to 0.01 Must be superuser to preload illegal preload value -- %s patterns must be specified as hex digits -R is not supported in this configuration invalid source address: %s illegal datalen value -- %s datalen value too large, maximum is %d a:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW too many intermediate hops ff02::2:0000:0000 getaddrinfo failed getaddrinfo for the gateway %s: %s gateway resolves to multiple addresses setsockopt(IPV6_NEXTHOP) setsockopt(IPV6_RECVHOPOPTS) setsockopt(IPV6_RECVDSTOPTS) -f and -i incompatible options Unable to allocate packet IPV6_MULTICAST_HOPS setsockopt(IPV6_USE_MIN_MTU) setsockopt(IPV6_RECVPATHMTU) setsockopt(ICMP6_FILTER) setsockopt(IPV6_RECVRTHDR) can't allocate enough memory %s: invalid interface name can't initialize rthdr bad addr family of an intermediate addr can't add an intermediate node UDP socket UDP setsockopt(IPV6_PKTINFO) UDP setsockopt(IPV6_UNICAST_HOPS) UDP setsockopt(IPV6_MULTICAST_HOPS) UDP setsockopt(IPV6_RTHDR) UDP connect getsockname you need -b to increase socket buffer size setsockopt(SO_SNDBUF) setsockopt(SO_RCVBUF) setsockopt(IPV6_RECVPKTINFO) setsockopt(IPV6_RECVHOPLIMIT) PING6(%lu=40+8+%lu bytes) %s --> recvmsg path MTU for %s is notified. (ignored)
new path MTU (%d) is notified
invalid peername packet too short (%d bytes) from %s failed to get receiving hop limit failed to get receiving packet information %d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms (DUP!)
wrong data byte #%d should be 0x%x but was 0x%x refused, type 0x%x unknown, type 0x%x unknown code 0x%x, type 0x%x NodeInfo NOOP NodeInfo Supported Qtypes , compressed bitmap , raw bitmap refused unknown qtype no address %s (TTL=infty) (TTL=%u) TTL=%d:meaningless TTL=%d:invalid TTL=%d 03 draft no name invalid namelen:%d/%lu No Route to Destination Destination Administratively Unreachable Destination Unreachable Beyond Scope Destination Unreachable, Bad Code: %d
Packet too big mtu = %d
Time to live exceeded Time exceeded, Bad Code: %d
Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x
Echo Request Echo Reply Listener Query Listener Report Listener Done Router Advertisement Neighbor Solicitation Neighbor Advertisement Redirect Destination: %s New Target: %s Node Information Query Supported qtypes DNS name IPv4 nodeaddr , subject=%s(%s) , oldfqdn , no subject , subject=%s DNS label (invalid) , invalid Node Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left
[%d]
[%d]%s
Success Refused IPv6 address rtsol_timer_update ifconfig make_packet main rtsol_check_timer sockopen sendpacket rtsol_input interface_up get_llflag interface_status lladdropt_fill " ) probe_init defrouter_probe sendprobe rtsock_input_ifannounce rtsock_input -1Ddfm Dd Usage: %s [%s] interface ...
%s [%s] -a
<%s> %s illegal interface state(%d) on %s stop timer for %s set timer for %s to %d:%d failed to get link layer information for %s interface %s was already configured memory allocation failed link-layer address option has null length on %s. Treat as not included. memory allocation failed for %s multiple interfaces found probing %s adD adDfm1 kernel is configured not to accept RAs kernel is configured as a router, not a host failed to open a socket failed to initilizatoin interfaces failed to initialize %s failed to setup for probing routers failed to open a pid log file: %s timer expiration on %s, state = %d %s status is changed from %d to %d No answer after sending %d RSs there is no timer New timer is %ld:%08ld poll: %s malloc for receive msghdr failed malloc for send msghdr failed ff02::2 inet_pton failed for %s IPV6_RECVPKTINFO: %s IPV6_RECVHOPLIMIT: %s setsockopt(ICMP6_FILTER): %s send RS on %s, whose state is %d sendmsg on %s: %s recvmsg: %s failed to get receiving interface packet size(%zd) is too short invalid icmp type(%d) from %s on %s invalid icmp code(%d) from %s on %s invalid RA with hop limit(%d) from %s on %s invalid RA with non link-local source from %s on %s received RA from %s on an unexpected IF(%s) received RA from %s on %s, state is %d ioctl(SIOCGIFFLAGS): %s ioctl(SIOCSIFFLAGS): %s checking if %s is ready... socket(SOCK_DGRAM): %s getifaddrs: %s ioctl(SIOCGIFAFLAG_IN6): %s get_llflag() failed, anyway I'll try %s is ready %s is tentative %s is duplicated ioctl(SIOCGIFFLAGS) on %s: %s ioctl(SIOCGIFMEDIA) on %s: %s unsupported link type(%d) shutdown: %s ioctl(SIOCGDRLST_IN6): %s default router list contains a non-link-local address(%s) probe a router %s on %s interface %s inserted interface %s removed bring interface %s to DOWN state rtmsg type %d, len=%lu rtmsg type %d too short! setvar control_handle_data control_writeone configure_interface1 dhcpcd_selectprofile reconf_reboot dhcpcd_handleinterface dhcpcd_handlehwaddr Copyright (c) 2006-2015 Roy Marples main
duid_init eloop_event_add eloop_q_timeout_add_tv eloop_timeout_add_now if_discover splitv add_environ parse_option b c Rp d e { f g me h i ] k l m n % o p q w r ɻ s t л u ڻ v w x z [ y A B C { D E F G & H 0 I o J 9 K @ L 2 M I O R Q ?Q S 9 T Z U d V n W x X Z | ~ } ż Ѽ ܼ 4 6
" 7 ] h ø & ʿ . 6 @ M W h f A m u %" read_config make_var append_config make_env ' " =0 script_runreason 0123456789abcdef dhcp_envoption1 dhcp_envoption y ) R n ; ` 1 Q l ? g ) F f & N s 7 ] ~ D h * U > ] " J o ' E a x < V 1 _
- L x = a 4 T n % = X s ( K d 8 Y w * @ [ v ' O h |
# A h ( H k = M h | k } ; d ) I _ , < L j 4 P h % P e u , < 0 , < L } f 8 N b | ( ( ( ( 0 ( E H D
) arp_open arp_new dhcp_handleudp dhcp_open 5 2 log_dhcp1 decode_rfc3442_rt get_option_routes dhcp_bind dhcp_dump F k dhcp_handlepacket dhcp_init dhcp_start1 ipv4_getstate delete_address1 ipv4_addaddr ipv4_buildroutes get_routes add_subnet_route add_loopback_route add_router_host_route add_destination_route ipv4_handleifa ipv4ll_probed ^ ^make_route ^ipv6_getstate ipv6_addlinklocalcallback ipv6_buildroutes ipv6nd_handlera ipv6nd_env ipv6nd_sendrsprobe ipv6nd_startrs1 7 > (
dhcp6_addrequestedaddrs dhcp6_delegateaddr dhcp6_ifdelegateaddr M dhcp6_checkstatusok dhcp6_findpd dhcp6_findna dhcp6_readlease dhcp6_sendmessage ' ' ) * P Q ' | } w dhcp6_env dhcp6_dump localhost. %s_%s=%s /var/run/dhcpcd.unpriv.sock /var/run/dhcpcd%s%s.sock %s: dhcpcd_handleargs: %m %s: writev fd %d: %m %s: IAID conflicts with one assigned to %s %s: removing interface DEPARTED STOPPED send_interface %d: %m %s: ipv6_start: %m NOCARRIER PREINIT if_managelink: %m pipe: %m forking to background fork: %m failed to notify parent: %m failed to read child: %m forked to background, child pid %d timed out %s: no profile %s %s: selected profile %s ipv4_init: %m ipv6_init: %m %s: carrier_status: %m %s: carrier lost EXPIRE6 EXPIRE %s: carrier acquired %s: waiting for carrier DUID %s %s: IAID %s %s: dhcp6_start: %m %s: if_up: %m %s: unknown carrier, waiting for interface flags %s: if_discover: %m RECONFIGURE received signal %s from PID %d, %s stopping ALRM releasing HUP USR1 reconfiguring received signal PIPE received signal %d from PID %d, but don't know what to do with it %s: interface departed %s: interface updated %s: interface added %s: new hardware address: %s --version 6.7.1 --getconfigfile --getinterfaces --listen control command: %s 46bc:de:f:gh:i:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMO:Q:S:TUVW:X:Z: ARLM --help usage: dhcpcd [-46ABbDdEGgHJKkLnpqTVw]
[-C, --nohook hook] [-c, --script script]
[-e, --env value] [-F, --fqdn FQDN] [-f, --config file]
[-h, --hostname hostname] [-I, --clientid clientid]
[-i, --vendorclassid vendorclassid] [-l, --leasetime seconds]
[-m, --metric metric] [-O, --nooption option]
[-o, --option option] [-Q, --require option]
[-r, --request address] [-S, --static value]
[-s, --inform address[/cidr]] [-t, --timeout seconds]
[-u, --userclass class] [-v, --vendor code, value]
[-W, --whitelist address[/cidr]] [-y, --reboot seconds]
[-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern]
[-z, --allowinterfaces pattern] [interface] [...]
dhcpcd -k, --release [interface]
dhcpcd -U, --dumplease interface
dhcpcd --version
dhcpcd -x, --exit [interface] dhcpcd 6.7.1
%s
/etc/dhcpcd.conf cannot specify more than one address family Interface options:
DHCPv4 options:
DHCPv6 options: %s: open: %m %s: interface name too long /var/run/dhcpcd%s%s%s.pid chdir `/': %m dumplease requires an interface sending commands to master dhcpcd process send OK failed to send commands control_open: %m dhcpcd will not work correctly unless run as root sending signal %s to pid %d dhcpcd not running kill: %m waiting for pid %d to exit pid %d failed to exit dhcpcd already running on pid %d (%s) /var/run mkdir `%s': %m /var/db flock `%s': %m control_start: %m version 6.7.1 starting signal_setup: %m open_link_socket: %m %s: interface not found or invalid no valid interfaces found aborting as link detection is disabled no interfaces have a carrier control_stop: %m: exited /etc/dhcpcd.duid error reading DUID: %s: %m %s: is a NET/ROM psuedo interface error writing DUID: %s: %m picked interface %s to generate a DUID no interfaces have a fixed hardware address %s: timeout0 already set nothing to do poll: %m %s: is a Virtual Interface Master, skipping %s: unsupported interface type %.2x %s: if_init: %m %s: set_mtu: %m %s: no assignment: %s `%s' is not a valid CIDR `%s' is not a valid IP address `%s' out of range %s: invalid IAID token_len: %m authtoken needs a key hostname: %m hostname cannot begin with . vendorclassid: %m leasetime must be a positive value metric must be a positive value dhcp6_ timeout must be a positive value userclass: %m invalid vendor format: %s vendor: %m vendor option should be between 1 and 254 inclusive reboot must be a positive value skip_hooks=%s ptr both disable invalid value `%s' for FQDN clientid: %m static assignment required ip_address= subnet_mask= ms_classless_static_routes= all routes need a gateway routers= option `%s' does not take an IPv4 address IA PD must belong in an interface block IA with IAID must belong in an interface block Cannot mix IA for the same IAID %s: cannot assign multiple prefixes with a SLA of 0 %s: cannot mix automatic and fixed SLA %s: cannot specify the same interface twice with an automatic SLA embed must be after a define or encap encap must be after a define invalid syntax: %s invalid code: %s invalid syntax incomplete request type incomplete index type incomplete array type unknown type: %s ignoring length for type `%s' ignoring array for strings type %s requires a variable name vendor class is too big delayed delayedrealm %s: unsupported protocol hmacmd5 hmac-md5 %s: unsupported algorithm monocounter monotime %s: unsupported RDM authtoken requires a realm %s: not a number authtoken requies an a key realm_len: %m authtoken requies an an expiry date forever %Y-%m-%d %H:%M %s: invalid date time %s: mktime: %m controlgroup: %s: not found stableprivate dhcpcd: option requires an argument -- %s
unknown option: %s fopen `%s': %m allowing interface %s arping env reconfigure vendorclassid leasetime rebind persistent inform userclass vendor waitip allowinterfaces noarp nobackground nohook lastlease nogateway xidhwaddr clientid nolink noipv4ll nooption require dumplease variables whitelist blacklist denyinterfaces fallback noipv6rs ipv6ra_autoconf ipv6ra_noautoconf ipv6ra_fork ipv6ra_own ipv6ra_own_default ipv4only ipv6only noipv4 noipv6 noalias hostname_short define6 vendopt vendclass authprotocol authtoken noauthrequired nodhcp nodhcp6 controlgroup slaac ia_pd_mix %s_%s TEST ROUTERADVERT UNKNOWN interface=%s reason=%s pid=%d ifcarrier=%s ifmetric=%d ifwireless=%d ifflags=%u ifmtu=%d interface_order= if_up=false if_down=true if_down=false if_up=true if_oneup=true if_oneup=false if_ipwaited=true if_ipwaited=false syslog_debug=true profile=%s ifssid= ifclass=pd - %s
/libexec/dhcpcd-run-hooks %s: executing `%s' %s %s: make_env: %m RC_SVCNAME PATH=%s PATH=/usr/bin:/usr/sbin:/bin:/sbin waitpid: %m %s: %s: WEXITSTATUS %d %s: %s: %s %s: arraytostr: %m %s: control_queue: %m reason ifcarrier ifmetric ifwireless interface_order embed index byte uint16 sint16 uint32 sint32 ipaddress ip6address dname ascii raw binhex rfc3361 rfc3442 rfc5969 norequest %s-%s %s-%s:%s-%s:%s %s_%s= %s_%s%d define 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 249 rfc3442 ms_classless_static_routes define 33 request array ipaddress static_routes define 3 request array ipaddress routers define 2 uint32 time_offset define 4 array ipaddress time_servers define 5 array ipaddress ien116_name_servers define 6 array ipaddress domain_name_servers define 7 array ipaddress log_servers define 8 array ipaddress cookie_servers define 9 array ipaddress lpr_servers define 10 array ipaddress impress_servers define 11 array ipaddress resource_location_servers define 12 dname host_name define 13 uint16 boot_size define 14 string merit_dump define 15 array dname domain_name define 16 ipaddress swap_server define 17 string root_path define 18 string extensions_path define 19 byte ip_forwarding define 20 byte non_local_source_routing define 21 array ipaddress policy_filter define 22 int16 max_dgram_reassembly define 23 uint16 default_ip_ttl define 24 uint32 path_mtu_aging_timeout define 25 array uint16 path_mtu_plateau_table define 26 uint16 interface_mtu define 27 byte all_subnets_local define 28 request ipaddress broadcast_address define 29 byte perform_mask_discovery define 30 byte mask_supplier define 31 byte router_discovery define 32 ipaddress router_solicitation_address define 34 byte trailer_encapsulation define 35 uint32 arp_cache_timeout define 36 uint16 ieee802_3_encapsulation define 37 byte default_tcp_ttl define 38 uint32 tcp_keepalive_interval define 39 byte tcp_keepalive_garbage define 40 string nis_domain define 41 array ipaddress nis_servers define 42 array ipaddress ntp_servers define 43 binhex vendor_encapsulated_options define 44 array ipaddress netbios_name_servers define 45 ipaddress netbios_dd_server define 46 byte netbios_node_type define 47 string netbios_scope define 48 array ipaddress font_servers define 49 array ipaddress x_display_manager define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 binhex vendor_class_identifier define 61 binhex dhcp_client_identifier define 64 string nisplus_domain define 65 array ipaddress nisplus_servers define 66 dname tftp_server_name define 67 string bootfile_name define 68 array ipaddress mobile_ip_home_agent define 69 array ipaddress smtp_server define 70 array ipaddress pop_server define 71 array ipaddress nntp_server define 72 array ipaddress www_server define 73 array ipaddress finger_server define 74 array ipaddress irc_server define 75 array ipaddress streettalk_server define 76 array ipaddress streettalk_directory_assistance_server define 77 binhex user_class define 78 embed slp_agent embed byte mandatory embed array ipaddress address define 79 embed slp_service embed ascii scope_list define 80 norequest flag rapid_commit define 81 embed fqdn embed byte flags embed byte rcode1 embed byte rcode2 embed domain fqdn define 85 array ipaddress nds_servers define 86 raw nds_tree_name define 87 raw nds_context define 88 array domain bcms_controller_names define 89 array ipaddress bcms_controller_address define 90 embed auth embed byte protocol embed byte algorithm embed byte rdm embed binhex:8 replay embed binhex information define 91 uint32 client_last_transaction_time define 92 array ipaddress associated_ip define 98 string uap_servers define 99 encap geoconf_civic embed byte what embed uint16 country_code define 100 string posix_timezone define 101 string tzdb_timezone define 116 byte auto_configure define 117 array uint16 name_service_search define 118 ipaddress subnet_selection define 119 array domain domain_search define 120 rfc3361 sip_server define 122 encap tsp encap 1 ipaddress dhcp_server encap 2 ipaddress dhcp_secondary_server encap 3 rfc3361 provisioning_server encap 4 embed as_req_as_rep_backoff embed uint32 nominal embed uint32 maximum embed uint32 retry encap 5 embed ap_req_ap_rep_backoff encap 6 domain kerberos_realm encap 7 byte ticket_granting_server_utilization encap 8 byte provisioning_timer define 123 binhex geoconf define 124 binhex vivco define 125 embed vivso embed uint32 enterprise_number define 136 array ipaddress pana_agent define 137 domain lost_server define 138 array ipaddress capwap_ac define 139 encap mos_ip encap 1 array ipaddress is encap 2 array ipaddress cs encap 3 array ipaddress es define 140 encap mos_domain encap 1 domain is encap 2 domain cs encap 3 domain es define 141 array domain sip_ua_cs_list define 142 array ipaddress andsf define 143 array ip6address andsf6 define 144 binhex geoloc define 145 array byte forcerenew_nonce_capable define 146 embed rdnss_selection embed byte prf embed ipaddress primary embed ipaddress secondary embed array domain domains define 150 array ipaddress tftp_servers define 208 binhex pxelinux_magic define 209 string config_file define 210 string path_prefix define 211 uint32 reboot_time define 212 rfc5969 sixrd define 213 domain access_domain define 221 encap vss encap 0 string nvt encap 1 binhex vpn_id encap 255 flag global define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime define6 6 array uint16 option_request define6 7 byte preference define6 8 uint16 elased_time define6 9 binhex dhcp_relay_msg define6 11 embed auth define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed string message define6 14 norequest flag rapid_commit define6 15 binhex user_class define6 16 binhex vivco define6 17 embed vivso define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 21 array domain sip_servers_names define6 22 array ip6address sip_servers_addresses define6 23 array ip6address name_servers define6 24 array domain domain_search define6 25 norequest index embed ia_pd encap 26 option define6 26 index embed prefix embed byte length embed ip6address prefix encap 67 option define6 27 array ip6address nis_servers define6 28 array ip6address nisp_servers define6 29 string nis_domain_name define6 30 string nisp_domain_name define6 31 array ip6address sntp_servers define6 32 uint32 info_refresh_time define6 33 array domain bcms_server_d define6 34 array ip6address bcms_server_a define6 36 encap geoconf_civic define6 37 embed remote_id embed binhex remote_id define6 38 binhex subscriber_id define6 39 embed fqdn define6 40 array ip6address pana_agent define6 41 string posix_timezone define6 42 string tzdb_timezone define6 43 array uint16 ero define6 49 domain mip6_hnidf define6 50 encap mip6_vdinf encap 71 option encap 72 option encap 73 option define6 51 domain lost_server define6 52 array ip6address capwap_ac define6 53 binhex relay_id define6 54 encap mos_ip encap 1 array ip6address is encap 2 array ip6address cs encap 3 array ip6address es define6 55 encap mos_domain define6 56 encap ntp_server encap 1 ip6address addr encap 2 ip6address mcast_addr encap 3 ip6address fqdn define6 57 domain access_domain define6 58 array domain sip_ua_cs_list define6 59 string bootfile_url define6 60 binhex bootfile_param define6 61 array uint16 architecture_types define6 62 embed nii embed byte type embed byte major embed byte minor define6 63 binhex geoloc define6 64 domain aftr_name define6 67 embed pd_exclude embed byte prefix_len embed binhex subnetID define6 69 encap mip6_idinf define6 70 encap mip6_udinf define6 71 embed mip6_hnp define6 72 ip6address mip6_haa define6 73 domain mip6_haf define6 74 embed rdnss_selection embed ip6address server define6 75 string krb_principal_name define6 76 string krb_realm_name define6 78 embed krb_kdc embed uint16 priority embed uint16 weight embed byte transport_type embed uint16 port embed ip6address address embed string realm_name define6 80 ip6address link_address define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt /dev/bpf BPF version mismatch - recompile net.inet6.ip6.use_tempaddr net.inet6.ip6.temppltime net.inet6.ip6.tempvltime %s: del_if_nd6_flag: ND6_IFF_IFDISABLED: %m %s: set_if_nd6_flag: ND6_IFF_PERFORMNUD: %m %s: get_if_nd6_flag: ND6_IFF_AUTO_LINKLOCAL: %m %s: disabling Kernel IPv6 auto link-local support %s: del_if_nd6_flag: ND6_IFF_AUTO_LINKLOCAL: %m %s: get_if_nd6_flag: ND6_IFF_OVERRIDE_RTADV: %m %s: set_if_nd6_flag: ND6_IFF_OVERRIDE_RTADV: %m %s: get_if_nd6_flag: ND6_IFF_ACCEPT_RTADV: %m %s: disabling Kernel IPv6 RA support %s: del_if_nd6_flag: ND6_IFF_ACCEPT_RTADV: %m %s: IPv6 kernel autoconf disabled IPV6CTL_ACCEPT_RTADV: %m SIOSRTRFLUSH_IN6: %m SIOSPFXFLUSH_IN6: %m Berkley Packet Filter /var/db/dhcpcd-rdm.monotonic 0x%016llu 0x%016llu
%s: arp if_readrawpacket: %m %s: ARP probing %s (%d of %d), next in %0.1f seconds send_arp: %m %s: ARP announcing %s (%d of %d), next in %d.0 seconds %s: ARP announcing %s (%d of %d) %s: hardware address %s claims %s %s: probing for %s %s: open `%s': %m %s: reading lease `%s' %s: dhcp_auth_validate: %m %s: validated using 0x%08u %s: accepted reconfigure key %s not found %s
%03d %s via NAK: %s: %s %s %s `%s' %s: %s %s %s %s `%s' %s: %s %s %s %s: %s %s %s %s 0.0.0.0/0 %d %d %02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x %d.%d.%d.%d MS %s: using %sClassless Static Routes Duplicate address detected %s: VIVCO option too big %s: dhcp_auth_encode: %m %s: DHCP messge too big ip_address subnet_cidr network_number %s: using static address %s/%d STATIC %s: using IPv4LL address %s IPV4LL %s: received approval for %s INFORM TIMEOUT %s: leased %s for infinity %s: minimum lease is %d seconds %s: rebind time greater than lease time, forcing to %u seconds %s: renewal time greater than rebind time, forcing to %u seconds %s: leased %s for %u seconds REBIND REBOOT BOUND %s: renew in %u seconds, rebind in %u seconds %s: writing lease `%s' %s: write_lease: %m %s: waiting for 3rd party to configure IP address 3RDPARTY /var/db/dhcpcd-%s.lease %s: no lease to dump DUMP %s: sending %s with xid 0x%x %s: sending %s (xid 0x%x), next in %0.1f seconds %s: dhcp_openudp: %m %s: dhcp_sendpacket: %m %s: if_sendrawpacket: %m FAIL dhcp_makeudppacket: %m %s: soliciting a DHCP lease (requesting %s) %s: soliciting a DHCP lease %s: renewing lease of %s %s: rebind in %u seconds, expire in %u seconds %s: failed to renew DHCP, rebinding %s: expire in %u seconds %s: releasing lease of %s %s: dhcp if_readrawpacket: %m %s: invalid UDP packet from %s %s: server %s is not destination %s: packet greater than DHCP size from %s %s: calloc: %m %s: bogus cookie from %s %s: xid 0x%x is for hwaddr %s no authentication discarding Force Renew unauthenticated Force Renew not bound, ignoring Force Renew Force Renew from %s: wrong xid 0x%x (expecting 0x%x) from %s reject DHCP reject NAK %s: message: %s no address given IPv4LL disabled from IPv4LL enabled from %s: unknown auto configuration option %d reject invalid address offered ignoring offer of not ACK or OFFER acknowledged %s: blacklisted DHCP packet from %s %s: non whitelisted DHCP packet from %s %s: DHCP lease expired %s: using ClientID %s %s: using hwaddr %s %s: Error making ClientID: %m %s: dhcp_init: %m %s: needs a clientid to configure %s: discarding expired lease %s: informing address of %s %s: rebinding lease of %s %s: delaying IPv4 for %0.1f seconds %s: removing IP address %s/%d DISCOVER REQUEST DECLINE ACK RELEASE DHCP_FORCERENEW %s: %s route to %s/%d %s: %s host route to %s %s: %s host route to %s via %s %s: %s default route via %s %s: %s route to %s/%d via %s adding changing %s: ipv4_delroute: %m %s: if_addroute: %m %s: deleting IP address %s/%d %s: adding IP address %s/%d %s: if_addaddress: %m removing %s: forcing router %s through interface %s: router %s requires a host route deleting %s: if_delroute: %m %s: preferring %s on %s %s: IP address %s/%d already exists %s: IPv4LL %d second defence failed for %s %s: defended IPv4LL address %s %s: failed to acquire an IPv4LL address %s: probing for an IPv4LL address /etc/dhcpcd.secret error reading secret: %s: %m error writing secret: %s: %m %s: deleting address %s if_deladdress6: :%m (no iface) reject %s: %s%s route to %s/%d via %s %s: if_delroute6: %m %s: if_addroute6: %m %s: deleted address %s %s: adding address %s %s: pltime infinity, vltime infinity %s: pltime infinity, vltime %u seconds %s: pltime %useconds, vltime infinity %s: pltime %u seconds, vltime %u seconds if_addaddress6: %m ipv6_removesubnet: %m %s: regen temp addr %s ipv6_createtempaddr: %m if_deladdress6: %m %s: waiting for %s to complete %s: too many duplicate temporary addresses %s: waiting for Router Advertisement DAD to complete %s: DAD detected %s %s: unable to obtain a stable private address %s: ipv6_makestableprivate: %m %s: Router Advertisement DAD completed rtpref: impossible RA flag %x %s: %s is reachable again %s: %s is unreachable, expiring it %s: %s: router expired %s: %s: expired option %d recvmsg: %m IPv6 ICMP packet too short from %s IPv6 RA/NA did not contain index or hop limit from %s %s: IPv6 NA too short from %s %s: NA multicast address %s (%s) %s: %s not a router (%s) %s: %s reachable (%s) IPv6 RA packet too short from %s RA from non local address %s %s: ignoring RA from ourself %s %s: Router Advertisement from %s %s: %s router available %s: short option %s: zero length option %s: Option length exceeds message %s: invalid option len for prefix %s: invalid prefix len %s: invalid prefix in RA %s: pltime > vltime %s: invalid MTU %d %s: invalid DNSSL option dhcp6_start: %s: %m %s: No DHCPv6 instruction in RA invalid IPv6 type %d or code %d from %s rdnss dnssl ra%zu_from new is null ra%zu_%s ra_count %s: delaying Router Solicitation for LL address %s: sending Router Solicitation %s: %s: sendmsg: %m %s: no IPv6 Routers available %s: soliciting an IPv6 router %s: ipv6nd_open: %m %s: ipv6ns_makersprobe: %m %s: delaying IPv6 router solicitation for %0.1f seconds DELEGATED6 %s: DHCPv6 DAD completed %s: waiting for DHCPv6 DAD to complete %s: DHCPv6 Vendor Class too big %s: DHCPv6 server does not support OPTION_PD_EXCLUDE %s: invalid prefix %s/%d + %d/%d: %m %s: cannot delegate excluded prefix %s/%d %s: status truncated %s: DHCPv6 REPLY: %s %s: DHCPv6 lease truncated %s: option overflow %s: IA option truncated %s: ignoring unrequested IAID %s %s: IAID %s: option type mismatch %s: IA Prefix option truncated %s: truncated PD Exclude %s: PD Exclude length mismatch %s: %s: DHCPv6 REPLY missing Prefix %s: IA Address option truncated %s: %s: DHCPv6 REPLY missing IA Address %s: T1 (%d) > T2 (%d) from %s %s: no useable IA found in lease %s: file too big %s: %s: %s: %m %s: read: %m %s: authentication failed %s: authentication now required %05d %s %s: delaying adding delegated addresses for LL address %s: adding delegated prefixes broadcasting unicasting delaying %s: %s %s with xid 0x%02x%02x%02x %s: %s %s (xid 0x%02x%02x%02x), next in %0.1f seconds %s: dhcp6_updateauth: %m %s: sent %d times with no reply %s: requesting DHCPv6 information %s: dhcp6_makemessage: %m %s: failed to renew DHCPv6, rebinding %s: rebinding prior DHCPv6 lease %s: soliciting a DHCPv6 lease %s: DHCPv6 lease expired %s: no advertising IPv6 router wants DHCP %s: failed to rebind prior delegation %s: failed to request address %s: failed to confirm prior address DHCPv6 packet too short from %s DHCPv6 reply did not contain index from %s %s: DHCPv6 reply received but not running %s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s %s: no DHCPv6 server ID from %s %s: incorrect client ID from %s %s: reject DHCPv6 (no option %s) from %s %s: reject DHCPv6 (option %s) from %s %s: authentication failed from %s %s: no authentication from %s %s: SOL_MAX_RT %llu -> %d %s: invalid SOL_MAX_RT %d %s: INF_MAX_RT %llu -> %d %s: invalid INF_MAX_RT %d %s: unauthenticated %s from %s %s: %s from %s %s: missing Reconfigure Message option %s: missing Reconfigure Message type %s: not bound, ignoring %s %s: not informed, ignoring %s %s: unsupported %s type %d %s: invalid DHCP6 type %s (%d) %s: invalid state for DHCP6 type %s (%d) %s: malloc recv: %m %s: ADV %s from %s %s: %s received from %s INFORM6 BOUND6 RENEW6 REBIND6 REBOOT6 UNKNOWN6 %s: loading for delegation %s: interface does not exist for delegation %s: delegated prefix %s %s: has no carrier, cannot delegate addresses %s: refresh in %u seconds %s: will expire %s: dhcp6_writelease: %m DHCPv6 reply for unexpected interface from %s %s: creating pseudo interface to handle Prefix Delegation %s: dhcp6_readlease: %s: %m %s: confirming prior DHCPv6 lease .pd setsockopt: SO_REUSEPORT: %m /var/db/dhcpcd-%s%s.lease6 %s: delaying DHCPv6 soliciation for LL address STOP6 %s_dhcp6 %s_delegated_dhcp6_prefix= %s: dhcp6_readlease: %m DUMP6 Unspecified Failure No Addresses Available No Binding Not On Link Use Multicast SOLICIT6 ADVERTISE6 REQUEST6 REPLY6 CONFIRM6 RELEASE6 RECONFIURE6 B B B B B @@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ (@ @ @ @ @ @ @ @ @ @ @ (@ (@ (@ (@ (@ (@ (@
@ @ @
@@@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ (@ (@ (@ (@ (@ (@
@ @ @
@@@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ (@ (@ (@ (@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @
! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ a b c d e f g h i j k l m n o p q r s t u v w x y z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~
! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` A B C D E F G H I J K L M N O P Q R S T U V W X Y Z { | } ~ " $ ` mU ~ @ d b ` /etc/group /etc/master.passwd %s%s%s
646 towlower towupper alnum blank cntrl graph punct xdigit Unknown error number Unknown signal number YP FAKE error %d
%ju %ju%s%0*ju , uappnd uchg nodump opaque sappnd arch schg snap archived dump sappend schange simmutable uappend uchange uimmutable , /dev/ptm tty 0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ pqrstuwxyzPQRST /dev/XtyXX w %s%s.pid /var/run/ full-duplex fdx half-duplex hdx flowcontrol flag0 flag1 flag2 loopback hw-loopback loop master rxpause txpause EarlyTokenRelease ETR SourceRouting SRCRT AllRoutes ALLR dual-attach das adhoc hostap monitor turbo ibss wds mesh autoselect auto manual none 10baseT 10baseT/UTP 10UTP 10BASE-T 10base2 10base2/BNC 10BNC 10BASE2 10base5 10base5/AUI 10AUI 10BASE5 100baseTX 100TX 100BASE-TX 100baseFX 100FX 100BASE-FX 100baseT4 100T4 100BASE-T4 100baseVG 100VG 100VG-AnyLAN 100baseT2 100T2 100BASE-T2 1000baseSX 1000SX 1000BASE-SX 10baseSTP STP 10STP 10BASE-STP 10baseFL FL 10FL 10BASE-FL 1000baseLX 1000LX 1000BASE-LX 1000baseCX 1000CX 1000BASE-CX 1000BASE-BX10 1000baseT 1000T 1000BASE-T HomePNA1 HPNA1 10GbaseLR 10GLR 10GBASE-LR 10GbaseSR 10GSR 10GBASE-SR 10Gbase-LRM 10Gbase-Twinax 10Gbase-Twinax-Long 10Gbase-T 10GbaseCX4 10GCX4 10GBASE-CX4 2500baseSX 2500SX DB9/4Mbit 4STP DB9/16Mbit 16STP UTP/4Mbit 4UTP UTP/16Mbit 16UTP Single-mode SMF Multi-mode MMF CDDI 10baseT-FDX 10BASE-T-FDX 100baseTX-FDX 100BASE-TX-FDX 1000baseT-FDX FH1 FH2 DS1 DS2 DS5 DS11 DS22 OFDM6 OFDM9 OFDM12 OFDM18 OFDM24 OFDM36 OFDM48 OFDM54 OFDM72 DS/354Kbps DS/512Kbps OFDM/3Mbps OFDM/4.5Mbps OFDM/27Mbps Ethernet ether TokenRing token FDDI IEEE802.11 CARP 11a 11b 11g fh 11na 11ng -o %s: option not supported Missing %s argument Invalid %s argument `%s' NAME= malloc failed sysctl hw.disknames failed dk %s: getwedgeinfo /rdk /r no match for `%s' kern.labelusesmbr Cannot copy string; %zu chars needed %zu provided Cannot append to string; %zu chars needed %zu provided Cannot copy string Cannot allocate %zu bytes Cannot allocate %zu blocks of size %zu Cannot re-allocate %zu bytes Cannot open `%s' Cannot format string $ 0 8 @ L P X d l p x | (; unused swap v6 v7 sysv v71k v8 ffs msdos lfs other hpfs cd9660 boot ados hfs filecore ext2fs ntfs raidframe ccd jfs2 appleufs vinum udf sysvbfs efs nilfs cgd minixfs3 0%llo %lld 0x%llx /dev/ %s%s%s%c %.*s/r%s r%s %.*s/%s TERM UTF-8 Inkey wstate screwed - exiting!!! [m [0m [ xx dumb LINES COLUMNS ESCDELAY TABSIZE
s k l m n o p q r Z { t u v w x y z | } ~ j | b c d e f g h W i ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G x \ z ^ y ] ~ _ `
I V } a { M J O P [ K H L R S Q N T U
Inkey state screwed - exiting!!! Inkey: Cannot allocate new keymap Could not malloc for key entry
inkey: Cannot allocate new key entry chunk add_new_key: bad type passed
unknown 5M S 7 )
# $
r ? 7 Q Q j % ^ . " Ar
O . E g
. _ l } J 2
7 W e m < B . >2 0 <s g + Q
| q ; o / | > W a 3 V 9V i + h[u 8 e " m : M k : k + t g Zw X ( h2 ) \ A _ 4 | v @ d p S \ n' Px 8 K { k 1 Z
V T r ] ; f | Q } [ k v / t m F / B 6 z F 7 * : e P : @ [ \/ q Gk % # e $ _ p uH v? 5 < > d E A |~ M; " i 7 h 9[ 9 Y Z = K g = M ) ] \ b s l *E X [ C Bp h 9 `% Xb
n %p0%{10}%/%{16}%*%p0%{10}%m%+ %p0%p0%{2}%*%- %p0%p0%? %>%t %+%; bw am ut cc xs YA YF YB xt xn eo
gn hc HC
km YC hs hl in YG da db mi ms nx xb NP ND NR os 5i YD YE es ! hz " ul # xo $ Yo Yp Ya BT co Yc Yb it lh lw li
lm ma sg
Co Yd Ye pa MW Yf Yg NC Nl Yh Yi Yj Yk Yl pb Ym vt Yn ws ac S8 bt bl Yv Zz Xy cr ZA ZB ZC
ZD cs rP
Zy ct MC cl cb ce cd ci Yw ch CC cm do ho vi le CM ve nd ! ll " up # vs $ Yx % ZE & dc ' dl ( dv ) DI * ds + DK , S1 - hd . eA / Yy 0 as 1 SA 2 mb 3 md 4 ti 5 dm 6 mh 7 ZF 8 ZG 9 Xh : im ; ZH < Xl = ZI > Xo ? ZJ @ ZK A ZL B S2 C mp D mr E Xr F S4 G mk H ZM I so J ZN K ZO L Xt M us N ZP O Xv P SX Q ec R ae S RA T me U te V ed W ZQ X ei Y ZR Z ZS [ ZT \ S3 ] S5 ^ ZU _ se ` ZV a ZW b ue c ZX d RX e PA f fh g vb h ff i fs j Gm k WG l HU m i1 n i2 o i3 p is o if q iP r Ic s Ip t ic u al v ip w K1 x K3 y K2 z kb { kB } K4 ~ K5 ka kC kt kD kL kd kM kE kS k0 k1 k2 k3 k4 k5 k6 k7 k8 k9 k; F1 F2 F3 F4 F5 F6 F7 F8 F9 FA FB FC FD FE FF FG FH FI FJ FK FL FM FN FO FP FQ FR FS FT FU FV FW FX FY FZ Fa Fb Fc Fd Fe Ff Fg Fh Fi Fj Fk Fl Fm Fn Fo Fp Fq Fr %1 kh kI kA kl kH %2 %3 Km %4 %5 kN %6 %7 kP %8 %9 %0 &1 &2 &3 &4 &5 kr &6 &9 &0 *1 *2 *3 *4 *5 *6 *7 *8 *9 kF *0 #1 #2 #3 #4 %a %b %c %d %e %f kR %g %h %i %j !1 !2 kT !3
&7 &8 ku
ke ks l0 l1 l2 l3 l4 l5 l6 l7 l8 l9 la Lf LF LO mo mm ZY ZZ ! Za " Zb # Zc $ Zd % Mi & nw ' Ze ( oc ) op * pc + DC , DL - DO . Zf / IC 0 SF 1 AL 2 LE 3 Zg 4 RI 5 Zh 6 SR 7 UP 8 Zi 9 S6 : pk ; pl < xl = px > pn ? ps @ pO A pf B po C PU D QD E RC F rp G RF H RQ I r1 J r2 K r3 L rf M rc N cv O sc P S7 Q sf R sr S Zj T s0 U s1 V s2 W s3 X sA Y AB Z AF [ sa \ Sb ] Zk ^ Zl _ SC ` Yz g sL h sp b Sf c ML d Zm e YZ g YI h MR i Zn j st k MT l Zo m Zp n wi o Zq p Zr q Zs r Zt s Zu t Zv u ta v Zw w ts x TO y u0 z u1 { u2 | u3 } u4 ~ u5 u6 u7 u8 u9 uc hu WA XF XN Zx @0 @1 | @2 @3 @4 @5 @6 @7 @8 @9 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 tc bel ^G cr ^M cud1 ^J ht ^I ind kbs ^H kcub1 kcud1 nel ^M^J TERM environment variable not set not enough memory to create terminal structure cannot access the terminfo database %s: terminal not listed in terminfo datase unknown error %s: generic terminal %s: hardcopy terminal V $9 < 9 V = V @ { V E V I u ansi @ P
bG [%i%d;%dR [6n [?%[;0123456789]c [c * [39;49m Z
[4%p1%dm [
[3%p1%dm H [8m \V [0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m 3 [5m 4 [1m E [7m ] [10m ` [m c [m U [0;10m C [11m J [7m N [4m ? +,-.0`afghjklmno~pqrs_tuvwxyz{|}~ S [10m 1 [11m 3 [%p1%dD . [%p1%dB 5 [%p1%dC 8 [%p1%dA , [%p1%dP - [%p1%dM R [%p1%dX [1K [%i%p1%dG v [I 0 [%p1%d@ 2 [%p1%dL 1 [%p1%dS { } [Z [D [B [C
[A [L B [4i C [5i '
[S G %p1%c[%p2%{1}%-%db 7 [%p1%dT U (B V )B W *B X +B [3g O [%i%p1%dd [Z [H[J
[D [B ! [C [%i%p1%d;%p2%dH # [A ' [P ( [M [J [K [H k H v [L R
[H AX f bs f dumb P
R
vt100 $ P
@G 3 ``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ 3 [5m$<2> 4 [1m$<2> [H[J$<50>
[%i%p1%d;%p2%dr 3 [%p1%dD . [%p1%dB
5 [%p1%dC ! [C$<2> [%i%p1%d;%p2%dH$<5> 8 [%p1%dA # [A$<2> [J$<50> [K$<3> [1K$<3> / (B)0 [H v k H R
{ OD OB OC
OA pf1 pf2 pf3 pf4 @ [0i B [4i C [5i N 8 E [7m$<2> S M$<5> S T [?7l [?1l> ` [m$<2> c [m$<2> K >[?3l[?4l[?5l[?7h[?8h P 7 \L [0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2> U [m$<2> 1 2 [?7h [?1h= J [7m$<2> N [4m$<2> [3g Oy Ox Ot Ou Ov Ol Ow OM OP OQ OR OS x Oq y Os z Or ~ Op On bs f vt220 $ P
7_ 3 ``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ 3 [5m 4 [1m [H[J
[%i%p1%d;%p2%dr 3 [%p1%dD . [%p1%dB
5 [%p1%dC ! [C [%i%p1%d;%p2%dH 8 [%p1%dA # [A , [%p1%dP ' [P - [%p1%dM ( [M R [%p1%dX [J [K [1K / )0 h [?5h$<200/>[?5l [H v k H 0 [%p1%d@ q /usr/share/tabset/vt100 2 [%p1%dL v [L R D o [?7h[>[?1l F[?4l { [D [B [C
[A [3~ OP [21~ [23~ [24~ [25~ [26~ [31~ [32~ [33~ OQ [34~ OR OS [17~ [18~ [19~ [20~ [1~ [28~ [2~ [6~ [5~ [29~ [4~ pf1 pf2 pf3 pf4 ' E N 8 E [7m S M S (B$<4> T [?7l Y [4l ` [27m c [24m J [?3l P 7 \K [0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2> U [m(B 1 (0$<2> 2 [?7h ; [4h J [7m N [4m [3g @ [i B [4i C [5i [%i%d;%dR [6n [?%[;0123456789]c [c bs f wsvt25 $ P
@ g [?25l [?25h o [r[25;1H [3~ [8~ [11~ [21~ [23~ [24~ [12~ [13~ [14~ [15~ [17~ [18~ [19~ [20~ [7~ * [m J c Z
[4%p1%dm [
[3%p1%dm 3 ``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ 3 [5m 4 [1m [H[J
[%i%p1%d;%p2%dr 3 [%p1%dD . [%p1%dB
5 [%p1%dC ! [C [%i%p1%d;%p2%dH 8 [%p1%dA # [A , [%p1%dP ' [P - [%p1%dM ( [M R [%p1%dX [J [K [1K / )0 h [?5h$<200/>[?5l [H v k H 0 [%p1%d@ q /usr/share/tabset/vt100 2 [%p1%dL v [L R D { [D [B [C
[A [25~ [26~ [31~ [32~ [33~ [34~ [1~ [28~ [2~ [6~ [5~ [29~ [4~ pf1 pf2 pf3 pf4 ' E N 8 E [7m S M S (B$<4> T [?7l Y [4l ` [27m c [24m P 7 \K [0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2> U [m(B 1 (0$<2> 2 [?7h ; [4h J [7m N [4m [3g @ [i B [4i C [5i [%i%d;%dR [6n [?%[;0123456789]c [c bs f xterm P
@ 1 [%p1%dS z OE } [Z OM 7 [%p1%dT OD OB OC
OA OF OH OP [21~ [23~ [24~ [1;2P [1;2Q [1;2R [1;2S [15;2~ [17;2~ [18;2~ OQ [19;2~ [20;2~ [21;2~ [23;2~ [24;2~ [1;5P [1;5Q [1;5R [1;5S [15;5~ OR [17;5~ [18;5~ [19;5~ [20;5~ [21;5~ [23;5~ [24;5~ [1;6P [1;6Q [1;6R OS [1;6S [15;6~ [17;6~ [18;6~ [19;6~ [20;6~ [21;6~ [23;6~ [24;6~ [1;3P [15~ [1;3Q [1;3R [1;3S [15;3~ [17;3~ [18;3~ [19;3~ [20;3~ [21;3~ [23;3~ [17~ [24;3~ [1;4P [1;4Q [1;4R [18~ [19~ [20~ [1;2D [1;2C [1;2B [1;2A [3;2~ [1;2F [1;2H [2;2~ [6;2~ [5;2~ [2~ [6~ [5~ [3~ 5 ``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ 3 [5m 4 [1m [Z [?25l [H[2J
[?12l[?25h
[%i%p1%d;%p2%dr 3 [%p1%dD . [%p1%dB
5 [%p1%dC ! [C [%i%p1%d;%p2%dH 8 [%p1%dA # [A $
[?12;25h , [%p1%dP ' [P - [%p1%dM ( [M R [%p1%dX [J [K [1K h [?5h$<100/>[?5l [H [%i%p1%dG v k H 0 [%p1%d@ 2 [%p1%dL v [L R
H [8m o [!p[?3;4l[4l> [M * [39;49m N 8 E [7m S M S (B T [?7l V [?1049l Y [4l [?1l> [?1034l ` [27m c [24m J c K [!p[?3;4l[4l> P 7 Z
[4%p1%dm [
[3%p1%dm ]F [4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m cF [3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m \R %?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;m U (B[m 1 (0 2 [?7h 5 [?1049h ; [4h [?1h= [?1034h J [7m N [4m [3g O [%i%p1%dd @ [i B [4i C [5i { [?1;2c [%i%d;%dR [6n [c ,? kDN s [1;2B kDN3 s [1;3B kDN4 s [1;4B kDN5 s [1;5B kDN6 s [1;6B kDN7 s [1;7B kLFT3 s [1;3D kLFT4 s [1;4D kLFT5 s [1;5D kLFT6 s [1;6D kLFT7 s [1;7D kRIT3 s [1;3C kRIT4 s [1;4C kRIT5 s [1;5C kRIT6 s [1;6C kRIT7 s [1;7C kUP s [1;2A kUP3 s [1;3A kUP4 s [1;4A kUP5 s [1;5A kUP6 s [1;6A kUP7 s [1;7A kDC3 s [3;3~ kDC4 s [3;4~ kDC5 s [3;5~ kDC6 s [3;6~ kDC7 s [3;7~ kEND3 s [1;3F kEND4 s [1;4F kEND5 s [1;5F kEND6 s [1;6F kEND7 s [1;7F kHOM3 s [1;3H kHOM4 s [1;4H kHOM5 s [1;5H kHOM6 s [1;6H kHOM7 s [1;7H kIC3 s [2;3~ kIC4 s [2;4~ kIC5 s [2;5~ kIC6 s [2;6~ kIC7 s [2;7~ kNXT3 s [6;3~ kNXT4 s [6;4~ kNXT5 s [6;5~ kNXT6 s [6;6~ kNXT7 s [6;7~ kPRV3 s [5;3~ kPRV4 s [5;4~ kPRV5 s [5;5~ kPRV6 s [5;6~ kPRV7 s [5;7~ Cr s ]112 Cs s ]12;%p1%s Ms s ]52;%p1%s;%p2%s Se s [2 q Ss s
[%p1%d q bs f AX f XT f meml s l memu s m E3 s [3;J %s.cdb TERMINFO TERMCAP $TERMINFO $TERMCAP TERMINFO_DIRS HOME %s/.terminfo /usr/share/misc/terminfo ansi vt100 vt220 wsvt25 xterm %s: %s: unknown capability %s: %s: cap name is too long no seperator found: %s %s: %s: illegal ^ character %s: %s: non octal digit %s: %s: string is too long %s: %s: invalid string %s: %s: not a number %s: %s: number out of range 2 K n , X ` % K bw am bce ccc xhp xhpa cpix crxm xt xenl eo gn hc chts km daisy hs hls in lpix da db mir msgr nxon xsb npc ndscr nrrmc os mc5i xvpa sam eslok hz ul xon #
" "
"$ bitwin bitype bufsz btns cols spinh spinv it lh lw lines lm ma xmc colors maddr mjump pairs wnum mcs mls ncv nlab npins orc orl orhi orvi pb cps vt widcs wsl
acsc scesa cbt bel bicr binel birep cr cpi lpi chr cvr csr rmp csnm tbc mgc clear el1 el ed csin colornm hpa cmdch cwin cup cud1 home civis cub1 mrcup cnorm cuf1 ll cuu1 cvvis defbi defc dch1 dl1 devt dial dsl dclk dispc hd enacs endbi smacs smam blink bold smcup smdc dim swidm sdrfq ehhlm smir sitm elhlm slm elohlm smicm snlq snrmq smpch prot rev erhlm smsc invis sshm smso ssubm ssupm ethlm smul sum evhlm smxon ech rmacs rmam sgr0 rmcup rmdc rwidm rmir ritm rlm rmicm rmpch rmsc rshm rmso rsubm rsupm rmul rum rmxon pause hook flash ff fsl getm wingo hup is1 is2 is3 if iprog initc initp ich1 il1 ip ka1 ka3 kb2 kbs kbeg kcbt kc1 kc3 kcan ktbc kclr kclo kcmd kcpy kcrt kctab kdch1 kdl1 kcud1 krmir kend kent kel ked kext kf0 kf1 kf2 kf3 kf4 kf5 kf6 kf7 kf8 kf9 kf10 kf11 kf12 kf13 kf14 kf15 kf16 kf17 kf18 kf19 kf20 kf21 kf22 kf23 kf24 kf25 kf26 kf27 kf28 kf29 kf30 kf31 kf32 kf33 kf34 kf35 kf36 kf37 kf38 kf39 kf40 kf41 kf42 kf43 kf44 kf45 kf46 kf47 kf48 kf49 kf50 kf51 kf52 kf53 kf54 kf55 kf56 kf57 kf58 kf59 kf60 kf61 kf62 kf63 kfnd khlp khome kich1 kil1 kcub1 kll kmrk kmsg kmous kmov knxt knp kopn kopt kpp kprv kprt krdo kref krfr krpl krst kres kcuf1 ksav kBEG kCAN kCMD kCPY kCRT kDC kDL kslt kEND kEOL kEXT kind kFND kHLP kHOM kIC kLFT kMSG kMOV kNXT kOPT kPRV kPRT kri kRDO kRPL kRIT kRES kSAV kSPD khts kUND kspd kund kcuu1 rmkx smkx lf0 lf1 lf2 lf3 lf4 lf5 lf6 lf7 lf8 lf9 lf10 fln rmln smln rmm smm mhpa mcud1 mcub1 mcuf1 mvpa mcuu1 minfo nel porder oc op pad dch dl cud mcud ich indn il cub mcub cuf mcuf rin cuu mcuu pctrm pfkey pfloc pfxl pfx pln mc0 mc5p mc4 mc5 pulse qdial rmclk rep rfi reqmp rs1 rs2 rs3 rf rc vpa sc scesc ind ri scs s0ds s1ds s2ds s3ds sgr1 setab setaf sgr setb smgb smgbp sclk setcolor scp setf smgl smglp smglr slines slength smgr smgrp hts smgtb smgt smgtp wind sbim scsd rbim rcsd subcs supcs ht docr tsl tone u0 u1 u2 u3 u4 u5 u6 u7 u8 u9 uc hu wait xoffc xonc zerom < # E 1 j ` r8 ' g | S V X X } ! Q X >c G 4 * r X v U l jR 2 C l , Us h x 4 " sW ) h m k c K u = z > ;'
D h = * w H U Y s f 4 / ~ >: % # K 3 } * t -y da, 0 ? u Z v
D n d > c + +1 t D yA L A a
d N n 2 K ) kc e U i E 4 0 8 * J ! k ! " Q Y $ 9 J D ' oN , K
F W W x 6 e @ o F [ M A } b y r 6 Y K } .5 \q 6 q Z 5L 8 n A FY J
_ c dv 32 : ] x [ ' ~ | i
acos acosf asin asinf atan2 atan2f hypot hypotf cosh coshf exp expf y0 y0f y1 y1f yn ynf lgamma lgammaf log logf log10 log10f pow powf sinh sinhf remainder remainderf acosh acoshf atanh atanhf scalb scalbf j0 j0f j1 j1f jn jnf gamma gammaf log2 log2f acos: DOMAIN error
asin: DOMAIN error
atan2: DOMAIN error
y0: DOMAIN error
y1: DOMAIN error
yn: DOMAIN error
lgamma: SING error
log: SING error
log: DOMAIN error
log10: SING error
log10: DOMAIN error
pow(0,0): DOMAIN error
pow(0,neg): DOMAIN error
neg**non-integral: DOMAIN error
sqrt sqrtf sqrtl sqrt: DOMAIN error
fmod fmodf fmodl fmod: DOMAIN error
remainder: DOMAIN error
acosh: DOMAIN error
atanh: DOMAIN error
atanh: SING error
: TLOSS error
gamma: SING error
log2: SING error
log2: DOMAIN error
0C 0` P s p 0
` @ X ; x 8 h ( H T + t 4
d $ D \ S | < l , L R # r 2 b " B Z C z : j *
J V @ 3 v 6 f & F ^ c ~ > n . N ` Q q 1
a ! A Y ; y 9 i ) I U + u 5
e % E ] S } = m -
M S # s 3 c # C [ C { ; k + K W @ 3 w 7 g ' G _ c ? o / O ` P s p 0
` @ X ; x 8 h ( H T + t 4
d $ D \ S | < l , L R # r 2 b " B Z C z : j *
J V @ 3 v 6 f & F ^ c ~ > n . N ` Q q 1
a ! A Y ; y 9 i ) I U + u 5
e % E ] S } = m -
M S # s 3 c # C [ C { ; k + K W @ 3 w 7 g ' G _ c ? o / O A @ ! @ a ` 1 0
@
incorrect header check unknown compression method invalid window size unknown header flags set header crc mismatch invalid block type invalid stored block lengths too many length or distance symbols invalid code lengths set invalid bit length repeat invalid literal/lengths set invalid distances set invalid literal/length code invalid distance code invalid distance too far back incorrect data check incorrect length check
# + 3 ; C S c s @ @
! 1 A a 0@` inflate 1.2.3 Copyright 1995-2005 Mark Adler { Tw Tw Tw q q q q q q deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly ~ ~ (; ~ ~ ~ ~ (; 1.2.3 need dictionary stream end file error stream error data error insufficient memory buffer error incompatible version
( 0 8 @ P ` p
0 @ ` 0 @ `
L , l \ < | B " b R 2 r
J * j Z : z F & f V 6 v N . n ^ > ~ A ! a Q 1 q I ) i Y 9 y E % e U 5 u
M - m ] = } S S 3 3 s s K K + + k k [ [ ; ; { { G G ' ' g g W W 7 7 w w O O / / o o _ _ ? ? @ ` P 0 p H ( h X 8 x D $ d T 4 t C # c
0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z- A1b62S-+ldEw}ZVǖAOIъ OM~- QJ#SpxAaU.7 Y -6]]w ll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* , m8 6F߲]qTp0ek*1u 4yީ%8 S1bSWĔՖ k1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$ ,52F* sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL 8^#ܖ TZ1ObbSyOIV~P-{ b-R4 ٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ
?&~?$pi;FBzw[keZ~7 Sv8H 3?r$ 7jnԄYFܨ |OQ;օ
U d S
-
=G\ p& G w ) ` /a߫i5&LsZ<#0zMzFM8,9; :R:( q-v,.7/pXqY s3r %w+OQvrtEux܉~OK
}!b|ty Bxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HIN SKyuJcO NZLݘMFGN@E$DD2AsX@*IB CPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^
iϏ은BI#ƈdX ܁T̓cQ:
rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"_HS1 ^Z4 eg Wb27_k%8ם(ŊO}doJj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg;
i8P/ _Y=чe:ZO?(3wwXR
@hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?# 1jvʬ`p^ Y<L~i/{kHwâ
hs)aLoD~Pf7VM'(@ﰤ ہg9x+ n&;f?/X)T`D1 ߨM ߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$ !AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3
m:@/)IJNv"2x+ ٗ Kx.HҥfAj ^y9*O]#kM`~b_R 7zF h!1߈Vc0a"j6nS Nr )Υ{t*F8#vufz`rs"WG9^EMvc&DAdQy/4 Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫϩ7~8A]&nv|o Y
yKiw\¹9~$ 66nQ fq>,o,IӔ 渱{I
.H>C-Yn馑gQ z taf w0a, Qmpjc5dۈ2yܸ و L+~|- dj qHA}mԵQӅlVdkbze\Ocl=c
;n Li^`Agqr<KG
k5Blۻ֬@2lE\u
ϫ=Y&0Q :Qa!V#Ϻ(_ ٲ $/o|XhLa f-=vAq *q 3xɢ 4 j
m=-dlc\kkQ labe0b Nl{WeP|b -I|LeMaX:QΣ tԻ0JߥA=ؕפmCij4ngF`D-s3
L_
|Pq<'A Wh% of a^)ɘИ"רY=.
\;l tҚG9w&sc d;
mj>zjZ
'}D hibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K
+گ
L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮ d°c&ujm
6?rg WJz{+ 8Ҏվ
| !Bhݳ ڃn&[owGwZjpf; \ebiaklE
x
NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮SG0齽 ʺS0$6TW)#gfz.aJ]h*o+ 7 Z- 1A26b+-Sdl}wEVZOAي»IˬO ~M- JQS#xpaA.U7 Y -۩6˚w]]ll A?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z , 8mF6]pTqke0*1¶ u4%y<8syjHA}X* ݹ 1SbSW§ٖծ 1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8, $5 *F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8 #^T O1ZbbySIOP~V{-b -4R ^~GelHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb#
&??~p$iBF;[wzek~ZS 7H8v ?3$r j7nFY |OQ;
U dؓS
-
\G= &p G w ` )/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+ )`F(>
q-q ,v.Ț/7pqXs Yr3w% vQO+tru՛E~xKO}
|b!ytxB z{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKS NJuyOcN LZMݥFĚGE@ND$A2D@XsBI*C ThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z
&J8 좞V`a/6i\lU,zB\u H=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_
^ϋiBۉI#dX фTQc:r
Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފ Z^ھ4 ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[
;g /P8i_ Y=嗇e:ϏOZw3(?RXw@
Qh+HZ"0*WOIo@}m5N#+'*GA |HX=#?X1 vjʨ`^p YL'! $UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n
:m@I)/NJ2"v+x xKH.jAf^ O*9y]#Mk~`bю_ Rz7h Fм!10cV"ajحn6 S rN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA 4S&ֿ EbLil!>aDƋΪ~7A8n&]|vY oᡱ
Kyiw¡\~9$66 Qnf>q,o,ӹI 散
I{. C>HnY-Qg̰ t zfagntsd prop_string_append_cstring /usr/src/common/lib/libprop/prop_string.c src != ((void *)0) _prop_object_externalize_append_char
_prop_object_internalize_find_tag X (- 4 T
W prop_object_retain prop_object_release prop_object_release_emergency prop_object_equals_with_error /usr/src/common/lib/libprop/prop_object.c ctx->poec_capacity != 0 ctx->poec_buf != ((void *)0) ctx->poec_len <= ctx->poec_capacity < > & plist version="1.0" plist !((*cp) == '\0') array ?xml !DOCTYPE plist