ELF(@4D4 (@@BD\\@0 6QQ O@@@( @0 fD!@P@Q?P1Р -L┸e@^main() returnedħ   ! X(@@T @@ 0/ȢĢ// P- @P0P ?R"/ x-PP@L``0S00  R0  Kxh : :-@#FL`7*PP 00S `p@ T@ L0@0 `VL00L0@@p^ x- :P:L#VT*``@qPL0 U0 0L0L00P0T0xp^ -LP@)`PV 80`pPH0N00@p^Z -LL`)`P@7A` PpW⊒`xp^ -L0L@ P R T0( @ 0>10CB>AP #>AL 0B`T00000 {L0\0`P/  !`80 00,000, !/@^ x-X0L@S`# 0PXP{8 t00 !` `1XT0P000 ! Kxhx`^@^ 0-PL@XP d0 ` 0?S5ZH0 20 3/P K0h0^<)]P( P P P, )P P$/ P  P P|/P P `P`/\/X/T/P/L/H/D/@/</8/4/)]:*]g*]G)])])])]*]#*]Q*]*]*]*]a)] --LM@,b b bK*]e] -SL0M 0@S 20 3/30S&20 3/203/2LK0H K3/P0SL 0B S񟗄` @ @X @d @ @4 @| @ @x@ @p @ @ 0bS P000 00 00S20S 0020S 0bSP000 0XbS 0S420S 00 0bSP0002 0< K3/ kX0S  00 0_y$0Sv2DK0@ K3/2 0< KY"4S1aaQ ) 0R X0S) & R0S X0` `S pXp0  0?0YHT020 3/P V00 0000K^Z*]*]*]^*] x-H`L@`P!i᱐ 0 VY^*] -L`P'`p@1V< 1V 0V W1V x1V. Pl10S-@N K T1   D 81   @?P0S#@; Tc>NBA(0.ABN.dP00CP02 0 3/@P v@0$0S 0@000000@ @p^A @A A(@A ^*] Q-L c+]0( p( 3/ 0-L8M@bc2!! Q QQQ @PQ,$  R , R0S,0 0,00$0<$ lc00hc$0S2<K08 K3/203/2 04 K3/P 20S 3/ P`XPC(A4\00l0 @0 T0iP 20S 3/,bK0]]^+]+]=]H @9+] 0-L@P4P " " " "K0hd/0@-0010 S @k0pP0SpqQ0#pTA-0PR @@a qq a``a`(`p@-0@ Q  Q00a aQPPQP0p -6DML@`|0 0!  0  $(`,@Pc'.0 p6pƟ 00 !,  0 $(`0@0 c00$6 06p 00!0,0 0 $(`0@c5  05 00!0,0 0p $(`0@c5  05 00!0$00,0 0p (`0@c85 0,5 00!  0p $(`,0@~c'.0 4 04 $00!4 (` 00,00@ 0gc ,0 4 04 P!0 !$ 0(`,0@Rc00D4D 00!  0p $(`,0@=c003 00!0 0 0p $(`,0@(c003 00!0 0 0p $(`,0@c00X3 00! 0 00$0 0p (`,0@b003 00!$0 00$0 0p (`,0@b002 00!40 00$0 0p (`,0@bd2  0 0!<0 00$0  0p (`,0@b2  0 0!D0 0  0p $(`,0@b001 00!H0 0 0p $(`,0@b00h1 L00!  0p  $(`,0@|b'.0 10 00!0 0  0 $(`,0@fb000 p00 00!0(0 0,0$0@  0Ob(K]a](^+]@+]@+]BF+]p@+]|@+]@^+]+]+],],],],]&,]3,]B,]T,]d,]@ -LxM@PKp``  kT 0D 00 @P0 00 0Z$K -LMPKp` @ҥ,K 0`d0,0\ p 0@PR0 p00 00 000 0 0Z0t03P0S  R R  (K茨ħA -L|M@Kp`P` ᖥP0T 員0D 00@0 0 00 00XZ K(^ -0LxMP@pT` 0S PK` kT@ i0D 00P0 0 00 0 0.Z-$K -PL|M`Vp- @K` Au1\ r1<0L 00@ 0 0 00 0 0Z(K 0-@Lpp0 `QRP PPPR08P@803/(0t@ 03/0V0Vħ̢@ -Lp03/ħ -P0L @T  0 !!\KhSv(^q,] -L!L1L(M03/㴗A,1,a PTẒP4 ΕTJ \0(K  0@&B(K\0K0!0000, KK9j0 0(K 0&B(K\Ph:~ 00Kdp@T 0J⼑ T^ħ\,]A#]$]P^,]0X(^,] -L M 0K@L P 0S1   t0K?P \0K8 P 0S81 @   ,0K+ P0K%P 0K P 0S0   0KP 0K  P 0S0 ( 0KP p0K P 0S00 ( @0KPK,],],],],],],],],]E],]00P#3/P -@`PpLP 㔣 118p0K0=0K>S @T^0@0K0=0KT1㼃K80 4` 0 0LK03/Pp@@3[3[@  ᜡ0S3  SS pSpqp0 S 080K S0r00S6  @0(S! 00S!.@0 0S"$ E$K'FXNEPiTD -L(M0@p`( DK,P080K03K?00 0cKsK0DK3/P3[ K x-L@0P`00 0S 000 0 QKxh[-] -Lv-0 0-0L, @T< P0 Q7Q 1     K0hQT0S@ 0!" @ ##  3/P00 @$ (0R (00(0$ ,03/0 0-L@ P,N@4T 8 b0آ 0- L@ ,0 0@00K0hGQX0S 3/PhOK0hآ 0-0@$00$ L0P(0000 00S K0hl0 R 0 00@ 0rP0 000@ K0h0S`-] -L@P0pQ% 0$`S0 R V(0 (00(0$ 40 3/ R 0S 04 000 1P0 0SKhg-] 0-0L, @P00  0  B 000X8P<00K0hP0 03/0< S@ #"0µ00 <0000C0K0h00  0 00 0-LD,@<0P R  B <0SJ0 -@ **L"(` !PpT 1T 1T04 T4 0T 0T @ @ 0S 0S @t T``@PT @00 P P @P -0^2A4A3A x-L,@ 0` S P <0SP 3/PP 00C 0x -LM`@+P`3ZY@P10S E 60pp P`  l+|0  0P``0C P PYHH 0P8KhYK]إ^&@Т=]$8@m-]-@T2@-] - ::LH#S@P 0 P0000^ 0-L,@G 0P CS <0S 3/K0hT -LM@p,`/00<00H0SP03/$000<00<$P0S @@ R" <0S#,\0 0*0  00p00 P  Ki0YXpN 0LR00 , Ki KТģУ-]=@-] -@LP00<000 <S@0 @ {p`0 10S0 R 0S 00<00 0BN00<0000$00  Y00;00000   B 8 R  R0 ,03/R(VP0PN-]-] - ::L# R@ 0000^ -LM,P@<0T@`0S P *0 *0 000 0(0WW@(K.]] -LM0B.K B@,` P00S0000/KBK@K,P 000 8W0$ KS00 20"S` ^ rP3[S5" Uv\0SY Wq %P \0SPPPP0 RPU*YQ 0003[ S R*(QWq1$ K0 t3[PS%PU* ?WU U U U2W0W0 @00R @@000S0S00ąS)P y0PP00$K(.]j:]:.]uA^U.]d.]y.].].].]] -LMhR@,`P<0S@001S(W<0 Rp(HpW@ P)WHp70< S@ #"0^F  @ 00S p<0W Q <K@0 c @0< ( 40 $8 1< K0  @ X @0 \0S 3/0p< S @ Q Q@ p 0Tp; 0PR00 8|{Т.].](]$@ģ  R0-0LPK0h&P@@  0K0hL^M -`LP@,piP           @ 0  ,  0 , , 0 ( 4 0J@B@N@ -`L@ Ppk0 ,00` I@000  040@00 L000@0` 03/Kh040#40R040  4/  0405080/0@00/ -LM@0 `8(0@,pS P '00( 0SzT0 0S040Y Y00 '<0PY L '0,000( 0Sp0S 3/P2 0  40'( 0S0"0 x (0P 0 0| (0K ! 1 K0 !<0 `4000,000 !/@^ 0-PPL@P0S0P0  R0  K0h x-`L@VP (0PPH0P00P@xxZ -0LP@`pT 0S 0Sq4p@ P Qb أ` -L`@S0PA`!p !x   R6 R5 R R PP@u Q 50S0t ]050f@^y@ 0-L@"50PS0500S %K0hN -L M4 0S FP4 0pZ   `V V V V# V sVH2 ` 02 ` `2 ` 1 ` 1 ` 1` 0i 00 0@PUTc P Ub 00U@ (0V     `f`) 7P 4 -PPY 匍 0 00($QPj -g ,80@PS0  U 0 o PP p0:0X`\ 0 $60SY 0S  0 0 000 0 0=pPP #P 0S PU P   P > P0` 00000&] -LM@K0!$1 01 0`P 1  0!0KΌp K x-P@L ` #R8< R0D  b 8  aR  R   B 0    0S  (  ( 0S    ㇌`Kxhox x-L`P@q$00S  3/xx ^ - 0L 03/ ^ -1@L1Pt` 1x00c50pSb[0500S P SP O P K$P GP T0HS  0 -[Ptc50@^أ0S/P2 ^k@ -0LLM@P40 80  T-v40K08 K1P Pj@Hq,0K @# !p`P @@ @$@(p,`0PL H00SF ' (! ! ! @$@ (p0 ,00`04PG0 ܐ00!0$000 @@ (p0 ,00`04PBG00x0000 @ @$@(p0B0`,04P 0G(K&]Z$^褂v1]$o@^x3^ࣂ1]s@ -0L`Sp@T7" T4T [P pP s$P p0<0S@  @P\$p$PP@W RU  ^ -6L1@` 1x00:50PSt9Zp5pk6T G6Tn 0CT d6T \6Tz T6Tn@R86TL 0TP 0CT`000z6T: 5TU 5TL 5TOH5T 5T 5TEȕ 壒 50U5TR 5T 0CT 0T 0CT&060AP5T 0D0;<5T0@06 (5T 5T+ 5T 5T 5T 4T; 4Tr0@S0@@0*0S$0 S 0S 000p$Kk0S 40@S01$pP0400S 000S 3@PU 0S Q 0T *  p@P@ p0S Q t0@T Q Q @0S  *00 FQ 0A Q0S 2@ 0  AAQ Ƈ0SPU@T0wP0(PSPUP v PPP k0PT S \@000@%#SpV1%q1 0 P K0S0 0A(@P@,@P@0@PA<(00,00780M000800<0F0<0+@0AH $KkyH $KkpP4`@000@V I# P040 A7p@^kB@|B@iB fB@hB tB@oB@f@wt@{f@kB @oB@{B@^^~fyB|f}BlB gBzBvtfBwBlB ^أ1] -LMK V0c# c K0M0000#4 Ѝ/,,/Q21 //0@- Q:0lS* aQ@0S @@T Q@ Q      L   0-0L0Q:cPaQ 0S 00000Q:cP/000/ -LMQPpJ 0A @`5\ I\ #\ \ \ \4 0\ \- 0@ \ \w \#\ \ T'\  \k \ \ T$\ %\  T-\ (\] ,\0\\ 4\ \\ "G\ @\S <\ =\ TD\ E\ M\ H\S L\ @P\_ T\ 0@|\ d\ `\x a\ 0l\ t\ 04C\ \ \\ @| \I  0Q 0Q# )@g *0Q* aRS( K @T *0Q* aRSz( K s*0Q :Sn( K(0@S3 f@0 0Q :S^( K(0SX  @ 0A 0A 0 0a T T: 0 01` @@iY)   @I4I 0@c 0P 0@ 0C@d 0 S * 10Y*0 1 3/t$K -LXM` \ X0 L0K` KT0 P K -PPL`  R@@0F S*10S0Sq* 0 @N^ꌕ@@@@@Ė@@@Tn Tk T&Tg Te `Ti^f*^ c^`*X@^U ^R ^ ^M 0^ P`^H P^p^C ^G@>@T;A@ T T T0T @T3  Y/*Y-: !@@T#*Y* @A  ^ @^ U @T ^@T* R0{@@m* @_0 K// -LMP@Kq`P$ @ W0 PR w0S) 0S R Q   $ $0 \  @0X{$P  0R0 0  0 *k003/KL^ -Lp`*묠p `@ 0PS % R C)0  0  ?`(0 000 q 0h?>#20 0(000,00<0P0p0$P0q0p0pSq0S x bP#?t zbP?q0S | nbP? ebPx?,0 l1 d1R 0S ?Sq0S@1<181$0$003/(04p 7/0 0 (04Py 5/4%?,0  0,000900040940q0S x0  50<.d>[tX$Kk>Z1]1]1]1]1]1]2]2]2]*2]F2]Q2]dZ LZ@ZXZ:]k2]] -P`LP@pW (08.0 08/@($KipZ -@LBPs 0T)S L)Sw 0S S S wS .Ss`yX00Slif(08` 86/(04` 6/(0p8`;8 #86/(08` 06/(04` 6/(0p8`;8 #86/(08` 06/(04` 6/(0p8`<8 #86/X (080 09/`0 0CS #T70Sp`V ,` `x0x0 wX (08{0 09/`x0  {Av`X (08e0 09/`/ (08`X ;6/(08`P 0 6/x0@(08` E 66/(08`= 085 6/(08`0 ;6/x0x0 Fu`X (080 09/` d5R 0S(08` 06/x0>9q0S: 5R 0S(08p 07/(08p 07/(08p 07/(08p(04` 9/ 07/(08p(04` 9/0 7/x0 (08p(04` 9/0 7/t0#Q #0S!(08` 06/(08p(04` 9/00 7/(08`} 06/|0@ 8S (08`o 06/(08`g 86/(08P_ 0j?Sj(08`U <6/(08pM(04H` 9/00 7/x0 (08P7 15/(08`/(0p4*P 8/0 6/(08P 15/(08`(0p4P 8/0 6/(08P 415/(08P  :5/(08P 0 5/t "88S (08P  05/(04P  5/(0`8P  <5/,0 $Kk"Z@Z Z  8Z WW Pp W x-(0L@8P  95/4P(04`  6/ ,PUx: 0-@80L$003/,0 < S`P^0PS 0\ES[RPl`Vll(08pl  07/(04`d  6/(08`]  06/(08PU  <5/(08PM  <5/ -(@` 0,`00(0PL4p8  8/(040  9/`,00,0(04$  8/  000000,0 00300 F 000C (04`  6/  P00!  P$  P  P$6 P  P  P666000(04`  6/ 00< 606060000000,00` r0000 -(P` 0,`00(0@L4p  8/(04  9/`,00,0(04  8/ 00300 " 00 0 000(04`  6/(0`4p  7/00 66000` q0000 -(@` 0,`00(0PL4pj  8/(04b  9/`,00,0(04V  8/  000000,0 00300 @ 000= (08`=  06/(04`5  6/(0`8p-  07/?, R00 R 0  R  R0 000 00000,00066000` Hq0000 -0BL@`pS񟗰 @0@@ȵ@ 0"S 0"S (04P  5/(0`8P  ;5/03 $003/00S S SP S S P SZ@P06S(0\8  0:/(08  0:/(08 0 :/00S S SN(08p  07/(08p  <7/ 1R:0S70 (08Pt  05/+0 #RM J  080(04P^  5/(0P4pV  7/8 0R80 < So%oh 00Rl ,0RY d0R0S S S00S o0QP/ Q   / 0S S \ 00/0/ -@Lq",00$00 000 000t@@@X@^"0q3SP R Q $P/ -pL@PT@000 P# `V#  P@0@S ` P  P  P@`V0S0PPP@0    /0QP/ Q   / 0S S \ 00/0/ -@0@L0400,00(0 0!00@ظ@0@@!G- @M,@d@8@0T\ @Ü @DP`@ǀa`P@T PURpR: R:P@TF PXPPPgP pW@ @@@eT@!U`x`\`V I `$ X * W pp% pp`\ p`P0S`  , ( Ѝ S-L@pP@ S SE0Sa@03/L070`00 Ԑ@cpcP@03/L0 3/U&@pPfPU D03/P0 3/X P@@0P3/L0  `H03/T0 3/ħx -L \0 Q P@@R*0 `0 57]xZ -BL `@<Pp P 0 0@0@@D0 $p0 0(,^ 0A<}  -L57]0(0,0000/ -LMp@P x0  0X"0 S M4S 85U (2d03/ 0R{@@@l@@`T@f  "*`di0V`!80  0@Pf`U  V`l "*0T@c %* f\!0d\!000 4 @ 004  A#AR p  04 @ `Pl0`U  V`l "*0T@c "* f0d\!\!0 4 00 8400 4 @ `Pl v5(K7]\7]ħ8]I8] -L@,PKM@%0P  T p`00V *8 ab00 j0 0 8 @m(K -L> h@N@T`Tx3v#p0Q  0BppPpW  0BP0p4 W-P ` 0Q!*T4  RQ:Q: 0S 0000> hZJDp ` 0l @0X{8]\ .0-@N@LP?i$0l0 0K0h5Bꔈ\0X@-A0\`Tp 0@TP 0 10@$ -LMP0(p`@UA 0V*)4 K00KRn4 0Q #::080 0   r 00 0S "88!880 00 s 3 >00L80  8 Ki jZ! 8  0P @Pj(K蔈\  -LM`0(0,000p@V RH0DP DP0800P00P0(`Pp0K^ -LM(,p( 0@Ro0P800p03U0SY `VRA3AS Yl1l!0S $S S:0Q 8  80 00c'80D T0 b!8 D0>00cCƠ: T#*Vb0 4 `0 Z0 0 0P4`j  0`0D00 PP (0p(0000D00(K^ -LM0(,8`p@P00X P0P(000000p03V0Sp 0  V1  00 `i0(K -L$M SPQ*04K0000# 0 0l@P+4` n` `pV 8 d`*P8p T"ʌ 0@T ~k  `p 0@@(K -LM@`Tp$ @P 0U00S   0.> 0 0  0P P@  ,k(KA-PP`1 @pT,\ R"*b 0R .  R*\*0 0cS0!>0>00@-///!/!`!//` `! /!=!E!M!X!`1/c 8!0/c#c4 4#1/!^!f!n!w!//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O0- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8 -0@Lp0`S(   Y (0P 0 H]0S L @2HT (RTH@ -L,M (p ` K<0K@P040K0 0CK@ ^@@P080K 0<#K4|P@  80R $ 0  0(K -L]M p@0PLA  `Q LQ@41 0dA `(@UPudQYQ d040 00CSr0LQ000P  0@~P Y`PX0\Q PSHQ  0=SM x $PTQ `QU4 R L0RP8XQ TQ8 P 0XQ  `QM?K0P? `P $LP|Q ,KPPQ M_KPEQ 8|QQTQ4P x8 0MK0?>P4!00 PZ80TQ 0080 Z0  P 0,K0  QXQL x !"s \QH .R d  Sd!0& SGS~Y H\ ! oP0 2,K 4!80< $[4hQ l1 ,K 8P PQ 7 K 3 KθP 01LA00LQ0 0 ~ \QPE\Q HQPHQ PxQ (K0 QT0LR#PZ/ -40ML0(0 0 0  K8]Q/$ -0@L @(R p e 0-\0@L0PS 0S8᪚  d廹#0Y8] -LM00 0@0R9(0C 0S@   K1 0c ? R3 00 R/ (,( @(@ ( ( ( ( ( ( ( @( (  K  K![  0 K0K1[0P $$0@D` pU .0K 2[P6&0`Ff+S A C(R R a D(R @DH$HcU .0K b2[.S ;S P  .0KTB[;T(K褦^Z -L M Pp|U=0@`0@PVQ  .0K4 0w03R0S`2[ A C(R 02K  R;SU6 0T.SPE2W2[& R# >  e R##&-- ##? ?0,<,<0 0  R##?0-<"-<0 0R 00@PU?00PҰP(K褦^// -LMK eo K -LM0`@Sp`  ,KnB,K bKBKKoK 0- PL0@00 0( ?! 0!""##$$ Օ000 -L$M@p4K !o A_` nA04@ p$ @(00 U(0PP $0@0 Rxt!'F00 I)<0K 0?VtP $$ & <000 P R < p0 &ZH WL H00P0001`0h0ՎX0S 0 0S 2 c80K0?080 8 8 8P `p <Xp(0"&100CS4@D@@@D@D@@00h0 00h0)aL 0j0S  0jP0H `RL00L00`(K:9]^9]9]9]TZ\ -PLK 0?rPY1 0c\p0P00ãp0n01 p0/  0 Xp0  0X0p0 0S&V) 00"X, Os P JsPP PuP3  AsP U P  pP V nPP nU nV nZ  ؑ (KedAc9]9]9]9]9] -LMpR`ሁ Pu sRr4  Um p t fc  0S] 1( K先PW(0S ԮP0UP(ˮG((0' 0000ȣ@P340( @P*(ξ 0(u@(òT(  꽾 0P  A!SR@ (呮0 0H0 (壾(儮$K@^X\ 0-0LxMA0?P" KXPP0 g 0KP (@P  ᯈn\H ᤈK0@^9]9] x-  LPGP @0S HM t`i0 040:40xx 0-L M@ PR$Kk0( K $!K1/P0 (0 XU@PF0K0 p-L M@K a 0+PP`P PKp 0-LMP @,P 0K0@-@0S;0s8 0QP2"SR.0q+QP'0s$x0s!|0s 0s0s 0QP$SRq QP 0@SP-- -LTM`p0娀S RL@PR0( 000@ SU @Q@P L r0P R H0 0 000o%P `? TK KQ%KP0F,0K #00 00<K4K000$KepP@=<0 0 b Y D  ^P<lU+0S Y @@  X g?K@X$00 cD0 0Y!L0@PPKTx 0<K $K p(K -LM0@(X0SJ P iQ EtQ0 0K oP7B0$0p0 @`_`@p_WV%0 10RP0P UP#P3P0@ 0 @ 2 K 0xP U 0 0l0kU[  T0P  00a00 0#[ b (K蔈\ -L8Mp@`P8!!""8:#:0900 000X0Hh0Xx0)(L 0"LX#0S  \0KD0 0 0DK \ @0 0#KX 4 0TKL P0 0H0 ?P4 0+b" 0|x0(0000L 0(00$K -0L  -@L E -LMA0p0CSg"#ISR8@P @k80s0$ )i@80sk(0KhK:] - Lu!:] -L M`@P 00CS 3 pቡ0(S I! 0嫉 0ち K00C S! A A AX A| A A A A A A A00(0X0S  0%  0+ 0, 0  0 // x-P0`@  x0L00H& R*0X6x\6S `&R \&@`60C`6H&Pe>@x -01B~L0` S-$=R= R   BR!R)oP @0S 0! P%0S c> Pd0l X00 \0 =@ 0C@!hc>@0C*8( -LdM`0pD S0p (P$o4@pp,tr pH0S\680 @0  0#280 [8@ \`0X6 0p@&D6 0KDg0P p0 ep0L0 K0 &KKB> 0<0 = KRK 00P i= 0KD9pP000 Z K͠ 0'K ? Pp q Zpy P Q L R  UB> 8 <0B4;$H0 L $K ? }  0 X0BS 2 K 0P <20[!S07 & S0r000!< 0000000p 020K-4pS S <,p "0p.0-40020[0X0S  Pp Pp_X0Sp 0p0S W @`&8@ b 00P Nie> 0X& (Kh*|D] 0-@PU{TL 0 0 d 0e .0e00000 -"LM0@UT`CKP 0S00\"0CKUTDBPKUT P " "0@PŸ 0NCK}NTP.0Hep!7#D Pd 0K;eCKd,1#@TPCK$ό8PxA%DP$7#hAP@PDKXA$1#KLA 0!CK 0 1,? ! T0CK@TPKUT*aP  0@PSR*@ğ 0 00C, 1#<, 1#, 1# 0R(Knm[:* -@PLMT0"0d"`p0d#K 0d "0R"0BPI"0`pt"0dd!9#`VpH"0d<Ÿ,1#`Vp>CY%}.d0LQ%@P!0d,1#`Vp1! ?0[OP8 <0 P8 <0[P t`Vp 08 <0 P8 <0ET ( P `Vp 0 @P  ?V `VpUT@P`@.0 `K-d. 0K(d@P< 0!d < 0d T((KQ*m3:n[QSP// 0-@0L(MRP& 1CR 1CR*00 0-"P 4K P !P4KQ$K-Q $K $K 0P $ KM,K0C -L ˛ 07:]A0000/000/@- M8Q#8 'Q 0C8#8S LLQ QP080#8 R ܍A-`0@'Pp@D- ++'R  R R S: RP*0pS* RP*0 S*\ *0 S*0T S*  0  P  P ,Pr    /0 /^ :: #6->Lp^ x-L@!::P#>VoPz0 0000  00Kxhp^ x-L ʠ ʠP,ƀ>H`0@S Px00 3/xp^ x-L ʠ ʠP,ƀ>H`0@S Px0 0 3/xp^ x-L ʠ ʠP,ƀ>H`0@S Px040 3/xp^ -LMV@  LPP`L P T My808U V0A00>K:]=]O:]@-\0`Sڀ  @!`18 00,000, !@^0 !<0 `4000,000 !/@^ -LM@PPLq0S00 $`6/( 0 $`6/ 0$` 00 6/ 00 R UT  $  S$R  !(0@0 $P5/ @T 0 T@ 4/0 @ 04/ (Ko^I -LMPD!::#>0@SE PA N0p7`4LP0 xѲVo(뀀儐0 00 00800T0<! ?Da??a?`@P`P -0@ LT0\pu`P 0S lP  0$ 0|1T1 Nh1T$ `1%%:<1T, H1T5 @1T( 81T;6 1T 10S/ j)0T &8F\000\0k $P |aB?@@GXP(Kp^\t]t@yt 1 xt {t 1@Xt@1(@jt@1(10 -0L S 0000800T< x`e@P0@ 003/᭟0S SP 0@0Sxp^ -PL`!::H#>:0@S 3P(p4 P$0S S\0X0@ 0990p1SP!0R또V@ w또0B 000 X0      ?   &   +    +           ( Rp!R  R   HR㜀v0 0 (0KS0ږ S~0A0Ú0(0l1(0p10P100  R 00 0208d0h00 00000 0 000`0 0d h070003/PX_0S\ PXp^^ - ::Ld Y@PPX0  x0S LP 0 PPP0@0S`0`00S 3/P <xPV00V00P18 < 0000S0P00Tp0 7/8 <p$0 3/q Z^041]"VtX0XK@X1=00  0K<0 P0 0040 \0P )P P (P P06P0 0p10H10L10T15$: x0l0p00 0t0?000t Wd0  pP0`0 3/pP 0@0SP(Kp^x:]+^ x- L`": :#6>0@S PxP V_V0 00  00000t0 000xxp^ -LM0@S OP 0`S 000lP(0t| 40 00 hXP00P0T0 ST 2< 0"0,p@pp00PU 0%0!Pc 8 W6   L00L0T0 ST <"<800"< 0,< 403/p 000 PU % !Pb 00000PpGUxP%pW) lPV_Pt0h0pgtpW:0 08 <000000S000T0 KF?KKm/K1 }O@P1%0.KK?KK0l=]r=] -LAM@`  Q L!0 P! 1 T!1 0 048(0000_KN PMKNPH0 1 (0b/K1 0=P_/K>6KpGH 1!0R$04$0/^ 0-@ @LPPR@ R` K0hFR -T0L$M@4K @0#4K(04K0 00p0GK萶0^ -LMK zR K\0`P/  !`80 00,000, !/@^G- `HMp0@` `(pp 0$@ `,pP@0$c$s$$,Z, 0 )i@0P$eZ )j@P$ \ 4PP0@@(dH P,eZ@($(p0'dLc8 8P,*lʠp0'c< @00@@`0dK0S0 0 00 P@ dK@ IK E$K -LxM |K#P KvPK0P0K0P 4 0K0P0K 0P|K\PK `@pWPp@@TtAX@X ,L H:Kz>]expa~=]=]nd 3=]2-by=]te k*>][[>]DugAmA 0-LMK3P@K0 p-L M K$` P @Kp p-@QL M`@ K P Kp -LM)0p@S`P  (+P@VPVP  @*"%VPVP  ` ( @+VPVP$ P"% K[>]>]>] -LM`/$ 2?0Rpr BL@T@@@LQ@Q CQì@LD@!N@@ pP1 Tg 0H0 00 _  0KhY 48<$?]I?]p?] -LMPQ`@}U2 p CW W0 0px2tŸ0 *R\"  L"K!' <"K,"0L1SKhJ?  K K K? K K K7 K  W:W\1 W  \1 xx \1ll \1@`` \1  P L H1H!0S <1*B0S ,1VPU1 R0S  0 R0S  W T0qGT : 7   KT[?]0^]:][?]?]=]a]?]e]?]?] @]@]%@]?]?]1@]>@]J@]P@]V@]]AXVLq@]%]@]@] -LMPpU`l2lB03/0T1\2PXHq8@0 002z 002 00x2 00q1 00j1 00c1 00\1 00U1 00Np1 00GX1 00@@1 009(1 0021 00+0 00$0 000 000 000 00KhJh dKhħ@^@]@] A]A]8A]UA]vA]A]A]A]A]A]B]+B] `S0@3/08$$#$  3/0J]J][J]J] -LM@ 0 3/03/;P`CQ  0\+%0  3/"R0d 3/P˟%.T !3/ 0A0CSD 0, `3/D` `0v3%&%h` X0 `00p0 %8t %P 8` `x 4 0` \!H L I0 !0`0T | If  { \ ?  ?d0 < ?3%`` @0 `0f:p` a` `H`x'rp y0`唀 p'rp 0ph` 8p∀a㤀 `  <h @  dɟ%`  0 1  updl` 0 @ Q4 !0AYSꠏAAdAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAADAATA0AAAAA A0A@AAAAAAAhAܓAPAȐAApAAAAA`AADAA4ApAA̓A(AAԐAtATAA ATA0`c0C S񟗾A`AAAAAAAApAA   0<3/ 0,3/@ 03/  03/  0 00 &00 !03/X0  n{8 0|p 3/r8`V0`mg4Ch0<t 00 0(4Y00U0x 5%0S0G 043/50S; 5%0S6 %03/L\03/ #0HO8OS0 0@43/@`V 8%80,3/L\03/0T03/ 03/03/0<0 `q V <0S<   D 2/ FQ@pP00Ppx\WW ?d\p]gτ1S 1 01!00 t0 -  0/g 0*g0 0<pl0p  Bp 0S  0 lSp80p$q000L(KȨ0N]WN] -0LlM@0*PI 4K P3*R>j#K-ᜐ堠***+0 `<0 B 㛐]_H` A א lpt q8p 媳H0t'Q k*eK`V'Kp 0kfK`Vp%K*$K 0(KdK'KRphKVp %KdKRphKVp'KdKSR%KfKSR<$@P8嵳YTP3P 0DS 000`0 p W PRp  <h l0 p ?Ph l0p pRpp0S l0 !p tApl0S ဪPR/Y 8p080Cp00S  0 ^pegⶾP  0 8p080Cp00S  0 :pA Ra @Cp8p X 8P|8 0 @ 8a 'f/ 01@01?aj@P5:  188 00. <0'+JH`@`d 5p0P 0p0t0  0t0)(K7]HA8^ȨnN]N]N] -LM0 !@1 0GKpD  1  K1 lP0 01 kt0K`X) 1S(0S! K  K@0e0K0<*K%K+$K<KE/K P 00 0p00偲 $K -Lp넀@P0T*0aV >P UP 0 ^@ȨN] 0-PLDP@0T*0Q $C@K0hȨN] x-AQLz xMP PP  t0P` PU$* R \ 00 0Q  Sh  000   0(Kxh8^O]$O]Z^Z^ШGO]̨ 0-41LML0@SE Q . K? P6K Kc P0 < P K ' K P R = J &PU 0 3/P ㎈ P <P (XK08^O]O]O]P]-P]̨ -L M#K0`@ P2dZdh` f` pV( U@0p0B$0 0#K#?@^@ Zd00Cd0 4 E(K -L M`pP @ T&* X  0 W0 =P QP QP Y C0 ?0 $@  (KȨUP] x-L@TP`HD00#4S StP 0xx0[ -0L#R ""00T `(0 00(p00$00,00<00+(04p 7/0L0/00 0{+ $Ki[1]1]([:]P]] x-P BL@0R-AApAA 0"S*$ 0"S (04PN 5/(0`8PF ;5/03 Q*  0"S *p + ++x -L3S 3/ -L0 #R" 3S 3/ -DqML0Rb=0᳐@  0P 3 <30 0S. =03V>00@`3<3 -3MLpBbsp?p0pP  0 0 0.> 0R ` `  c(KAAA -LMP`FPo@Kx 3h RG 00 0(p0 00 00 00 00 00 :0 0|0 0x0 0t0 0l0 0h0 }>d0 0  0`0 g` 1\0 g1X T0 0 0P0 gP 0L0 g 0D0 1|`H 1V@0 0``hp<0 `pچ`p000Vppd |P PP/`  OP `` GP`p``$KP Q 㜃/ĩ^ -TL @99P 0S 1(S3 SPQ] -LGM0`@3S PP1S Spp2S $xP22 1 Y  1$ P000,08040"1X" Q 7 BR7 0 0$ 1P$00CP ! l0\ ,0K⠐#0 10>.0 S   cD0n4 f4 00c1 0A/K  B?K4 C0 4S: S5i0!101   $js Ⴣ1S $\sX=0,SK  0, p1#0 0L01H 0H0X0@ !p (10S002 020000hp0 {l0$03/1S T0 ix g (KAA -0L$Mx03<  C `( 8 @8  0 <$ pPs 3 P4p 0p @ p30Q`*0SX0 CRS0<$ 0PK RG0SD( Q=:Q Q! Q5R3S1@0 6P@0* ?0 4 #R!S6Px /0R@0 6P@0  S 0P 500(P000 4 Rpp 8(K4[=[ -LM`@Pp[P 00 0<PX0@0X0K -L MX0@ P 0S P 0PPPS*0 P000p S S S  0g Q  Q` `0 R R R 0 f0Q 0 PPK V0`  ? ` 5 0=00X $` $0X 0cEP p  m}p =EX0W X  Ru!qX0`P 0X0 0\0 R 00X0dp V hu!q``P  (KQ]P :P/ ^ -LM @:#: c  00> 00. q D0 (0 1. 1D0"& K@^ -pL`W 00 00P0@@P@@WP  .P^ -LB@PB 0`Rp:0 W@ p yq00 0000^ x-xL@$ 0$0SP` 0U*05# P pP0:000x^ -LM0 qSP @1 +0:'`!P#L0tL00L0Հ'q 0 h qn00 ` D0PP 003/K p-L$M 0 a 0 01@0  0@ 0 0.D vPKhK 0-L(M@P @  K 0vPPK0 -LMX0P 00Š@0@0 1Ġ @@0@ cUT@D@ 1p!@`DP0l e<00BS`e *0 0H0b0@00 0@@ 0KA 0-@L](08P岹 1<5/0 -L`P̹p@GP(0 00(p00$00< ,0( R0,0(04p凹 7/0 08Kh,+} Kh1] R]l[-R]SR]:]] 0-0@ 0LP#R pT T T03 hp"&*0eR] 0-LP @-P 0? 0[P 0)] p-L MP@`!QS 1 1   L  00$0040(0t800S`<\D@ H LLDpMI]!^x[R]R]S]R] S]R]R]S]=S]eS]S]S]S]S]S] -LM @pP` 0 R PAP  (0S ~@ ?0000L 0p(Q 00(0L000S  0c0 + 0 000p@$KS] -L MPp \`@ D0 + 0 0pP K -|tLLMtd0@Q3/03/- 0-00S  !``0V`s`V 41  u# z  0 qW \0K0  07/Px{3( R0B V@x Vx X|: 1D0`0 :S0L ~ V p 0p !7rx'x:; S  S >+?; S R | Wpp`0 0l 8Ph l<"l1S(0d0 Sm 00(0L0h0 `(0l %ld 0P( a Vh 0 \Khl0 6+l0 \ Sh !xP_/p0 `0  0P0 0L0 D @ \ K,4Vd ۇaL0 p`  0kp10S~(0S= L00R6BS8uV0 0&R $! R &R !  R !q Rpp~@d  V h&|d R0` 0+ SP |00`0 00S9\K0 *` 0\` P0 0(Kħ@^x[BU]0U]̢T]T]0X -L8M- 0-P`AP0UPsPU 41  S 0  !UPL 0LP(1`U U*10STK0 l*0T0 0H0 0T KD0  K@^qW] -LA>A0B30U   00!.1  0R R  0 " 0<0C 0  R0 L3 0  B 0: S 000?  0 L3" "8匙004S 3*0+')0 4P <)0P 7)8&(KTU `^TX]"X]5Z]AX] -L$M@P <38`pR` 0K#K% 0QP (@P800c@_#Ks%` Y"I!P0 0S800 0MP(`@YD ! 0!00C0  R0 L32  B \%1Rp=SmT嬀 J J 1PU4 RX0"   U@ D $0@0 < 0<@0 8 8@0 D 14 \X2000U D @0 먀 < <  D @000C00T ST T  ST0T0010C000 0 (KU T -L,M8@#KL3"00PpS@ 00W Tu\%t4`R 0 0T  BR 0 0K +P000`3P #RQ00W ß  \%3R=S (00W!0 0000#KT3`S U  QPEB^A!^APBUP0( 3PT0`Ws80 \ !4 RROQ ᴗ 00 0#K < ?)$80Q0S10CB>A>A0B30pg$0,0$0  ? @ L30  00q40040T3S U  QPEB^A!^APBUPṗ0%( <\#KD D R 0S10CB>A>A0B3 0D J$00g$0  R? @ L30  g 00D 14 W pg B4 a400400 `cT3S U  QPEB^A!^APBUPe0'0P ' (KTU `^T -L,M#K@ 0 `4 ?m#p  \%1R=S ( 1帠R\ ?ᵟ S#P1>0@S< ? 008#K@ D =@DS0 0 0UT 00@50 000T@ᯖ  0 L30   4 : S 0?0C0  R0 L3  B 00T3S X  HBA!税AB(Koʖ`^TU cX]X] -LDM$K #K @?K"PTp  \%@58 R=S (K T?" 5P ` < R` L00W*`p Vw P X&@#K $K@U   0&0800  0 L32   804D c` V  !@ 0c R3@HBA娎ABQ0 4T0 Wà30 QP 0S  10CB>A!>A0BRs #K ?@ $KD@0@$08s@0$0  ? 80L3 0  80 0cR3 Q 0D ` V P $ 800c$08  R? L3 0 a  0000  0 L3 000\%2Rk=ShT嬀 I % 1Pu`\X 2000W \0 X 먠  T T  4 4   \0X41\X 2000W \0 먀   T T   \00 000ST T  ST0TPP100T#00R 80S10CB>A>A0B30<(Ko``^TU X]X]X] -L4M@ ᜠP?!0 a8 dK\%08 R 0 ?!  T8 ` N 0 0K  (P80` 00^ ^ $ 00Z0 @$KD0v%(KTU -LMp`᪕X @8@ ? r?T X! 0 TX ? 0h K -LMp`T @ 0_@s rt0 0CR0 S x\$Kk貔 -LM0 8` @ 00pX?  T⛔ W!E.]?` | t 0S 1CP  ?!  @? ),P?@ ? 2\L#  0R 8 ?! L3 20S\ 8  0(K -LP0@p `8 (a` ' 0Y\ Q 1 CLt ?T ?8 ?!@W aF0  ? @? ?,P?@ ?2\L#  0R 8 ?! L3 20S\ 08 ? -L4M`p@P ?h\@$ Q T  B 0 K 0 K $K|&P030pZ #R "T  ( ?1l3 PZ`@O< @00Q`0US P  D 000C0  R0 L32  B  T08R3 80  ǒ0 "<0S10CB>A>A0BQ  80R``PU P# $ 80 0$080"L# 0 0 0H =00C0  R0 HL3 00C0U001D0 D 80Q0c R3PEB^A4^APBQ 0H NH80Z< 0S  10CB>A!>A0B30ï$00j$0 R? L32 j D 800c R3 Q 000T3S X  HBA!税AB %0"(KTU `^ -LM`B@@P8A8pP 0$Kk$K[ -LMp,P@PPPhh 0O`P ,  o k Y:0pKA>A0B30 p0eK0P * `p= 0D0S0h h ! ?! 00X 0" T  B64P#SR   40 0D  4040 , ,400X`d3Ԁ X`ˡQ Q9<\>D@$?# 0@2 P/20S  00$hb\ 4 P\ P(KTkY]Y]U `^TY]8^Y]Y]Z]>Z]BY]Y] -L0L03 ?,0L0 @ D@ 0L@\LSPU@@PY0 \L B ^P@U@T0 D@ 0O@@ T00C2S0!Rh0 00CB4 0YXK4P P PEQHUP\K 00'KR ?%$KR0KLH,0#KP 00$KP\ "X!X? 0D PLÖh"œ\  \ RH# R/ RLÖhœ\  \PHP D RLÖ@Œ\ L@ Q R_C ,?UT@#P#dH3 \0 R R  B 0X0T2 0 0= { T d\0$ 01/`P X@T @ 0v\0`(0R0 S0l0P0;00S h!x/t@ 0*dS h     R S0h 0!  000S0 h  0! 0 ; 000 R d0X00 00 R l0P0\%0R<KHA#K#4 0L `ދlYND 8q(K\BZ]Z]Z]Z]Z]T[][] -L4M⸐`p ?0\%00Ad0DK 080 1R 0  ?! @_` L0, Y`$K`Y0K  P0l 00Q Q @ 0080p$K "0 (KTWZ]U -LM⸠`p ?0\%S 41 R 0  ?! `  R@0@@_AT  B)0, Z0K  P 0@ 00P Pᵟ P\ ?@P URPP%(KTU -LMp@8`L> \%PR P 85 K@00@@ T @T00KKTPЉP  @P KT00 T 00SI  KYX8550%0@550L05000X8X6Tg0 0p00000 00K0 0P KP 0 )*K'@ 0T0 0  /P%KK TP}I 1  K@ P \UT*8%@UL0@@P@PU PU) 0@ P+KT 0p00+K@ P@P0K0@P+K0Pz*K剑 00 0qP UT@E5P5L050@%@0P@0TՉ0p00+KcP0K0@ P+K\PNPU KT  B+K@ P|0K00K0+KIvP50t 0C0 01-?@T@㛉+K,00P K00KP0 @+K#PPK&JK܆KIKT  B00 00 00K0 0uPhP t0 Ԁ 01@ 0@K@0 0@ P@KP @ P@MK |@KP0!K P001 Up   HPĐP @Đ PUPg T+0P 0 0000+K K-K00 0 +K K K00 K00 0 +KPV KK.K ",KT K B-0000 00K0,KPP Đ 0 KSP01 PKKU@P PT0,KP2H0P+KL00P 00K0P+KDP MJKQ@ T  B00 00 0 +KP @@@ .0,K2H01@ 0 @ 0T  00000K 0+KT L0000 00K0+K[P @T@Y|@KgYe  2 0 KAPT0M \%l4@RT  K B'+K ! 0+K0 , K ? 1#+K 0 T@_ L@@ P0K00 0 0P0  IPUR0 00 000,K00 0K 0%IP0H 00  @ఠK0Y!0 P@@K@@ PK@U *000# R00@T" D! R?!85 K@00@@ T@T00KKTP ЉP  @P KT00 T 00SM  KYX8550%0@550L05000X<X:TQ0 0(000h00 00K0 0{P KP p0 0 0 @ 0T0 0 P  K[]Tc[] KK TPsI0 1 KS8 P DUT :@T 00P00 8%@UL0@@P@PUT 0(00+K@ P@P0K0@P+KPe0  !P  UT@E5P5L050@%@0P@0Tņ0(00+KP0K0@ P+KLP>PU KT  B+K@ P|0K00K0+K9sP%0t 0C0 0 QU>@T@㋆+K0P00P K00K @0P+KP@K܆K@@ T  B00 00 00K0 0ePXPt 0Ԁ  AQ 0@K@0P 0@ P@KP @ P@MK |PK@0!K P00! 0Tq   9@Đ@ PĐ @RPk T0P 0 0000+K, K-K00 0 +K! K K00 K00 0 +KPZ0 ",KT B0000 00K0,K P P Đ 0S@0 y @FPO8R@P PT⭅0,KP2H0P+K00P 00K0P+K1P UP@@PU T  B00P00 0+K PP @@@ 70,PK2H0PA b" 0 r@ 0Tw  00000K 0+KP0P0T L0000 00K0+K> @T@Y|@KgYe  2 0 K& PT0M \%8@RT  K B +K ! 0+K0 , K ? 1#+K 0 T@_ L%@ P0K00 0 0 P0  IPUR 00 000, K0 0 0K 0%IgP 0H 000@ఠK0Y!0  P@PKPP PK@U *00 0?800@T 0h DBh@ 00 0@0x03T0S PP rPKPP @K@@ (K -LtM@P$K8`DK@Q tDP@?<#@0DK@0 @TP$KK@EK0P 0TP TP 0 080K0$K# P@ 0 80 %41d" d"0$ ;60 0R #00d8pP8PpP 8P 0 0@0S8000TPp`p %0۵800 ` 0 \0PAtp R   R!P!080`@p0St@DK@@PDKD@? .'K$DK0@TPDKTP D ?Ad@ P@'KEK 0TK %K 0KPJ00Sd 0K @&KK. \KT B 0 0L040K0 $K#K@PPp009S \ 00S000# &K K@P$KK 0$K%K R0%KP\00S  T Br$K 0L040K0 $K#K@PPp`\ 08*@(K@^[] -LMp |1`0SX ` d {P` d0P 0 00 R;SR0X K P00S<  1 < 0 ' 00 0 0 00 H 0 {80Sڎ N {0PP#K R00 {K P0<0S 0DDT   D0TH 000 080S[  00S0h h ! ?! 00 08SPYU @PC{00{L{u3B#K R00B }{V0br K@PP xr{`@#KPP8S9S @P {U0PQ P00J{LH{V Or(K@^[] -L4M⨐@ `8{4p1D0 0@Pzz 0S S 0 0R000 0R  0 p 0 { { 0 0{{\ GpP r0p0`p0@0Q 0 '#K#K R0SR0Q%` #KSR$000# #K[P 000S0h Bh `! ?!00S0  `pW V0 0B?K$KV0eP 00D @0K PN1t @P@TP Pf@ T=00 0P P0SRK '` \#KSR!000# #KP 000S0h Bh `! ?!00 0 k@0t0`0 60 R d0X0 00 0(K/z-z0@^B8 -LLM 0"P@00,K`H 刡 `!T0D y\$R80S 00H 0p00E000D0$P ? 01P0 4 K0PP X ᷿ 0#K4pY@  0 "408 1L0 0B?P 00I> 0180 @ L0PP 勿@ 0 @ p 0S S 0 0000p8 ppL00L0Y`VVYiy(K #*@^B[]\]82\]X\]~\] - 0Lp@`y PU 0`R000 0p RpJp8S0007yIx000-yV  $Kk5EB -L\M@dPp 0 `8D`T` x )$K2T K,0KP0 P00!P @T $K R0%KR0PdP `  80`K 0jS0! `0KEKR@K ` $KQP`:K $KQPKP @ŘL0 `L0` P 0 $K`   ,0K `#4 K 0 00000P0` 0$K1 PP<0 b \ @jT0 'PP<T@P BZ@PA ) %< 1S 40ß3 0Ÿ40$sE X4S 0 0X4sHD40 AXLc@ T&800PT 0 S40 Pd B0 AK PV0P!`0 1  180@$5SP0K,AK, S$%!0!1$P 効CP  `P_*GP  C\5p S??L1!PP@ ?# K01 ?! N0@P ?x ?` m0T  Be00  @P B A #   B9 (K]]TT]]]]]]:]H^] -LGM0@RP0 p $1 F000!0s#RX4  =P ʣT`  q-PFܦ@@P 01 y~ Y/ $: K0 ?( WP(n1,K 00\% R-h0R Rh0KQP/K/QP 5V.HR^ڴ(h1@ 0@ 5!  % 407. K/S> ) %< 1SE  40ş5 0.407 X4S 0 0X4h0 SB0K1 dPKP0000 d4T P BQ04 K  P  5   0 \000004圀A$5 S,001 ݢL!Y,80d#0S400iT  B(  0K uP(1 0 ( 80 ($5SPÄ0, S$%0 , HÄ 4 tS9Ӭ4հ4S@0Ӱ40T3 `!0,000(5 0S80@0@080P0<0 0@040:4080<80$Pp t0D0t 0b0?oR0c0H0T0 0CL080P004080]q \ 4J D\4S p 5  0! 00400 (40L5  @y;T h! qP ,V P p 0 0(K[TT!^]]]]]:]]]8HA]]O^] p- 1L MA1eP8 K~PP @- 04 '4  @P    40740}  0u/ 0P` 0Y ̨ H?  C>h%Kp@^9]A]] -0LM0@S@ P `QpP HPHTD ^OPKP KY -L$M?`/?PKh0`p000K P0$+4hPP2 5h a1 5000000@0\%R=S04, 030304040 500" " 20 5Z0` e-P$(KT -L4M@ < 408 ALs`@T,800PT 0S40Pd BG 0 0K<PP0 p0 ;@00S8 @8QP(KH -LM∁R@0  R4Pe R` ` XP% @40 K PU0 0Sp30݊P4000# p0\ 0!QPp C?U 00 ?80#10S0ppMC00' 054p0EOW 0$?`40U$4 PP02C 0IM`0-OV0 m`P Ppl 0C0 EM0O0> Pp=S40  PP 0 40S 50ó 5=S4   040=S# P e80 5< 0!00401 Q000000\4S $40 0S0E0S? 0 00 #`Pu/N 50 5=S 000C   O "XE> 40SOh 401400`>``p2(K@^X\]]O^]:]`^q^]^]^] - @`L1LPqP 00 P@=S \P0 0S yn7B Q[LQ>$%0,RL1ch`P [TYmT40@: @408@^ -L,M pP`=S =S ⊳K 8?98K@C0T@s@0@K4P @8P4 KmP AP =U  0m 0U   LP00 @0 =@0@8-U T0Sʄ0S A U0    LP@M=S 00@0C P@c8(K5Z]_]B`^ x-0QL@Pa QKxh88P 10 jPP}8PP x8xx@^-/-/-/-/-/-/ -LlMP P @ 8 SRP 0 6S   d7`)WV:p0SP` 0 0S     )` R0SR R H0r 2 00 0 pP ,`K00&T` `V K$K R0&KR0pPp 0KKKK PK f$KSR:0@08E@@5@L0@850l0 l00 cP`1h0 &KR0K `Kp D$KQPp :Tp 0 $K@ p'K PK p +$KSRp*l0p@5L 00 0, K4pK 0"0pTp 0000 0@p$KPp<0 @bTT `hp0 pP<0PP@@#K 0%K#KKR%K0T  K@@l@ @ZY@P0K0l@ @@ @1/@T0H    00 0#@KR%KPDP T@@z-p((9W( K@^q_]x_] x-@P@L` . 0803/xħ x- 0L@ S(@0` !P 0S  P VP Z L0 R0@P @@ 0, !xx^ -@0L@p !P`0PP * 0R00 @T P $  0R00 0S,,@```0 !!^hBlB 0  )?)/ 0  )?)/^ -L M@P(T! 0p`p0 X0  00 00   0Ghq$ @<08 LM1$P10 00#00 0000 0  000%' 0 0 d090000 @0c 0iK`0hKdpK p)K1/ 0 iK (K ?Rp)K\K0\ K   )K1/K06%KP@>8_; 0Sd040d0`40VQ 00 0S 3/@5 0p W,0KD #  0(KP` ^ PPp  p0P0Aq!O 0 a0V``V00S  `^0Sd0 `` <@0`  p0 %KhK(K R0kp 0"&*CƠ ` )KV0iKhKᜐ a?`p gKhK`AH ``p0k K(K  p0lK 0RpgKP vzp  \ ` V:P LK $LK Td )`V d \ 9 T*03/`P d)\@T ^# KR@T `L0KV@K(K R0"F`Jap0K KH(K@ ` " P TPP p0@T UP!#@`V0S pWp p0 0p0 @T PUc p 0S`0p p GKKUTpp @W!  p P`,0K( #0P'K`p0P pW1 p]@`]FKp`\  P `l K@TPTf@ 0PRp@p00W0760$70 0000 `$@@ 0p`dV $6Z1%ZZe3@  (@`e` ` ` W LK'K R0"P0!`` #@GK`0` W 1*#@PGKPpW` PP  KT0K KhK0l0K0-K=`P@@@ l-K 0@_ 1'K@ P0PT` GK@POKLEKK^_] -LlMP@j`T[Ppp00Nj80 $ 0( 400 3p080 02>P 坘 0TP哘Wji KPκP0i0K Pp T P :t t0Y p PP \` K⥼P Hh KɻPz 4\ K+P 0%Kh0d KT0 幻Pd00 LKP0 dh04K0Lp @0 `0<0 \000 d0D0 kP7P0X  R0F0P  P\ Q! P RxP #* b0 | rF| P z 0x  !40 8P h  R: Q0S  T KL0KQZ4P mFX iFoi0[S Hp (K]_]=]8C_]-]_] `]5^-'^`]W]"`]-`]>C(] -@ :L:0M#P|[Pf 1Ub0p S[* PX0 SUPU PP  R SK 0 0 G U 㿀PP @  9F`P DKP 0  -F`P U+  姀' 3/ 0 0 000` 3/ V` U  匀V Q 0 G$K萠^I - QL0 喗ᒗ\`]d`] x-L@P`EP P `$ R$ $@x0S   E x-L@P`{EP P `( R( (@x0S   E -L`h@p[PPUpWP ,0S ,P4=$0S(0S L刔$Q R{(Q q`]`] 0-$@LPT 0 3/@00000Ȍ0 -Lp@T `V PU0PPP/00@-@T P 0#Ġ ,,8PU#Ƞ#<@R @ 0#4 <#0#ȠP,8Q,<0 -LLM`Pp @ / 0S, X6 T K TS K :T  PKP KTK,0K $B@TK @PK 0TK@ R@KO@KPK@00P0KX 000 08/j0S 0 3/ P0WW 03/ P MT  p7/ P@0\0 0`pX` W`H3 WX0S\0SW \ 0 ` 3/ P` 0 3/W `X 6/ PpG0S `6/ P @` 4/` (K -LM K0K K0 00 0 0K8 K -L M0K#40K000K0000 K 0 0K! K -LM 0 K l 0 0 K -LM 000 K l 0 0 K -LM 0 0 K -LMK l@  0 0K -0ML 000 K -0ML 000 K -LM K l 0 00 0 0 K -LM K l 0 00 0 0 K Q-L M`]`8 8#4`#/ -LMKp@ ` PX`0KT0 0P0 0 0 000 0 0PuP3PppW@T@T`PU TfNT %$KD^T^ -L M 0004 0 0000000 0W K 0-LMPX͒40 R0000 0@P% 0&K0`] -0PLM8宒4 Q  0 0 K`]@-Q @0@ @F -0L bp3@^X^1M/ m P-LXA, P PEl8DP- P=d<Q6KCKCKCKCLCX0T,P(L$H Q Q@B<Q Q Q 2p .d*X&L  0 Kh&ꐪpHPX`hx -,7LML,@Pp`0 0! 0 @@ @$@(p,P0`U<6: 00! 0 @@ @$@(p,P04`@,0 l6 40`6 @00! @ 0$@(p,P08`)$6 00!6' 0 0 @@$@(p,P048`5 0500!5 @ 0040$@0(p,P08`x5 00!d5 00400 @@$@(p,P08`$5 00!5 00400 @@$@(p,P08`˔4 00!4 0 0400 @@$@(p,P08`ᴔ|4 00!h4 0 0400 @@$@(p,P08`᝔(4 00!4 0 0400 @@$@(p,P08`ᆔ3 00!3 0 0400 @@$@(p,P08`o3 00!l3 00400 @@$@(p,P08`X,3 00!3 00400 @@$@(p,P08`A2 00!"0 0040 0 @@$@(p,P08`)2 00!d" 0 0040 0 @@$@(p,P08`$2 00!2 00400 @@$@(p,P08`,0 1 00!040 0 @ @$@(p,P08`0 ,0 h10 00!040 0 @ @$@(p,P08`ɓ1 00!1 00 @@$@(p,P04P8`᳓0L 0{0x0(K?a]Ea]x3^tICKa]H^Wa]dHCD^da]*na]$+xa]*a]*a] +a]<^a]@^a]+a]T^a]a]*a]JCa]b](+T^ 0-\@LP0S  R 0 z PR     0T^h^ -L(M0pP `$( 2@P7PW} A:W0 0SPrp @K0?0K@pK8K@K )P`@KPQ 400 D K @K0 PBDXP X _D $ P4Y4 40/ % 0(&PSR!H0!d R 0SR: R 0SR: 0UT *l`|d  0 ~F !@@0KPT 03/@$KT^IC -PLtM'U@ ,50SD 505 0(0㇏:(U T0K( 'Q(EiQ0/S0V@P, TK( i0/S0V@P  (:0xpK(J∠  0)0`0 (PR LY fP 0p? 0S0KxK0LKT0KKP TK< gP 0Pp*0pS0K0LKuKPp T0K hKUP H:UV1/ 0/O1) 0)0SF1* 0*?1* 0*81, 0,11, 0,*1/ 0/#B  0 - 0-1- 0-1. 0.1. 0.+T(K*@b]b]^b]^ -ldLMP}  0 } u0@  }  0  'R 3S80<0S(rUPP  0  RX YX  $ (   $( $( $( 0S} ,0K  #) P040:S- 0R0% * 00KyVP 00 Q%*凍Q }  0 }0S #0q03 n}  0 pP c}! 0!f}6(MQMaO0 3S8 <0SD00c08  0b/S000C000000 vSPP@10SI 00!jD0( 0 ( CS; /R 3S80<0S0TPP `0 p80 > :80-'+'() 4-0 8,.0 0/ 0|∁  0 |((K萪I]*b] -LP@Up 0'S(nT@P ` & P &P  0$Kk -LM `K0@pDH Z$Xw 50Sq50Sm $LT X%X0RP   T0KzUP T0 Qd册Y XE~|  0 |GPK @K   X& P5 S&P00[S0[0S 40S ᡎ W0S 40S ᔎ| 0「0S0KLK0T0KTK KP < nP. 0P 0S 40S!  V ^0 0 P0 # R ] =0 Dd30S  -X 50[S 30S   0[S00[0 S0r0 0 l0p30 20S    ((BT KTKP L20S  L L R  ≑ 90 00 S 10Se 0 90 0I 0̋R000(0  0&X7܀ |10SPG* KQpK KL H0Ko0K0K0KKhKpK0K0KK 0㌀K娀K5P  0o0K0p0KhK0KpKKl X J <@7{h  0 9{NQ(K贮^H^I]*b]b]1c]c]c]d]Cd]d]d]T^l^\JC -LMP 0(pSpe 1  0 Wtm{D0 S 0 3S80<0S RP 0@ S@  * 0KSP 0 Q % *x ۊY  0: @ז0P! L, R @0 , 0z  0 z 0S 1  0 zB  0 z R Rk R> R RB RQ RR:Ru R :R6 RQ qR :0BSj 0S 1! 0!T񟗭kCkCkC\qCkCx 0Sp 1! 0!i l 0Sf 1# 0#_ 0S 1" 0"T TSQ 0S 1" 0"TA D:TqA 0S 1# 0#Te 0MQpP 0 3S80<0S0 S *0 BQ@P0@%Pp0 S0%0 * 0KRP 0 Q: 0S ~ W  y  0 B  0 yvX8 0S> 1$ 0$7W"R 0S 1' 0'S 1' 0' 0P@P  0S 1( 0(W70S W WT 0S 1$ 0$ 0S 1% 0%TW 0PP T  0S 1% 0%TW 0PP 7  0S 1& 0&TW 0gPP   0S 1& 0&Td'W{ 0JPP\6XuTQWhpH50S @ R@N 0 S2 060SV /W x  0 x00@@ S0%0 *0 0KQP 00 Q: 0Sx  0 `0@p0 ,Vd V +V! }3V <Vy 0R0%0 * 0KQP 0 Q: 0Sx  3V  AAZ 0R`%` * 0KrQPd 0 Q:``V[ 0S㊡ 0S 0R00  0KSQPE 0 Q 0S<   rpG @`0 S0%0 * 0K4QP& 0 Qg: 0S  $,R @`y0S0% *0 0KQP 00 QI:PPUAx  0 5WKh 00kKlKdKT  !P$ ㇠K KK K0p 删K  !P 0W p4 8 D@ @<:00 T0P LP H0 8p @ 0`K  04 8 ,0K`#40 d0d 00##0S+ lKP K3/&0S#Td wI]* e](*e]ȷ[\ķ<^ `^8w  0 w@0`P0  0R * l0KxPP l0 Q:Y 0O0K0P0KKL HK@PK@ 8 !P 1@ T_ 0SZ^0:SW`0Sd0Sh0Sl0S ` PEp0St0Sx0S|0S p P30S "1 1) Z&  0]NpP P 20S K 0II(PK 08cP6MP 2M(00 @Z P 20S K 0$I(PK 0cPMP (k CMv% R0%vL 0N@P@ 6 @p0S@ @ % * 0KOP( 0 Q:  @T 0O0K0P0KKL HKPK8 _PH0[SCG0[0S?@ 0@4#$48#80 (0Pe@E^񟗍zCzC {C {C {C0ST 0S S 0ST T l0KXHlK _ `P  lK PlpKf 5`P 0S0S 0 R0% * 0K9OP 0 QlppW 0T   0 P01 STP UR  RR DC   gQ lP PR?U ?RU%@DQ 0 lZppL@T :T pp6`` 7`` @TgDC}C}C}CC@p 0&KP  PR0CPR U Q~Py 0 iP0oPp(K -LDM`FP50SM XV@@H 40E HpWB 0G0K@K0H0KP HKDKD@ 0@ P0 0S- @P* GPP% T H~PD 0<008P40 400;P00@@H@L00  3S 80< RD P0 b0 c90 Z#T 0000Z:iP 00PS 4    R R @` :    X m Piv ( X),-./4  Z 0 X@ 0 P@  L  YPP 90T 00P R4x"  R0 QQ PQR9 X0 'X00d0(0 sTSp0h(0 JR*c E ABAABQ aD( ʡ00d((0(mFP0@(0`:(0C8*`#,#4+`8#(#<04 8( #8᧎* +``` 0P 1) 0)1@( 0(1/ 0/~rF  0 r HHHV(K贮^ 0-L MP0@:U <P P R4K ZPP4K ~  RQ  Z*K0 0-0@PL2r  0 K0h2rꐪ -L巺P &[ -(@0P,0 000(0L4`p|U 6/(04`uU 6/,0`0,0(04iU 8/  000000,0 00300 0 000  000000 6600 x-@LP(0U U U8P9U 05/8`1U 06/(08P)U #<5/x -LP`CU@p@  ⷃ` 0?>#20(0 00(p00$00,00<0(04pT 7/0L0ᤃ00 0C $Ki范&[1]1]'[:]P]] x-P BL@0R-CCC0S:@bD@0T T , 022 $'[f])f] P P /  P PP0/N // x-LP80`@T  P@x蘫^ 0-xWL@U" (R  BR(13/4WU PEU4WiD73/4W 8S 0CS 8 083/ 8P800 "0 -2LM0@PS!!RK 0"0EQp9lr1`0 / R U R 0 S%e 0!/ R#0 SlQ+0!V Q"0 010l8lQ-l'1S xd!0QU R!VV VflV` 0 SVflV` Q VfV`08U} UyOhP G j80POPKlAf]('[hf]$'[f]{f]n -LM@0wl2i >0 S0 0000S0@00p8SpXp WP1Q0 Q"  l!(`1f Rd  0 <1 0F8 n7(1 R!  1d 0@Sg/1!01{5Ku01 R!0 S !~101 S  10CB>A!>A0B3X00@0k/1S801$Klf]^$'[^f]C0.R  "-" R   80P/P/////nRꌜC|CCCC|CC P p7S00 4\ 8/0S/$'[ -L Muop`@00S4! 0!딠P0U00 00 P00  T0T 0U P4@T`(K:]l^f]]f]g]] x-L`@PPHH!Kxh]00000x7S00t1q 02t'Rh(D  nt7S S S0<0<0;0|000CS CC$C0C 0ndK :q?0h0 p0S7~ #a 0nh7  0nh7   0nh7   0nh7 0{nWT 4<t0 h0ZLh 00p0 P@ 0anh7    0Xnh7    0Onh7  t  0Fnh7   0=npd[0 SdKPS,K07 Ad0K0 XhpWh upd0[W0d K0 P& ` 0 nh7  0nh7   0mh7   0mh7 0mplTK8nX ȟ  3# =1! ? !1 ? 1!(? 3l(=#(KlH([P 0@/$'[ -L@|PPTT".P8pHT T T@ T T@ ~@@  T T@t@1峀X4m ( Pg T 0X @`V \ `0S O21"`VIQ ``1!0Sp <p p ppWT0XC@@0S00S  P4 t8St7th4S 0tww\00S `78`78`7ELp`` 0 p0L@p^⩞8p8/0<``0@P U(0:$0: 0:0:: *[ȮC@P 0(00(0 rc`pc`0 0"$  # 3  4  4 "$ 0 <KP0|K !` !(#LK e\K 0p0 e \ P l eU |K 0 |K 'G$~ KKl K}pK lK PEp0Y㘐 r`VUm |K |K G4Kl K~0K}pKlK YUT 0 \ 1 #R c ^|K} | K 0 v 0Z0 b|K j|K G4Kl K~0K}pKlK [Y 1# Z0 e R lK 0 K0pL 0 j rl0K?0`PV c0|K\K 1| K:(K(k])[ -LM@ <0 唀 @1 *d 딐0   ($ ` ,0tKᘐ"ԊKYX ᔐ *0  0 N88ԊKP圐|`K0! !(0`0C0i0 0L0K0匐Kl0K 0*Kᨀ ( A\0KZ8\K ppg`㐀0Xp1YiC$~ KK| K}0K0 |K lK lK 0I0ꐀ'2`Xp␀ R \WM F4K| K~0K}`K |K nlK  jlK 9W4 0S0#SgQ* v|K  0 NF$~ KK| K}`K  |KC  lK?lK   7吐0p` c php\KlK }PA @1  6c0 딐0  (K:k]ak]k]///<0  /<0  / 0-<@LP1 c0 #30000k] 0-<@LP1 b  %30000k],0 $ 0"$" /<*[ -0#800`L@400p40040P0 縐P)08#80 #08#80 #08#80 #08#80 # pW㸐 -L M`0@P0ᲠᶠᴐḐᶀẀpp  ("( 4 00 "008#8000 # *ᶠ*x )Ḑ)q(Ẁ(jx'xp'c4 ("( 00"08#80`0#7 *8᪨07 )8ᩘ07(8ᨈ07px'8x07 (&40_0"( 0 00 "  (K8 #/0 84 0 / -LEMKK Q@P`P,KP@@PU QaEP`P`b@V`!0f 8 8qR ,pKqX,KYHqIXpp,KpqW)) r$D'P\S atP`@$$0AK/!K$($L.!K-AK,K!\@aTaL!D\ K @!R $\0S(K<*[l] -LCM@KoK@@ TP@pp,KpPPpW@ TGP`P b@R !0b 0! 0 U @ ( !"@,K&d", Kp!WYG!IqW ,pK !R(\S sP `&$` &(&l `@,K@!\PaUaL!E\  !R , 0S(K<*[l] -LM0< S !"  $$  0# Kj]<0[ -LM<`0 p  1 ` 0  `Ǘ 1 ` 1 10 1k @  4 $BSR  8 &0  0B 1014L@P, H20P T8T4P $p00S 0P 0 8 00084P  40(0  0C 0j}P , 28T@0001 0P u`\ !0   ⾸ 65 35(K8l]\l]H0[l]<I# -@LP!#P0@003T0[ -0 L P44r0PS(k]0[ -LM<`@Pp` 1 ` 1 10 1u0 3S80< RD0 80 00cS0pGp00 8PP 0(00(0p >0 40"$, _   0  # 3  4  4 "$ 0, 0p! !0 S43  8 00 3'(0 0pK0b p# z5# 0#("( # 0#(Kl]0[ -L$MPp0@0S`<K S S   `< K Z<0K   S< K L<0K G0S ص000K 0 K-0K.0K/0KNKp<KH w' ='< K ~ = jq' *w' /'<0K ~ / jq' *w' !' < K~ ! jq' *w' ' ~ 0 jq'd @U1T d\!@ K L0 H HL0 @TPl1 0@KL0 l w' ' ~ L0jq' @ TdH L0 w' ' ~ jq' @DL0H (!@0R% @K ᷸PdU0, K0@Z  DS@KP0ڹ w' ' @^ @dQ%@W%@%@> `1# $ ( #$0  #(#< 0(K -LMR@P1K0 00 SP @T! *,K1Q 0PP0S@C TT!(P0PEcPg@ 0U1! pPjPq P P 0,K0qX X YHXqIXpp,KpqW)) q"$'@ TU H1p1. ] 0r "D!KCK"",BKA!K0,`K0!Pp @aTa@!DP QK @!R $PPU(K0[l] -0L@p1K00 00 S`@0 T1 P Y, KT1!Q,K `` R@1B TP0(``i @i 0 V1`i L L!Q T0X! " !,K0 "!X YH!IXX ,K !R * @TV p1/  \ 0& $DKC!K ( B!KAK0,@K0^ ARANB^Q/KP.Q2(K0[l]< 0-@LPP000 @0"04[ -<`0p @` L PTTLoP PUPPR PPP #R8 <QD 8   bR0C0000 b5@P 0(00(0  0, R("( B R<  0#$#8 0p0  (k]4[ P-L 0003/0S 0 84 0 00Ps//P0S 0($0 0,0Rp3//P -h8LPQ@p`s&@P` 0  0 >.XdQ= R1S  =d R.h8  `0 P h  0 ޺P 1 |= 0 =000`0UZ  ĺP   l%PP X0\  ;t7S0500SQ909 `  1 #  "\ R R `Zʐ 0 0  4,4 P1 ;0h;,000X X 1 ;+;000h8U1 :0*:00 02S1 8:0h*: 0P 0 @  dT\00 0X  0V 0090  #V 1S 3/00000 0Spp0p0  1S d  X4 4h& 0V& d.d\0S 101 *<,(( ` (  `0S 4`0|0d (K -LMqP@` E !嗯V P1 RPc1P U0 P00U@00@01 y1PQ $Kk 8p] 0-,0LPS@W,,0S !000S }U ),0@@ q] -L|MP@S@p` S- S S 0S% S@ PS S } S S x `7t7S2Sk Sh 0j S, XK⿮H 2p5K2$5KrSKTKZx*0Sq S S@ j S< g XS% ST0L 0cN0K]0S8 SD W *S F2S8 Q S( @p7SK 0P45K0 0C##T0K0R0K>p7S0T0K90S ! 0/?=H00H0)0Q0K& P 4 0S 0 84 0 <S 0S0 ! 000@/@?P00P000<0S1Fb? 0S ! 0?Fb!>@0S1Fb>  R 1 ,?Fb !|>T [VP1  >Fb !8>T00T0S[Q pQ 1  >Fb !=X00X0[A =P:1  <>Fb!=~d10d1hW ! pV101<00<0  0 t7`Sh2Se   ]P] H7!Q0[R 1 TQ[ 71<0S`77!66`7Q0[71%[?0"  1 S[ ?4(<Q!65[?0Q 2  P7L0S ;!0:1`7 XK 0m#08 d7 rd78d7XK 0V#5[  P X KpP?S0 X0KH jP`ܠؠ P  Zh8W`'1* tǐ\ x7S ``0Z * R  01:2R `  Y1:  R1 0:  S 1n 909 e X1s 9 eX h R  0 `P0 !g l)  a`7 X 1Z 80(9 9=Qh8W\  d  4P  pW+ 1 R$  ܠ 0ؠ  1 70D8 8P 0u]iu]P=v]lm]}u]u]u]u]u]"v]=q]Qv]Aq]v]7q]5q]v]Xq]v]Pdr]=]^mr]:],]v]h8W  CpP2 /2  020Fb0>!꺑ḡhxY`  1 M40V <>d 0h8W<10<1h00h0A꼡0d S*2\  \ \ \  Ƞ Č  ̌\ 0Q1 (?Fb0,?!@? D00D0 0S! 0p?Fb!?H00H00 1 L0V ? 0[h8W<10<1|00|01 `Y㺯d崢   ᤰP2020202 3`7Q /  67Q`776`7!/20S`77!66`71 cL`Ÿ2P P  l \\Ÿ0V H 01 jx7Si jXʐ15 2020 -0a00101 gPP1 #L 0t7S3 1;x70CS:jX ʐ1 L10D1( D1;L00L0?0a00101 3P1 K 0t7S S h8W  1 3/400401S `d d0000 P (Kns]_q]:]Eq]Rq],]$w]Xq]^Yw]=]w]o]w] -p- LM0 @PK0 ]t`K 0KKpw] -0- LM0 @PK0 ]PK 0KK0w]0000S00040S0 000u/ -L Mp`Pt7S2Sm 0!1Ri (K0Pb@(020100010020 0083/ ? 071 01GS00 D1"02222222 8," NZ" 3254282S887='00c 70r0Q   ޤ0   04Q   Ӥ0@@h K$'[ -P LL0R`@p>:L et'R ⶤ80(R   ⪤00 R ⢤0 83/?G@0?D00!S 0Q !H 0000L00 -LMpaFPTE 0Zo ( Kx 00 4SS"K0( x0Q0S0 (R2K"(t1 ,K 00 X1 83/?/KmKl2K? k2K71 j2K?1GS0c2K?Kc"[50,K0S.V*, K(0/K0R"[R 0Q   0   0R"[R 4Q   L,0KK WP,K0p`c@1`fa(K$'[ -LBM1P@S% IK pP IKPP I?K`,っ0Q  R ,ϣ!0IKR1ā!K 0-"L0R@P R  00#-8S8 4!0R1Ł!_!@R,dK @Pf[4Vd0K @P` Vhc^K n⪢8p. 0d0K0`0K00_0KQ<<_0K4 10R P"%K#$Kd0K  䆢0Sd0K |`0[0`0K 0%K$Kd0K  T gdK@ pG @t@3R 01`0!6 Q"  @T0 1! R !bH1SdK k P dK,`P 1S01Ł! Br @2gaVdK M P| dKpPu 2dK ^0KX @)1 Sh0d K\0 1\ R\0 \@TA  `P R dd K`` \  b("(!- @ @h7< !/A8S80 . 㐃(B)Q+D +D+D+D4+D0000##N01##:00s03F8?`720x8L00:S (03/$K|5[@^L#DD~ -LMPDpt @,% `PC5`\6 6@0C\ 0C\  \ ? \t7   \R4\ y:0\v 4\V 0C\ 0\ 0C\4\ 0C\`7#2 \4\ 0\7 @4\h 0C\ 0C\ 0C\`78 3\ +0C\3#4 3\Y0 3\h 0C\ 8!0C\ 3\ q: 0\ r0\pP ll#\\Px7Sah800h8 h800 80(80?0x7Sh-  |++vp70s03 V P"  "!F" ` RvlS`8h3/` 㦠0`t8s ! R01h8D!0100512`2`751+h8?)00A0$>!t1 1``09P D 1^0P` U C Ug`V0@P"00000`7=$`00 0,0 i;00 K(0 t 0KH00L 000`0$ 00 `H  KF%*CEn|@^~D -L,M@X` P@(G pP`0,(V`F``S -' BS ? S  S  S 'S^  SI  BSE'S  BS  S  BSd'S  S BSd'S) . BS  BS  S ,'S@ l:+ S 'S  BS*7 BS  SV / BSE&S r S 0V Sn` F  (嗟~V0S!V Q" 010l8t7SlVv3   R< jRh <3\Vg0Sc`4D4D9Dl4D9D9D4Dh' p'RVh' h' P t'St7GVIP0t8@ X50SH5 \20 S`a`V0  R&"!0S  \0t8V 4V 4 V 0S h7  `78`7t7Sx7S`7  8`7 <`703A0AS7SV0S V0S7V0SV0S h7  `7 ; `7  ;`7[VX3 `7  RV0Sh( 0ղʤV0S h7 `70 `7 0`7V0S.Ӳ0ї/DV0 BQR0@Sn`0㲠X0FF P0 . ၞY@`P0cVn W?B0CSh1 3A0AS]13/Nt7SW cP?t7SN `F LKp q3P0LK \1R/ P$X S10CB>AV>A0BYY6X# ,K P3 0@ 0S1 3/4Pp03A0ASwW4pppp(K-%EOnl~| -?LtMQ`P@/ !?Qi ?Q/ ?QP ?Q  ?QP ?Q F0CQw l?Qd d?Q$ X?Qj L?Q @?Q.0d?Q ?Q ?Q 0CQ >0S_!- 0H! lK>x7lKSh( хl K l KlK! p> 1  08pPh0LFS}\=D8RD8RD8RD=D8RD8RD8RD8RD@>D`>D>D8RD>D>D>D>D@DLADBDFD8RD8CD`CDdEDCDCDCDDDPDDlDDDDED,ED@EDLED8RD8RDlGD8RD8RD4HD8RDHDHDHDHDHDHDJDJDFDFDJD8RD8RD8RD8RD8RD8RD8RD8RD8RD8RD8RD8RD8RD8RD8RD$KD4KD1S S S`740`74`7400@S *#P 10CS>D>D>D >D=D`70`701 `750`750`75`7!h8 U1 ,C!R B":B1S|7<0S:h7  1 C(bR+/18SC871S`700`71S`744!@RMlKPh0[ S$[l;Zg0[S=t7lK@S hi P  [  Ph PZ# Æ^:3/l[g [0P! h0[@S000Ņ%K"0 # l0Kh [ qYl@K  P 6[S>:3/Y X!RlKPl[Qt7lKPS hH  㤢P <1 8 @P RQ4!*RlK]Pl0[0CS񟗯ADBDBDBDBDt7Sk [iR l0K 0lK P@ \Prt'R R 1&[3/c0lK@0MP   @Pu lKl KLt7Sil0K  @Pb l0[S t7SX PUPP !P X!L7  !1S`7 3 31S`75`7!R R R5451S h7`7: `7:1S`733`71S`722h'PX6002ӑ 10DPz 1 C(R0ȕs9 &P1S5 Uh00  P P UY㎐V 1!S002ӑ J J1 C(R0ȕCC!18h7>1019`75Q UK VP lKšp'0 r 3,@K`@QT @6FT@,@K@@Q@A0QlQ0[,K@@PlUT@ 0 Sx ,K!@R Q" 010l8elK ؚ03A0ASC7S5t7S c0P+1 3/$!ZRMlKPU X!PPB 03/P= Z1lK6S003/1ᰊS%GDGDGDGDGDX  P$ 03/P 03/X 03/X@ J03/X $03/!R lKP lKb 0P f ["[ h7i  8S80   /L00t B0[ )0\ ,ID`IDIDIDIDP 81062P 810)%P 810P 810 810q3,$ t7SS1 C(RF8ƕZii8iiiiiii:i6i(i5ii o?) "D5[05[(]n* *i8䮂$'[i@^t7SS1 C("(=R*l 0'1S`7 0 0`700S10x8h7!0R1 C!R:T 03A0AS13/4X 03A0ASwW4ppplK! pPl0[ SN@ 'l [l0K(x 0BS !R r39S  00Sq QPAUPPUf0S lK@  RP@U:3/ᙞP͆ p !l0KppP EP 0wPp 0lK0 & JPpPU@ 0S:3/W!~P0S @YP > BQ  `74ppR$$  `'`'S`7儓嬣000>0n`00P0SPU@@`001 0pP0V0 VpP H4 0S h7  `7 ; c`7 ;^`7500400V> 0 㧘 `7P::`7x7S t7S `wz  7h ㉘11D%SH58 S!V Q" 0108l8x7S~t7S8%SSl8p8r h(0!Rn x7Spt7Slpc6 1  0 pPU "DXX`\Yʀ !p6 `!  .! `aRa/# p&pPUa/㿗 ! 0 G` 0 !<7 @P Y,4Pp ?o4pp(K -0@ML00 00(0p0@P`,0 pA $0`(0KS Pl0 0`0$  0( K0(00pA,` S P( O$Kq=^w]w]w]x]65[ -L8MP 2  0 0@00Pp 00` K0A $(p,`0S P'0 0  00$  0 KA(p,``$0KS PL"XX|OT0T@TP R T*03/K쮂[]?x]UDa]^Tx]O5[XZ^ [^ -LM@pK` PI0 `,K 0pd , 0  0   \  L0PsP3PPU~~0@(K -LM@Kp`` T0PK 4N0@00 0 0TP 00 0 0K$K -QLM0 |4  R)Q&Rp  0p`0P0u03?`4`\ ʀ !`84 04,000 !K c3h@&hiK@ T V 02S7S=@ 06S i>@ 00 h8SA@ @ 0S0h80 @0K`\0⸀  ` 0 T 0Q  Y` pYo V h(Tj h(iT`  Q   Q WT:?0K  KK0 U KQ0!X0|KR0c0KC18K8K8K0K ~0K0}0K;71G[0K2PK5K=0"0cX0 0 T0 +D1 4K?3K#3lU 1l #K3K53KM?03K61.0K<1-0KbP20pe00 yI `Q 000 [0@T- Qi. @Qh \ 0 1S@  @ Y0 !h0 `\0 X0T000, !X0Q*(K@^^$'[0S/;꼫^HSD -L\MpPD @PKD#1uN0( 0!cOD K`P0  $(`,PQ P0020200 $0D K p(`,PH0KQ P2'02  > 0$ (`D K,PH0KQ P424·00 0$ D K(`,PH0KP nQ PPk100 0$ D K(`,PH0KXQ PPU10 $ D K (`,PH0KCQ PA810> 0 0$ D K(`,PH0K-Q P+00v>0  0$ D K(`,PH0KQ P0"}p0  $ D K p(`,PH0KQ P <<L(Kyx] ^hUDa]^x]TDx]x]x]x]x]x]f5[cS -@LሎPx x-LP`@T 0S00`00C0  `x --L M00 LL Kx] 0-@ TLPhLMTP 0@d@@ 'P 0000 4M0x]x]]D -L M1P@p` h0 Qr:0 0,0 2Kh8,KT  @Wed, K0#3'  2Wlg, K0 Kx]:]x] -LM1@P` hx0 Qpp7:|0 h8U f0' 0 $K$0 2Kh$ K0Kx]:]y] 0-1L@  i0K0h=]y] p-L8M!`@ 98@ 0pX  >K⾓  DK⺓80@ 0jBK80K0S070K"#KD K 0$Kp1y] -LM1@Pp` 9h 0g0V00  &K⋓  ,K⇓0 0Kk, K0pKiKry] K~5[y]/ -@LtQQ 7Lb0Y %Q%Q:-Lfɠ@( Ƞ`,XU60X XVV@0,X,X    B `75`7$KiHs]8y]> p-L M`1@ T9V00 048)"V  0R 0 0 0 0S  0 83/Kpy]y]5[ -0@L83/0P 4P Kh  -L M@ 9 0J 2J"2J5|  #"0J ?`J801 0<00J= (<D1KhJy]z];z]]z]z]z]z] -LMP@P  qK`1 8000 0C00e0iS VqW1 8 0O0 !wP 0R 0 0 0 0S  0 00 K Kiz]5[{]C{] -`pLP hHP 0 |00 R.00@T 0S 0C8#8S0 1 Q8< 0u @*00^hӂc{] -@L`1  0pPU 2S :0S 3/48)"EKh6{]5[ x-@L1  0`0S P0U 01S D< 0IP00|Kxhx{]5[{] 0-<0PLRp(@0!*G ⫑0$'[ -LP0`VF0T@8 "@@$S 0!R@t7S?`'@  @8@Sp RїP @`7    ƗP @<1S1@@F @=T+-y7 ]Is7  ! UI0 ! LIII ! BI?0 ! x5I?ppl0 ! +IL0LH"I$'[{]{]{]{]|]^{]{]|]^|]j]Q]:]}] -0(gnLR@` ᠐YQvvT0pvve 1 ddH`P!0R3 H H@PUp3$KhH$'[5[|]]%|]H^*|] 0-@LPP000A88I@T  Pj0z]6[ -L M`P@1p 600 0` ㉐0 p0 000!020p003/09909: 0-020T1%00 0 0 0@0 01 pq R @pP` KiXy]6[$'[ *[BL0 (8@0 (840 8,080880 01/0fDeDpD$dD8,dD"0 "(0 /B202/ -LM0 p  Q 0!, h0%d'(d' K -1L@ `700 ,0, 0`7=`7d78d7:|]B|]]16[ 0-@8LP3/K0h p-L M@PQHUHthv 0!00200 R:Qx7SD1@1 Gτ0S  R01 0 0c 0cKpS|]d|]nG6[o|] -@L`8p3/PP  \00\0 p-L MP 8`3/@P/ 1 5 00 Yh T00h822h80!`0003/0990920T100P\00\0Kp|]Z6[ *[ -PL`8p3/@P  ~h8 0 0h822h822hh80!Ph8 99\00\0 x-@LP`4Px 0-LP@P hGG 1S 3/0 -P0@L0`p00 ʎ Ǝ Ž0?0?h80101 M? 061071 N? (Q 4d$Q 0_ 0 1S 3/ -LM` P p`@P 00 0UK -t7L@SS` `7]P i^Pp+0 R0S PPhX"d -L Mt7`pSS@ `7]P i^P0S TAT.0 R0S oP@hH0S i V1Sp1 >40@008 0PӇAχ K|]m6[ -}p@L`t7S 0 hXⵇ+PUt7SSPP ⡇ 1 3  0000|]6[ -LM@`P@@pzAT ݀ P01 SsP1 30,0( 0t@$K|]6[ -LPXp;  R 0S R`P```6@T!  ғP 0R01 S R 0S R  ⾓P0 0S`P@Z -LMPp@` 㠓P @T/ 0S  ᔓP000AT  ㇓P0S  ~P @܆1 630$0 0$K|]6[ -L M`@V+ 7P0S0S y WQU@1 3`\ 00 !Yr KiP  Ki K}]6[ -@hLP 0h8i 4P 048@P 0@8 x-t7L@SP m`5T088$8hhXP 0 02222000099}0D001p8t7 S13/x'}]n -1L@` !2]Ppt7S118888$8VPPT p D( =h8 """" 9900?`7?0?p7SM/61t7S`7<`7?0?`7 000    Lph~T0 Q QG⽅$KiL0}]6[ p]'}]n p-LM@PhP ` ?P 0P 1  <10<1!⎅P 1 1`'\\0   @@ 4 `7<`7KpC}] 7[s]_q]:]Eq]l}] -LAM@t7S:IoKi~  p8IVU 83/0$0K1PPS@5 0VP Q r  $KPP 0Sr  7S 6S1+ "!t7S `7 8S l Kii^ P6S mP7U4 ?? -,hXUhH 0 0222200009900?Kxhx轁] p-X2L ML"@Q PP4=2P1 0wP@=1P1 00!1Fm G 071 `U8080$8h1g,X08(X HP(8 1 00!1i^ F  0jn(' 0' 8' 6@7D'<7fVh8 h  h'         h8 ( Kp8݁]7[] ]7[ p]PD2]a]hD -L @pjpGl` 0YPQ 0a S0C20` T T T T ,T@@hX&h` ll`(``ᲀ 0- @L嵄s0 0 0uPB`@P@tP RRP@@v@wP0@B@Cx@C@C08[ - 0 @LT@@ ᆄ -@LT 02  @D@  u -0 0LS@ P0$ R-DD(DD(D(DD00 V  R00 I  E 0 =  9 500021000 -`7L@<U hx000 00 00`S R"  0000P P00d 0 0H00 P0000` `00 0 000 ك`9d09#40dQ0_@`7] P"0hx0P 㾃0P00HS P R15 㭃0000` `00 㟃0 000 㕃`0000P P00 ㆃ0 000 |P9S0Ņ9ׁ#40ŅPdAdQ@@d 7<f]8[8[-8[%8[98[=8[r]A8[U8[M8[a8[e8[] -LM@P`P000h <p=ݐ Pw00H08 2 t7S0000(001011 I)pPᇻ `0X   L 00L7S`P7HgLg0P703/$K]]] x-2L`0P@X 2S " P101 "00": 101x& B("(R0"`    0  Q00S  S (S S  S SS S 000S00t'R8S c">)R1X0 *60x8[ -LTM0P@ Sp|1<K ㌂`8 t7S <0[ 0@(Sᘠ.㲠,(Z )>㳠8Z 0)7R᙮ Z#[7R 1 <K~(>0 07&000岒` #[l7R```7@@ ``Z800 3S 8 <0SD00c08  0b0 HS #%*a@P 1 &000$X @F000@0  B    0 @@ Z 0R @K0P @u@@Ts 0U       #[ "$ 0(l 3S8 <0SD00c08  0bS00f0000 @P[ 0(00(0Y00 ⧁6K  㣁<K 㟁0 0 00Yp 060S  S  S#*9S000 <<00#"!# #@4( 0RT0Q0ZMY Z80H 0H0 30L0 0S +:(L Qc%:0000 0 t7S񟗪DHDDDDD,DD$D <K <6K  8h00<K .  *6K321303#[2R `7 t7S8 2 R 0@0080 R (0  3/P1 <K 'X 81081~0H h@ X0 0X 00L0Hd 0`\0 \ (0` 0bP0 0T0 Pd L1 \ 1Z 9Z P= H  bDX T0T` 1T 01d 0 b 0p _p`P 00(00 R80h0` P h 000(\0a0T8000000C00 P Pp 1lr01 ? _(K݂] *[Uj]|8[]8[ ]~P]f].]w] -LDM p0 4 8 < \P P`  ```V``P`lfQ8P P@ D0 P e PH gHD0@ gTHT@ D0 Q@8P@<TP 0 0 Pp H 8H0PP PPUP000 0p T40  0(Ko(K葃]8[ -L$MP18 p ` %0P00H"H2yV 50K55@P000J0 0p pp0p !rp00 V0   00 000 00  c (  Q8<PD 8 aQQ0C 0  @P 0(00(0 0 0S 38`80w 8@0 1011011 s%p`ᱷ\0 00L7S@P7HG0LGP703/(K]8[ ]/] -L$M`Q@pX 71 E%`0000(*(:x0W W W, W)W PW W W `70KkqPP  0~h(00/ 0 t'`R    p  + h 0  ~G0 9p70 S000 +0000 0  00 0 M/00 "$0 0p000 Pq0p000 Pن00 0 6! 0000 0  0p000 t7S0 0 0 0 0 0 00 0 0`7 0E0 70S0 *0000l7` 0000000B0 0`70    H8( HR ,   XZXh Zqs3 0K< 80 PP< 80 0R㰠0岀00 h6 0@, ~0X0(01 9$, 60:000(0Y101 101tX1 $ 00KfPP 00ᰀ00(010180KSX5HHPPP t7`'S000 p(  0/  h' ;0  W000 0 $ 00 h }00000 0 0 }G 0 0 `70   40S < }0 Q 0 }0 0000 00 0c0(0j0K3PPG `'00 p 0 0 ;X000 0 岀00G 0 "1 1000110 0 `70   40S  0 0 00c0(01 _# 0 0KPP000E00尀00(01011S A#d 0000@,0 3S8 <0SD00c08  0bS00S 00C0000 PP 0(00(0 @O= `000w0008 b0  , R :01 " 10@001 PWt'R  "0pp'q 0 41 0100L7SPP7HWX0P7LW嬈0203/@(KVI^]8[q3nR]s]8[]̈́]]8[^ ] -L`pPP @00(0K000 0pg|  c| x-PL`@P  0; 0(0  ` J|x -4L MG`h7p# -00 @ 0KPP 1S # 0000 0{00/ t'`0 R    0  + 0 `0    {0 0000 0[20 0S 000 0000 0  00000 @000t'R0 000 000 000 !    F  00000 010 `7   `70 2`7`7 0s0 x10S0 *0000X1` 0000000B0 0 00c10 c( #R8 <QD 8   bR  R0C0 mPP 0(00(0l&4p00岀0 N{ J{ F{북(KD&]9[nC] -L Mf@ `Pt7`'S000 0 0  ;0`7 / 8)9 S!    "808S !  !808099`7  4`72`7t7S[`PC |1pW 0 pW *@8Q pW B p,3RPcQ*g1X  !5y0 封0p@!z`75`71 00p v0S00C00S0  R  R000 (K_]9[]>]…] -LMPT1P!`@RX10X11S 200 X1<1 0]KhH ?pq?Wp00L1GuS0 PHQpb0pLQPQPPQ1 e P 00U13/K]] - L0? @ A)0B9a  x0pd 1-pW@h8S  \ (Kox(K:[nV:[:[:[n;["];[$^l] -LM`7@(!00S  tQx7S8(00S8h000 080800 002 (13/K@}]] -LMPK ` p`t0@K00 0`@K00 0  0\@ )`v`3P`V0 R:0 R :0 R:0(K -LM@`Kp` Pt00,K 0Pd0,0` 0 0\ 00 0 0|)PuP3PPU0S0 0(K -1DML00(00@P`,0  A $0`00Kp0 PPT1  $ 0 K00A(,`0 P= 1  $ 0 K00A(,`0 P+00000' 0$ 0 KA (,`0m0 P00t00h0 00$00 KA (,`0W0 P ,,1,(Kq=^w]]a]x^D]DTx];[ -LM`p \SP  1U3#t  000 S 0@000 S 0@TZQ00P*@x00S X `0   H00,00 00+(Kx^'] 0-  0 L2#0 @ 0  DP <t{8P80PPP,ZGX0耖@B -@LMpP` 0b O{0SL P @0@ 0p0+$Kx^P] -L$M@0p00 1PTaR:0SN@ PH w1 0C(KoW+0SS3#㈁00఑  00 b z000S#ڔ rP 0000 I` P  P  ZG p!00,  0+(Kx^q]^] -LM000@@P`P 0S S SPP q0SG*PR  Q? 01Rڸ 40 P40 (0 00 40 F40`0 0*0b∀00S0 kz0S  P 0P*0S. P( PP *GPp0*`1V0 F0 H 1w*`4Pr*U(Kx^]^܊]]]%]] - @LKh<[QP/////////  0 / -,@ML0 X0 0L0 K,00!0(00,0000  $ 0B. K>] E -L M  gW Kw -L M  PW Kw -L M  9W Kw -L M  "W Kw -LM  V Kw -LM  V Kw -LP x-h $A 0(110 LP BR0 `ë$a000CS00Kxh蹫x蘬^ -LMPp8Kvm8K0 eP`V Q 0A \P.0S 0㰀080K@T oP   @0S 00C \Pʑ0 0eSW 80[S 8KP8@K$KB]^ -LMHP@U80`08040`00 0H`psW  0(KF] -PLTM` P"*P)8 "Ÿ24 ""Ÿ28 "P4 "0 P08P 4P 0P  @p 0! 0 @@ @$@(p,`0< ,<00 0! 0 @@ @$@(p,`04,001 00! 0 @@ @$@(p,`04P8,X1 00000!080 0 @ @$@(p,`04P<< ,'>4 00< 0 0!8 0 @ @$@(p,`04P<,0< 08000! @ @$@(p,`04P8p< 0h,(KD$D]?a]DlD']~]xDD]{]]]\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ 0-Lt0P@T 2S 0C8#8S20S 3/@0 0K0h> ^($D -H@L>  00  ]DLER -L@L4 A8 =(0  R<Kh ^"O"N -LM0  c( K豋] - L$M`8 4 k90p00 O  $< b8 800 HP`@  `OO<  o0P(040P(KhD x-L@P``0"0A00000$A000000 @(1T  㠯@Kxh꘬^ -LP` Yn@0@T (0S p3/1dL@KhW 0-L,0P@T @K0h -L@L00H00D00@00<0080040000000KhDDDDDD DD x- L@`P 0P0S6/x00 R 000@  @ /ᘬ^^ 0S   0@  B@ / 0 00000000000/ 0R000 000CS00/ x-0"L0@QU W `,P0  BR0 è0,1Kxh[x蘬^ 0-LM(1PS K@40"0A00000$A000000(1K0蘬^ x-@9 L`P$1 90OU$1,10  0 x -0pLP`U 0S @ T 0 RP 3 P 0S P @P D -0pL@`T 0S 3 P U 0 0RQ mP P@ D -L MpX0S !S * Q P 20P`V, 0 S @% T# 0S R 0000 00 Z *0 UP qPP@`(K蘬^D -L@RP}PKhT0T0S R  R \  0// D -0 LPR`/ "V- @0T'  R!0S P Q Pp 0 S*0 ) P 0@D P-LP@pL0S Q P `P ᤧ(0S  S  3/hD -L@P<0`S l @A43Q g0CQ `0Q<1 3Q 0Q 2Q2R@!@PΠSR \` @\ @` \ \` `\ \` `\ \``\  \0`1 0`1IO3 1@#1 3@:!00#* 03-31*H0@00% ?$!8 j8 jXh wj- D?UT $P00S t4iui iivi ~iiip8^ x-0LP @0A \"0S0 BP Q|0R * 0AT \0RxxD0<`@T 0S hPx@꘬^D 0-LMKP@P P03/K0 0-L@PP P 0S 3/000-00 P 057#/ᘬ^ -T 0LDM  00@0000S\40 `P "P    ݣb$S  0R2`pȣ 0000S002P SV p"`0P#S2 Q  S!:pS!*`qV  i `V  i 0"_A0 S|2p0`0l2 00!0 $(0 ,p0`00K%P ( !^ 0!0 K  $(p,`0%P1 00!0 K $(p,`0%P1 00!0  0$(p,`0 K40K%P'><1 00!0 0$(p,`0 K40Kw%P0 00!0 0 $(p,`0 K40Kd%PP 00Q$0 3/P@  0S-@ 0 ( 040T R0S  R T ) 0)T Du 08 0C) 3   ?)4004000T0 T0 02X $ * 0*  0 )7 ``RpV` `V V HL0 ( 000aP`80S 00S  R   40040  0A(KoT^^xL3E`^ -L M`p@ 0P`ZVQ+ 0+0d0 ) UI0 1 R0S0S 9 R !_41 *EA) 0) P U * 0*) 44Q @SR ) 00t0,R (L0 000 4  4 ) ?)(Kx֎]`^^ -pqLlQj`00SP 0X 0S400000800C80X 0cA]! 0!`Q$0S! 8 R    Q 04#$48#8 S  S4# 0#-$ 0$0E$Ki]^]x-/ -@p qL$r(s (p 000.0(0,0<,0\/E -@L`0 08!(\H !$("(C RR >KhspH R7 L S4P R/ $"$(R) P # R!(1 R WdP \] 0P4#$4 8S P@ ]0P0~Kh갬^HL R0R : 04#$48#8 S  S -LM`PPA 9 )i帐i @ ( @O]p00p9 000 p0(1] 04#$48S  (1]0;0K0, Kb<00cP  X 8c80P ,, ) 0)80  80 * 8@(( ?(P#  3  (1  cPZP0 @8K 00@P80S  04#(02S 8 Pj X (2X #80Sa0 4:\ 04 8 #T#<1( XX@ J-0K8 -0[0C S@80 @<80  O80 * T18X.E@1X  X01 #(1X 1X 8h210S0 @T 8@8 @P"0 Q    80  00080Q000000(KP0^GduX]<[ ݆w58^w^ -L M03K3@A0ASp8 2`YG 40P, 800C80H0S  00ƘP` 40H0S 800C8000A` `40 ) @PT VA`@` ` Ro Rz R R> R}4K [@n8 0 ,KX [  0,0K^0*0K0+K0)0K0(0K0'0K ,0K00&P`8   0W0Q3KJ  0zE8`@l,K| 04#$48So 0,Kh  <[   00$"$("( BR"-#K,0K0008 0O}P 13K@ ,K[0 43K/`5@3[8S(08#,#43K0 3S8 <0SD00c08  0b S00S 00C0000 8 80S  (  ( 7`8P"  0: [,K 9 [  ZT4K(! Z@8K 0F>P `8QI $K`^<[=] -0DML@,PK0 0@%!p`0(0 0 @@ @$@,p0`P0 0D0 @00! @$@(p,`  0(KT]Z]0HE -LMQpP4@P/ 80S*W$220$ <K Y B`T 0Y 0 8K<0 FZ 2KBZ<K 0P@ ``(K\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ x-L@PaT 0:P R `0&b`C`PC```C00@x\ l -080 0:00<10$x0@L0l00%` 0%0 00#0p0 24001(0 0(0, ,040S 00CS00// 0-@L D 0,P +PP ,0400 A -L4MPQ@`? 4 0| 0 p|  0 | 0I?KK[P w $ 㤜 (Q 4)m K!pX!`O[]#ERa[] -LP`@x P l1l 5* P XKh>  0( 04= 8 R R  R pW 0-(R@    K>0K  >T00  00 0S K ,>T0p0  0l0 K0Pd0Kb040 00 0x9H0 yK 5> K `N K> 0K00 000 000 00 0 DP ,8T K-K  `> `V 0SX  KR>KF 0KK00 000 000 00 0 DP `d7TH@  K=  K,> KH '>0K,  >K ,>0H0 K0z6T- ]1CT) 6T% 6T" 8686T 0C60S0H6T 0CT*0CT&:0T0D6T:0T0T`V 0S R ጐPL5T  0CT3 $5T 5T+ 0T( \5T X50SP5T !0T \ !,5R/@\ 4T. 11CT p4T 4T 0T 4T<  0CT05 4T= 0TE H֏-3 0H \=P0  Q=뷏P 00 <1 . <1 .3=@`v ؎@Q 0p R 0V` paAp N 1`p`VpP!~d0n0u  @Pv`Pp 0 K<PP PKd KK 0 P S [d0K 2 000Kx00 |00 kP K KmP0S/ R00hh0@ |10S Qn P T(lL1 @ T h0S m1 0 -@@1@@@@ &<- #<Y(KUiikiii Mi WiH>@^iku(ijuP imiHLi0?Ni0Pi Ji(KiiildiHeiH]i:]%i ni i ߖ>Si i Ii !i Ti `]@+]\ -<0LPS3 3A0AS/ @帀帐T' 00S!` ppP 0ppS PA` .Rb0 QD}b@$Kkk^*ƙ] -L@KhA-0`V0 1S+ #($pW QP:P QP: @PQPW QP1:\ QP:@`\0 ^ -8L Q Q Q Q0AS GQ #Q 5QQ Q Q @] 0-LP㎤@㊤ㆤ U(0 000 -@LW唤咤 (Kh茤 x-`P L@;0`0000!36 0x x-`@P L;0`00000 08C00 80x -L$M0K@0KK 0-@L'PBP0 -@L$M0Q`pZ 'Rl 'R\($0 P DK ;DK P 0R0 RR   BR 0 PP P P P P!PP0S00SS000CS1P!10!0!0!0!00 Ki= ]8] -LM`0P@K 0 0 APK :0K :pX tKK:tK  tKK KtK K :0K00 @P  @P0 @P 0PU X @PPpW|00 x00 P00S @n :0K \:K[\[\ظ*b] -PLM 0p 000c 0b  06 0$0 0 p0@T 1$K P.`@P & e@Kh+8+(<+^E - 0L@ S PQ Q R, $ S SPS  0RP_ 80`GS SV`##S6 S SGS S %SIVVFpp =@P>  7@P8 V 9#V!P000 00 00 00 00 00000VP0S  Y9000000P0 P%PPP  ?PP^^ -QRLM`@H 0P .P aP0 a?R:K K0[ K0 C K0PSU A ER PPC0X tK9tKZ tKK c  [tKK_ pKtK  900<000K pL9 PK -LM80S :0CS 10  10  bpDUT10Ss /80S Sk 10  d#3R10S\  W100(0 SOALAK PP K`8 K 1TKppK\K[pKUKXP KxKKDP wpKWKtP `P pKYKP 0,0 (0 @0K 0@0  0|P L0P \ R \  P /CP ($K*]][\Z\3]] -LM`=8Tl!hq @dTK 00SD0SA 00S=PU 0S   .,0 H uu0P 300 v00 8 C8(0Pu0T00 R R 00S \ U000CS00r@/(KoS lEظ*] -L M@1p`,K0.P ,0 (0 >P T @&0 80 P 8T ,K i>P K -LM  bX K -L$M0,00@4 'S8 ((S@P~ 0;S<K@Pv 0(, -p44Pt. )x/ 0ドl| H0 L J`PH0LZ g(' Ƞ(gt"t',,,ĂY Ƞ ,,̠ h0 < @ D0 Z; 0㰷P6  'P -L <00 (00 @g8'8#4`g4##,0-##<./08 9 ( D0W8 9 84 2/PLp e ` `[@XT  (K -LM0 0   K0 ^ KE p-L M0P`( R@002K 0K2[#ĠČ3 ȠP,Ƞ 0cK  K  01K0 R![0  0K,0`#,`Kp 0R S 4/HP/// -80M@L0 0@ 0KҜ]P0S/4u\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ -L@E ( " R Kh ^E0@- R00P 0P@`P 0@00@- R00P 0P@pP 0@0 -L4M`@Vp R R R RP SRPHK0FVS  DP PxX'x%X H0K 5VP"Pp D20T0 0\0 Z  0RX0 {P0S# ` R d Rh Rl R4P 4 8P  w<P RX T 2/SVP Rp Rt Rx R| R p X<P  0\0SY ( R L * Y`@K A<P p ;<P ( R U $R@ R< R8 R4 R `@K !<PW $RXz(K([\(E`\ -0LPpS  `R0S RpP 0ST00 +0 x-@L`T 0PS 4aP H0S@x p-LDM0PS 4`K@P 4 PK 580PKL0 004 H0 0D0 0`~40 0000 09r9tKp -LTMp8WP#p $ p $ !$#4 8#8 A0T  R$pR~p RtQ xqP rQ|`````Q>dQ;hq P ^Q[`VXqUR tQ`x r`|```l Q R+ Q4Ql R R! R rP  /R R  R R  rP  R R` ` x0 | ;x0|P   Z RVV 0@u@0x03T0SW $0S| 0Sy   3/t $0STln0t3/P 2p S0S 0S0S ````0S0 R R R S0S0S 0S S0S 0s$0S 0S` :P00Z0SVlK@V lKl@Kl0KT (K 0-L M0@4PS E8P 0S0 (|0Rp \:P rP-rP(p0St0Sx r | /K0K2K, (0 $0 R|0S 0/0K(K0p@00KK,  0KrqK0 -L$M `PV$p$04 00 0< 80 0D <@0 ( #D0 ! 004"@,80 @$ $ )Ġ!Č*"$ Ƞ(, "ATC  R>$ R;$ R8p Rt Rx R| R, p 9P&` Rd Rh Rl R ` 9P<\@0SD| 00S4\80sP   @V $ R `  0Ḿi0KhVP - @Lp8/04L (00L0(01 Kh0 /8^Ge^[ -LX( KhBSZGH$Ņ -@LQ H0R:H 㨙P0H000H00 -L,MPQp  0S P @P  0r 03R0Sa R Z0SR @TUU# @\" 0S`/L   H0KP Nn`PP nA>4  HKP XH@2 `@ `W* HKL0KHK 0 'n U`  R VH@AU  R  R QA``VT AP @PЉA0 S@R`(Kķ -LlMPX`K0|  @|Ul0KHK@@00 0S000 0  0pl@ H@ DP0H R0 4x50S 30A0L R Rl Ul  Z6 @T3 R R R R' `  .0H`KG0K@`KlQ$pP  P 0 100Ul00W R  R R RlQ 0 h K 0P3P@x pP tP pT `XK\ KҀP\0h RHKP0l` KĀPd K⾀Pd0` R0<30Sq $3 0 cRP`XK H4Pp W tQXKt p 0`St0aS}p 0bSt0aSuq l2 0 cR p H2 0 cR|q ( 0 cRqT 0 cRR l0 QReRH x R|9x x<0s H9x0< <R<RMR00Z L rP!    R5R1 # # (  XK0 U0P0P0PXp 0P0 ,0p SHU9UXKPp@W 100 P(Kظ^`^@^ -LM  KP TP/Q1 00/ᬮ^ p-LM`P ,P(0@  "P PdP !K9'`P P03P01[01[#$44[Kp -(@L0HH L0|,0<0H -xLM`q@`Wʀ0!0`1D1 <18000, !R+PPV00S#V00S 4K D,0U,@ @(@ H@0 T 4K)P@40U0 SP 0 !@0`q 400000, !$K@^H -1LHM0S@-_dKH [,(0sWdK$Pd K0 S0 "K1QTH@$ d K`$pT  2P, 2P @PdK`H $,@L00L0`L`dK`$pT  q2P, k2P @ 0R0L0 K蔊muHH 0n -0L  tx0 2/Px0 " R` ``RW W`R  Z RVlK@V lK0l@Kl0KT (K -LMP0 40 U$0(`0$0"< 080 @< )ĠH"Č$x80'$$D ȠH $H,Ȅ0 1 @T P ` P PP\P @U $0S P0 4 0? 0 ? @@ 00,0@0@$@(p0`> ,0'0!0,0 0 @@ @$@(p0`> > @@0t>@ @0 0,0$@0(p0`},0 <> $ 00> 0 0,0 @0@@ @(p0`g<= $ 0= 0P0,0 @0@@@(p0`R,0 = 0= @@0 0,0@0 @$@(p0`=<\͟X= 0,  0 @@@ @$@(p0`@ ( < =-00!0,0 0 @@ @$@(p0` << 00!0,0 0 @@ @$@(p0` <t< 00,0 @0@p@ @$@(p0`4< ,00,0 0 @@@@ @$@(p0`<; $ 0; 00,0 @0@@@(p0`,0 ; $ 0; 0S0,0 @0@@@(p0` <H; 00!0,0 0 @@ @$@(p0`,0 :@00,0 0 @@@ @$@(p0`'>: 0: @@0:@$@ 00,0(p00`q,0 `: 0T: @@00,0@0 @$@(p0`\ :,0: 00,0 @0@@ @$@(p0`H9 ,0 0 ,00 @@p@ @$@(p0`5<9R , 0 0 @@@@ @$@(p0`" <@9R , 0 0 @@@@ @$@(p04` <8R , 0000 0 @@@@ @$@(p4`8 ,0 R0,00  0 @@@@ @$@(p4` <T8 0%0,0 @0@p@ @$@(p0`8 ,0+0!&0,0 0 @@ @$@(p0` <7 0(0,0 @0@p@ @$@(p0`7 ,0)0 ,00 @@p@ @$@(p0` <07 0*0,0 @0@p@ @$@(p0`6 ,0+0 ,00 @@p@ @$@(p0`q <6 00!,0,0 0 @@ @$@(p0`]'.0 P6 0D6 @@086@(p 0;$0-0,00`0F 6'.06 0.0,0 @0@@@$@(p0`2 <5+00!10,0 0 @@ @$@(p0`x5,0l5 020,0 @0@@@$@(p0` ,0 $5 05 @@030,0@0 @$@(p0`<4|$050 ,0 0 @@@ @$@(p0`<4 $ 04 060,0 @0@@ @(p0`@ <<4 004 @@070,0@0 @$@(p0`3 ,0(0!90,0 0 @@ @$@(p0` <3#00!<0,0 0 @@ @$@(p0` <\3 0>0,0 @0@p@ @$@(p0`8p <@ y3 ,0?0,0 0 @@@@ @$@(p0`f <28 0<0  0, 0 @@ @$@(p0`Q<t2 0h2 @@0@0,0@0 @$@(p0`=42'.0(2 0A0,0 @0@@ @$@(p0`) <1!00!B0,0 0 @@ @$@(p0` <1!00!C0,0 0 @@ @$@(p0` <L1X!00!D0,0 0 @hꕞ]MF]@F]Р^]p]<@F]h?FȞ]hӂ6^GWI؞]]]]]]]!]/]5]LFܠ^9]TF@]VF=^K]O]W]_]g]w]]]]]]ß]tEFP^ϟ]^ڟ]]e\]GF]&]BF"^KF]] ]]%]]dXF2]IF=]K]\]k]x]] ]Q]>F]UFȠ]|FFΠ]נ]Ҡ]q] ^DDFݠ]]0]tCF]]$]]$] ]]^@ @$@(p0` <0 00!E0,0 0 @@ @$@(p0`o <0 00!F0,0 0 @@ @$@(p0`[ <@1@!00!G0,0 0 @@ @$@(p0`G'>1 01 @@ 0H0,0@0@$@(p0`31,01 0J0,0 @0@@ @$@(p0`<02@0$2 0K0,0 @0@@ @$@(p0` `2@,0l2 0O0,0 0 @@@ @$@(p0`<2 , 0 00K @@@@ @$@(p0`<3 ( 0 K00 @@@@ @$@,`'>D3(#0P3 @ 00$00(00 K0@@,`'.0 3 03 ( 0;$00 K0 @@@,`@ '>@3#ˌ00 (00 K0 @@@$@,`@ ,4@'.0440 0 0( 0 K0 @@@$@,`w'>@4$00  (00 K0 @@@$@,`b>48 0<0  0, 0 @@ @$@(p0`M,0 $5 005 @@ 00,0@0@$@(p0`8,0 p5 , 0|5 0 @0@@@$@(p0`#<5 , 0 00K @@@@ @$@(p0`'>6 ( 0 6 @@ 0@@$@,`0 K0(K -p0LM`P.ʠ ʠ@,Ǝ0 ɠ |K ` 0KL0 000 0 000 00~K0u -p0LM0`P0 0@0` 0 0|0 00 p0^ |K 0KL0 000 0 000 00MK^^^tӂpӂ -PLM0Kp` ` @0 _0KT0 0@0 000 0 0&@t@3P@T00$K -PLM0Kp` ` @0 40KT0 0@0 000 0 0@t@3P@T0 S0$Kؠ^/u -LM@`Kp` 0S S'000 c_6,:0 6,Kh0,\ l0 h000cS0#610 0K\0 0` 00 0 000 0 0(KP -0LM0pS`B@PHK@K` \ \0K  $0Kl #T0 0@00 0 0D 00 0 0}$K踧 -LM@Kp ` `P0K\0 00 0`0 0 P 0 00 0W v 3P R   0 RP00  (K -qLM ` P대K@` Y0+\@ T0 0 0  0 0 0`s`3P  R0   0RP0S 0\+* (K耦 -LM p `PK@` 0+\@  0 0P  0  0Ppsp3PpW0SP 0\+P (K耦 -L|MpK@`` 0T0 T .1L0 @@T)T'0L0 `LsP  L \ _Tp0PӨ@@0 00p0 000 00yL@\W(Kx@^ -LxMℐK@` ` p 1T0 T = (R(  X@D0  D @@T0T.(0D0 `D!PP & D TP T ʈ( @@P Q@0 000 000 00 D@T$Kxx^ -@LMpoPK  ` ( K\  0 0   0   0PsP3PPUPH0U !U P00 (K^^ N 0-LP@ᯋ0S 0 - P`L A 0! 04!(0:0<1 00$04Rp$p$M$P0(00,0(0S 004000$ t0 l R ?Sp 0x S080t0900S @  0l$ 0 0%<!0 \0X 0`00d0x0h0@Qll Kh_\ d\@B -LMp`P@eK  ` y0KT0 0@0 000 00@@t@3P@T@xeT K -,QLM0Kp ` `@0 I0K\0 0`0 0 @ 0 0 0v03P0S&00 0PP 0R K<0T`)K ?)K P 0)K$000  K(Kܠ^ɚ;6e -PLM0Kp` ` @0 0KT0 0@0 000 0 0@t@3P@T0S\0CK 0`S ň^@P0`)"$KԠ^4X -LDMP"V4 @00!x4` 000`p @@$@(,0 0(4 p p00!0` @@$@( 0,p3 0`00!3 @@ 0$@(, 0p3# 00!00` @@ @$@(,0 0pH3@ <3Rf10 0`!0,0 0p @@ @$@(`0x2 0200!p 0 @ @$@(`,`0c2*00!0,0 0p @@ @$@(`0OL2 00!82 0 0,0 0 @@$@(`00 81 00! 0,0 0p @@ @$@(`0$10 0101 @ @00!0$0 0,0 0(`0 ,1 H10?6!:0 0,00 @@ @$@(`00 0000!0,0 0 @ @$@(`00 00!0p @ 00,0@$@(`0 0(K]ͥ^!]']x,]P6]>]AFF]d,]ȥ^O]pZ]SFb]l]v]x -LMpR`P@K BAK ` q0P0 0 00 @ 009PuP3PPU$K -LxMP@Kp`` KT |F0D 00@0 0 00 0 0 $K p-L M`P{00@0S  0Kp -L,MRp020: QȈL0K0@PP0 U& `V Y LKT TP H  L  d LK`H埈V I @P` `@h߈@(K^0^ -`1LM@ Rp XX!PP J0S 5S CK `  ,0K d #\0 0p0 0  00 00r.W+T 00& L0` Pp咈U`1V PgUP!U p GpP0@`ePpp-(KКa0 -LMQ0 @ Pu @  Y0 ppTXP uH2 PZ ` R00 9P ". `T010#0 V" 0WSK'  K P2 ć Rm V$!0Ppd0C0 $a !屇弱ꭇᰑ`PL00 PUB 嚇T010# P0  坱 50WS$Z K ʇ ȇ K P t R# Z' $! 巇vY 0PiXP  0   @0嚇 嗇V# 0Ppd0C0 (K@{{ -p2DML 00!X2@P` 0 0 @@$@(P,P0`p 2 00!1 0 0 @@$@(P,0`{ <1!00! @ 0@ @$@(P,0`h|1 00!h1 00,00 @@$@(P0`S01 'Π0$100!1 0 0,00 @$(P0`0 :0 00000!0  00,0 @0$(P0`# <|0 @00!0,0@ @$@(P0` 0(K聡]%]]$]]j)]$]]^F]] p-LM`@ `@ PvP3PPU 0 S S0000Kp -30M`Lp@P0 0p ``A `$`(p,43 00(00p ``A `$`,2 00(00p ``A `$`,2 00(00p ``A `$`,t2 00(00p ``A `$`,z42 00(00p ``A `$`,i1 00(00p ``A `$`,X1 00(00p ``A `$`,Gt1 0 0(00p ``A `$`,641 0 0(00p ``A `$`,%'>0 0 0(0 `0`A `$`,0 0 0(00p ``A `$`,t0p0 0(0 ``A `$`, 0$K辡]+^á]]a]ǡ]]!^ʡ]]Ρ](]ա] -LP _\ -LP`@p  w`(0 000  0?>#20 0(p000$00,00<0^(04p峟 7/0L0]00 0 $KiE_\1]1]D`\:]P]] -(@p 0,p00(0PL4`剟 6/(0`4偟 9/`,00,0(04pu 7/  000000,0 00300 " 000 (04p\ 7/000  00000066000` 0000 x-P BL@0R-fF0fFfFfF 0"S*$ 0"S (04P# 5/(0`8P ;5/03 &  0"S |px -L!P P`\ -(@p 0,p00(0PL4` 6/(0`4ޞ 9/`,00,0(04pҞ 7/  000000,0 00300 0 000 (04p帞 7/00  0 0000006600 -LP`ž@p  6`(0 00(p00$00,00<0((04p} 7/0L0'00 0s $KiP`\1]1]t`\:]P]] x-P BL@0R-jFiFiF0jF 0"S*$ 0"S (04PF 5/(0`8P> ;5/03 I  0"S p x 0R S 4/HP///@- 0 @ D0H0L04 8 <@ 04 8 <@ 04 8 <@0 ă0Ȍ0̌04 8 <! 04" 8# <% $04& 8' < 0$0(0,04 c<0$S  0@^ -LP|0`p0AT  P  P  04 8 0! R! A0 S0$00@@00$KkE^ x-L@@0PP `MT {@+x踶 -LlM0,00h p @"0S 04 8 ,> 04 8 ,6 04 8 ,. 04 8 ,&V̷$ 0$Ϸ6ƟP  ?RP  P 0T h     0S 00C0( 0MRM.ȎW` 0G0K0H0KKD @K0HK X0K0 M5P0SU 40 H0SpMPP \ XKXKH\ KXaPRh0XK` K QaPK\0` R< tX$ 0$* 0*WH0S 1# 0#4ğp  ?Rp  p 0X h    H    cVU  0O HKOh0HK` K aP C$ 0$* 0*7HKH\ K`P\0` RHh($l 'K P 0KSR'K: R K0SR:$Bڶ) 0)ݶV  08h2'KlQP.40 0\[WY" RCH3h0 ``\2hKH 0iP V (X 7X  08zh R7᷌t! 0V! H1@0S Є QP :0S DQP:@0 03pH )P  0pPH  0-P@ H0S 1% 0%N$ 0$QE# 0#HH0S 1$ 0$W 2$ 0$5VVWWB(Kķ^`^`^]Ң]^ȸ -L M@P`p0  0 0 ,  0d   00 [ pf`@P0 (K -@LN40P!0c580!0c5<0` 0c50D0ۼ a5@DP-QPDP ɼp%`PU Q 40,PH 0 00L SP0PEU0P`^ -L M, 0R*L0 P뒼, 0 R:@D`@4 Pp 0 0  Z0,0<ɟ 4 , HI800  (K`^^ -L^ -L M 0004 0 0000000 0G Kķ -L M@(0K p 'P[3TPPQQ)PU@!aT ϿPD 0 < 40 4000@0H00+8@P L00` 000 P3S80< R D bP 0 <0bU:v 0忆P K -,TML0 ?@`p0 0!0` 0 @@ @$@(,p,0 >) 00!4` 0 @@ @$@(,p0h> '00!T>P8` 0040 0P @@$@(,p0 > 8`00!= 00P @@$@(,p04P= 8`00!= 00400P @@$@(,p0h= 8`00!T= 0 0400P @@$@(,p0= 8`00!= 0 0400P @@$@(,p0< 8`00!< 0+0400P @@$@(,p0z<(d< 8`00!P< 0,040 @0@$@(,p0c< 8`00!< 0 0400P @@$@(,p0L; 8`00!; 00400P @@$@(,p05p; 8`00!\; 00400P @@$@(,p0; 8`00!; 00400P @@$@(,p0: 8`00!: 00400P @@$@(,p0t: 8`00!`: 00400P @@$@(,p0,0 : 8`00!: 0040 @0@$@(,p09 8`00!9 00400P @@$@(,p0t9 8`00!`9 00400P @@$@(,p0 9 8`00! 9 00P @@$@(,p04p}8 8`00!8 0#0400P @@$@(,p0f|8 8`0p800!\8 P 0040 @0$@(,p0N(8 8`0800!8 P 0040 @0$@(,p067 8`0700!7 P 0040 @0$@(,p0x7 8`0P700!T7 P 0040 @0$@(,p0 7 8`00! 7 00400P @@$@(,p06 8`00!6 00400P @@$@(,p0x6xƟ 00!0 408` 0P @@$@(,p08 6 8`00! 6 00400P @@$@(,p05 8`00!5 00P @@$@(,p04,0 p5 8`0d5 @00!040 0 @$@(,p0{$5 8`00!5 0'0400P @@$@(,p0d4 8`00!4 00400P @@$@(,p0M,0 p4 8`00!040 00K @@ @$@(,p06,0 4 ,`0 4 @00!0 $0( 00 K @ 003 ,`0300!0 $0( 00 K @ @ 00|3 ,`0p300!0(00 K0 @ @$@83 8`00!$3 00400P @@$@(,p02 8`00!2 00400P @@$@(,p02 8`00!|2 00400P @@$@(,p0<2 8`00!(2 00400P @@$@(,p0 X8P `1!1bA1 \0Sm*Q Q AQ@bDB@00?a]] ]^]^]^!]^0]^=]X^M]0+]]h^g]^t]^]^]^]^]]ã]^ң]^ۣ]|^]^]fS4^] ^ ]0^],^]@+,]@^<]8+G]4+R]^x3^F[]lPk]^v]]ܝN]N]TN]x^]t^]p^ͤ]l^ڤ][\ȷ^Fw^K(<+ķE 4 <0<@0[(0.@S*:D0K 4[<S#UD0[0 S:D0K UC[D0[0(0S S :D0K UC[D0[0Kp] p-PSL MPK0`@0%0PP @Kp 0-L P@P  ؇@P  0  -LP -L @P Khׇ -(0L 0  0 P06 0S1^  0SR :^  0SR:@( R ^*00 H0K  R  0/)Q}0(08( (K0^ข8؂xhķXЂ^ -,1DML@`pP0 0! 0` @@ @$@(,p0PZ0g 00! 0` @@ @$@(,p04PE00l0 0`0 @00! @0 $@(,p04`8P.80(K?a]K]x3^4Fข400S0kS 唎 /-/0^Ђ1 -PL@D h1PU 0T`0" Hp0# $0#$ 0#( 0#, 0#0 0#01Q  0 U  P$  P0S PQ  0 U &#&$'$` 0 RDY" = !#!] "ku(juPข0^ -L$M@Q@00qS(13^ 5 0G0K1@KH K>@H$H*0PP@Xh @T `V 4|Zf ``Uf@P U d X0R P勐$0 @@@[(K0^ข[\2ix؂P乂x΂ -LM0`PlS Tx P @d0CS5FFF F0FFFxFK{P*0 Q# :QS*@7@TpD+,7@H7'0QA0U K<P[?XHS0SG [P@x`P 0[ 7Rg% Ϸf6F  :[&0&nF0e3S00K6K Kr@ T0[ 30""##`:[ R&00‘`0@z KP[\ KۍP| 0U0"x 0#t 0#d 0#` 0#\ 0#X 0#01  0 K`$pZ  P$ @P0S) ሀKlK5[  0 Ag0#"R 1! 0!44IwX0S004g 'P ! 0!00S?" 0"Q0 @R S 0@+/X  0 00`S 0S " 0"40 0x`P4 s04< C0.4` 4K  K#(KขI]0^`\ 0R S 4/HP/// -0L@0D0PpD0P0P0L0L00S `PO `000S `P@   0S ``a`P 1  $0S ``a`P$" $ @0S ``a`P@ @ (P& ``a|`P( ( P `P ` P `$P `@P `(P }`7 -L`P4s@P* UpT ڪPD 0 < 40 4000@0H00+8@P L00s VP  5@7 -0L@(S`pesPP v7Vr0( 000(0C00(00@ @@ -L MP@p`  ? K8K @ K@K D0KK< ( '6P( WHp10Q DYX :Q $@PUT:@`0S-  S$:S(%@P 0 0&W 1Q D 0SR:Q $@PUT:@pAp0Vp$K 0-LMS(0 0e@b PK,0 01K00! R![0  0KJuK0 0-LM@P )Q SP PKއP0 :R0S 00:S000  *K0 -LT @00D0H0L0q x-``q.QL@PP >_00/U00S00=U00S0D00U00S 5P %_001U00S P _0 0#U00S $P _0$03U00S (P _0(0,42UPPU @P ^0@0x -L M@ pP`  QS#0G SQ-S*FFFFFFFFFFF\FLFFFFFFFFFFFtFFFF8FhFU 0S 0S 0S 0S0S PU. \ R 0S0S0S 0SP0S 2Pe^P  RU0 Q0U0U0  RD0000 -PU0T U0U R/S0S 0S0S0S 0S h2hGPP0^P `000 ,pP|U1 Uu 00Uq1]0 !000 ,PaUTUX 00UT#W$ 2W@]0S@  U3 U;0 U7 R4S2 p0 R-3]0(U 0 RSH0U\P0 R00P0U 0 RL07* KlP -LM@0PpS`Tw]P7 8 ER0*      K -L`M `0$)R@x0 p@P Px0EGx;S6F|F|F|F|FFFFFFF|F|F@F|F|F|F|F|F|F|F|F|FF|FF|F|F|F|F|F,FFFFFFFFF|F|F,FF,F,F,F,F|F|F|F|F|FFF|F|FFFF)000 +P;xK≅P6&UI UM U UX $U %U )U2 'U! (U& /Ux 9U\ +U:x0  RT0x0P S(( x0P S (P (P x0P S'' x0P S'' x0P S&& x0P S&& x0P S## W x0SP011P04S`0Sd0S~h0S{lPxx0P S)) x0P S%% DK P$)DK :0xKP)xK  b\PI  ք`P y\)0 @m\ptp P9Uሁ  @\PP' 9Pp0p0000 0CS񟗢FlFFFHFDK 㢄Pt DP P03S10DK⛄Pt D0  Rs900zpK }Pt sp0S0ŕo0llpK oPt el0Sh0Sd0S `0S 00$ *P 0Ol0[S\`V XK0'@0 0PVW0 S:0 $ (`8 8`# 3  R0 ``F`j`V 1S 1& 0&(P00$1 0S0S 0,  ,0R 0 0 ,00 !#  # R 20S 0, 0 , 8#8 p(1  WJhP 0 0 2$(@000" $   !  ;Z@ 0 0 !, )l0P, 0 R0   @@dQ  (00(0,1 gP,1   @1S 1& 0&0@@ 0 jP U`@ۨP 0(" ?"00 1J Pj` U@夔' 0'委7Pjjjj3PPj|@劔* 0*協\ 1% 0%APƥ]lP^8^ȸVUXķ00 0  jP 9DP0X 00 R     R *b88#4b4#0#$0 #(#< 00s0S0J  1  1P]0P P 00S6 T  U0| 0R0S   0t0`V 80S<0SS \0S 0S  3/0` `\@^ 0-0LP@T# T80S S0 0 00S44400X0S R 0@D3/P00@0X0S@PDPP0@^Ђ 0-L PjP @j@0 -L M 000b 0 0000000 0" KЂ -LMKp` ` @xP0KT0 0@0 00 0 00 0 0^@t@3P@T0 C~R0$KH^ -LMKp@ ` `kP0KT0 0`0 00 0 00 0 0/`v`3PppW@T`@V Tz%@a"T 8"$KH^ -0PLM84 Q  0 0$ K] 0-LMPX40 R0000 0#@P% 0&K0] -p3LML`,@PpD0 0! 0 @@ @$@(p,P0@D@PWD F@PF=XH@(-7X(H0(S 7S  0R S 4@@ H@T@@@* 0*+^p@ 0(Kww^ -\:L,MPLJ PL <:4 p0SC   0 40 9   _0S q_P4 ·! 0!&4P`&2S + 0+`aV嶇" 0"0VJ_P4 P妇" 0"婇 04 8 < R  R c4#<S 3則. 0.4`1, @000@S S 3 \80S 04#$48#8Sh" 0"4(Q]! 0! R0(0 ayY,K01 +  04 8 ,H 0 PF40S80 B @0 01<0 04 8 ,87@ <0S WX 7,0S㰃(<0PD C0S S Y `V  V R `DSDS Sb S Sh R VyZ L0 oPL0S  JZ 0 000+S L0 L0%0C#10*40*8*0  L0 L0S^p2P0 H L0 L0  p000000S0D0 pV0S<C0Sg̤ oP"Pi p P F0$SP0SS "200 "S > CR  R R) @d $0SP d@00#8080 pP p | 0S  t=oP 000 ,K! @000 fYPD0S 30S88 3  B008 * 0*h0`d0h0lm2 01S pQX  Q \0H @04R3Q 0SN QHV90 40S 4K P&40S @001<0 ą' 0'Dž 100#4 0<3/P; 孅  0 尅4[1N(KXV PV HV pQ 00S  04 8 ゑP`Fv|0,0Sx% 0%R 00 4xh% 0%wX^^ЂЂ^^|,^\ -LTM,0 8@P`p0 0!(p,P 0 @@ @$@0`ᘘ,0 h8 (p00!,P 0 @@ @$@0@4`ი$8$ 00!,0' 00P(p,P40 0 @@$@0@8`j7 P00! 0 0(p,P4P 0 @@$@0@8`Tt7 P00!00 00(p,P40 0 @@$@0@8`=7 P07(p,P00!0 0040 0 @$@0@8`%6 P00!0 00(p,P40 0 @@$@0@8`l6 P00!0 00(p,P40 0 @@$@0@8`6 P00!40 0 0(p,P40 0 @@$@0@8`5 㸥00!5P 0 0(p,P40 0 @$@0@8`ȗh5 P00!T5(p 0 0,P40 0 @$@0@8`᱗5 P05(p,P00! 040 0 @ $@0@8`ᚗ4 00!44P 0(p,P 0 @$@0@8`8 傗h4 P00!T4(p 00,P40 0 @$@0@8`k4 00!0 00P(p,P40 0 @@$@0@8`S3 P00!80 00(p,P40 0 @@$@0@8`<d3 P00!P3(p,P 0040 0 @@$@0@8`%,0 3 (p02,P00!040 0 @ @$@0@8` ,0 2 (p0p0!,P 00K @@ @$@0@4p8`,0 T28 0H2$00! @0 K0 @(p,`00 28 02$00!0 K0 @ @(p,`̖001 01 @00! @00 K$@(p,`Ḗ wQ Ph b`!`1 PbERP1PP@ T<8,0S*QQ Q@bDBAH00h B0 0#U\O(K~]'] ]^]¦]Ʀ]H0GЦ]]]]fSX^]D^]h/G ]T^]P^]w]]^x3^/Gv]]ܝN],N]|N45G,^\`^`^Ђ -@LKd Kh LN -PL0SU@P P`01 0pA`0 0m`P`W:`pGF  ^Ђ -@L40S  040Ђ0 4 /Ђ -L(M p(0@`1LP  4K4K 41rP@  0rP@   4K24K00  0rP@   4K24K00  0qP@ 0W" 000 004Kڹ4K4[ 0qP@   0qK 0-0@PL2  0 K0h2w 0-0PLM@P  R R KjKj0[0 P0S0ĕK0h00S \0P0HD0! ("P Á "  /^wт x-PQ000@LD0H0Ldh$h&ddd&&< nPxU `x<88001S p R #R\0x| 0-LM0@ P0P4Q#$4 8#8e๒ PK,001K00! R![0  0KWK0dP/ -`pL`a@`F0V Rg0` R P0 PUP  0`e@  -L$M`PQ,08 01<0 <\1a8 XiW( <0 0H @0 00 D 4 00 4#!RTpPd H 0pH0 0 @@L0 U , < Q L0 4  !. 4 0<  04 a#4:!0(4"8",0  :0#40 04#$4 8#8R0Ե Ե`4:0ĵ#40ĵ 004#$40#40 8#,#40#40 0L W PL Bƀ( 0(ɀ7@J8 ( @  4  ,0, 4@00,000800夀) 0)!妀D000D0 0 X@0@aR@88(#,#40#4 00 @ @4 00#40@0@ <崫  ,0@0,0Y? 4144Q`q0Wʀ ! `!   , ! D bRT@L0 M O 7@ L0 !`q1 000 !T pPpJVU`(KXw@^ --LTM 0T0 0@  SX@ ` h p n `0 pPCd0 04#$48#8S#[* 04 8 ,  #0 3S8 <0SD00c08  0bS*MSP4 AR d0  B  p    *@  0 e00 b(0@ 0(0d0 04#$4PX%<%TP%TPYXp X0h0  00I1I0@00' 0'`Q @K\@ K` 0O0K0@LK P0KDK`H@ D@ `V 0S 0 (048<R `` 0PSU 40 H0S`ePP`PKwP`Kh0 hpPr @0@0d ; 04 8 < R sZ @T @ pd W% 00S! pU`HPP GAp+ 0+` H@LpR@0d d0 $ 0$400`U % 0 l  l 0 $0(0,0S rX0r,,Z    T 0  #R  3 F3p~+ 0+~ 04 8 , Q 00S80S PK3/ p  04 8 h 噊P2 Z 0S- XUP( 00S $VP ,0  x ,00,0x 0 0 0 x t0 媩x    t0P K~0S 3E X~Tp  04 8 , 80S PK3/p p ~ 00S DB~( 0(E~0P 3 h0   04#$ QPX0 ,X0 , h X0(DQ  ,   4 0A4#$48#i  h  l R 0 4@00#40\3XK 0㧸pPX0S p0  )0 # # R, \ d ^* ; ,   @ X0  , @ ,  3  h20S T20S|X0,  , X0 ,0P`K t > 0 0l  0Ꮹl i  Qc ! R]X0,  , 04 h hApd0lj}* 0*m}2Xd pPX +XQ W rS0 P K 0 0XK NdpPCX00ST0S X0KP X0Y P \ \ Y  ! 00Y B -p 0p Z XK ᆇ P 7p000Y @3R\Jvh7p\KdP\0SSS @ @\KcP\ 0BS񟗝hGjGhGhGhGhGhGhGiGiGiGiGiGjGjGjGjGjGdjGhGhGjGhGhGhGhGdPz  0HRP| dn BRcDiGLiGliG|iGiGtjGtjGtjGtjGtjGtjGtjGtjGtjGtjGtjGtjGiG\iGtjGiGTiGdiGtiGQ0HX0Fp0Dl0B$6 0>60$13503 Rh0 R! R-p8S R@K  0S 0S  R0p0@0 @K S 0S 00,K0a b  0\0 \$\ bpWL@ `*7`;p.(K  x-@PL `P0`UP\Kxhhux x-0L@S   p0!` b   B PU  Q   {P AKxh:т -LP 'p0`@T 0S0e00S0 7z$ 0$:z1!  @p W,0<  B@T*P*тт҂w -(1(LML@lP̠p0 0! 0 @@ @$@(,P0p0 U00 00! 0 @@ @$@(,P0@4p@'>(`0 た00!040 @@ $@(,P0@8p 0)(K~]т']!] 0-0M@LP000 @@@ 0h0 tBL0,@ T "0 RA "K0h0]^т^ -,LCP 76 KhBӂ -@LmB(0"0R S  B! "2 2R2St`0P"QPSqP P0?UP U0r0KhBт^^ӂ -LM@0  0$( 4"",#$)"( ! CPCQPl4 Q  Hy, 0,yGhx! !!"$ "$ A  $(,"(?QU& PR  ĀȌ̌\ \ P Q tGx, 0,xXB@x xǟ 8 o`P8 x- 0-x8A 40 @0 U ! b  1"RQ 8PP 0 000 001<00 00 0410 0 0!p R1P5Qp !W     $ Ġ"Ġ$("( R p00S0 ``0`0@  X   Ā  $, Ġ  )"$("IYʸW  0 $!"$("(! $"$("(QX 0S0` `` @T  !!Y ,A @$"$("   R`  !R cw- 0-wSh Aj TsR! b   B @ @  fK  嚂X  8 呂8 SK0 0 )<)) 70 0100 010c00 0 0S(,0r  B owC@PCrw@ M M@00T@ AYw( 0(\wZ  $"$("Y  mI0 $)"4408#,#40#4 004#$40i8#,#40#40b .Q ` Ƞ(," ,Ď"$ ,Ġ"$ 6I )M 0R0 0  1 p0C100C0(Kwтӂ҂N  0O   ! "`"Рo00 KK[ M>|K~<0KtK $Kᖎ'K< R0l0'KaQl  R0='K l ltc(KIKK| 0p'KQl  0=A'K Al H1l`<1t0!QK (0$,0SK@0<@8KxD {@ =l0 100S. 0#K=0 0,0K0 00 00d K0000@0@P D ф K@0 K(g$Kӂ?B^^@{](ӂ 0-00LP@T P@0^ -LM P@p`U 0 000 00 0Pq4PP@!@ b\X@xx -X@LR S!\0Khn5 p-L0L MP@ K ׇ`PnP  Kp0ӂ -$0@Ln0ӂ 0 70ӂ0  P0ӂ@ @0R DP D0R 0Ps/// -LM 0@ D H  L  P  T QR #X e K0DX PR # 0z -L MD 0`@RP 0R0X RPp0U ( K( %P(0pS P K 0 D  P  X R # \!n00@00H00L0 0T0000/01/@^ -pPL` n@P V nPPPeP fmV m000V 0 `@ 0S 0 00 P00 0 @  e4ӂ^ 0-PML_e0@@00@ @@@ 05|崆     t d T  D}$ 4x(K00ӂ]^ħ]ڧ]7:]]] ]%]=]P/L 0S0S0  R0 R 00hm^ x-LP`]m@P pdPPTeeQmx0`0 00$@ 00000PRex4ӂ -@PL" d 0S 0 0S0   R0 R  000$  B ,eKhm4ӂ -LM\  P P }. K 0-LM000P@  0K00ӂ -d`L |P@pp@PDPHPLPPPTPXP1 00ӂ 0-L@ P 4P0% K0h|00ӂ 0-@0P@@0D0L@ D0H0H0L0L0P0P0T0T0X0\X0\ 0K0h 0-LP@0 0-0L@S P00 0-@L Pu:0{0000 :0 0K0hh 0d -04 ML@ ;K0ӂ -LM0000@00  0&K0ӂ -LM0000@00  0K0ӂ -LMpPF 1` 0@@0@0D0D0H0H0L0L0P0P0T0T00 `` !0pP  FK -LM0000@00  0K0ӂ -LM0000@00 0K0ӂ -LM0000@00 $ 0K0ӂ -04 ML@$ K0ӂ -LM    0$  K0ӂ -LM0 0000 $0n K0ӂ0 /807/ p-Pp LM( R`@0  0P  P tKp0ӂ - @L $9000\ӂ 0-404@LQ0S00 99P000@^\ӂ00CS0/0w9\ӂ -L9\ӂ0/hӂ 0-P@ 0L0?!‰ 0QSL0  埮0S 0 S0 C2S0 0^hӂ^T]p0 / 0p0$0  R / R  /hӂp0 / 0p0$0  BR / R  /hӂ$0/i -qQL0p R S p0l0^`$0@ A800Sp0  0SLl0\0CSl0M/ 0/|1S$ 0$;$ 0$6T 0Sp0  0Ll00CSl0T(+l1Sʈ12@ T   0 % 0%T / 0/% 0%& 0&0Tl0 \$Ki8hӂ@^ -@P`0QsLp0Sl0S 800CS80^D0 808 h00CSh0J000Kh&@^hӂ}n -0l0 4@0 h `Lp 8P80S O8) 0m$KiB8~(^um/0S/ x-D0L@!`Pm@7T x@^ -(0L@!mKh7@^ x-@0L`!Pm@7T x@^ x-D0L@!`Pm@7T x@^0S//0P //Pa\P P$ $0 / 0 //]I^G -锄LEM P6y Apt`Dh7 f70@0 $QP: 77p0`00  30SS 77h@p0 ?7_?U0P41 {0S4 %S- n BR(PGԜGdGԜGԜGԜGG|G j\#41T#x0 j8~1 j00#000.~< J?  j #$~P0Z*P0p?p0G7W C7"@7/P 800(1 d0Sp 40 pp -7@2*7W pZ 8" fQ0. P01 2 pJ/KpPl(d0S40p7pcW01P0PP pZ 00 0 1 Q  -CKG pP J0(1 (0S @7K P0SPYUK0 *K`0  00S 000 000 000 K (0K$   (1 1 0.1IK 03/@("( TppV 0 Lx(K耦@{ ^=]J]]^X\ ^$^(^ -L MQ@aP0 0 `0 0 `P 0PX !HH0x _/A @` 0e|! 0!$Kx+]]!^/\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ -L@40040Kh -LP40 q 0404050@T$ `50S 5 0S"00S 5P  40 eP L'A5,Kok55y40040,Ko@^@{@z@ -<@L 4J5HeEeKhex@x 0-Q@Le 2e@e 0!1 !0N f| 0S0=g 0A]P#P|0T100+lLm᧊u"^010000000x]Ġ^@^/0 0S/x@^ p-L M@Q` 4)40% 04 S$$ Q0 0`뵊TH0  40 ,0  B 0@BKp蠡G@^̡Gx`^ 0-LMpP@4d1U X1UEP100?D1U@ <1U :0000 0[PP710P:P0P P)P, 0P0U*{P 4000040000(00,000 0L1$0PPPU4000 4K0@xc,c@xcc,Ġ^@^ --LM0 0 z Kӂ/ӂ-//01 /@^@-!2 A!Q!5!r! P apU Q!`Q001QQ0A"RAT B01" R0S!R0C R : :#62/ x-LP@`@@ T Kxh3 - L@¨] x-@L/  3011>1a01?1?1`P PUx 0-TPL@3@0<0C@00S  0 3K0h3x0@-!2  P AEA|!E0Q#!1Q0 x-APL`{e@@x -LreT 0-P@ L@Vg30@ 0R:3ppz0 @ X0R  0@&300130xР^d0^ʨ]@y@^Q@-2 @ a4Q0 "S q0 aoQ`02e -0Lp@T `0S@4Pm30 S*P P$p0 A3{ -QLM 0 |BP P | Q4Pp UPPP w 3/P (P & CR#SqU  R S0r0u0S?{X 23`23P U `0SPt0S \x0 S 2@@@ 0Q` 2V`  \P 224@̈́ y2A` @ @ 0\~*0Sr @To X p$ Qh Z  \ 3RX  0 U2xx K<  ( K 0  4 K|  x 0KKK( R  KKL H K  < 8 4 00 c2a2xW01x0#K  u00 20S  g X0$00Js  |`;201X p@00S0000@0&2X ("2SzPU 0)(K@{{H^ -LlMpR@2@03?0T;z| 0tPP#@Ddp@ 1\2\`1P2@T `0S@P$B00S0{0001`g11`zpt0S 1 000 0;P 1U0x0 [P h114-| d1넑tP 倐 0t R<*0S3 \0 00 Q100 R $ Q1p ?R g 1 P @ lK 0 z01lK @0)tP p0@`@0Cp0 0$0t  t P|i1,01x%[Ux z(Kx@y@{H^{ -LDM 0t1ttQ 0p1`0``` 0@oqDAD1 H81`` 0,1(q0:_q1`H 1` 0100Pq0̠0@P0,0 0 `A `$`(00 -{000|0 `0M0,0A `$`(0 0{(Kx$Gd0^^Gx]GبG Ԃ&]TGG̱G]$G x-4`L@]01 T:0x@AT @T `}00000000x p-L$M`@l00PPEU0P 0 0 0  (0S  0#K"K 00 40KQK"Kn P 03/0P Y0  pn`P^X 8 WQ020?SBP !X011QoPQQ :?1$0 a(KoT0!#4#0!1 11 0R!  0 P 003/P  PX00@  P 0<00@0000H0 03/P  T !);  40 4 (80 080 )0!  (8008080 R08004 00@@0@@0@08 8$ ( (0RU XZX  (KԂ -@0L M`Q~( 0  l2pP(*t0Ss2pP j((000 $P (  0Dp    @@P:B 0$ 0 10 a( K@{@^ -L M`,K(KpvPP(,0 (  D&Z @'l4.EP,0(@@Dp&+1 1 0[1,(   Ka\]@^ -APL@ `'@pW0PQ@(@^ x- @L`Y0PT 0T .Q0P ,7qQ0a@Q@,0`@PXaQPP@ 00 Q@Yxk Ԃ "  "4 Qx-LP@ x0\`YV` x 0-80L@DP ' 1S0 1  R0  K0h'0 -L M<0r``W@PD0Sg/ 0"Y'80080 090 0$0`$`'(I'W<0  80 0@ * <  D #K00,0 'DKp-'W$00$0$0`$`p'$K - @PL`}P  U ! ' -0`(`@`1LQ}&1V ʄ1 Q  `1S` 10V*`,'&4DX@^ -0@L dP & ZԂ]lG -L M`P0 h 0Se Qc Q QPP@P dPS r0 PKPQ& PpR ppXP eq0S   40 40tXpP %%ᴰeX 嫴0d 0cC100WX  坴00(S00 0_P(KԂԂ 0-@PL) 0S& O/P FP?@Pd?P0PU H8P0"X PP X P*P00Ԃ0S 0H0/b\ -LmM  ! `pSP} (0S &w \  mK0 3/0PfmK PQ V6 V1#1K/K hP lP 04RKh/R -L M aPp! 0 P"   P?@0@ p0000 0P @0_'UT( œ# Kyؠ^ -L4M@ Q@D Q0`]1 } 0H 0p@ PrP8  |-x @< 㳭SP S04 D0D0(,!唠$`$ ` !!!!  =I$ o  똠L4P0P08@0 S>@0@0>@ldhPx0 ᐠD1L>LH zd 30d 0d0! p0p0<@<n0pQh108 l12000K `0h00 00000X 000 00 0000X0000P &000 100lPD 崁000110 0S l0l00l000S0  0@00\0|0|0S|0|  0|@0 1 R @@0a1u@03/ <Jo00000t0(0G00# ! A|HlH<0@ 0 HDH @i(Kr]^Z]y]\ H@{{ Ղ -L,M010KP8 Am`P80`Yb @0 〠h2pP@ PP PI W1P  @xPg0 mP0  P.1 <0 .` `p0V*0 0S +00KoWP0JP0 听`@1 >`W 1 6`Y@$ @ `V 0)P` 0 PP00K001 K 0000#PQ 0K `10[S3HБV 0OT 80(KР^Gy -0L@S h3/00h0 -LdM Qp0 `0@l S a "@1S xp0PSX0T 30 W걄,0D000>0#6040080>0#60D0>0#6000<00@00 qP H$$0 1p0W ::} $S!$z$pXhX p  t x0 l0 |00l00l0F. h0 *0 0 $ 0P u) )DP0P20  0  zuXytX`0<`0jiX  `k`kZYX00P G 10 00G3V l0 0 (03/l00S  3/Rl0 0 c$0S Z pWvt Qt$0pWj ^0p03/4,K P000!>0>0h0 0 004h  00{Pt9 zb003/`qXj .Fl0SL)FL34P ^ $ Ქ HY NpP tP p0S  \t 3\ t3\h0 0Ẃt$0pHt *tD L0 3/,K0(003/ 0 003 0D0zP\0X1 003/HX 1S D Ml0 q 00S p0SZ8 =E80p  8 Et0p0P 41S 4 R l S 2/ 00<1 l0 0,0S 3/l0 01l !@03/l10S TsEl0S`nED^h \10 S 0 \KB0\0 0P0 <1\K 00 Ld0& 0,pK  帐?0' Xp I20(0t000C0{ yw$fZ\0 S HkL夿60P ](K@{$Ղ0X] Ղ0Ԃ^@} 0-LM_OK@P P0K0 - ML  KG -4L4MAp1Px0P0 l1S 0B p p!EP m]p bDh1SA HKh1 X;* 00S# :S& .PL0K`P``PL Q 0x`LP LN 0 xP A`Vl1S `D` 0` s 1 tt 1` 10  l1  !px 0R %`Pbl1  !x  P 0P`Ql10l10 %   0.`P= 0y.`P 2 1 %l!0 ] 1` gV#l10 `l11 2 000 D K@Z  1t 10  B B  1t 10  B 6 0p` PW m]" (K ` CW }]a $Cl 1 @^ Ղ@{ 0-LP@0S 0 0-P@L0 ㈧h0B \00S 0g?0  Q  R0 000x000Jg?0 0<00$0<00(00 x- aLP@T T $ 6$0(0SS S ;?@A< X"lOD 1L0 3/ 0 2 0D0kPP Qd pPUN 0SP 0000@ :0<000S0 PP0P00! R0S0!boa!"! 02 B P 10  00" 202H0 @PG2S LpA 0R X>PP p4ܐ0 03/P0 0 0 0* 0 0wkP  X>0 p03/ *0qP 4 0*]sX>4 p(K@^#0X# x- 1Ll  00x@@Q` 0`cj 0a002`!f`  !R000S 0R0 0 00S0 @@0@0Kxh -L M 1p`X@ 0S 0cnT8# 0QP.. 0.N# 0. 0<@00* P0$0 0bP0T 00T0$1S(!(!(1$! 00C000C04100C0Y A $@K$k (@ :,0S 9] 0S dP ;00V`0Q X0 M@P =M^V 0 M K^PՂ@z -L M`0P@S 4Q pm@+QP 00  0ZP m#0S 뼠Z  ἀ?p /jp 4 gI 1S!!1! 2 <x0P  6 41` P  ` ' 81081@$0 ?r@0(0P p0!0b0?oR0c0s4!0b0?oR0c0sS0$0C0Y0S   = #T){J`V <$04$05$a@^@{e] - 0L@0 QS B$p`$ 00S; F'R  =P <  $0 y? 00C0(` H$0 /$0  0 0   $00$0 -L M AP0 0Q 5PJ  Z<0` < \ 1 0S ,S0`0 ,YY`0 a R  LKLL0[S < Q 1< LK P ' v\ KLKd  0PP | L K 0dXZ$ X" ҂P /~P l sll  Pl  +~Z B PXRQ0@3/XP }0X0 Z   $ 0R000 R R0h S@R Q 2  0$X00X0$0 0C$0^b4XP |0X0 0R000 ` 4@1$  B$ IX  d0 h R\$  B$ 8 $  B$ 09P 0 ! SY $  B$ @Pb$  B$ X K (dh 000S@ 0^H0 D0 0` OP`2 0P` @ D0`0 O`0$00 ` 0 00P 2/`00l00 00 0 0ly00000 l@ @0S4  0S !P0TT ֌X v40q/U Pq0`5000700 0(K@^^}HT],}H$0S8$0/ 0-LM,K P@T  P UPC@CP,K @,K U CK0[]=]] -|L M@`pP R 0S  80 \(^C@@T K@ւ]]j H 0S/0 0FZ@ւ^ 0-`0LP@T  0R0P 0S 03/@K0h9^xւ -LM@ 0pS T$10S* A  0 R!  `V T! `@\ 0 `S0@0S " 0 R    B@\L00S 0 0S(00 $0B@KЩ@ւ]]]]@-\0`Sڀ  @!`18 00,000, !@^0 !<0 `4000,000 !/@^ 0-L @3P @0303/P lE03/0E] 0-L @0P3/0 0-L @ D0Q  0PS \Y K0h-@ւLւ -LMpP 0 `S U @T U@h00S \ P0P\<8 $B00@\K@ւ]T] 0-PLTK/0@P 8 0P $ 0K0h0至]~ ^(] p-LM`C4K P@T >P &P(P PvC* @P8oCP4KW @4K fCKp荳]=]]] 0-0LP0S!UC P@ hKCPX 6P@ P (8C[ 0舦]`ׂ]ӳ]ܳ]] x-@@L`0PSqzP  Kxh,hx^ -80LMP K0hP  K^ 0-L@PP *PP0 -@L Kh x-80@L0P`q 0  B00`xb\] x-`LPK/0@P5  0P.  0P' `@1SFAP @1S9d AaP @1S,4@Kxh0x至]~ ^(]@ւ]]] x-0L@@!P`R l@5PxP P@1S @x@ւ-]@] p-LM`PPP3P00S 00S@}P@@B4K P@ P `1BPH*B4K 4K 0#BKp蜦R]^N^o6^i]=]]] -L M`0$PK,` (0 0p0%@0S @@TpP K 0-LMP,Kb P@ 0T(P,K,K\ T 0S :S K P  P  F+K0 -@LPK/P3 P- `P'p@1S3@UP @1S&h?iP @1S8?Kh`至]~ ^(]@ւ}]]] x-0L@@!P`R l?!PxP P@1S ?x@ւ]Ĵ] -LMpPPP1AA4K`@T PP P p)A@PX"A`P4K@4K(AV =Kմ]=]]] p-L$M0`P4K<0 8 oP@ V<KP@ 4K@4KeT XKp0000/ 0-LM@P{P0 0 `PQKPK0 p-LM`P4K+P@ FVP@ 4K@4KKp p-LM`P4K P@ $V P@P 4Kn@4KKp 0-LMP@0K0 00 K0 0-LM@PP P 0K0 00 K0 -0ML 0 0l KLH؇H x-PL@`83PDP T dd >x`@H "MD1S T  ~>x@ւ]]] -(0LL1S o> Kh@ւ4] -@PL`p *00(0P ` @p  ^t0@-@P PUPUPU  PU  0R00 0@)0^ 0-LM4P@P $00 0K0HԄH -LM` )@C|Pp0Sl0 0U L0 R0@@@400J,0 00K@ւ^DւH p-0M@L0 00 @16`P60`P@lll *L0Pd `P0TTT L@P H>@T88 Kph)UO]xւׂU]H^]ׂ]H]LւHH0@-` P0@P  0 @ @@@@ @@00C@00zzT 0S P ((\\$1/8c\ : 0-LP@0S a0 -L@T t0Sl02l0((|@ 0-0LM @T P (0 0@ @R@@ 00000x0xPt10 0Ah0 0@ @@@ =7< 4RK0Xc\zz0uauAuׂ]H] - 1LDM`p@P00,0 0p `A `$`(p00 A000/0,0 0p `A `$`(p0@\0p0P0 `A000,0 `$`(p0 0@(K]ׂH]]H000/ x-0L@0CS0DP $`I((KxhD(Kxhz -0L 0##@T `VpW 0KhxPp)0S RpPm0$ R@ @T Kh (zz(< 0 00 R//z -LP t0SSL0 0##0S  RP///z x-lP@L`TdP P !@0@T@@xz -TBL$MpH@ ׂ0E>ׂ0T\>ׂ p-`RL M  $ 2 RI($!!0A(1P1QS 01!01 QSQB|01 @03/ַ0T  1Q!A AX1` 0R #)81  ?Q)0Ì01 È  !? ,0QP 00`Q ?-000 000``E 0`*d0TH  BKph^^Z]y]^zׂz{^^Р^ؠ^@uP^؂\ۂ -80L 40t0@?0x0ׂ0T=ׂ 0 T=ׂ0 T =ׂ p-L M@`PUPUPU0PK0%ش P p3Kp Qx-LP@% Q &Q Q !00CSıHıHXHıH`0娴VᤴP0奴U 80 00CR0P xxؠ^ -LM` @ $ K0P $00 00000 0 0K -LdM@x  | 0 #l  #xp D Rx\KPrT TkTPph \Xph WdPt `W U tP h UZ#p 0PKhh p0Y?: Jl`0 d K0L H0 0$J$KLK0Jdd 80 <@  LKYDP,l0S@ P | 0RV@f@ l 0 10$01l0 0S T! R  X!0\10T1 0^00t1!  R0t1 50[/0.h10 B0x -LMPp@/P P P P P P P P } 0!4 0t"8 0"< 0#@ 0#D 0$H 0$1 0% 0%< 0hP&\0l00p0`=PpPd=PpPh=PpPl=PpPp=px0t00Sx0x000z00z0u0x0咲  0@(R #0尲/ B/  00 !0F 1W 1R}[ V}00 0 t0h1t 0 |1_k1g? [? 20 00C  41 4 ? p &? t0 R 01KJ00 4100 8100 <10 0 }NK }10S0CSTD0841010101 0"& 0 "&0* c0 P '? 0  0p`!(0h1$<pP0000(0S 0@400$ t0 l R ?Sp 0x S0i1t0j10S b K4 0 0 0 %0`PK0 Q/ 帑؀ ܐ 弁 圁堑 夁娑 쀗吐 쀇唐 嘐 ؐ$ ܀` P  0` P 夐 0 >$0f |010010 0Sh00h0100 Sh00h0131 0=l0 100S R   0%00t0 CSRT 0 <0 K(1 K m1<0_0110K00 0X K00001010101<}| 0 @T  ؈ 0 R 0  0 K $Ad ? ` z? \ ? X ~? T ? P ? L !? H ? D "? @ ? < #? 8 ? <& 0`p-KP Q 0=A-K A 0P20T2(Khc\c\c\c\d\ d\?B -LDMPQTP @< P0 Py(Ko7<PPP< XP H H UT T-0S*PU0P 0P8P P8 TP0P 8 Ϡ4 Ϡ4 p6` <1`0@<K@ L ZX@Z `0S t0S lT000 0&P0\ BHHHHH@HLHXHxHx.1+10$'ul0  10 R 0S 100Su.KSR000PqP0 d D XbP00S0@@H\5:X \80r0\  R+ S -6{  h  8L8 0-40@ S0!T/l!D D0S6@@ H gH  LYL  Y00 JF000l <Xy   5X  1X   #Y  Y   YuxU X y Y (}u U SMPMppGgTMQMy  x  (K -L M`p Px0@v$)  ᾭXửX @ ᷭX P PP0៰P/   X ᝭Vw   ᖭV  ᒭV   ᄭW ၭW   }WxvpXmV w iW   دx cw bv [  >(K -LM0 00 K" - ML0  0 K -LM0tpa@uP$0T0 00K7 -LM0 00+ K" - ML0  0 K -LM0tpa@uP$0T0 00K7 1`0#400/ p-L MP` 00 0@PPKphïKp -LMP` qP@1T@# ,Kx,K bK@{ -L,M Q000@ ၯ0P08`K "P ?P&p1@0p x $0R  NP 0_/`< x000 00. K@{ȵ] x-d0L1 10SL00S@0@<0AP`P0$ (0Sx@^x^hӂ] -l0L1" " R @QQ: @@P2S d)@^ 0-@LPT 4000000@0 x-l0L1 A0S `#PUj 00@ T Px@^ - LPR0+ R= R>tp W U3Z5S3  @11` $1 @ 0T# 0S&*U*W"@p01 A` @T& 0U0W  @,Ko@ `8 @@  00) @@@^^ -LM `0 0! 0 @@ @$@(`,01/.0 > 00t> @00!;$0 0 @(`,4n1<0>P 00! 0 @@ @$@(`,0P4Y1<= 400! 0 @@ @$@(`,0P8D1/.0 =-40 0 !8 0 @ @$@(`,0P<,1/.0 4=,-40 0 ! 0 @ @$@(`,0P8P<1<< 00! @ 0@ @$@(`,0P4P80/.0 x(0娠 00!000 0 @ @$@(`,4]@|]H]0 ]Ɵ]H]]#]HH(]-]6]?]I]w]V]]c]o]v]P]]H]]-0/.$0 0!000 0 @ @$@(`,4-h0/.$0 0!000 @ @$@(`,4 0-(K -@Q ALp`!0S S S'V @T|Q$"V P 0)PS |!|0UPVť`0)P@T `0S@;)P6)UPEP 0婥P|1UP %@{{ -ap ALP0S S, S8U @T5  mP `.U P# @`T"  WP U`|@U^0`@T `0S@P`PV {0B0PP '`P U @{{ p-LM` AP V \@ ,Kp ,K Kp -LLM@ph `l0 D/%K<KKЎNpW9  30 S z#UTK#2 <K1#KRSRK*CK@TPCKD#K R0DKUTKKDK$qK%K 0KK!p0 !9#p@_&K0dKD@pP0T 5#&KRnX0K\ 5#&KHnpV K 0@n K0;n h0S 0 2nh 0  +nh0 lP $K0 H0L 5#&KnKK< 0nl@, 0Kn PUp@@(K@B0@-@  0 @ @\ 0=L LA! 0!@ \@\ 0=L! L 0 $$R00   04S0?B 0-@LPT  P00 0bP00T 0T0$A0 p-qL M@`P Q 4<X to` 0 $<X Xco iKp -L\M@ l KPlKX K -1Lp "@ `0Ѐ0`` 3o먠P0 S00 ĐYP` "oP&U  P `U @|P^h -X`XpL@hPP P "U@P^@| 0-@@L0SP @0 R K0h000 @PK0h0 - RLMp@UT@ ` UT QPx p  0'Pp G@` \ \HHHHHHHHHH SRȁF` SRȁ SRȁ@D0UTA: SR=:!0@!P0@P@#UT& Dbd00@b@dl H SRȁ | SRȁ SRȁ@ @A(K^Р^ؠ^@u -LMQP0 p@Y0HSU``F VQ YN KPI 0 剥0P8W 0K` n 圐K0@  0 mX0\  \  0K  0 j0P p0 0 @  "pwp3PpW0 0 00  0(K 0-LM@P $KP  $0KK0 -L@p@@`cPĀpĐ0U $KkQP^ -LMQp`PU KiPz 0@P A j긑 XP @@ 0@PR0@0@0 0+x(a0K` Tm  0  ` \P   " @0r03P0S*0P 0㶤@P!4iP`@kPV 00S.0CS`pP @  m b@ (K耦'Y^ 0-<0LP @ lx l0@| 0  @|0@-c;    ! ,"      !   ! !R bq1(@\ $( 00  -0@ L ^l00 0 0:0/00cS 00 Q/ 0:C: 0/0l0 0 S0/ *B0 0:0/(// -LM@pP`V f (Kul(`F%1P U(  U1(0 0( 4(0 0(( l 0  R  0:C :00    $K^ -LxM0p@ S$15 3 5PU8 X3 K3K(,3KK$4`0K K l`0V U1 #0K0   !  ^:!R010!cQ$  0cPl$00UK\ kK ke$K^ -0-<@LM@@   "R$  $ 0U P!W0U 40 UUKhhӂ`^ 0-L@  00R    B "R$  B$ P?P ; @‚!U@ R"AQ5 P P0`o"RB  0 //( `0BRS000X0 S$0$7$0\Q\ QRR R  7$00`0X0 -X LP00Q ?R ; B‚1@ᐲ00T0@^hӂ -L000 0S @@@@^0/  ꗸ] -@L Od00/ -1LMQ@Q  00 40 ` 0 4 `00 202<00   8 F8p P I/0S (Ko00SJr^6pk6408  EP 8 8 ^68 p  X0[6Y 00Sp, 1@P2S (K@^t^ -0L@q00S7Ppp~I gY EP) P6 `P0VW$V `XdI ]I  0XSI 0$Kk6@^ -X0QLa0P` pp`@ EP2I@^ -PL(I@ kEP@%  cE`5V @5 p$0W "S  OEP` 0$KkI65 x-P0@LaP`0S   1EP@Hxx@^<00SP/ 0///ሦ<00S P/(01 00Ps//ሦ@^,00SP/0 //ሦ00/]Ӆ -H0ML0<0  000    0s0 Kָ]$I^| -(0L @}00|\ -L@\Pv0 |@-p0 10!,h  gϠP d@T 0@ 212@^ 0S" 0"( ,00/ Q-L@ 0P 0S(01 1!1 0R@^ 0-D@PL y 1S0 1  R0  K0h 0-@0PL1 A 0D@ 0 0 ] 10 Q0@^ 0-LP@L0S 0 x-@LP`T (0S$0(`00C0$Ax 0*0)0X0 0 0+)0X`p@- @ B2 1" 0`V  Q  @ P000p`0H000p 0b0?oR0c00  0b0?oR0c0!// -8QL@U` q ~$04$00I 2112  (0S jP Xt0>Sʴ0?03/(00CS(T*I|*I`*I*I*IT*I*I 0S $PP xU $PW S 0(0000PP+ 0-0ML* 0@0 0@@ @@@P0 000 @@@0XPT2|0 <18 400K0^ݸ]|]}2IP>I|&I] x-HP QLk =[xT0`@  08$+dajx| 0-[L@([P 0 K0h0| x-HPL`8S T0 @  +4a08H@Kxhx|G-tQH`pq0@0D0H0L000000000 @  @@ ဠ@  S BA\\0?S$(,04@ d0lApA0d00tAxA(A,10 0A4A8AD0JS 2<  < 8  8 4  4 00000 <0@  80< 408 004 000 @P<$04$04Z0D"03\h   0jv  l T X 00g?@10S  3/P @PU H 0"1R R x R h  l   0.(g?@"(@ᄁ(K}4d\ -0t0d0LP1d0g?`0pS0  B @T (0S0S V $0  `(p000$A$ t0 l R ?Sp 0xP/ -LP@p `V P0`00@@@`p0 R 00@Pp  @000/0S0S/ 0R000 0 0 !<0 `4000,000 !/@^ x-L@P`SPUA@ @x00/ x- 0@R000 L $ 0 00$ 00 (Qbb (0Kxh1t0 \00c` 0`06u PFᯥ0(0`Kxh^hӂ -LLA  0( ;00\0Kh@^hӂ -|1|qLA0`S MX> $0 W$ 40$0P3 P. 1UX $P a冇PT P 01 PP 1H0R0PP 0S  V ' VP/'P #P@^4d\ -`LP@pQ 0帀S,@T$Ki 0-0P@LU K0h0 0-L@P0S 0SK0hK0h譻 x-0L@`Q`Uʀ !``0 X0T000 !TV x@^0t0x 0-LP@70S ~0\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ x-LP`@T 0SP00:#003/0:#0$. 0.! 0!X@x@^ -T0LpAa 0P  (p@^ -@L MPp`@0 T* PT@9)z c p 0 !P0H 0 04$x 8#01qaQ (K @^9]d[I x-0@L P P  0\3000j  04,X0 0@`Kxh@^]Iy] # 0#/ x-P@La 00XP(0Kxhy -x0MLP0@p P0@00@ p000 0l`P 0\ 00|  h0w0d 00L 8 00i0 A$Kkꁹ]UI]]%]] -aL M PxAR  @]81 0@P1@p g0P  b00 0{0 v0pS  Pz?  zUx 0PS*0QSA! $ Ki8 4| K ^0X] d\]j%]]"^(7E0  0Q0d1/@^ -x0L`P@0 & p  0*  @X @R X Kh-@^ Q 0 @^0 -P L0   x  +@^۹] -0L MA P`p000 p0倐40 0p01@020S 0000  000 00 40p0(Ko@^//// 0-(@LP  cN0@{///N/-/// -LMK  K W[p3 K -LM   KKI[p3 K 0-LMP ,KP@& P 4Pp  Pt UPH ,KD,KcU $  K0]!^]=]]] -L@PP 0 +P KhKhN] -L M@QPpqTRPTRPw7`DT  V+P @P a0H R00ŗ@PF P= P rP Pp10CB>A>A0B Y0 40 c400ɑ 1 0 6 TQ\ 6  #:: 0 =P 0 (K脝]]]]!^ -|L0gM` ,K `;0S P  P@+@;!0  :P `P  fz@P :DRP0SV:0P #{ 0S:  {d0zSV000 AB>AX>A0B1 EY0 01P91 0 $ V  PP a   _K0p03V0S  _K_KsOQ, KPA0P!S*R  P!C_K i?K@P y@P _K i?K@Po@P }P PPR U yK I _K0PU' !: :#6( L8 0"$(0*,K0 S_KX1 QP1 _K g?KP,P P8,K 7  7'0 S @Q ! 1  jQP!1 d0'!  _K@PWQPPl_KOQPPL_KFQP 5P_K>QP'6 _KQy0P @ R 0S @ R 1 1d0  L6 lc@T7V  N@PPD P !%0  106  l  6#:: 0 [@P SR*PMT# PP  P | x 4 6 #:: 0 $d0 e@P 7 ? _KQ _K": :#&&"(? 0t$ _Kw@P`_K  $@L4@7@P<( -P_P3 ": :#6 9a  000F`` U*3P( LNPP DC 0QP  PP}  _KqQ_K!**"&&"(? 0" _KPPfPqxPl\28R0P`7 #: T : 0 P8B2p2`l P@P; ": :#6 9aX /eKPU PpP @P `0 K`劢 XOPeKqU 0 H P% (K00PeKT0KPpl `Pc@`<6d #: p: 0 ^D^@^&]*](;^8uu 0uJ ^C]!^|]]]P]\]] uX]k]]]{]]=]]]]]]](u ]zd@%]]$ t0 l R ?Sp 0xP// -L @0PKh 0-(0L@SPxyxP(K0h 0-(0L@SPtgtPK0h -Lu ] 0-LP@[0S 0 -L`P@Pp >2(p22@2(p220h1$00$0 P00SD0P 800S,000Ps/^@^\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ 0-p@MLd`P`0@0 0LH00 0E000 0>K0$]*]3]K]^] -p0LPAP%Ġ  0l0d0 ` Aᅳ 40f(,Koz@^~^ -0L MpPaOP@ "0l0'4 0x 0 n M0 @0-% A `X(K@^~^ -P0LpAP ,KoU 0l0$4 0` `2 00 U@  @^~^ -T0LP0S 4 00 @`  0KhM^~ -<0L1"R( R $0@^01" "/@^@-$0C  0UT#C@PCC``pD@RPSRcC*`Vpc#D R0# -LM<@K`1 pS @ b2 0X1 Y l0(0222(0S V $00(0 0(0_'0S`Y#X@2S 0  VX 0SH00@2PH221ᴡ0C1M@PM0S  X?0S00S 0 03/ @0S PrPUT@  ;@>T t0! !3000S L 0    V(K^@^ -$0LA0l0Kh4@^ -40LA0l0( 0(Kh"@^ -lqllaALPZ" (0S$0 02*2S $ 0$1"@200S0S ( 0(0S j3 P l0, 0,-2 0220C2@^ -,0L1@P2S @^ -LM P,pK`EzE]0S '0(02@22@@222@呿- 0-0S  0S`00S T003/ P0S `j`VUP 3^ x-( L@R Q R R !h0  g?0S 000$08$00$00]0S 0(0Kxh*bb ( 0 PưN0(0`:Kxhhh] -QL q̾1`@T/ `0S@ `00"t R  BR 00t0PU 1U F$0#($ ( R 0$Q ,@咾Kh׾@{@^{ -2L MrBY20 000 2! !00S00np2`V `0S`<"宾0S 0(Ko轆((2刅  b "% ` V KNᔐY8 $03 #@PP0 0P0h0S$0 (00CS XIXILI\I\I\IXI0S 0Q50 40 10Td 4050$050T0 0S0  N I@ UT @1:UT :x 0:_/x p0 @SR* 0 @ (Tr knpӂ^@{^{e\]Ȼ]޻]]@-h0Pd@ 0 P 0 P  0PQ,,^ȁI -0P`p0L 0@TSp  0_됀0P 剽t0P 0U r"QQȽU@ `0SVq!0^ȁI]I@{@z/ -0L0S 0Q/ - L01" "@^ p-P@L MP @0`0S  0nKphKp -RSL Mp@P0( KP `T(`dV 0P` K p-PL M@P @0`0S  0-Kph誶Kp -LMp0P$R@  !T PR QX``XU     0gP 00 0p``V }00  TP u 00`0`S@FYU C0\ 01 8 P8 Y0@00CS:,IdI,I,II T30- K.P-0[0B T( 0#P 0* T T @!㑳pP *  0 PP ᦳ00SS TᜳT  J 0Y  dJᇳ(K聼]e\ -QL@ S_QT`00 `0P  -LM@0 0P4S2Q70s4\0 000  ᠁P&0pP R00  0P R00p T80p  0 R  ,U `K`K 0P<0S  / 0[00C S`0S 0CAAQ P-S _S R  P8Lp40Y 0 `' 4 Z 0 IQ00YK  0 1HP 0 `Q d0S  PQ ( S ( S\ D0ST60S<60< ; S   \\ \zW0LStIpII,ILIKP@0KAPD0 R0 S sPdPPh Q V?K0SK U?KTq T@PTXA 4 0 S*8p0p` XX1 UX Tq ~PUݫPPv @ثPm @ B00 0P0QP R00>KP R0Q P0Sp K  PpW   0l1 l 0P`!p! 囫Ppp! LB!B尫V  p0 0p 0lQ0 S  A GK00A 0 0 0C 0 0!R C ( 1  h!RT1d0Q% TQX0S!`!0X0 `>`MpP  VB0Xp70T @K V O@(K辽]ڽ] ],][] --L0M0 00 @ T?k 0$K 0!0s 0D`K0 0K0 0K]@P WTMpK` Pp A4$ K0 0   $0K@# @`PBP@-84 @  R*0P `U  0S0  XP X00S= PP 0 XA0 XP' $K -`L 1V`04S 88P@`pU8P( &00S`P 48 `0E!"S*` Q   0P 0`0 P `P0Q 8@P@0400080P0TS$Ki9^] -PL 0o p@a0Wt0 T t@h^T@ TX@DS@4@DMp`KhFꮾ]ξ]P^P^J]׾] -LMpPK @TH $㌀K` @딐K 0 S3  Q 0 0` PPF 1 d 0 0  0 0K G P0 10`P,0Kd # !  0` `00(K -L$M@S0p` 0 00 ,PK50   0p 0000tP0u03V0S 0PY P3P#T000(K -dLp`P@0WS U @00 \ 01O@00-ݾ]A-Qp` P$@xA*-/0 R  0/0@-@  0UT   0 @ 0 0  0/ʚ;  0/@B 0/ 0-@PL03/0 c0 -h0L`pQ 0 R`!AUT`$03/03/`P^ -1LML`̠p@P0p00K ``A `$`(p,0 8 /008SC !A ! ` `$`(p0 ,0004 8 '>008A00 `0@0$000 `(p0 ,0004 '.0 `0A0X0 `` 000$`(p0 0,04 0(K]]̴I]4I] -|qLM`@K@ 0 K ` ? 0  @P  \@   LP  c0s3PX4 rP.  R0 `R 2 0 0vP PU =P$P03/03/@P@0SZ(KP^^ -LM0 SAQ>0p`@ P00Z0S* VpP# 0Kp000! 0  W0: l0  KcH̰ 0\@`Ppc$@ P (KP^:]]] -<L$M@T`PP@D C$P >0pS@@  03/@ ! 0!B' 1#0UT"" 0"0S 3/$ 0 (K0ɚ;ʚ;I0 !<0 `4000,000 !/@^ -d1L,M`APTʀ !`01 (1$000 !4K cK, R0$KaP<  R0$K00<0 X NoD0K000 0qP $Kl 0< PQ 0 8000  K@^ʚ;ɚ;6e p-`0`P``M@L0 0@` @K00@ @H  0BKp5]0Q>] 0-8@PL0P 0 O00Ib -LM@$K%P$K ㉣KQM/ 0-LMP@ $K]P $ K0K0 Px-L` P0 7@@PQP00/ 087xxʚ; -LM@$KPQ $K >K -LLMp\0Kh 0`0K `P <VnYj 0 d`0S0`0 ` 0.@@p3 M hLKl $KT <Kl @@TP@D0 0cS0'!@TP @ EK@RPT0D @0cS0@T P@  @ R0 @aQ R0 p000@T000 0 \ P` `x #X(KH]ʚ; p-L,M`P ,K⒡P0S<0K0 ,0Kc@Q 0<K 㗢PKp p-L,M`@ ,KnP 0S<0K0,0K@ PQ 0<K tPKp -LM0@S 0Q ,K ,0 (0 \$K$K UP K 0-RL M@P 1dx T U 4K #P 4@K "K0/$K0 K0P] - ML0 K -pQL` 傩 05@P@ 05R @TP=)@ - d帩V ThL!0#4 ?$ $0! !$Ki衩0ւ@B0 p-0,ML00`@ nPPP !P<KQ,KQ ,K ġ<K 㧠P PKp - 1`Lp F0w03R0S10Q](00CS0S \00 \ E% 0%XX@^X 0%400X0j0ɚ;6e -0L`0CS(I%X0S 0PSdC!0$Kk0S%pA\00 \ % 0%XXQX 0%d10X0X0SM 0S0\ %ESRXXpX R0%X@X`PX R0%00X0 TpP 00S0``00S0``% R0%XXaQX R0%,00X0\000Iɚ;6eʚ; -X@LT %@d  R0%XX@%@aX@T$HP P@0X0@SX@UZ400X0% R0% 6Xʚ; -LMP@`@0AS1!0SJ Q,KT"KPQP$P U\ 00 0!. P0$!aQ% R0!0000S 0Ql0 QQ a% 0!`XPPUP 0!000Kʚ;ɚ;6e -LPM@0 @`p0v03R0SydK P`PqdK\Pmp⊧YѧaDK@d`K@%X0SB 0@ CRT;StKeGKX l0@P 1ERX )0@PE0"T! tK%GKXl R0%aQX R0%00X0%X0S R0 %0X0 J8wX DK$K0ɚ;6eʚ; p-LLM`@ \K⊞P P 1URT#Z M< 0 R P0  R0 I#4W T( T,0 , ptpl ppx 0x h0 @@D 0 |T`pp pXpp,@K 4$   W(K@0 -LM 0u KV@ -L$MP`P `{Z`P@p! QTm QhT )@匥0X(WtХppY(0吀夠嘐圐堀H0 H0Y Y Y,qp!%$K0ϠX0K  HS Y Y<K<KE#KX4 0\%QX 0%@00X0N {W 8(K0@ɚ;6e -L(MPp U`@T0SDK ㇜P LK LP H0 PT D KG$K -`LpV@ 4T@g "@P\ 0\ X0@PX1@eP60\0 %X 0%XX 0%10X000S0`T 0Q  Q EX 0 P1 e06  Q EX 0 % PX 0%00X000S000@10S dy@ T0S  0S 0S0(嶤,$Kis $Ki譤0ɚ;6e0 0- 1L@0PS% Q 1@T U PU l00P@T 800P K0hy00^@- 4P@ R x-LP`@0V Wx -2LQ 0@``PP`Qo 0   00cSGS SB SB"   S SB SB"   S SB$  ,SB( ",,, ! S  SB400<SB80"<<< 01 " 0"0 p0 007/喣 PR  P0勣00$KiУ@^ -0pL @P   0pppcW 0  d00`00d0@d@$Ki謣 ` 0p0p00V P `0p0p00d00`00d0@d@勣@^ -L4 0``0d0h0000S0 @^ -LM@PT @P 0``0d0+0h Rhl0  H0Pm(p}0 h   4`pP0g0 @ `@ $0\@K]I]]]] 40 0  0  S00/@^ 00/ -L@P`p ` pKh. 0-L@P K0h" 0-L@00    0#Q000P R@ܢ0 -L M@n0`#q 0p0p    0000Q0S+0S( Z ᶢ 00 0$ 0$lp] R ᤢ 8 L L00 `/ꑢV A0(K@^]^ x-L@P`P `Kxh{ -L@@t$A@ -L@0@@f -L@@]@@ -L@@RA@ -L@000KhC x-1L@ `P  1h \ dhdlPldhlQ>B1h \ dhdlPldhlP(B1h \ dhdlPldhlP",,1h !Q dhdlPldh l ``V 0Kxh,x@^0 R/^] 0-LM @R 2/P10<0  ? (0S$ $K3/PP0[0C S0[0CS0[S0[;S0[<S$KC00<P0 P0K0ܠ^ -L4MKP0TK 00%KP@ lyh"0@#K 010K<K04@K3@K00K/0KK4RP0S   %K<K PcK"0RT1%KV%K/0 !P!0$R00 S %KV0!0h- 0p2`a- 0X``<K 0V T$$%K#K040 00#K$K40/`QUD0 p@`ʀ0 !0`10 000 !LK0 !1`Q 000 ! L(Kf ]^]A].Q`]]]]@^] 0-LMP@U $K0<0"K R?"K 5/0S T0<0 R?8P 0$ K0$K3/K0ܠ^ -P@LM0S $K"K P $KP K^ ]$ t0 l R ?Sp 0xP/ -4 L@. 0-LP@ 0S T00S 00S01  L v -`LMPp0p㴠P U@L0 @0@@ 0@04L$0$ Khꀅ$]dI@PՂ 0-80!? QL@统P R0者0~ꀅ -`<2q?pA02PLP!  P, P   ∁  qrhp0l0_Y`0p00!C202C`pP? 003/PP: T8 0XV 嬟I+Pp`X }P  WX 嗟0, R,P(p| 0 |0( W(px0S 0 03/X | 0R up@P2S 7@^-] -p ,0L⩑SP`? . 1A0,0 000XsX |0 S S0R| 00 0| 0( Q 0x0S 0 03/X &W@A  Z J0,Ko@^ -L 4]p -0Lp 0@ aPU 0SPT T@4 zP ` -1DMLQP@  0!@p`00 (0 40K @@ @$@,p0`(1(0 0!4 K00K @ @$@(p,`004 K00K @ @$@(p,`0 00!4 K00K @ @$@(p,``00 @ @$@(p,`4 K00K(KĠ^F]N]JV]]]o] -LM0P`p@  *Pㄡ @K` =,0 K\ `9h 0  \  0@   0  @T(Ke\ -L@Kh -L@  Kh -@Lh QP  X  R h!4M!Ѝ/0M0000#4 Ѝ/0 !<0 `4000,000 !/@^ -L,M@P n2`QUʀ !``2 X2T000 !42Q \ 0S  R  RBK+SKQKOB0[K0B0K<Kd1< d4c8 dQr' ?h!d1` p2`p  [P@P ( KSR10"9#4KLK ? R0 0L @4[P8@88#,#44K f R"L@ "**$KP TKR   nP   +@P(K@^ @ 㗜0 C R* =/ 9 0-LM0P@ PPP$TDH$H@.D. , Ď Ƞ,Ƞ"Ġ$("( 0 K0e] -L(M 4K&4K K=] -L M @K ! * 0 !K"$  !K"$    R@K 0-L@MPK *0000K00K1[000K00K1[000 0 00 0S PK0 0-LM0@Kc(#("$c4"P0! i*}z00 0 00 0S @K0 0-LPM@ KL*0c(#("$c4"0c`00 0 00 0S @K0 0- ML  0@ a0P  PK P! K0 - q`L1k@k 0PupY R03/  KP R0 3/P  HN - q`L1k@k 0PupY R03/  P R0 3/P  N `8 8#4`#/ 0-@LP(0S00SP @0S0S0 -L4MPP/ 08K 00 ϸP8(@P0Sk84@P`Fh &h8<0 P0r0 V0S@P cz* ` O)Ꭵ p0<  0P(!@  4@8@@ 4P 04 R @4 4(@ 0 04K0K080@P.4p0 R WPI@$ PP@ P MPK@ PL@ PJ@H@ R =ޣ40 00S00 0000 ɧǧ0P ç8(K]^P J -LM Qp` o<0) 㔤,PK @ % 0o, 0 00P0  0P00S0 000ყP0 7(K蠆 -``` VpLPUV@0դ` 0j( -0L@Sp`Ũ@P 0P0UP =00P x-LP@0040`~ {x x-0LPS@㈨PP `0S 00000 `] ZWx -L n&p3.(] -@L000 S$$KhwKhu]f\ -QL@0P0CQPP 0S 0S0 pU ړ`V p ` s PUP x-L@P@0 0000`0`` `0P 08P, 0.Pl"d 0$PD@ 0P Kxh x]f\J]\JJJ -L³A Kh~ -L⹳ Khu -Lⰳ0 0@l0 0Khe -L⠳@^ Z0 00P/Q -H0L@T P D0 0 Kh;0P/Q1 0-0L@T2 0S S- S) P 0 00 P PU P 0X0P0000C00 000P 000RW SW -P :`:L#fp@!PQ @1L \1SK <1 R 舠 0(p0 .Q 0$0i@aPT `嘠, ]. ?V" `TP P@YY @1@!\ 0] -@1L@B (1S 0J0 P #prP3>P `1i 0FP 0FUPEm$Kiq^D]K]lf\f\ 0-LM0@PS 000 00$0 c&@  1 K 0P#B(1X!0CS(1 @1  0@1JyK0@^=]] -Lƭ  0-LPὭ@/PPT0 -LMpPᬭ@q0`h!>     wh 0@1l!@AR/_@X1t0,P!\1h0(T!d1Y(0K0H0 `0 00/P   K\]].Jt.J]-J] x-L@<aP)l1\ PU :(`(), ")~]]] x-LP:P0@p1D0nQPtaxQ|Q( 0l1Oux 0J^0J -@LPp`P1l Kh\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ -LMp` $l@@_R |00$00@0@@l0 $0 ꊄP$00Kh] -LP`@0pS 00$00t}Kh]/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/ -L⸸ -`LSP1P!Rp:gR U b bM&PU: -L Mp` 0  0P@P)00 X01 0!00 0P Xi Z  0P Z i0Pcf(K/ -L`@    \p P貐0 3Wp  UP  y` -PP3LMQp` 1CQ 1CQ0S 09@TZ"80 @KP 0  9 0S`Xʀ0 !0`1l2 d2`000 ! @T K娖P@2W# 1CW 1CWU-0  @TP 00S @TH $1 T900,1T0:0 U7T7 $1T6 ,1T3 0JhK&TKZ@P # K7. 02h$1 TP  z 0!h410 !p0` d0`000, !4P@ 0S 3/(Ki@^ -LM`PPP pԕ@P 00p ` 0PPG(K x-@LP```V dP`xx03 /0-4@A@P(PPQ P0(00/@^ -LP 0 0g@봒@: 뜂@: r@: @h2@ :` 9HŸpD2\  :0 0!2``1 0fD1$ !>0!0!Q10c#6 !$1 03/03/03/ 0HQ3/h6u=914$!$1 ! 1 !1!  0 ! 00`  (K0`S]]@xg\?0 DSBOᆳ]0^HAiP)i` H^]?AP`?] ]At`d@AGk^*̢^ħ^TB^B^A@^D^/ -L@q d0SPAq 8 q (q =]H]N]V]b] 0-0@LP  0K0hؔ]JJ(] 0-L M 0@P r4  ( 0  0 (  ,  04 K$0 ,00 0P4 K0K0^JJ/0! / "// -L[k] -LU] -LpQP!n``0Nn@`d h08P PdPP|pPdT* 0J0a  0X@\///1/8#81/1/ ~ R/ R/ 勆 :: #60-L<!u@P Pߊ0S@@D$0Н^ 0-@LPf/<(0 P4 S<0 0# 3,0%@0#00%"*!, 50 54 %4050 ,080t0 h P>404<0 XP0008,0P PP00Y0Н^]WEV -( L@": :#6!뜀P჊U 0S0(0CS$0"08 p`$'zRp:W ꐐP`bV`! 0W    0`f`000ᜊ$KkН^ * *-P"VL!pЖ@P, 0Yt`Q0U5 W  WH0PHPL0PLPH L00SP0 olD厤P嘓@Pk^Н^ - :`:8q#f0YfL$&hQኖ@PU ?$000`000ᑕ뇤@P- U puW0S 0S t`0Uʉ X  XH0PHPL0PLPH L00P0 Н^ -LpPt`@᪉P0SPU PPU `⎎!3:⎉Q x-LP*`@` PYQ ⤝`\ /0S  0GPKxh:x]7]^-] -` :p:L#v!ڕ@P^ PD똀X h1Y `1Y000yq0rppf/qw0yqW n0Y 1Y + 0   @#X YU딠` 0pW @ 0S  0p`嘐@6Н^edAhdr @0X p-@ P  LML!`cP 0S ,0H 0QKpН^HNJ p-@ P  LMP!`@P 0S 60(0 H0-KpН^HNJ -<@L8 k(uP Kh[Н^^] -LM@P0L R @ K 8 (/  0㗴 KK^^8]P/00S0   /^ -0LP l_ :\œX \0 RVR :<< 8 480$, )]T]u0u -`L$MpRPሁ@ wR4 E R  R} Rz @@p t x t@0040 0`=S =S 8000   :P W0SU00K0T1 0.XPI04aL00L0006 #:,: 00(0000`p  t 0 @O $ޛ0 0P 080 MX80@ 0 `00(0 <Pu/B@@(K@^) ]7] p-PL!N 0]@^] -LMp`@孅$.PP h0PP 1.7P$ PP 4$吅00M օK@^] x-L@`P P $00 3/xx -L4MP  `@pp    ss0  $ @0 P@QQ$Z 0SP 403/!PP= ;  R00S340@ 3/40< @ 3/P0 8 40 00000 @0H KD@ H0 0000D0KQ뼟0P @T0 ;$ T0R $  $0 P(00(0 P@00@0 (K](] gJP -@@PPL`p h 0$0 S X T  VU  WV 0]) 0-0$@,00LP00T  =P@ 0 0-$@LPT  .@0 0-0$@,00LP00T  @0 0-$@LPT  @0!`0!p@-`@&!$P @%"" $ ,220pj\ p-L M`Q@ P?.` ""0Kp]:] -0PL@P0p3/^^ `03/V^03/P^`V -@L`P0p3/@^`F0fV 0@@03/1^03/*^03/$^` -@LPp` 0 0 0 003/] 03/]03/]03/ 03/]03/]p`X`03/ 0` 03/]03/]pW03/]X -L@Pp`D 0] 0X 0S 0N 0I 0D03/$Ki] -3L0 4P 0-4BLP000,000 -L$0@03/$0(0 3/p3 -L@؝P0 P`apVʀ0 !0`10 000 !,0(0,0$0 03/0 !1`a 000 !@^00S/P4*B] 0-LP@$ 0S 03/004* -( @080,0L`F8p 40  PP  U`P@PQ]T (0 Q,"# P @[ 40 [00S>^>0 7/,0@ 40 \P  U\\(08p* 07/(08P" <5/V }_(04` 6/  \PU,0 0,0\0X 003  0,0(0@( 0^M]kJ -(L@p0P 4`ޜ 6/  ,0 D 6  `  U YP , ]@[ 4  [i8屜0 9/,0@ (08P妜 05/00S$Kk'(08P啜 05/ j\T] x-(0L@ P'  P8P!4Py 5/(0P4`q 6/P8 0R80 < S$003/p x -,0L@(0!ki8PL 05/dP(04`C 6/ ` 0S[PU, p(08P- ;5/,0/0,0@ -$0L03/ x-(@h L00PR,0l RQ` Ȣ0պ<03/00h0,0l0x -, L@ (P 0"͹,00 <    10HHH# 4c  #㲹#qc0pz  #0㢹"abp00   &0㒹"Qb00   &0スLd"APbp00   (0r ("1b40 X   0<0 ,00,0+ 0\!a40  0 <0,00,0+ 0G`!dap40  0<0,0 @0,00<0 00/(!a40  0<0,0 @0,00p<0 00 `00   0d W ,0 05<0d 0{PTP$Kil,]:]|]]H^]]]]]]]]^pkJ]]0 (坹Q-/ 0-L,0@@P 0S   0 x-LP @0 `DS   0P 0?."S @`x x-,0L@ x(04P屚 5/(0P4`婚 6/, 0Q1    P L   PxP   0  Pxx@@@ 0 0 / j\ -LM`4K;0(pCK@_CpP,00 808P@P= @C @8@%$K^@B - 1DML@p`P0 0! 0 @@ @$@(p,`0P'0 00000! 0 @ @$@(p,`4P 0 d00 0X000! @ @$@(p,`04P  0(K?a]Z]|J]\{JP 0S 0S// 0-LP P @T  P@0 -QL MP`A1R  R 00Q 0 S0 *@pT" 0"0R  X 0Y 0)P 00K00  0 PpP p@p(K<* -QL M`pNPI V` PC 0S 0S0S $  0 P@U, 0S' 0SP"X 0$Y   0P 0P@ 00K00 0P @$` @P@(K -L,MPp@ `P 0`.@P Ἀ0PB0@ ( (  D0 } ` : 㡠墠壠 D0  n pVP  @0 S  0  _0:( } 8K L 040K18P 00030Kc  0 dU 1( 0(W W WU 1/ 0/U 1U 1B  0 V0|   0/(K[\8^ 0-0LM@$PK _P0(0$0 P 00S0(00$0 6 ,0 0g0($0K0[\^ 0-TP@L}(0s 0(0$0S K0h~\0`P/  !`80  00,000, !/@^0 !<0 `4000,000 !/@^H0 VXYT MU W Z [ L Ѝ/ -L4M `\0 P@% * <0KiP <0 Q@%* w@T Cn  0 p0 R 00S LK LK F^P 0S S 3L0SH0SD0S@0S L0[S42z 01P4   `ttz@P @PUT ` *jZ!R   P  0S00 R    Q# ُ``}(K耇\ x-p`Ll y 0L0@P*0y,P$ 0@x0X\ -LM0 Qp`0< K eCK 0UT%4 [30[{ND @D2DV@ @d0@=X < < BE 0X00V0(K; -LMpP` 0 p"  <K_>2L40K>;5D10K{N~>2 @Pp∀<K00KCK3pK/KM P d 0(K耖p@-0@S00R0100 \0S*P\ `R``a `P 0 U TP. 0@ T @R@A0 Q@C pj\ -L M@P0 0 S0 00.SR0 0.S @0R00U0S7J.\ \ `B0p W-`VZSF Qc c ` \V(V0Cr`` SR\6SR_000S00Q4KpL Udb.WQ Q0d prY QW Lp`L \ 0 R .R  \V P Z Q\ B  0G |`GVpPU`P0 C Q0  cfP0b0~  @V0405:(Kj\0@-P`@q \ .\ C!c@ @ @ \ 00 00 01@PQ 0 P"J0PL0L@PQ 0 PJ0PL0LP0 0@p0000 P0 0@000@-@ P@`0S ?@@D lQ V QQ  P A p`p`qaW`PV\ Q* R2 R@P\ Q Jp`p`qaW`PV d@ `P`PaQVPPUP QZ R j\@-0?@LT@ 0  0 R0@ST @\:`PV` /V000@ ?@@D$ @0 0C)PC\0:`V` /V 00CTP0US /U 0PS0\ :P@UP00Cl 0 #0 S/ -L`0S q R .R  S/000S/ 00/0M000Ѝ/ 0P0P0c/ p-|0|P|`M@L0 0@` @xL0 H@0 @( Kphv@]HQJ]m\/ - @Lᚴ☴KhvH -LMp0@Ps`QLP(K (K 0(P $` HK -L M@`0K 0p PW 0sL0W,xt @x o !,0 p8P$0$00040X 0L00s0X02P L0X0 \0!0M $55%5@<0K0 $ 80K{ pP _c< @< 0L00PM0;<7<3</<+<'<Xp4K m40\0800sX8+L000 00X0S  40KPd04 3\0 lRGXL0@0L000@0@ @0h0`T$< 0o0@$KHT]m\00  L -L M@ 0PpL08 0sFL``B\Uؼp dA10B03q `0Q000 0fP \ 0&!\`  \P0M0 00\0H >0> 0  0f0 0 ጾ \ 0 Ki Ku] -L0 @ S@ ""@ @ 0@0 D00D0 0! 4P X@0 l d@CPbT A@D W0` d0t4W P D0l@0Ch0(K0h0 0\ %S/ -L$Mp @PRE `0Q 210\0 S ~ `oaP000l0 0C#200 00K 0$0P0000$K 0``0z0!0$K{0! 00 >00 4`.0VD0l p$0 B"0$000 $ 0j00 ` K -L,MRp@`Pv\0Rs40K08 K00Kl 80 B"0000 ,0K 0$0PY 0, s040@I 41R00S : 0 !S s *BS),00400,0Z0 40 R%ZSK,0SK0 40P%TP,0R040 ,0P0 4$KP! ,8  0,0 0t0,P  K -LM`P@00 0KipP T 00K0@-\P2@ 0`o`a aQB1:0 0S Q*P 0`o`Q1!0 -L4M@pH0 PQ `T{\0 G Rv࡟P`Uf 5<0K0@ K80KBl @0 B"8000 40K 0$0PWHPU` Q<  q# <Q340i4  : #: 20< 4KQ0#40<004)4ᲔK00<0040= 40 00< 00 0K<00<0 80< R*U4@ 50t00S0@0Sp(K -L,MQ@Pp :P :0p0 @<K4I\ 90@ ` P&"L ̠LL q a oQlŒ  D0 H PD0H *P` 0  &0p0  5 "@q a oQlŒ  D0 H PD0H*P` 0 @\: V X0p0   0(KmNA p-0L,M@P00 `Uh\0Ue(0K0$0K, K,,0V 0Q  ql ,0 B"$000 00K 0$0PI,`A0!S s% *BS1000(0I0 00( 0:0 3K#40P000(0500P0 (0K000(000PK020!(0 0P0Q , Kp -0L$M@00 \ S 5702:0`0P\00`U>xVQp 0s000V `, K(0K`l ,0 B"(000H00K 0$0P 00D S PV _ K -LMpX0@`S8PL whh q h  h00Kp0l0t0.S l0 0l0 40KP^X0 Sl0040 440K]PP00W`c400X RX000C h 4 00Cl00pV70l 0pP 4 ^*h  L0 00 CS0 4 dT040 l0 B$c. 0C#p00p0$ Xp(K0M!Ѝ/ -LtM @0H0 @\ h X 8\0 MPp d040 00CSPy0\0  0PP \0SPgPeL0 0 .R  R R0.SP r 8K 0UP P Pl   ? / )l 0h0 S0r0S0  p\` 8Kptp |p Xp \0W*L0K0XtD KP0KP \ P l K B`0L HK $Pd dL0H\pf0 d  0 q 3QQx  Z|p RO  X ZR  F `0` ?;0 `0\ l\1 8K P0* yP0#x Xx,ph\ ZXXH00 R K  Q K 岅[r1 0R KQ0K5[L0X'` d d tt e\ p\ X40S  LPsZ|p XX0jrH,p0PhZ XP prP0dS pH0sXLh\p\1 wJ h aLPFXX0SZ r>\`<h\p\ d040w-  DLP)XX0SZP# P \0~XX0SZ H>\` P \0mP 0\0 0IPP(K -LTM8@T 0, p4`\0PR:pdc10 00H P \ 0q @d0\ H3\0d0,@ K 14 KH0KpP0KH0l ,Sh0 B 0@ DK $0PD h@0 l0 L @` M L l0,K\0  0!800s00X` SM ]\ 00` d ,0h0 HP P h 0R<*h )X DR 8t`PZd@0K084 K0`PPKl B0@ DK $`P?D0h00  I\d P0`P H PP X DR :`P T0S L0 X0rH0 L S0H0 H0S<0KH jP<0TT 0000j,pd@K74 K0P^Kl DK BJ0@  $l PlJh00 pG D0 T 00 0PT P1h&XDQ P-d74 K0eP$Kl B0@ $PD h00 00 0CP  pG P X DR tT(K -L$M8`pP<0K04 K0-P 0Ys9l K B0< 8K $BP(8<0@ T*Q Q\ P H P  | @vP (K]] -LML0@P,@ g L0d X0X S@` S@] 8` rL SV L0R l0Xd T@ c" 0C#p000 ,0K 0$0@P>,00p+08  P2:0(0K;0'0K0市[s4 ( K5 ' K"[X X X sL0X ;P, (0K,P >@P (?@P (;(0P@@,P T 2U ;$K] ] -LMQp`pd0l P <àbPh57C 0LAT@A0bC B0@ $ 0bPY0h  00ppp(K -LM 0$ 8 K -L .P5%0ALPPPTPT0@cRD0 X\ 0|0(3 $#PQ R 30000000002 R08x0xz0e0?oU0c0l00Gh00g0?oW0c0W|ppd0W<g0p@P  >%6*H# rKp@^W]9] -PLM@RPq R4  R ptx| |000x000S0ӈ040h ` R40-    P0S80q0S 2( KfP}(0S 5v06P(5m40(9(0' 0*(EY (5?40(P(9  (C`(EV)( 0B`P`P 9(9(  C(E(f5$0( RX000 (V5 $\( i9(0' 0000O*(_EY010w$K@^X\ 0-@LPd0S @K0hd -LM`0p S80s!@PSRQP00sHUT(SRx0s 0s  S0s  S0S d 0 /B 0UT0 d04   @ 00 @P0 0CUT$SR3 d040P@  0A @ 0*@Pf0 CUT 08 R 5$SR 00H V T0(L0 0L00000s d04@@0 "0  g*@P00L000L0000|0s d04@@0 0  I*@P|0L0 0 0L0000P @d4/(K -LM0`@p0S   R9 @00S( 80 \p b@Z! X@, K0P 0H80 dl0c  ?KQP80@l B $KЯ -L,M`pP8 P0\ 0Pd .0Sa @Ÿ@PU \ r0P R H0  0 000D ۫PPD P000T@RP ?T<0K04 K0D PPKKl @ B:0<P 8K $PPD880p@ 0 b\!  D xP8UD0S \ @d h0p\ 0 c@0 00 \!0T4 dM. 0 = SPdB.(K -LDMp @`0娀8@ S8 S 審8P \ 0  RPU  0R d-@\P  PP d.d0\@40P@0 P0  0RP<@ +p@dPP V< A1@ 0PT z 0 \ \ >0>00S H0  06H0@8CKP 000 0 XP PT -P@T 0S&4P 000%X( ȅ@C8@ D L H0 DKKUT |AP b 0hQ \APP #K 0ZCP T \ 0wTPU8  aKX@ P@0CK 07CT 0000ZY:TP8U - <0?  a R0  RT dA-T(K]]M!Ѝ/ -0@L`0 dp,00SP PW(2d2b20d - -PpPLdU 2O2 ,P PP 032 -0P 0@BPT 22 , -LtMp0Pddp d d0 t pR` S dR @tAd0U11dP 1 A1`1S@ 5@P`0`L@@  R .R S 0 t0 0 A@00l l@ D p$,d0h hS0,`x h0 t 0 ?@`A lXX 0Q \|  TCS d10d0 1hF@P&a50dKt f @P,d0Sh ' 0S$ L  0 P0 l\ h@Pdd 0dW1d@ l\ @t\ K^@P p+J040 00A50`K  @P A00p+`0Sl\ d"100p+l@`娠, Z  l\0n@ 0  PKf\K bh x,000t0 0P PK 0 O`+40  040, jP`b 0l\< $@0K,K( )D $ 40K ( xh d 0@< j0P `0 @0@Z80x`S4 h0D K 0 40  0 p280 `040D K000 02|\3 X0S(Ħl dT0Cb B0p 8K $PP `[@ @80h0:04sh 8P `F@@` `?@dP \000000`!B@@(K|]] -L Mp0`000CSk)QP80d l0 cG008 P 0#QP0$ )0080l Bp#SR Ki @K] -L M0X@X $0g@  : :#"$0ZXK]]]00\ < -LM`@0 BQ d4"8PL0儀|0 p0R0S%0S I "" 0w  0M%$Km00C SPJpJpJ0JDJpJPJPJpJPJ\J 0d  0+ 0  0 // -L|M0`0\0 8PL0 K \p  0 00 d)!U0@S 0#2l0 U0X l0 X0 2\2h0 X0S rL S P $K@R0P @KT KL㬂P Xʄ0sLl0d P cuT0h,1# X0000 ,ㅧ000S: spP$KX 0\$K K0Pl\P X0 Td K PT Lh0b p00lS0!t0 \0\ `Y@0K0\4 K<0K opPKl B0@ 8K $pP80@  b R t0 Rt 8t00 0Y:pWQa Q~ 0S0y s p0& 0B0K0A0K0[s0 x B0K0A0K4[8|0 'K0Ll0d P cT0h,1# 0H0 P (KK 0"-2 0 0 2X  0 0 000S*8c. -sP8X$K 0\&K K0Pl\P 8HpX0 $K 0 $Kh@KT K@KT Kp0K0p0l\0$K\T r? 0R0 0S WP 0[T 00 0TT0d(  0p c(K=]|D] -LMP`@0Pp0 RP4K4PKl 00T0V L0 0L0800"0 WU4KT4PKp00R 0 VU`4KB4`KM00P N0000 K -LM0 pP@d 'X0S, \0R8*x Kx0K@ z`P.00<` 8` !0 0H0K!'K00 80\0 00 0 80K 0 00|K K0H`P 0d' 0 `0d'K 0-LM@ dP'C\0S 0 80 0 00H~\d'K0 -LM0p@Pd8` 㸂ᨂn'0 00 0'!!L0d Tl0 XP 0 P c< (1# P P c/ (1#L 0$ 0"L0CS0 00:0?00& P$Ki[Z*^K x- 0L ` V 00S0@ \ @\0 s @@lTs  @@lT `R   P !xx`^+] -!qA0aL(!0Y뼑PPQ1 @T PT!p6 0 cR1 0SY, 开q 0 cRZ Z 0@Ġ倠 tp30 Z jP  hP 8pq E  R0@PT,KoY^*K`^ظ@+ -L M 80S #S@00 D|`pUT@DU TL@TP0S4 q,0 0R Ki[ K@e]^\0`P/  !`80  00,000, !/@^ -L,Mp0`?0K8K0@0KP@@KK< ( ,$PD  40V %D D0SVTG @Ky0PB , @K, + D K 0#P3D0S0 T0S !DW800C80 40!  H0S" 4 00 S 000ST0S T L0 0S V H0 0S T 0(0$؟ Ko\*]]0 !<0 `4000,000 !/@^ 0-x LPU hK0h詟X@0PPT000z(w,0( 00K0h胵*]^K 0-LP8pO00@000@0N0?0: 4?000t0 0S 80S3 #00D00S 380S00000u^^1 x-@P`L( U`0`` 0Px P-L  Rp0S Q R(   \  0 ]*] -@PLp 0S`Ϟ0SPPaK PpW/0Q彎(  0 忎(  0B0S3 1S$Q 0S  0S Ξ0PU`@剎A  0 勎40 0S 4幞 0S M]k]*]]] -L`pAW$00 0ᨴD0@<00 0 0| $Kk`^^K -L M0T@4pK0`H10S7 PHP  R 1SY 0P R000}%1SX HRX 01k $0K@ # 0"8Q 2880S080#$K贮^`^^* -tRLM@V QdPU8 H`V(ʝT1pQ0 Q  ῝Wẝ!(BQllK K KK8KlKKK R  !0$* B PI p`pH0 00 `V pc ` `50S5 01 00+0SR&"S      ! 000 0O D R  $Kk|V]]0]U]*^P 0Ps/ 0/᤮^ -PQL@QUX `1P`P $0pS 0SwP0S $ `R Rh0 pPP HShp 2 R00S 1S P P $0lPS S 0S 0 R Q"Q0*^* -L@KhM0 -L$M0@S 00S0K0K?6P F00K4 K6P400Ps900S R\   !(  !,   !0  !4  0\00SP0P0SD 2 R  0SK*^ -0PL@Q/  0P) 4  Q$TP! 0Q  R!RT  ! R H0D 10 0Kh$ p  R^* -7L4MP d7P X7P 0PH700<7P 47P  (7Pa 7P 7P7P 6P( 6PP6P@hJ/6`P@PT\ UZ 0 50P 0I10I00 020I@~.@6`@ PpT; PU9 0X00d00800<000228|0 0  K1 R0 P\0 p ` X Z0(0H 5H궢@Ȑ18 J1@\ $ QP :\ $ QP:@0 001000100010 00100 0100$0100(0100,010S  S:d! @T PUT:@T PUT:@PQP0 R 10 @T 1P 0?00$ 0S! 0,0S! 01$   0*S! \  P\Q \ 0  @T 00S000@3 ߥ$  10  00 3  Q 00SP0SQ00S ከ1$ 0 Tl1qP@T! 0`S00S P 开@ Rɝ!@T `@o1<@K0 N4PP5` P T0SP !(  !$ 0,0   $Lsz(KliHLi0UiNi0WiHOi miHMi Ji(KiPi *ظo]80#S S S SS SS S// -LMHPp0 T`@ 4W9 ,PU 6@K`  30P 0% 0v  P 00$g40d 0 P0ckYt5X  X \  \ L 0 @$ׯW0q`  ! 0 F04 e+4 $  $ Q͛pP40& *01p3S0@K0|40 40  00Kp r30P  KP 0S › 0  ᬙ W P-40; W W W$ W   V"80KPtXp#0ㄘKV0 40 30S  l0 0 0S:80020VLCIPTISX0Sl p0( Pf @$ $QQ Qø 0 0 pWF z0100 P 90P0!t0S\ 10H0L0W 40:40OVM ( 3S%0pK0(1 0 40 00K 2P 0S R  R( 0 1P" PU0PX  BX  0 P40TP;40 P @P^ HPL(K[\]o\*x^]]# ]3]Q]p -L Mp0`SP 3P U< 40 PP 800C80H0S40( 0@P3 aPP 400bP 4 H R 8 0 B8 0P40  ZP@  QPP@ T@TU3o100jG0 P2@r0 ܡ $00 0$@00@3 1Sʜ!010i1S p!0001x0\1S5s01 0S  P PR0|0U PE0 0]P1S/PU+001 00%+P 0100 3  0( +00110 0 022Z p  Y ppXZ0tK00 2 夠 `圠 p V} Zs H YnH tKtK tKQ/P 0 X0X0 d0T0K80P0 <0L0 023K8 r 0 @Q0@TPR 1 0$Kh0`@Hp80 \0P<0 0S0K0E8T#8'  \0K K0 KKK x /P ⵗ  㢕 K 묐pPX@%XtKH 3K뜐 `0HpSp0`Zp p  W pp0w03Z0S \p  FpZ tE (K<]*]]00S  R/805S S #S SS GSS S(1// -LTM0`S  \K9@bX @@PP@@  4t0@T$DT 問PD 0<00+8P40 4000@0H00P L00WX0Y 0 0S0h` <00d0K0c0K @00(0@0@000`00:00Y00p      0 !"# $0%"",&'  p.P\4Z0G0K0H0KKD @Kl0K0HK  \0K0 P! 0S 0(S  ზP10Sq H0K♖ l0ㅔhHK HK  rx0(00)0,0-0.0/000 eZ.\P 9p(0 pp0(00 @000q@0ApB 9 G4(4p0#40*p+p0:( *h0K +0\0\ Kp1@( 0(1. 0.E  0 \K\KY(KX*~] -LM0 AAQ 00P 0 K -LlM@p  \Kl`K9PW PP@P@P 3 PU ST 0 MDP0  <  8@$ $  @ H PL  Wl[ Qxp s KtK@  ( 0PP000`00:0000l0Sh0Sd0S` R <6K4&Kh d `0 6-P@ t0@KG0K0H0KHK\KⶤKD 0 b|0K0 HK \0K⤫P  20 S} H0Kl |0Xt Kw0(000 )C8-0S Y 0S 90R 0YS  9`(0 ``0(00 @000a@0A`B 9  4*40#40(4`,-0(8(.0/ 0*`+`:( Ϟx0K* +H 0`1@( 0(1. 0.ᮂL  0 専\K\KX(KX*]X 0-0L(M/0K000K0(K@0040K0 00K4 K,  PP PƔH 0㲒40S  "408  B8 K0Z\] -!pL@Q1 000 P⠔ 0 S01$ R00$Kk 0Sh=3P PMHXBPP Pz 0, S10$KkaH  `40   PP00S P [0 F@000000 00W0000 # 0\ 100v8 0$Kk,+4]{]^m]]*]^^K 0-p0LP0S @P  0R8 0 B000CS00K0hB0,+ -L M@PP\P`  `  0    ڑ0 0000 ͑ ɑP0S&Q00S"80%S S SGS S4pK ቞P P1l0    ᝑ 0RD 0 A000CS00$K] ]R]}]] -LMpK`P @ n Kj6 00 0R T0KZP T0 Q` Y TF  0  K`@K *PPZ 50SI IpF@@ 0/;0S0S0S0S*[5R0S0S0[S H50SD 0S0KLK0T0KTKKP < P40S 0[S40S HT KTKP40S ݐP0X    4 刁8 ,! 04 8 , 04 8 , 04 8 , 0S 30S `Kᠠ[啒P`p&0o0KhK0p0KpK ᾖKl X 0P 4  0  R 0 XP0 0` p ` pY 0K00 R 9  R 20St KtH 90^j K 0 P0 H20S K^T K}  Rx0Su0Sr0So Pn 0Sk 000dZqR0S0S\1pK )P%H! p02\`0K0  f  p R00@`K K0%@0S K 0S K ߏ0S K ֏H@C  0 U (K贮^I]*]]D]o]]]];][\c]y]] -LM@K  P `  pZ 60S ᧑0@P⢑PX 0ጏ0 R  T0K,XP T0 Q9X E1  0 3j0 0K0SK )PM0[S \50SF K\T I?) W50S6 AFT KTK P40S1 --L`KVp`paP 0 P000 K#| 0o0KhK0p0KpKᾆKl X P40S W 90 00S 30S K`F 90`K `P T@T 0X 300 1S)90S W  JZ 01000S H010 00130#0S100  & Wp   R   9 0 0 "  Q S01X"P20QW Y  90Z 01000S10 0    0110!1S< 0S9匑`qXʀ0 !0`1 0 0X100, !HP Z10SH;0 !1` 0000 ! !4004000 [Q  <@}h  0 }S(K*]I]]]1][]]]*^@^^ -Q@LFT` yPPՍf0 Pޏ 0 S01  Pҏ 0p S`10㻍L R H10S5 4 ⮍/ Q 0 !1 p00 0ሣ) QR  0000S P p咏p0 } 0Rh 0  ~=000CS00KhhF]]@]{]u]*]^^K]`8 8#4`#/ 0-L< 8 Rx00S h 0Ir 0$ H0@@PD| 0 $0 0$00*]`^ 0-LM0@PT 0S vP40+   0 0K00 S- L S S SX] -L@T  3 <0S P T0S 1S@\0`P/  !`80  00,000, !/@^0 !<0 `4000,000 !/@^ -LDM P@1p `dK  P20S Z 20Sn ዎ`∎PP 0q`d0S`0S\0SX0S^  0R0 T0KUP T0 QpHP 8A |  0 |>FT KTK&P00S0 3,P R ` a 90 00S 00S dK/`F 90`x`0 dK0t @P{@  0 {Q(K贮^*w]I]]] 0-L8M@PHK4 0D0 00@0 0<0 H0S $1040 L0000 HK4 0K0 p-LdM@P `pKtP m TKi 8Ke070KS0Ko0K0K08@KT@Kp@Kt0K@0pK@8 KT0KtQ t8 R 8 0  B 0$0Kp0+ p-LdM@P `pKtP 0 TK, 8K(00K70KS0Ko0K08@KT@Kp@K00t0K0pK@8 KT0KWtPQ rt08  B8 $0  U0$0Kp0+ x-H0LP@`T 0S P @x - 0L@T b@ -L`|1p R l10SS `1\0&MP1PU@`G 01PV  P T R aV``$0S T@ PUVT `V`T  P T0S 1SPUT T :$Ki괮^*^]]] x-X0LP@ `T 0R 0d RZP@x* -L8M0D0 \0@` ,20S, Ⰼ d0㜊$2pPU U \0 d0d R+P iPQPP PU 00S PW`10S }` d0`@gp @K0?0K8K(0,@pKPD0K0  @0K0pP DQ J0  \00\000S Ed@`?@0KP;`P p< 0"D0S8  B8 $K*]*]0+] -L\M\0@h 10 Sv  d0n\K`@K(0h0KpP0dK H0KcpKGpKdPKK` L HPKKD 0 pP7\0h0Q\0 81  B ,1PU4 U! \0d0d R aP  P 0S p Ëd0 p婉Pp00S d0K⯋d0 pP嘉hP 80S080(K*}]0+*]] -HSLM@T} X0 `P @ @0S00S@TX0 \0`lP\00\0\0 `cP\00\0 Ra R]0S@XRT3 0S00S* X0' \``VpP 0S 9d0 p$\0X0 i`P 0S $d0 `@Q@TE 0@ 0S `P@L10 QD  R `P< @T X  \  \ @T/ 0@ 0S `P0  000)00@@T 0H HR000@ \;gK**C]]ظ 0-L@P 8P P` R` `@K0h0 -LM0@Q080<0\0 n`P 00S ⊊ d0Bsh0S!ʛ0`S   `P pm8U 00CS0 0 U[8KhK*]] -xRLM `pRāp"8`P:7Q 0R0"@T 0R00 $ R R \ ` R P  Q@ Q4 4 h Rn0@ R0 0 0d0$080(0<0,0X0@P 7:0Z(@0E`d`0嚋0 ( R0 0`S0 X0 @P h00S ɉ 0<岇Y  000(Kt^*`^*"] -LM ` K6 K⬅KHdKK0( 4SR@ KX 07P 10S mpT 0`K0 p00 P 00 00 V P P @T`d10SQ XJM`Dp  81@P@eT Ñ``b V 10 s @`p`gV@@đ0@dP00cT@!@0@c 04 0@ T!H0 0H0 0\0 K⒋P K PD00SL 00h  h x (Kظ*m]]0+`^] 0-L@0PS00S K0h#haK -PQL@ 0QU= 00SRP  $pW p 0R 0 0`V `P 0S0S   6`W f00CS0 $ ╆Kh6贮^* ] -LYM P< 18Q p0I_K@` 01 D o0P DX H?0S yD@u800 0]$1[S#1[0S >0S ^ K<0 R0< 0KNP 0 Q@p@T `Nu  0 uFA/KAK P>0S{ w0 `Dd 0( h 0l0S0p0Kl1 K08V0K0 4#=!  K  `=PP00S |0?00%= 00 04 8  r00S 0 R05: DQч08 00000ⷅ0aKPR@P y[W4q [0[p09[100[PK 0R,0 -;0S R<I[T9 ; ;0R ʔK>u  0 @u@'(W5@P ( K4pW OLYp0p00@@0004A Z5 PKzPPQ 0Z.0S( R 0S   R0S x)0S S 00S0S  )4 0 K00K<00KK0 0[܀  0@ 30K0 [2 000K00K 04 8 0 4 8 <h K@`P7 0[0X  X  [X  X S 0800<0s8 %0[ \0PP 0S Ɇ d0"岄4\`0@ S6  4QR: 00` S 0[ 48 080R GXt  0 ZtyK4 K@PPP0Sm ܀K ⎆ 0["u_X0080<0`0[U QQT7@h' L 0 KP@H! T1 ,Q xA \ 00S @|! } P{0Sx,AT @,A @t  K ؎ R 0XddQ b ^ X1 : Xp xPX^~ &K@ 0) 0LK)q %LK H@PJ 0LK*|Q# HALQ iUh 0bdT%H1@TQ@@iU  bH! bx X!q Y!\KILDh$KK 0-LMP0@0c(#("$c$"x00R?"#0c(#("$c4" 0  0S 0 00c0 K0P 0K0 -LDM A`0K` p_P D`\P e{L1<0 P1TP 4P 80 0600 06,0 06(0 `0K` .PT  5[P  P ` K" KKA-P@T `  p@p pp pp pp  pp`` #!AF. -LM@ K%-P 000000K x-L@P`  -P P0  0 000x -L$M4PK@p \h000 \0`,0 P0(0 ^g 04 0 P00M@4Rg K$KlKK -@SL t0S t:P0 0T0%p\ -L Mp`P@גP 0uP 0 Ki K -LM  `0,@Kx $p P0 -P0Rl 0   !,K ,0  BR   -P9'0KnP10 P00 0K 0 m-0P00 XJK a-P'0KmP0 P00 0K 0 L-0P00 PEx h0S 0        *    | t 0p0 }>l0 T0h d0 Mp0` \0 P`0X T0 IP X 000 Pd -P PP(K -L M@ K+P00K - ML M KTK -LM00 00 0K0 d K -LDM0=0KP pT A`PT0`P~ @08K  2+PPq4@Ts f40Y 1@S00 @fPL fLf 0L }+PPH 942 uH ` P0X!*0S0  00 SH+<0KlP<eH<  0 000`|1H uY LePY LeH0S ,1H uB@@U$@ `V 0e` 0 +PPP0P8K00= K 0000PPQ 8K ,P`=0[SP0J㪕HGV 0veT T P(KР^TKy -LMPp@`V$K *P K *P@$0`P0 00K -0PLM`p0 4K *P CK,0@0(00$00 00`K -0PLM`p0 4K *P CK,0@0(00$00 00`K -laPLpe0@00000 00 0 0 0| x0 $0t p0( ,0l h00 40d `08 <0\ X0D0@ T P0H L0L H0P T0D @0X \0< 80` d04 00h l0, (0p0.$0t0 0x00|000000 000 N+Pd 0-| P@L  0 0000000 00( ,0 $0p t0X \00 40( ,08000@ D04 80H0<0P T0@ D0X0H0d0` P0L h0T00h0x0`0|0d00l00p00 -SLtM@Pa Sg[dpS_ lpK0x0 11 p 1P D0t0 @P|@ pFT  |00|0  R<Sp9@qP ukP *d Pp 0| @ 0 K4/@P| Z tT@ #T@U j 0S @  0Ikd 0@X c@ %(K@^ -SLtM`PA S|c0pSt pl0Kܡ x ! !0 刐 D 0 t b0PP|P 0Y U |  | QOR0LP\1P jP c P 0  K0| 0S 00<0e  W 8!E 00`x=Ve l=V V`=V; $T=V H=Vl0, K1" 003/,1`P0j=V =VX0, K(1 01" 00$<V 09 ,V VC 0,!  (! 1,V' ,V5 (!  P$! , K0"P3/(1`0$10,10,,<Vp ; <V (<Vl <V 0IK4 8 <,1  04 8 <(1 0  $(,! x;Va p;VKK  0L0D;V (;Vr ,;V0,1 0(1 0$1 0 1 01 01 ,01 000 01 01 0 1 $01 (01 400 800 00:Vx :V0, K(1 0p1" 00y`:V T:V  1>1>0K/K1 003/ `KKm,K>1>1>110Pr KKm0CK1 01 K?K   R K/KhKP9T000 h04 \ X0 , \KPP h)HPhlK`tVdK `Pl0KP PUP3DP `P `0d R`3:l `lKp -LM0$0 0 0 00 00 0$K0 u K -LM0$0 0 0 00 00 0$K0  K -LM0 K0!7 K -LM0 K0!8 K -LM0 K0!7 K -LM00 0K0  K -LM00 0K0 媁 K0 S !@ / -LM 4KwPFX X <K QP1QP Q!0#K"KSRSR00 S!cK@WVQ00WV00S 0KBKUTUT00S $0"K  40K-A$K -L M0,0 0 (0 0$0 0 0 00 00 0,K0 G K -LM0 0 00 00 00 0 K0 吒 K -L,M0@ ,0 0$ < K(0 0 0 0,K0 K<00800K -LM00 0 0 0K0  K -LM00 0 0 0K0  K -LM00 0K0 y K -LM00 0K0 垐 K -LM0 K0! K -LM0 K0!4 K -LM00 0K0 ) K -LM00 00 0K0 # K -LM0 K0! K -LM00 0K0 % K -LM00 \  0 KXKަ K -LM00 00 0K0 屏 K -LM00 0K0  K -LM00 00 0K0  K -LM00 00 0K0  K -LM00 00 0K0  K -LM00 00 0K0 G K -LM00 00 0K0 j K -LM0 K0!4 K -LM00 00 00 0K0 Y K -LM0 K0!< K -LM00 00 0K0  K -LM0 K0!咙 K -LM0 K0! K -LM00 00 0K0  K -LM0 K0!ĩ K x-L@`"SR SR"SR SR#@QSR SR#SR- SR*T?@"SR SR!0"́"SR SR!0"́#SR SR$0#́#SR SR$0#́x -LM00 0K0  K -LM0 0 00 00 00 0 K0  K -LM0 0 00 00 00 0 K0  K -LM0 0 00 00 00 0 K0  K -LM0 0 00 00 00 0 K0 # K -LM0 0 00 00 00 0 K0 6 K -LM0 0 00 00 00 0 K0 F K -LM0 0 00 00 00 0 K0 X K -LM00 00 0K0 n K -LM00 00 0K0 ~ K -LM00 00 0K0  K -LM00 00 00 0K0  K -LM00 00 00 0K0  K -LM00 00 00 0K0  K -LM0 K0!g K -LM00 0K0  K -LM0$0 0  0 0 0 0$K0 u K -LM00 00 0K0 5 K -LM0 0 00 00 00 0 K0  K -LM0 0 00 00 00 0 K0  K -LM0 0 00 00 00 0 K0  K -LM00 00 00 0K0  K -LM00 00 00 0K0  K -LM00 00 00 0K0  K -LM00 00 0K0 ( K -LM00 00 0K0 V K -LM00 00 0K0  K -LM00 0K0  K -LM00 0K0  K -LM00 0K0  K -LM@ }K -LM00 00 00 0K0  K -LM00 00 00 0K0 H K -LM00 00 00 0K0 Q K -LM00 00 00 0K0 ʏ K 0-LMP@ HP 0K0 0 0 .PK0 -LM00 00 0K0 A{ K -LM0 K0!q K -LM0 0 00 00 00 0 K0 I K -L Mp `{1{ @P00"uY R03/  SDK0_P R0 3/P  _N $K -L Mp `{1{ @P00#uY R03/  SDK0_P R0 3/P  _N $K 0-L0M@PP 0K dP00/$0 ,0 0 (00 $0K0  00K0 p-LDM@`P HK BPH0#p`p 0 " 000  0> eKVp ᨜4 0` |eK0#a " ?p$ K0P!|0l`0 K?R T0 P000 #K 0SP0S P0C6 S LK y@K0 mBP 8 0 d0 00 00x0 P 9됀@ T#0  0S&K ?(K"KSR F030x 03 P x P@x0%S Z ,P@ T0@#B-#jh0_U\ ԆK$P8@$ ?  0I#P)$ ?  0T#P ?(KP P؂P K 3 1 0 0DmP U  #K 0E#)9Z\  0 S!0Bh2Zd"\@808z0$"KKX ($@(y K lKx KCP[x_Y8=(K@:#1@# R0KP|1@@10(KlP (K_@"(K@/#41ZyK s Y 1# #c(K@"[ 0 S!0B@808R9y0[S dC"L0K\  4A \00嘟 (K(4@^-]1ux5 -LTMP0 d0@ 00 80 8X \@ 14 H0 0S 0S 0@ R8@0  1P H0s&\ 0@ 8@ 0vSR\ @KL@ <@ p`WPH 0P Q QW QǟX@0@T@ 000@Z"  4A0 UT T0SRH0 ( $7000T0nWP 0@4!UT*Y0<@ 0 }$Q QW 㣞Z0@0Ss YqL0 Q0P (Ko?<ƟH@00 000;0@0`P}L 060HP so0@0i<@ Y!ST:4`P H0\ş0@800808 pP 8@0&0 p p4@8S !QP4   %H 2`P @L060 %P 4s Zs00P H0A$T P4[4@8S@4!UT T0$0i0d P@dT # 3\ Rp P@긠 ZiPڸ0 ASR`d n0< TUR< 0i b<\ @ S103L0 5 D T :4` <@$ 0 `0cY@#00Z:D R  )! A` W8`04  0P 0` `0P@00C K)!$K98@0 0 0  0 $K4K% 8@0 %KQP0 0  0K00<i0l10S!80S48S HZP=pP 0   %0600bP 4xpZXPSVQc @JS`L0@K\Y (K@^(4DL] -LDMP $`@d &c` 媠  ⨐$ T  &T RLK\ P >PP 9 \0p TP P!nP#\0S+8W V 0S!0Bqґ‘V V T0S 8 PL0KP > < : %KT0S# V8  Pz ? 0P!᳚6K%K&K %K 8V08Y 0S!0BqґB‘(K -LM@P`K - K‚0P0K )@P R%p K0]R~iZ]it] -0MLPp0K (@P Q! `K Kn0K K`0KLK@ @ `Kp E2D08 K0 000,0K@ < # 0L K0K l0 S:   O.  lN07l0 <0 p0K0h0K0h 0 L K0K 0N PP F),Y P* 1l6Kl0 <0 ,0K< # 0 L K0K:/#P 0 Tl<0P0cl0 0SZ 500 P1z0C1 FU 1 Uu #U 800, 4P 0 |0 0x S0x0  t K |K xKPt 5 0R (10(1O4PY 0S0Z0 0|00x0040SE x48 , ,0($1S@0 S0C1HX A100!H0X 0100h0ß( 0l00,01010,01010 0  0 0W 0#003030S0C<ౣ<00lh0Z { P:ll0 00 0h0SR  SR1:!0S\ʌ# 0 y!ᚍ῱80Q & 8 Q8   8 (088 80PH(Kt\t\\55`^ 0-LM@P0d0 0c KD T P 0WK0 0-LMP@8  :8b 0 !;K0h^K0 -SLDMw 1X\P` QPdKP 0R  Rp  0R!S`QPKcK0`Q00KdKPp00S01 d0Y @( 8 < q18 < L0aQ`0d00O 000H0 0P000000X0H1L811 L0! b\0R@1 d<O H181 (K`^]]Q]P] -LDM@p `@ ST K 0R0  00@T 0p 尐帠 000@T  |0)? 0R 0S$ $  $0 n00x00C0(K(DD l]XsL^r] -L KhK  -L M @`Pጠ1 :10`!0 0 y>4 pP0 !*?;1^>0000pP0>될!;0 0 0 P>4 P p*!PPU Up  0  ! ++!++!>(K^z]] -L$M`@ LKp?J༠Z PU 0@ ?R 4 Q    帠0 b",Ġb$,  K0h -1LM刁ؑ0ASiq`VS KPK 00 00 KCpx?!K;*KSR   !KQP0| R 0K"GKUT(0l R  t0K00 R 000G 040 0P`0SX0`L0L @!/ {00t(K@^,0D^4 x-PP@L0S00  R0  X 0@`T" 0S4P 0 t#0S0C040S D0 R0 @/@Kxh*,0D 0-QL@PP @Q<0  @) $0@0$0 $@$0$$@00 -$@L Kh,] -\@L0S 004@0S Kh,4 -1LMQ0S S.p1l1H0 KgX6!LQK|1nQ0010 1`P 4`V 0S) `)@H/00@ `|0KP l0K0400G0P0700pP@}L=0y000 K@^dp\Tp\,]X~L0D]4R0 // 0-L@PP00S LL 0NCU `6&$K0h.]tp\ -LPp`@T)z@& 0$Kk> 0-0PM@L0 0@P @6`0`( 0@ @60@888 0`QP (CK0]QH]0]L] - @Ls:q:KhQH -LP`8 @v@V0T0|.T000pp0@h0 T幊 0-hh7d`dX\Pʪ1*1& 0&܆T 0 H50@^p\ 0-LMP0K'P @P000 K0 -LM@p0PS` P`PV 000 1r(0&  8o<080S(0S  V 0 PK@^H 0-0PL0@S 0S dT(0S (0S a 0( '@QT-dX8P P 0S86 80Y]30H`8 8#4`#/ 0-@PL0T K0hf"0 -,PL@U 0,0N1  p`1SzKh p-LMP0`S4 Rt11U @ @O ,`V@ 8 @ C ! P ,0 0B 0@ (T @0 07T1S 8 mBTt #T T (TKp@^]] -LM@pt4@P0TT4 0000@0\`2,4IW00 Q 4Q00 3`0 000C030 0400@300P @   !  <KⳈ卽=Z 兽傽Y @ R 0 P @H GR9DLLLxLL8L$.$ 0 3S80< RD  bP00c0 < 0bS00S `00@0$004 `9$ 6# W 0 0 3S80< RD  bP00c0 < 0bS00S ^`00@0W00p  t ` 0SP0@0`2 1! !:10 030000 3S80< RD  bP00c0 < 0b S00S@ `0@00 00 @ 幼.@ `D(K\`33443(4 4 -<@LWP " 0"0KhW  4 0-@MLH Vh ~W`P`0P0 0+!H0(0 0$!00p0 0!K0 L(;^.]4]@] -<@LWVHP!(!pKh! 0/  0-$PLH@}00K0h  -QLM 0 @ R K*r0P KA -LM< 0,0p@0,0 40`P,P 0080Z Z($0  ,0K#000 0`PF0   ```|#< <` JV0 W0'-,0K  #000) 0`P0p 80 < <"80`V80+ 79`< `Pu`r1 Q   1 4SX 4 M`P 101XQ0`4S0qA 0 10100S `x0|V`1eeo∀`8S `x0|V`1`eKn∀ `+0 R @? 00 ,0K #000!0% 0 R,K00!|x`ሀ`m` `P 1@010@00h0m:TPLHd```\`X`l0h`p`(K^^K] 4 -LM@`QX Pg꤁q夑K!P pPX 00 K R00 40 m@m0 40P 06`!Rʀ0 !0`10 0000``&!00S P (@  00 !`0`!!X0 T 0 0 0 !P$Kh^^ 4^Y]@^  -pL@PD0@P`1'sp0P1  zⱿ( 0S ⫿%P"4 P ⡿P1,<1P W  Ͽ#P0WPpPP^ -@Ln1  {><1sKh`] -Lx<0S 3/P<@HU <0(KoxQ' 0'(K (4^p\ 4]h -40ML0(0 0 0/. K]Q1 -L /  -@LP & Kh0`8 8#4`#/0Sd 0R\ 0 "!#"<00<00S#*#0/ P/(  BR( /0%30s/ 0R000 0 0S  0 00 x-L`PjV@o0000x -LM40 0P0 `8 bVl pWpXZ  #R8 <QD aP  b ̃ b\@'<0 }8@<0Q-<0  @0 3S80< R D bP 00c 0̄0 c0 \  0< <0l 00 ? 0 l0 `g gY@,  #R8 <QDaP b , aY  0   R  4 0 0(K -L Mp@0 `PV0S0H`pV0 pP@0 UU 0 3S8 <0S D0P c00c0 < 0b0S  00P 000}0P 2 00$800 000P0@80D080 0000p`9  f wjVP2T 4PD  <  P$ $  @ H 8PL  P P[UP `evVPpPP@0 080 00P  ~0 `P @ 0|000 00  Q'8<P#D`P``b````fV T  V`!V  /0 0      `f`@R (KS c\ 00 /H/ -LMP`08 @`< `hZE0SV0SS  0 R 40 0 \!VPUG ` Vp p4 0@ AP@;  ?4 0 g`gpg4 p0 R 00 B  0 0  a 00 c<80   aRPV0  0(KoH(K -L M`P0p 3S&80< R"D@ @bP 00c@ 0L0@cT@@DT000  g0Pdp@@@U7-U@ 8 P    Z@ `0 0 0 0C0`U UE01` 0 +0Pfp 00`@ 000(KM0 0SЍ/ 0-@L l0@2\0P(0S (PH0,00 P\0U 00 K0hh033 0-@L "\0PP0SPPP\0U K0h"0 x-T0LPQ@ \0(``F(`\0V0Kxhq"x3 -@PL0p: (`V9 Y "?X600Z`fFa`\0RY` V 0S ,  0$0, ` SR `V(00(0\0|3 -L$M#Kd0pP 000 #K0H (0SH0 P0Se@0K#K\0`V ,0 SR$0 S^ .!`00V( 1#T \000!0(00@0 PQP00 @`܃KԀ Q$,$HQH,@ D0 @ D0Q@0000000@000(00(00@`\0V (K3I x-d0@ P8L`98(0S$ \0t0 V ,PU VHP PP \!PP,0S,  , 0\0Kxhx -L@ 4._P 80 S8 " @0L00P0h00l00\|$< `$}D H T X d dP0p0p40 T( _P 3^3 -LL@ 4^P 800CS80e ^P 33 x-LP`@0 P0@Raa U 0ScP 00@V/0A#AR  3S80< RD  bP00c0 < 0bS0`0 0  0000Sx x-L`@P P0 2>  ,( 0 $ ::#0,0(~0${4 x88u<@r@HoDPlHXiL`fPx1$a!0QX(U0R0S00 J04 D A$ >(8;,@p c40H14Pp c*8X'<`p c @xq\\ -L`@QpPh)  SU80< RD  bP00c0 < 0bS00S 00@0P00h00, SU80< RD  bP00c0 < 0bWS00S 00@0 X00d0 XP0@P3 -LM`00 p0@QP40  đ)  #R8 <QDaP b , aR  R 00@ h   < #R8 <QDaP b , aR  R b00@ d   ,8 L(IHF PCX@`=8  04  0@p(Ko3 P-L P 0 R 00Ps00S ⥁p3 p-L M @P`$K KP"8$2$191-KpHLp@-<B#A"< T`A̱P@"̱0 #"<00<0p@-< R@ 0P@-< R@ 0Pp@-A@P<!B<pP`ḆR@!̱pA-< BTaPV P`Vp@PPT"p@-A@P<"C<pR`"̱#RC̱pA-< CTbPV P`Vp@PPT#P0 H0S T 1H0 P @P// /`Q П/q\ -0@Lt0S!*tsP Kh3$4 -LM4 80 P< u``(0jS@00 00S0 f000000 3S80<Q DPh0<0hS00S   p  < @<< p1880S S{   #R8< R D Pb  b , a U U2p00 4  .u40q`EQPE kY 4Cc p^ 3 #R58 <Q1DP a bR q R& 1 #R48 <Q0D aP  bY! ey 0 p 0 0iX,'jX  p   bPeU  Rp    #R8 <QDaP b , aR  R p00 0P S f #  p`WM  #R8 <QDP a b,0R s R jWhP`  #R8 <Q DaP  b  bX! x 0P 0 0ph 0cQ  R  000 00   (  (K3q\] -L M@4 0K#0 QN00K`8 8#4`#/-// -0LM0Kp`P ` @0 ^x0KT0 0@0 000 00%-@t@3P@TI K,D 0-LMP@80T@3@#T0  K@ 1K0xT(,xK0 -wL @ 181!(P ᐾ`P9W0S`9 p`P '1p 01`P  0](KlA<C⬱⪱q⨱z⦱W 181^] x- 0LP(@ᔺ;`P@ x -LM(Kန`@P(p 㭔pP  P 0X s @@ %P`2(z$KL -0LS $0Rs (\ p-LM0@S" C   0C?S R000KPP0\``K `P PKp -L-E#0 0$ x5 -LOF Kh -PLDM PG MD`PK<,1p@P0 0 ``A `$`(,p00 930000'00 0S?$00 ``A(,p04"30p00 `A0 `$`(,p0p4 0<3(ڇ`P 5(K400004 H0 40H  T 0H0 X\<0K000\2`DpK8`K` p  1a@PV XAM 8D 0 000bS0D0  @ K  PP@ 3VP 000K PP'T+8D 000bS0D0  @ K  PP@ 3 P <?@AR P0PP <@5T <0X8D 000bS0D0  @ K  PP@  P <H@0%T4400004 H0 (K(4@^] -LTMd0`T  ?vpSR P X \ PVt&X00X0x0S0`0 P0S, P H0KP@4 QL 8 PPP #R88 <Q DaP b , aU%U#8 <0SQD0P c00c0UJ40H   0H0 0d0 xd0EQ QE!T(8U14KHKT PP1 0 3S80< RD  bP00c0 < 0bS00S 400004 H0 40H  T 0H0 [40  #R8 <QDP 0a0c0,000c S00S 400004 H0 40HP  P  0H0 R T0 T`T `P000DK8K0<0K0002 1 d PPd QPQE 80 D 000bS0D0  @ K DK o@P'@ P 000K D K0Q@P0U <mk8D 000bS0D0  @ K 8KDK G@P <VPS@ \ ,K0 0 P0$@P08D 000bS0D0  @ K 8KDK @P@ mx0@P<'HP$P 8KT D0K)P < P<X P0`d SX \00T@@T\ `{` T`wX 0U0400004 H0 (K(4@^] -LM0 d0 4@ `@   v?  QP @K i@0KH嗓000 @  E \ \00\0|\ 1夀 \000\4 X  0K@p \N  8PPP #R98 <Q DaP b , aU&U$8 <0SD0P c00c0Up0p   00 EQ QE01 T(bYPUڌpKKT pPG 0 3S80< RD  bP00c0 < 0bS00S  p0000p 0 p0  T 0 0 &Yp0  #R8 <QDP 0a0c0,000cS00S p0000p 0 p0P   00 ! \5 P08<00(@PKD000p@p40A30p0PLPH 00h00  0  h  0 00000   p h{ pK 0KpP xtK|PK0 P0x0K0007  1pP dq\ t| 0娐00bS0|0  l K tK|K YPP|l 7 0RLt |@000dS0|0  l K tK|K ?PPbl@0 %K ,KL 0 )K&K}H)KUT \ \CUT@@T@q@@' KSR  x0 S0r00  @ᴐ 唐 t| 0h 00bS0|0  l K tK|K PPl :P 00hKtK| K0 PP xph \P Y\X0%( 0w03dKT KP TX08PX0W@pt |P000eS0|0  l K tK|K @PUlPPxpP0` 000  h 0    R0 @\  P\ [1P W101  ]P@  W1 91@ ,K0( 0 0<@P x[p9T@ \ X0pH0xJW(T `  00 0P0Q0S 0 b000p  a 0    R0 ip \ @K00@K@0C00 00S@K@K%@K@KWNp0  #R8 <QDP 0a0c0,000cS00S p0000p 0 p0P   00 pp 0VU@p0000p 0 I(KS]k](4<M@^4] -LtMx0 d0pᨐ 0`07t lp @P p $ H   h0Kp` T@ `X pPI 8   Q68<PDP@`@`@`X$X"<0S0D@P@@c00c@XjX0h@0h0 00 0H! !BT(7XXKhKT @P0 ~0 3S80< RD  bP00c0 < 0bS00S X0000X h0 X0h  T 0h0 VW`?@X0  #R68 <QDPaa,000cZ#Z!<QDP 0a0c0ZX0h@   0h0 J J t ! U ZXKhKt 07@P x`0K0\KT0KdpK0 p  0ӽ@P Ap0S \d `000bS0d0  l K  yPl j2 0Rp t ?\ d000iS0d0  l K  \PlMK 4 0 $K| 0 | 0D QPt Qp  QP@ 0Zsp \d PP 000bS0d0  l K  Pl  i`P 00PK PPP ` @Vp Zt0SX0%(0t03LK< K%P pPX08pX0p```0V( ( 0&T0S T@Xp X0000X h0 0ZX0000X h0 (K(44] - ML0  0 K -L|Mt0 d0p 0`@=Lx x   x H  00 P|0  h0KTP p TX J 8   Q78<PDPP`PaP`Z%Z#80<QDPPPaP00cPZX0hP  0h0 00 0J! !BT(7ZXKhKT PP0 U0 3S80< RD  bP00c0 < 0bS00S X0000X h0 X0h  T 0h0 ,TXX0p  #R98 <Q DaP b ,000cZ&Z$8 <QDP 0a0c0ZX0hP  0h0 00 0J J ! SZoXKhK 0HPPTP tX 8PPP Q:8<PD`Pa `U'U%8<0SMD0Pc00c0UFX0h   t 0h0 0EQ QEt010 T(:U+XKhKT PP3 X0  #R8 <QDP 0a0c0,000cS00S @X0000X h0 X0ht  0h0 0 TXSW @>`?P| X0P  #R78 <Q DaP b ,000cU$U"8 <QDP 0a0c0UX0h   0h0 DEQ QE01  S UXKhK 0pPP a 0\KdpK0`0K0T0K0 p  0 PP OQTH x0\d `000bS0d0  l K  @Pl kD6 0R p >\ d@000dS0d0  l K  @Pl@NK 4 0 $K 0 0D QPxp Q QP@ Yrxd P \000bS0d0  l K  T@Pl  `P 0 0PK7@PP x  `TPx0V@ ZpPX0%(0u03LK< K\PYX08@X0td @\000bS0d0  l K  Pl m3 0Rp | @\ d000iS0d0  l K  PlPAK =4 :0 $K 0 3 0D QPt| Qp  QP@ 0Zsp t \P 0d 00bS0d0  l K  Pl  @P 00PK PP0t0  ` P@"tTp Z|QX0%(0u03LK< KP p RX08pX0``@`xtV0( (0( ( 0&Tt 0 &T0S> UP;VZK X0000X h0 0sEZX0000X h0 h06UX0000X h0 0/'UX0000X h0 $(K(44] -0ML     !  0b K@^ -L|Md0娀` 0 `0 0d X <S\0 X0( T0 P @pT RTG XQ ` 0 ?R<:x 000H0K \ P4 RK 8 @@@ #R78 <Q DaP b , aT$T"8 <0SD0P c00c0T40Hp   0H0 DA AD01 T(PTy4KHKT pP  0 3S80< RD  bP00c0 < 0bS00S b400004 H0 40H  T 0 H0 |P40  #R8 <QDP 0a0c0,000cS00S 1400004 H0 40Hp @  0H0 v` r00<0K080K0D0K 000P8 1NpP q\QC 8d 00 D 00bS0D0  @ K 8KDK @P<@ AP 000K8KD K־@P/00d0 W8D 000bS0D0  @ K 8KDK @P@ 0 00$0<8D 000bS0D0  @ K 8KDK @P@ T0@SP \8 DQ000j S 0D0  @ K 8KDK @P@@ h@ l FK@S0D0  @ K 8KDK w@P@@P0@S<{HpdPP P܍00  000bS00  K KK >P QP 000bS00  K KK %P 45 p0 S#*p3 %(\ 0l J008#80PE00h00  0 hZ  !8888P Pk꧍08Y80000 0 + (K(4@^\] -LLMX0 d0P(( 0T L0娐<L$ H P0  @ H0KP 4 RK 8  p Q88<PD`Pa`W%W#8<0SD0Pc00c0W4H0`H \0 \0G! !B01T(7W4KHKT `P0 ~0 3S80< RD  bP00c0 < 0bS00S :400004 H0 40H  T 0H0 TJU ;?`J40  #R78 <Q DaP b ,000cX$X"8 <Q<DP 0a0c0X54 Hp` H CH H0T1 J X4KHKT 0o`P @X08KDpK0P<0K0 pP  0 `P @a0 v 3S R P R 8D 000bS0D0  @ K  `P@  0@?SP<H` P8 D`0  00fS D  @K`P@` <@ 0S7 \@ L0 UL0 TI`P 0d 0P \0 E<v\0L0@QT:L0 T L0 TzIL0 XT0( 0d &8S T OP3L 00dL0K þ@PL0\@ <>qP0S* 80@ D 000bS0D0  @ K  `P@ aP 000K 0 R`<ËCP P0,K@   `P0@ <@<0S 0 R V T ᣋL 0 0XWh400004 H0 K0X400004 H0 (K(4] -LtM`d0p p 0x 0 CR0CS>p-yP>pl X  l  娐00T0   0<0 d0Kt tPT \J 8 @@@ #R78 <QDPa a, aT$T"<0S)D0P c00c0T"T0d   0d0 00 0DA AD!T(7T TKdKT @P0 [0 3S80< RD  bP00c0 < 0bS00S T0000T d0 T0d  T 0d0 )Hp0S?@T @@@ Q8<PD `P a`TpTKdK g@P i0dp000d0 00 0pDA AD!  GtT0\   #R8 <QDP 0a0c0,000cS00S T0000T d0 T0d@   0 d0 $:0JsT0 2  #R8 <QDP 0a0c0,000cS00S `T0000T d0 T0d   0d0 h900- #R8 <QDP 0a0c0,000cS00S -T0000T d0 T d0 d T0  #R8 <QDP 0a0c0,000cS00S T0000T d0 T d0 d T0  #R8 <QDP 0a0c0,000cS00S T0000T d0 T d0 d T0  #R8 <QDP 0a0c0,000cS00S T0000T d0 T d0 d  #SRTh $SR04  3S80< RD  bP00c00,00c S00S bT0000T d0 T0d@  0d0 408@\ 3S80< RD  bP00c00,00cS00S -T0000T d0 T d0 d $-0 3S80< RD  bP00c00,00cS00S T0000T d0 T d0 d $SRTh SR04  3S80< RD  bP00c00,00c S00S T0000T d0 T0d@  0d0 40HP\ 3S80< RD  bP00c00,00cS00S T0000T d0 T d0 d $-0 3S80< RD  bP00c00,00cS00S _T0000T d0 T d0 d 00CST0  #R8 <QDP 0a0c0,000cS00S +T0000T d0 T0d@   0d0 0 n ::#gW #R8 <QDP 0a0c0(4q\4`^\4@^4],000cS00S T0000T d0 T0d@    0Qd0 0'0 0008@p B,HPp 8,p `K0XK`0\0K 0`  1@P Tt\ X` 000bS0`0  h K  `K@Ph !PP9`+ P X `0  00aS `  hK`K| n@P|h \{```d L0K@PtL0\\`- X` 000bS0`0  h K  `KG@Ph U P X` 000bSST ` `KT :@PYU ,K0` 0` K@P<`U 1p0l0K00  HPl0\`t\ X` P000bS0`0  h K  `K@Ph h4 0R Pt =X `000jS0`0  h K `K @PhK)K %4 "0 $K| 0 | 0D QPt QP QPP@P 0UPsPX` Pp 000bS0`0  h K  `K@Ph  P 00PKXK` K@PPp \7X@ Zt\X0%(0y03LK< K⧲PUX08@X0t\~Y V +p Cx`0X( ( 0& 3X` 000bS0`0  h K  `K<@Ph 0@?S\CH@0&TLT0000T d0 (K x-` P0L 0\@TT  0Mx -LM 0d @l0 p P ,x R 06 0 t0  | p `00`0娐x0 S (0L0  0<0 h0KpT xPI 8 ``` #R68 <Q DaP b , aV#V!8 <0SD0P c00c0V|T0h   0h0 Fa aF01 T(7VeTKhKT `P0 Y0 3S80< RD  bP00c0 < 0bS00S ^T0000T h0 T0h  T 0h0 xB0S^?`T ``` Q8<PD `P a`VTKhK `P Q0h000h0 oFa aF01  :BxT0Q   #R8 <QDP 0a0c0,000cS00S T0000T h0 T0h`   | 0h0 R440T0  #R8 <QDP 0a0c0,000cS00S 㹽T0000T h0 T0h`   0h0 |0sT0 2  #R8 <QDP 0a0c0,000cS00S 〽T0000T h0 T0h`   0h0 <:00. #R8 <QDP 0a0c0,000cS00S MT0000T h0 T h0 h `) T0  #R8 <QDP 0a0c0,000cS00S T0000T h0 T h0 h ( T0  #R8 <QDP 0a0c0,000cS00S T0000T h0 T h0 h ' T0  #R8 <QDP 0a0c0,000cS00S 㺼T0000T h0 T h0 h ' #SRi SRT0 4  #R8 <QDP 0a0c0,000c S00S ~T0000T h0 T0h`  0h0 408@] #R8 <QDP 0a0c0,000cS00S IT0000T h0 T h0 h $.T0  #R8 <QDP 0a0c0,000cS00S T0000T h0 T h0 h $SRi tSRT0 4  #R8 <QDP 0a0c0,000c S00S ޻T0000T h0 T0h`  0h0 40H"P #R8 <QDP 0a0c0,000cS00S 㩻T0000T h0 T h0 h $.T0  #R8 <QDP 0a0c0,000cS00S yT0000T h0 T h0 h N #R8 <QDP 0a0c0,000cS00S JT0000T h0 T0h`  0h0 X!0Q@10000 08@p &zHwPp &p0XKdK0\0K0000  1L`P qx0S" Xd 000bS0d0  ` K  `P` @pP/(44`^\44@^]p X d0  00aS d  `KXKdK˽`P`p 00dL0K S`PL0\0t0 x0S- Xd 000bS0d0  ` K XK dK⧽`P` W P Xd 000bSST d XKdKT 㚾`PXW t,K0 d K0XKp`P< t Wp 1p10l0K00  pPl0\0t0 x0S pXd 娠000bS0d0  ` K XK dKT`P` }T2 0RKXd`000fS0d0  ` K XKdK :`P``c0 #K (K4  }KxpD ( SR000 0S# SR@Y~ R (KQP x Xp ᐠ ꀀp0Xd P0 000bS0d0  ` K XK dK`P` 3P 00PKXKd KǬ`PPp  \ pR` Z0SX0%( 0w03LK< KPYX08`X0Q \忼W x VW0q0R0S@ |0S0|0  S|  Vp5|x P0r0Q0S <`K#SR8$SRH5t 1pP0p9 t O  G tp0 tQ "Wp  0Gp 0( (0Sp 0&2Xd 000bS0d0  0@?SQ\AH`p` K  dK%`P`  M0V(T0000T h0 s(K -LtM`p T` x t pd0P 00 `=h  h 9| tZ(0L0     0<0 l0KZ@X I 8 ppp #R68 <QD`P`aa`, aW$W"<0S0D`P ``c00c`WX0l`   0l0 00 0Gq qG!T(7WXKlKT %pP0 0 3S80< RD  bP00c0 < 0bS00S pX0000X l0 X0l  T 0l0 <t0StX ``` Q8<PD `P a`VtXKlK ̼pP 0lpt000l0 00 0tFa aF!  K<Z5 0jsX0 2  #R8 <QDP 0a0c0,000cS00S X0000X l0 X0lp   0l0 900=- #R8 <QDP 0a0c0,000cS00S ǷX0000X l0 X l0 l X0  #R8 <QDP 0a0c0,000cS00S 㗷X0000X l0 X l0 l X0  #R8 <QDP 0a0c0,000cS00S gX0000X l0 X l0 l X0  #R8 <QDP 0a0c0,000cS00S 7X0000X l0 X l0 l & #SRXh SR04  3S80< RD  bP00c00,00c S00S X0000X l0 X0l`  0l0 408?@<\ 3S80< RD  bP00c00,00cS00S ƶX0000X l0 X l0 l $-0 3S80< RD  bP00c00,00cS00S 㗶X0000X l0 X l0 l $SRXh SR04  3S80< RD  bP00c00,00c S00S \X0000X l0 X0l`  0l0 40HP\ 3S80< RD  bP00c00,00cS00S 'X0000X l0 X l0 l $-0 3S80< RD  bP00c00,00cS00S X0000X l0 X l0 l  Y`?pX0| `` #R98 <QDPa a,000cV&V$<Q:DP 0a0c0V3X0lp    0l0 00 0xFa aF ! 9 VxXKlK 0'pP ᦸZTX0  #R8 <QDP 0a0c0 (44`^\44@^],000cS00S eX0000X l0 X0l`   0l0 00000 08@p  HPp  t\KhK0 0`0K0T0K0$1 1jpP PZqH W\h 000bS0h0  d K  pPd 9^@PE \h 000bS0h0  d K  pPd  E0@?SP``Hp \ h0  00aS h  dK ַpPd ``p``L0Kd ZpPL0\` <`\h 000bS0h0  d K  ᰷pPd &T P \h 000bSST h  T 㣸pP PT ,K0` 0 ypP<` `嗷p`\h p0P00bS0h0  d K  l@Pd kD4 0R P| >\ h000jS0h0  d K   O@PdNK 4 0 $K 0 0D QPp| QP QPP@P 0UPsP\h p0P 00bS0h0  d K  @Pd  \P 00PKh K@PPp  `ppY@ Z|\X0%(0w03LK< KP UX08@X0 ` ``T0S Wp@w@3WWtp0  JBV@@T &,0K`!`#t p0  pP<0\` W V ozx0`HpY0( ( 0&"Z`q㍳WX0000X l0 0|VX0000X l0 p(K -LMp @d0倐 0`0 <|0 >|d Y d $ H  0<0  l0K p@ `@ 倵|PT \I 8  #R68 <QD@P@aa@, aZ$Z"<0S0D@P @@c00c@ZT0l@  0l0 00 `0J J !T(7ZTKlKT 卷@P0 0 3S80< RD  bP00c0 < 0bS00S زT0000T l0 T0l  T 0l0 6\`׵?@=T0  #R78 <QDPa a,000cY$Y"<Q{DP 0a0c0YtT0l@   0l0 I I0 1瀐  6 Y[ڀTKlK 0 @P ስ|T0Y4  HKr 2  #R8 <QDP 0a0c0,000cS00S JT0000T l0 T0l   0l0 :00- #R8 <QDP 0a0c0,000cS00S T0000T l0 T l0 l T0  #R8 <QDP 0a0c0,000cS00S T0000T l0 T l0 l T0  #R8 <QDP 0a0c0,000cS00S 㷱T0000T l0 T l0 l T0  #R8 <QDP 0a0c0,000cS00S ㇱT0000T l0 T l0 l  #SRTh \SR04  3S80< RD  bP00c00,00c S00S LT0000T l0 T0l@  0l0 408@\ 3S80< RD  bP00c00,00cS00S T0000T l0 T l0 l $-0 3S80< RD  bP00c00,00cS00S T0000T l0 T l0 l $SRTh SR04  3S80< RD  bP00c00,00c S00S 㭰T0000T l0 T0l@  0l0 40HP 3S80< RD  bP00c00,00cS00S xT0000T l0 T l0 l $-0 3S80< RD  bP00c00,00cS00S IT0000T l0 T l0 l K  #R8 <QDP 0a0c0,000cS00S T0000T l0 T0l@  ! 0l0 0\1000 08T@p wMHJPp mCXKhK0 0\0K0`0K001 1@P UA`P|\? Xh 000bS0h0  d K  ²@Pd  \в` `PPH Xh 000bS0h0 k d K  ᣲ@Pd b \屲P(44`^\44@^] ` X h0  00aS h  dK  }@PdPPd L0K@P?|L0\\P- Xh 000bS0h0  d K  hKZ@Pd %V P Xh 000bSST h hKT M@P ZV ,K0P 0 $@PXd@000dS0d0  ` K  ݮ@P`@+K '4 $0 'K$K'KD QP00x0 0S0Pt0  'KQPP@P 0UPsPtP PXd Pp 000bS0d0  ` K  ᝮ@P` @P| 00PK  0~@PPp1|@P UxQX0%(LK< K0㩞Pt RX08@X0X.X d@000dS0d0  ` K  \@P`@ \j)71P  5P  m/1p91o\P04X8)T0000T h0 (K(441u] 0-LM@P 0 V8@08K0 -L M0 @R dl    1808  1 0&8@08K@^ -LM0Q 0 1 K@^ 0  R /0S*/ -L MD@Kp`P   Pe@$0KT:0  ! 0S (e@ P `Tp 00"1$K -LMpP@4`KT" 0 0S e@ K5 -L M`PX@ phWp .X. P@gTppGrW 0 00 v. 00X0RBDT  e.@ RBD(K -LM`2 0 S!0`@?Kp1 C. 02 ,PK0b \2% \  !0  0"R  b-K b@ T -KK tdKK/KdKK/KdK  .Kz/-(Kt7,y\ -L 06/K  0"S p  -LFP ty\ -,0L@(0!ki8P  05/}wdP(04` 6/ ` 0SwPU, p(08P ;5/ -LP`@p  z`(0 00(p00$00,00<0(04p 7/0L0k00 0  $KiSty\1]1]y\:]P]] -(@` 0,`00(0PL4p嗷 8/(04号 9/(04`凷 6/,0`0,0(04{ :/  000000,0 0 #0   00 0 00000` f0f0`000 x-P BL@0R-LNNNlN 0"S*$ 0"S (04P7 5/(0`8P/ ;5/03 :  0"S px -LG)p3 x-L@`)PTL@000 800\PKxhOx]-] 0-L@PPX0 -L M`pK?0PS&0AT# 0S 0s S$0S0\00 $10 K @ ,0 (1(0 0$0 800400,0Kk$@TKs(]D NP 0-LP@Ŷ01S  R $ R $ 00፶ K0hK] -0D ,L $00000@DPYT10 1(K:]H^,]] p-LAM 0PQ@ ` ` 8G/K< 0G/KvKp=]] -Lp@`V@ 0s S0s P0SPsPPP" Q 'P P Q 'PP Q 'P PP Q 'PPY  9/PU @`F -L@᜵0003/ -X0L (] -L⇵<1 S :(000Q?0@  Q T RC G )X00X0(`& 0,p  &` "တ010 !40 >P0<0 0<Q40S400E S 0  $K0~?K0`;^]]]]]]]]]]"]H]}]]q]]]]]]]]Y^]]]]]]%]/]9]C]N]X]_] -ApL M`P$1 Ss (1 SsΆ PY QV 0 4 P0 4OZ X@!0S 䫩$} Rx X soX-0W hHPP h P0  0 41P041pC30Pd C/00 900 ! 0B?040 @T(Ky\^E]]H^=]]] {\P P /P P/D///1S!!1! 000S !R!R 1/ 0-LP@P , QA0SF1!00 -阐LP`p  @@0S R R 0AQ  @00C@0Z4\ -䐟L Mp`P  @0@S \!  Q  R 0 0@ 00@  @ pPU@@@  0(K4\ -LM@` 0 00080 800 00 =pP P@0X*Y 00K 00L0 `0@0`A 00,0$`(0p  0*(K],]90S;0;0 /$0$ 0S/00S/0S/00@S/ - 1`@PLp 0Q6 PT/*$:1 R  R$ : 00@03/PMPlu:#60L R L @03/PJ9ħ 4] 0-@@@P[L003/03/垁0 09ħ x-0NL` 0P@S ` :#6L0S L4`z003/03/+x9Eħ P-L 0S 0 0  0003/ħ -N4L@S 003/ 0 ħN -LQLQT0\0 MQ R0 S$0@0D0S 0H03/ħ Q-L@ L4S 80X03/00 M4S 0<03/0M4ħL@-0P# @T@T <$ B<$ X Q !! B B!!   B B  E -4PL M`p 0@P  V XS@` 0PQSVQ6 U4 Rㄑ^ T+ PV U$ 0`!`0 000 *"&W!00LV   4 B0 N4 @003/,SḠ)T' `" pV WU` 0 : #60  0L0 N 00 4 400 S@(KEħ9 -1LS@!0R00`R0V \\]@^ -L -L@ M`0 P@p @Pħ -@L@00@ <Y@0 -@L@00@ <H@ -L$MP@p@0 !!%, !@0R0 < 0 "8 X3 : a 4 V,  R) S % ^P P < <<0S  T U 0R /P < <<0SPo T US 0  @  @  < <0 N  @0 @04# H48$P X R Q P 0S 0 008 40`  0N  P ,@@  00< @0 e<  !N  o(K9]]] -(0L1 1S0803/@^ħ p-L MP@K( :#`P 00 0<')Kph9 -L Ma 1!D0PpgQ$RdP A刀T| D@T HĔHP\! R@ Q8 U , (WX1/0!000 Q 1/1/04  1/WH W @^? -@PL M000Kh -0@L p 003/03/`@PP @` V@03/@@00003/9ħ0T( X80/9 -pBLM\80 PX2`QUʀ0 !80 `1,2(2$000 !b^\x'zq\0 XS*(H0Y1`(! `  Q*8 P8  , 8 4 P8 4`Ȅ ! 㑜, Rd(:  h8d(帀0+;d(h8 8 4 P8 4  5 S$ 0\8p6\8p<03/,03/03/F0 !H0 `Q@0<08000 !\(K9@^EAħ x-\@L`PPZ%V!0P0 (003/03/x̢Eħ0@-HDT0$@!ʠ QP ! R  L" !R  ," R !% 0HP$0!/ -444T4DL,M 0 Q"=pH4th^~, Z~ 0,أ !Q6/ 4 RP4  y)QX|p㘡!X3  ! 帐   R  4 P4   Yt P 2t}堂<03/03/03/00|TxX8P  0t!z TxTx0P@0p!z TxlT8 "p;"TP:T8X8\3C?6C0a#T(5>>0d(! 0>0>00`( T8}|ut̢0] MN?T7]IX>=]LN@X9 -L$M4 ,($1P@p(QpG-(Uᕘ(1*0 04@P 0040K000 00 0 0MP %4`ɄV T *8  P0zJ `8 iP(K9<ؠ^0XN]e]@@-@!T T4( 0; 9 -L@p`Q$: Qt Ph PP0SPP8`PJ$Kh9]] -0!L@ 0T$ TDE ->LM`nP@`0 Q Q p1pp[X1Xp[ PpZG  Q$ 1Z 0 Q FJ00^ 8 4 9P84 ^ Ȱ.  Z Q UHJQ JJ(K]9xY ]&]\0 /xY 0-L0LMP@@ 0S      nK0xYp@-h0 P A 00PU @\:`E@PPSRpxY@-X0:S A R @\:  BQ0xY x-AQ1 `**$LL ::*0; `k`0+/ R0P$+*+* **** * * * d 0*H U*0?00?x`k `xY9 !iXNON -0Lp0@`a0>0>0PU $:PP@x:#KJ0?0?0000?Ĩ^Ȩ^J] -pL@jT*$::6S1!0Z%U T*L0HS @03/003/ J003/ħE0H4 /E -LP蘈\ -(@` 0,`00(0PL4p凕 8/(04 9/,00,0(04`s 6/  000000,0 00300000 -LP`ပ@p}U  `(0 00(p00$00<,00<0(04p: 7/0L000 00 $Kiꘈ\1]1]\:]P]] x-P BL@0R-NNN0P ,Q 0SP80SP30SP.`p 00`  "P 00  v0P K   00  \,0 3/\? L0MPl @.  lP 0QΌŒ Q4j0T00  ⵤ`(0 00(p00$00,00<0(04pu 7/0L0ᦤ00 0E $Ki莤$\1]1]<\:]P]] x-P BL@0R- O O O4 O 0"S*$ 0"S (04Pu 5/(0`8Pu ;5/03  0"S px0@-@TPP@D@@@T@DP@P@@PA@_A @TPP@D@@@T@DP@P@@PA0@-`p@UT@@@@UT@@@0@PQP QP000@- 0@T1S\00 @Q!@0 Q PP% 0 0080 S 0P* \// x-0LP@`T  Q@PLۡ v00 00 00P`0@x8C]0S  0 /@-0S 0 @  -L M0` @ R  P @@ R0LP0S*0P 0  0J PUE0JR fP PU 0 0Z2 ?P,P@pW" 0 0Z0  40 0 400PU  RP Y 1 !PpT(K@-0 @ 0cS`c`QP *P p UQ U:0c \* R  @-@T̠$0 "( 0#  -@LP" 0 ``00\*p  Z`00000e PA 0` `0Q@  0 000 @ `` -DRL Mp0`Wp@R W!T D d`V`hVġ0W`0VS`FW@ (^ W g` 0`p  PpYWE0BPP;  0p 0  0 0 KU00PS@ @HP#0@S T :`0 0`0\Q`LR`q`pg10V0 00 0(K8N_]H\ x-`QLP 0 [P @x@UTP 0S Px -LM@ `Q@ P<   8P긠 ` (8 8` 0@0 K00@S< pJX  R V R  QD PD PpX p 0@ 000P RPP00P0pSP@0 0000 00@0V `    0 pR-P UP (0"(S(B0S 0 SQzPPU0S (B(0S QP000V< 8 0HS60 R I< W p0 SpPU0 0 0 d*X 00 0P PP &(K] -PLp@`P @ 1  dVP*W  KP" 0@ R @T@ R? 0S<   R  R P-ҞQ xʞ  BR R   P Q Q"0嫞 0 00PS) T0 P `R00 Rd 0 R   R0#0P pP0 Qpp(0p,0p>0 S0Q00 R! Q`Q0 R` L\  0 SRR IpU `P0P0 RPP 00 0#00#0-]8]]']0 -L`p0S 00@T 0 0 0S@U  0P6/P  0-P@L 㟈 P@0N -鐀@Lpp ( X`P0p 0 0p0d0(0` 000000 08TOOOO 0-0L@SP pM0P 0K0h00 x-1L R  !PU $ LPPP@Kxh芝pMP`F  0 00P 4:lP`P\0 00@T P$x8D]W^]]DN]] -@p0 LPQT  ``0P0`TP HTS1/ 0/L1) 0)0SC1* 0*<1* 0*51, 0,.1, 0,'1/ 0/ B  0 - 0-1- 0- 1. 0.1. 0.PP@Alz  0 (@cz# 0#fz*lP| -L Mp1@`P  T8@#070K0K0p 80KCK4@  @ T 0S@@8K70[S/@8 K04@9@U BPK p-L MPa@U0 Q/PK  ! a,P ( KbP# 0S)UPiUeUUkPEU \ \  Kp  -4a MLp@i1p    0P9`QUʀ0 !0`q  0000 !00 h`P`P @0 ^0}tP  f K@^P^L^ -L{]1M/ d0 /N --L0 M00 $1` p@PT1 !0R+1S R%P  P P  PU  0iPP  0ReP POP@UFO 0>eP (KN/ 0  E 0  > -@SLP` 0S OOV1 8p 00 03/pP  003/V@ 9pN -0LS Ј]0@-0R8 < 0# 4008 < 0# 40 08 < 0# 40 0 8 < 0# 4 0(<3 @(Q $@A(@L,"LA(@,"GO@(@D,"CO@(@H,@,@, , 0R8 < 0# 4008 < 0# 40.H"0@ Q $@A(@L,#LA(@,#GO@(@D,#CO@(@H,@,@, @ ,$e @,0,00 R8 < 0# 4008 < 0#40L<1 @\$@A(@L!"LA(@!"GO@(@D!"CO@(@H!@ !@$! @(!,& !L A(P@A(@TP%@P%!GO@(@!HP%(@L% @!@! ! 0 000 \ x-L@ Q2a Q 0C`` ` `````1!\mPQ(`!\Q(Pa(dQ(X`&!W_P(P!(Q(\`&_&PQ(`!\Q(Pa(dQ(X`&!W_P(P!(Q(\`&_&PQ(`!\Q(Pa(dQ(X`&!W_P(P!(Q(\`&_& PQ(`!\Q(Pa(dQ(X`&!W_P(P!(Q(\`&_& x \\G- p )P ) ) ) ( ( ( ( p' |' x' t' P% \%  X%T%X$)LA k(L' `&AK `&(Ǡ  Ы `&'à 0  `&  $ @,'GO@Cp,%CO@0@,@AG(@*0 @$% У%\ @$) 0Q[ @$w) p%P P'sP%pP%pWp&|K qЛw,$)pЋ),wps Ы)$sp0p)pqw(p($wps@A(%sp0pG(p qw,à p* 0 p'%%\ QУ[ p'P%& @&go `@% S0P$ p' P%a 傂!q(pq(p!p!,(!$( !! !!,((!!$(!%( !! !!$ ((@!A,à!%(%\ !&(Q&g !! ! ! ( (o `  ( ( " " " Ѝ\ \G-M@ ( ] -LuJ] -LDM01@,PK@%|`0" 0! 0 @@ @$@(,0`x0 0000! @ 0 @$@(,0@4`x00|0 00!h0 dP 0(0$00(0p0 @@,`x400 ,D0eP(KW]]]Ox3^NO@-\0`Sڀ  @!`18 00,000, !@^0 !<0 `4000,000 !/@^ -L M`Pp0@00 00+P K -L M`Pp0@0 0P K 0-LP@P0 x-L@`PcPx x-L@`PKxh -L@`_00P|pY`PL0  0oV _00O1@01N -@LM0 0 "02Ks-Pp`@0S ,8@T 0S80<000@00C@0?T-K 0 1K K0BNN -LM`0000 0@80 p18 4 0<0 80 S<0@t_x@WPP1Z 0 80 R0B000U b @0 D ]D @0\P D@0 P@ X0u03V0S! 00S$ 00S 00S 0S P G$#$PpW000 @7U4 00 @0S @(K\ --LTMp0t0 " p0 l0 W 0'Kd0 70Sb;pP 0s(wPh 00P `\` @#`P\`  0h 50S0\0 +@H$G4 1`K 1x00u h0` x RP#P3SPU QS `PK PUPEPPP 0YP0SRm SQ 0SC0a P\X0S} `Kl K:@P @l R l08  B8 0@@00\ZY #pP 1@ 500SPV u#K9$PV 0 )9(0S<9pc?5\#U01Z㲧KW $tK0BU"01)080 \0S 0"SX0S 0"S1  0P 00CSOOOOOOOO`Kl K@Pl08 p0  8 `Kp K@Pt@T \pP YPT0S0S;@cTS T p0\0 00X0 0T0 < 00 pH@T $10L0 0H0 300@0 20L@ H@ h0K `K003h0P "@P  ṹ`0`K0 p400'$GDHE(%)&&#&#)&`0 0`K8@P XQ<Q p)p,P E@LP K@P PU HPX0S HPX>K@P L@@PHP 1K@PX R p04@P PT pL0S S (0S ` K3/pp0HPU p0H RHPp  bp804 R0 040L0S (0S ` K3/ 0p0 @" ? 0%-@7@`@ @@(K=]\@^NN -LMQP@ ` x   t\Th l  d hP !h d l h  0  p0 | x bt g  RR R`K0 4 0 f2p@Q Rt KbPu@$Tq|0S "S pWf 0S $1 0 L0 0K00KPXp0L S d@T t0Sʼ28 030~`0 0p"P>p 00p0 @T2 0Q  Q)H0 0 `KT0 0 @0 0K00KP"p0S d0S t R "!,  4 `  dp "P p 00p0 @@@ T@ H@ 7ZdPh RKP 000D(@0@(@p p 0J6T f`1X 0 60 0RpBppp/6 W  bX0'6@` V(0S0000@016(K\d]\ -LM@pP4 `ڶ <Kֶ2 3K<0KCr< K0ᶂKr K x-L@`| PD0@\0H00H05 ` < R@@ 8@\ <@@ 0PSaKxhN -LMK@`pP00d000S x Kℶ@K Kx0㔀 p %P 0 U  KN -0LM00@S 4 Kc K_28 :K3K0 家K K0P KN -P1LM00@S pi 10 `K4 70 \ \9 \ \4 \1\ \- K5\ U\GT 0 T0 T0 0$! K   0  "0K.K4 0 , KP" 0  U 0崀0 00x K0 Ԁ 2K:K40 K⌐ 0 x0P 0  X`V(KN -80L8M00 S @0KP  KN -P<1L8M00pSF  P0K@P@ 0 3S8<0S 0D P c00c0 < 0b0U1`P4 ݵP` U 0 ҵ0000(00(00 PPKN p-L M`PB@pP0 00@0  0 PO^ -T0L @0, `0@0ll q=PB0 ,R, 30X$ 405KP20tK,0 XP ST00K@-\0`Sڀ  @!`18 00,000, !@^0 !<0 `4000,000 !/@^ p-L M 0 K0 0@pPP 0P0 0% 0   #. R( 00 0 40 0 0 03/` <PP0 IPP `Kp^^ -LP=0@0P `0@80@0800 03/!P`p X `000(0V `0p`0808^^ p-LMP@0`0KP 0K[Kp p-LMP@` KP10 0KKp -@LPQ0p `0@   0 0$`P0i  0P1NP1 R0003/`P | `P`P (_0001P?^,^ x-@0L0PP k0  {X`P000S [0PPU: 0U<xx^!^ 0-0L@0P0S >0  K0hL0 -LM 0Kc [ K -LM 0K c!#  K -LM 0K#  K -LM 0K #!#  K -L MP`@p@T0d @  P@@D  @ K -L MP`@p@T0d @  P@@D! @ K 0-0PL0@0  K0h 0-0PL0@0  K0h -Lp00P(0S`1G @P R@ P`[ F ^_P 0`S00 (03/000`00@00 x-PL@0(0S  0`R000 Q0 (03/0 Kxh x 0-LX00@(0S P|0StsK0h0 x-`LX@PT p0 3/M@P0 ,03/Kxh``8 8#4`#/ -LM$ P0@0 0 p K␠K p p0* 06K|0K<0 UP d0 X K-$0K0vK< 8h0 AP P(K22 6$ -2AL4A0B020 aA?RT@ -LMp00 1S@T1  X$01 `0K␠K0` `0@*00P@00 p06PP0xP R @@0% KnwP000P4T6U0K;>@@ KPQ^P 0-LMPP$ 5P R` K>wP P0 R B @@(6T$>K0Q^PP-/ -L`P`@p5_P@ \@ T@  PK̔_^E^ -LM  0KP [ K^g^ -LM@K00p0` ` P0 0KT0 0P0 000 0 0MPuP3PPU0 0 S S 00  P $K -LM@K00p0` ` P0 弘0KT0 0P0 000 0 0MPuP3PPU0 0 S S00  P $K -PLLM :P8 000hhh$P8  X8PPT@ HH@@ 44 (($4  0 0`p! 0(0 40K @@ @$@,p0`|T40,K 0,3 00! 0 @@ @$@(p,`< eTl3l#<0 0 '!0 00 @$@(p,`NT3  0 0!4 K0 @@ @$@(p,`;T2 00!2 04 K0 @@$@(p,`< &T2"0 0 !4 K0 @ P$@(p,`T$2$"0 0 !0 04 K0 @$@(p,`S1!0 0 !0 04 K0 @$@(p,`S001< 00!( 0 @@ @$@,@0`S@1@!<0 0 ! 0 @ P$@(,@04`S0 0 0 !0 0(  @$@,p0` 0SX@DV P8  d8wO8(Kؔ^^^̔8KP7:]LP] LP]c^^^MP:^5^^NP$^]:^ 0-L@0PMP 00T@@@00^씃 -@LM0Kp ` `P0 -0K\0 0`0 0 P0  0K`v`3P`V 0S$ P0(K씃 -ALQ?XVPVPVPVPVPVPVPVPXVPVPVPPVPXVPVPVPVPVPVPVPVPXVPS00S #S!00SmdP S S L00S<00S 40 80R 0CSS 씃Q Q QP0P/ BR , S0P//씃Q Q 40P0CS0P//씃A QXP0XPXPXP0XP0XP0XP0XP0XPXP(0P0P//씃,0( 0S0P//@씃 0-ALP@ Q6XP@YPxYPxYP`YPxYPxYPxYPxYP`YPPPE U%00S!0U+P Pd0 P0S0800S 000P00씃 -H2LML 00@Pp! 0(0 40K @@ @$@,p0P`-R40,K 0,100! 0 @@ @$@(p,P8 R'.0 18|0 0! 0 @ @$@(p,PR 0!4 K0 @@ @$@(p,PQ000 00!04 K 0 @0@$@(p,PQ'.0 0 00!4 K0 @ @$@(p,PQ'.0 P0 00! 0,0 @ @$@(0P 0Q(Kc^^UP{^5^t^0 /씃 -|L tp@p hd \X PL D@ 8UP7:]씃WP]WP]WP ]xXP%]@S0$00$0XG$003/(04p 7/0T0GG00 8F|($Ki/GD\1]1]\t\e^:]P]] x-P BL@0R-ꘁP,PPP 0"S*$ 0"S (04Pd 5/(0`8P\ ;5/03 g{  0"S {p|#|'|x x-L@{ 0S ,0 (04P1 5/ P 0(08`% ;6/x踈 p-@LMP`* OK,P|02 ~?2 02 ^0  K 0 ! S2 T0K  D0& 80 <0@?5/Kp u(0P0002?0/S0?0 S/ 0P/ x-l0 L0QP PP`P8@ 0ESP`Px00x uP -2L$MB<03/ SR |2 `R0`RS R  HH":: !#&UC  "ʠ ʠ !,&JC#Pv 0Ss 1@=Ct(Ko7CFPB@@ ? #K1@q0`P80 0UI*1煑@<0 < 0f 0&S!*$&R4D@0 C@080 .x!|800:00#K?* 0 SL0  pDHD0 h !X D  XD0Xp 0 4YL * 00C0`8 Kv 9:80K/Kp VH  pZ0 ~m `008K0H i0Std \޿   U,P000P00040040P0S @0@)0<00P010 <!v0@ d@!cU @@x d00SI }PF P00AT2 vP/ , d0S" }PD  p`0Vv0P@0   d R @dD@ ~@q` p D d ~ qPUq@d d (K ^ ^ ^PИ, ^\I ^o ^w ^ ^ ^ ^ ^4^ ^ ^ x-LP@`_P 0 3/x 0-L@P\  0 = />U 5/00(X PPP 0R ᫁P!U0R0US㾠E00 3/40<<4]. ^^ ^ ^ ^P ^ Q -LM`p0P 0@P  0@KhhT d00S X00S &74/401L,=(p.K蠘^\=] -LM 0 0 K -0ML  K -LM 0 0% K -@PL `P  0Kh *=# ^ 0-PL @P 0S000 03/ 0 Q 0-TPLH@T 0R0L0 03/&P -0L`X0pSPP@ 7/P0S @T 0S %@T p ` T T蠘P -DL8QT00AS 4/QP0S 3/PPp`U 0 3/P`VP0X0PP 0R0T0 %x6|0P0 xT`0S Lp90U 404 4U $Ki9蠘ZPB ^:]=]J ^$0$$08S0   OQꌶLP 0-@LPDT 0T 0AT (@@ 0И -L Kh  -L@2P Kh4 / -40L@0S40040L0S 3/P -40L@  0S40040P0S 3/P -T0LS 3/T040LP 040/ x-0P@L0P0L40`0400S  @ @(( 0SKxh5S \U -L@] P X0S 3/X/ -PL@p40` 0Sژ!Q 0 00xtt q00C0TX i⹺@ 00(0(1, 0\@@^} \ 0-P@L00CS00 ?K0h\ /\/ -40L@ 0S 0S40 040`0S 3/P -4 L@  0S40 040d0S 3/P -h0LS 3/d00\` h00l0/ -l0L@S 3/0\0`0d0l0p/ -4 L@ 0S 40040t0S 3/P -40L@ 0 0S 40040x0S 3/Px00pt |0/ -|0L@S 3/0p0t0x0|0 x-PDL`P@ D0T*H01S 3/@x -HP`DL 0S  \ 0A#@D p WDHpqU # -H`DpLP@T !1R0G R @ R  @T: T -D@H@GKhm#01 - pL`Sdp00Ȁ0000"@P!Bp pW W @ @T P  00R 0@P 00R 0@T$KiИP 0-0L@ 0S S S)K0hP PPP000 0R0 RPP00C00S0 R00 x-L@`PP u P Px -0L@Sf00Kh x-PL0|`0St` `P@ 7 P87P88P,8xx ^]ܳ] -L@/Khp -L@0,0@T   B B  Kh$ИP p-LM`4KP@ 0 R R0PP4KBP4KUl (0 `@90S QP, K"KpP ^ p-LMP`4KP@  U@P4K4KKp -LMp<KP@T# W ` W  `P4` 040 0S 03/P U4`<K@<K^$K 0-LMP,KJP@ c |P ,K,KEK0 -LM`@ ! `,T,! 4K#P@ 0$0SP 0S pP 0$0 3/TP4K4K KP -0 MLp0 0`RPP"P 0~@P 00h p0APP D @0g 0- K褊PP]PP ^ -L MpP`P#` 0G@P tP h_6@\\ L0`P 000 <0.]P KPP ^ ^PP ^0/ P-L {p3/p@-0S0% RP`@ 6b @T5R <0p R Pb<Š@` V 00p@T B p - QL M@`PPPP0"P140 0IPP!rP00 U V :T0 0`gV T00 `TA0040 PP1(K -LMP @RJ R#b,r0 "b0   R | 0W  `` 0G4  Z$0s! UW  W4  0p 0Pe0PSPU4u50 0S:PEP(K^ -L b0a<0 Y500 00/^ -L$M0@S0`P,r0R    Q | 00  R? 0  0&5(j #!4  G8 剑 \' S$* f0  Z!rx 5W < 8 < 0 0 <PjR0540 `00(KS^^0 ba3@- 0S@C0  -L$MR@P` Y0HNR`GY#r,8 )r0   R | 8X  pp 0jឃ뗠#H0 倡< X%  @ @40`l P00 8 0\  S * 4 e\!r@|400i0 (K< 0@ ^^ -L`p PUp2R1r1:F @0`P80G -@L,Kh' 0-LM@PP 0 S    ep 0Pe PK0 0-LM@PP 0 S 0P PK0 -LM R`P00 @pw WP@ UU=*%  P0S2 ST:(Ko00"Rp#0J!8 40 0 Y00T0S 0s T:P 40@e@ 40@8 ` p(K -L M@P 0 S 00` 0K -L Mp`"@P0V`!` yX V* fX Ki+ 0-L@PPT P P0@@0 - LDM`,0Kp@P`# p ``A `$`(p,0 600S   X A P ` `$`(p0(0,04 06(K^ ^P -LMP@p弐张0`00 0D S*0 S @v0K 0P0p4v0K 0P @p@000K 0x000(KZ^:]Z^$\] -L M0pPS J 0 SP0ࠟ @ Y*`V W 0 fxP0  T@ 0Q@ 0Tt2W@OxP P@03/(K8QP^Z^Z^$\6^ -0L3/ -L03/ -L03/ -L03/ 0-L@P0P $ P {0 -L 0@3/KhJ0/ 0-LP@P 0 0-( @LP#y  :0  00w ^ -L@ Kh- 0-0L @P00000P0P00K0hV x-L@P` 0S%0S00 0R00 00C0Kxh6 -@Lp 0`0 0*V P UP0 3/0PP0`P 00CS 0% 0D00/^ 0- 0LR@  Rʠ1PQ BP P  t Q P 000000C000C0  0 00N^i^\ 0-L(M@ S 00^2h01 1D0\<0K40 000 0 0 00< PD04K8 BK$ 0 a=K0蔈\@^^ 0-L(M S@ 00^ h01 1D0T <0K40 000 0 40@PD04K< 8 BK$ 0 1=K0蔈\@^^ -Lp`@V7 P3 PU00C0 0VP1R 40 *0S 0 0pP0p`e0000e000e0  0 蔈\@^@-`V0 @PUTV*f@ p-L M@ K`PJP 0 5@ YPKp p-L M@ K`P4P 0 O@ CPKpP  VP  N -LxM`K@p` wP  PqP'0`D0 0 00TP 0 000 00},`[$K x-QLP`P@ RP0SP'0"PV x x-PP@L`=(0S0(0  R0  Kxhz -@0LM0S00  K90 0 K^$@B -LMp@`PW P0 S0P0f(A$t^S0<F/00X 0KWIP /K^^ -@LPp` 0Kh! -LDMI0p`00̠0@P=0,0 0 `A `$`(00 $3\000P0 `0Q0,0A `$`(0 03(K^(P^P -L(MpP`b0 &@ `1 P\⋰(^ sLw,K Lp0P,KpX 00KHP Tv/,K f)00X2P0S .KPP^^ -L  0;^$ -@LLHX@I(^^B/&.4)&Kh& -LM`@P0 pP0S PpW4KL e4K0 4K ) Y P30 2P 0UW# XrUpe0Xr5:0X20P0L,P$0K # X ^HP H.X0sLX0 s0P0L$KB^ -LMP0p`S <0@K 0PK` u000 0 0T@ 00 00* K@QP$ -`LPV@ 40pH0P(00(@0\ -APL@ `uPpW0(P\@^ -, LM 0K#@8 }=)= K -80LM  0K#<8 t== K -0 LM 0K#@8 b== K -$L % 0@ -,@L 0 uKha@ -t2L,M0@S@XrX5PU @K%@05040 408080<0<0@0@0P0`0 $PQ*H\ ' L@PࠁP $$ \*c T0H0HLL$ @S0\@N0C$ C#HH0`P T0 P0U<* UTPGLK6HC<K6$KKP4 D0K0cS40 P K 4 #K  0YX4&\Z 0   0rPP$`8(@V0@H (K^@ʚ; -``LP@Td50S 0$  B2#Hp`D` Kh@ 0-@0LP@4F50S DQ  K0h@ 0-80LP@,05@T @ t0@ 0-T0LP@H50S U,a0 St Y0@ -PL`p@50S TpD 0$R*00 HV  ࠁ$ !H%t +@ x-x0LP@l`50S VLx0U:0x$ E!Ht x@ x-<0L@`0P50S b Kxh@ 0-40L@P(50S , K0h@/ /////,/Q :Q  400Ps/490Ps/4/4!0Ps/<0/P8/@/ -0Lrp3P0@- 0@0 0SP U000Q0D0@0 0 S@ T00000^^^^ 0 -LMSPP40 `@0 00  xx<0 p$<0p S Q 0<0 q P<0 00S000S000QG0SCQ]V=>V[ 0S#3#0S !R R,\  000 S\+Ds S  P $!r<03 0Qa S@ P1SV20a04p< < S0Sd"d2DP"0 S !R  RpW  000 S*hq S  VP_ 少!r<01 0qW@Q4` 0WP' p$0  80 /P40I   < fr< P <080Yn  P 0l-00T0p0000K  @U@S @N(K0^^^Z^a^^^Z^ ^ x-,@LP`$x0 0QP 000 P00//^^ 0QP 000 P00//ᘎ^^80 400S\ 0//^^80 400S\ 0//ᘎ^^ -@LT00T 001S 0 00 t0\  R 0S H S< AT@@0^^^^^^ -@PLXCT0 L00R0\@  @}0^^ -@PLX#T0 L00R0\@  @]0^^ -L MpPPA 1@ T" `V0 00 4 4m HP004# R@T0 B R|00T`!d001S U  0(P00E@(K0^^^^ -L MpPPA 1@ T" `V0 00 4 l GP004# R@T0 B R|00T`d001S U  'P00E@(K0^^^^ 0-PL@P^0%T0U 001S 0 00 00\ Q0Sp S d !R 4 4J L@P@Pt00^^^^^^ 0-PL@P0%T0U 001S 0 00 O00\ Q0Sp S d !R 4 4J L@P@P+00^^^^^^ -L M@PTp`4V 00 0lV4`  000F `p`3QP0S6pW!0S @08@V  a" l0V Q< ` A"j808 Kk^<^0t @-Q  Q \ Q00 R @H` 0pFV%@Vd@d@ -!L$ QW  RT 0SQ cAW%AQ  R 0S 0=j$0S<0\P\!@J J R ("(I R ("(I$ R 0kJx ]Z d JWY @ P (< ]T ,KoW^^^^^b^;_]^ -L M@ 0 PK -LtMpx `  P 1@@  0r0Q01!4SjAT1S1S1S^ olK@ zkVTT @Kl Kp@ @P HK'X0[H [0s03R8 [0RS 080!s`0PQSP& t 0x@4/P'pPY YPItP Q P 0HK @0)K<@0 IKUTH0 0 0X V` P (K^U^ -LM40 0`p(P0  `RU@Ȅ LP6 QR0P 0?#KP  OqP 00p#K@ P.P 0` 0;qP  P0( 0,qP40p(K9]0^6^ -L M @`P`1M0X$0pP1fJ WP 0SG0 00(PP p R R(R 000 P00 pW *W 'f/j$0P `f/|j0 , 0 & 03/;jP 40 0000`(K;^WEVR^g^ - p0L`t 0@Px 0|0pS X P0 R  P$(, 0pPU0PI? R  R R PU00㔀0堀 02p  $(,   0(UPXá  $ (  ,Q+/ -LM@Pp( K`i00 (0` S<(0<0(p S2<0< 080Q 00000000 000n BRKpP XKh pPS0 X0 / 088"B10100KP㼆[<6[X"1010!0K⼎KP-[ \ >[  K K0K a K K0KX0S0S T  R0<  p W0q0R0S3 X0- p@(#Q0S0IS\@ !V "; d080 V<814` P@000 TS y 0YL@0S F 0pUp%00       ! H0 hcccH00 ZP3 0 :H0 D D 4pWH0D \ 800S80 x/4 c4 @p#pH#X " O!00<V 0;0(K耉LQ8 0-@Lcb8P00$0 @@@K0hꀉLQ x- LDy< 08P040`@T*P 0x耉8Z^Z^00 0 -L`P @phf`Pp$Ki -@LDm 04R0  00 0 0  KhꀉLQ8 x-T0L@1 14`Q1T 0S 0S (@Px@^ -1LlM1PpPK A40Sq\ 00S60t!tKDtK pKy!|KxK_`PLHV|PJ @0<` 80 d` `  4 dK⮮`P )||x (4|0P    ( P徸|x z|PUpp0[S `P 0xp尚x _? _/  o K H 0& #! K@^] ^P\@{^ - L@0     $ R$ 0 $0 8 00 0KhKh` -@LPp `+ $`V 0S   X Y 00 0 P 菟P00` -SLP@ 0S ` V)  B 00S0@@P! `\` `\ `pWP   0S   ZKhUP B  R @@0 -40ML 00 0  0" Ks^` -PPLUp`@  d (@,000J$ Q$ A\$0$00$@P  <՞0U00 0 P 00p 0s^ 0-L@Q PU00 ⴞ 0$K0h0 -LMp0@`Q0 ;:0BY6P 2 P 040  0R  Q0  0S:40S  P ꉞ# 0 (K -L:08 E7*D^4 Y LZ hi HY : ^ !*D@P @ 88QY:e  d+R) |340 R3Q4 0  \0   @P2 ꐝ-#@@ 4@00@ 0@(K -LM  K -LM 0 000 0 K -LM 000 0 00 0 K 0-LM@P\%P 0H0 0X@T  Q@K0hH`^z^^ -pLP@ 0`I4X C@P9@0S R:QZ V RX Z0   X V*T   VJ  * J R @@0^^P# Px-LP` 88S LLLPL@ULU R_P U :U 0 10!S R R @D@x^ Q-LQ J00 Kh,^ -L$M`VPDY0 40 `^Y0 40:pI Wܠ `@P Q*l@PUT `pSR j*xxQ 0` 0` P  P  00 X`0 0(K^!^]:])^ p-LL Mˠ@pP  ^`@x`PKpH]H] -LtM0STQppR@10pIh Ka> !hW01h0#0 `V2 Z2: KBK@PKGKCKDKKKH Kd P ` X \ ` X h T p P  @P   g x`@@j(KHLTQ -L$M` p0P@@0K 0H0 T! Z0S'V]PP  @K aY 0  @KH@0K0@K00Kj] W*0 @K0P ` Ppix@L0 L0P(KLTQQP //PQ // -LK0P]I 0-DP@L s0T0@  ^0@\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ -P@ML 0 0@@00@ @@@  0Pp`TD0K@p@PU D0K0 }^D P @0000$Kk@^^\QTt -p`L@pW}0S HP Q00 @]PR\QT^ 0-@LP0 K0h8^@ 0-$PL@D@ T0@@W 0-L@@PWPU00@K0h000RF/@00RW/@00 R !]@0 ]@0 ]@0 ]@2!/2!/0!#/@-0B@00 S !R S0@00 0S Q0//@ -0L dp3@@-40 0S A 0@@00S !R bo `/0/@@-D0@0S !  bo `0@@-,0 0S @0 @@-,0 0S @0 @@-,0 0S A0@ -40@L`pPT @P@20B20B -蚃0 u>@^蚃 -$@L \Kh艓욃^ 0-@LlPu0S 00L5/<j000ȓ0S @∓0욃p@-@ T P$ @A P`V =V U0C0 @@ T  R00pp -L@p@@Ph%8&h R R (:P `>q@ "8("S 0/ -@@LP($8"(R `V p@0S0> :P @@0$( R (( -@LP@/ -L@Pp` 03/ 03/0& B`!Q000@^0  & ! Q/ @^\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ x-QL@U ` 1S S 00 03/KxhxZ -1L@S  1S 0 f01Z$ 1  S// 1S/0fZ -LMApP~ `Y03/+Y 08K<0 DP @@ W0 8K80 D0K40 ~8K^`& 1Q  -01 3/@ 1 wqc(K@^0NQ<0 Q1B ! R/ Xf@^ 0B010S/ Mf@^ -L!,0@Q 0 Kh1@^Z0 112/@^ W -L MP@@0S60 䠟`q`Wʀ ! `!   .! !40 0 W  ! !40 `q1000 !010(Kom@^ -LM (PN@@NpN@`@`>l $0K( `#RTD @ ^(P ,*0@p$Kx@^LRQ -`@ML@ @ 0     0KSQ^ -$0@LP   00! 1/@^ -,0L1@P2S @^u 1/ x-LP@`  4/Kxh@^ 0-H0LM@4 0KPP K0 @RQT0   R -LMT0,  *0KP K R -LMp0@`+TPPU @ Q 0h 0{P PpU RT00X \ 4  p(h 0 Kx]^^ -LMT0,  *0KP KpT0  p -,@ML0 X0 0L0 K,00!0(00,0000  $ 0 Kg^XQ -BRLM P! P 000 CKU@ ! `pJ1!T01 ~ 10Y{ CKhDT0 0.Kl p0 0/K 0/K< 0.KD 0-KH 0-KL 0,K8 0,K0 0+K4 0+K 0*K 0*K 0)K 0)K 0(K 0(K 0cK'KcK^) !?'K4!0&K8!0&K0!0%K %K> $KF? $K!! 1\ X K 0#K#K 0#KgKfKfKeKeKdKdKCK!0m P@ z10(KdQ 0-@LPT !0 5/@0C^\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ x-L@`P00p0 0R P44 P0808 S  R4 4 R08 0 80+Kxh@^p@-0 M 00 @P0U:"00 00 000  0 Ѝp 0S `U:0 0@ 00P P0 0S0S `U00 0 PP 00S 0-0LPS@ 00  0R :00 00 00 @0 0 0000 x-0L@SPx0 Q `R` ~0 `x x-1`D S0L@0C0<0P0cD00S   p0@00S0PP`800C800000S000x 0-0L@SP D0 Q000@-0$M 00 Q@0S PP@ @0@T 0 0 @ 0S P P@@0 @T 0 0000 00 000  0 $Ѝ0 -LM40 0 P弃00 3U@P0p`S0 S 0 S:00 0  0b00?o0cR0 00SV` WpF[0 40L00*+ 8,0lDH`dp p$`hTP4[( a8 [@08  " Q#W: c<0 8 p[8  B8 j[8<0\@p I┐  cY[p0 <  0 R0SthQ l#@T10 `<[000000000P0t0 x +0000Sp`V hhQP ``000@@0SO0S 0X00\00@0X@@S  (Ko;0`00@@(K^lQd^XdQ -LM8 ,  یP@uH㑅&0! T@P`p  ` p 0PU @E0P@ 0|0@ 0x0@ @Hl 0 \0@ @HP( 0$KX\^h^Q^^آ^^^`d / -tP@LppЂxH L0R+`0SXl0 0l0册`0d3/UH L0R:0S P 0 0000SP `Vp  #   Q (!( "$"""!L ! `,, ``VQ,h RD  BD H  H !R  B R R 0 0 ! ("(!<R R R 0 0 0S0000D 00,0R*}]^ -tp@LPT03/`P `0S d3/03/`P p0@PPPPVU V T003/ 0$(pS00P0P00011`  p0@000018 #h00S00Ð0D <0Wpg D p `  0"0S00SP 0S: R `` `80 0S800000h^ -L@D ,0R*hP  -`L@Q1S1S0 1 p 101P<0 @0$00 0 `00营 -L,Mtp0PH0 `p0  DK4` @P@T 04 R T @0@@@DK4@ @Th p0  0 `c`X21 00S0`0`010C1000D00D0H00CH00Sl0@ 0l0x1S%00 0080S4 SH K.0S   00S0@0@00  0S000<  BS0S   00S0@0@0@HK Kt @T 0S @^h^ x-LP`@T 0S   T003/p0@9x p-L M@$"P0S @D 0R 0 0x+R x+YT X \0RT \00\0X T JT 00CS0T pt`<PK00%Q  .xKpX\dQ 0-@1LP3/K0h -L`@T pP0UP*10@>S  آ -t`L@p001100 <@1 M010 pR寿`tPU hh^LPPx0P0@0x00SH33@ K0P00@00Q]Iآ@^^XdQ -L$Mp`dP@P 000 0 0 00000000m K訤 0-LPd]`0t@T <1H0<1堿5,O<1(0C<1嬇@K0h萿XdQ\k -0L@0Sژ00S 0tMP(0p`000410181hQN$KiIxxp\Q -LM`0`S d3/P tᘿP&0$pK0'0@PQ 8 00R |0 bR:<0D  c,0R: $(0S (K$Kh^dQ x-LPǾ`0@ x;S@R@ 0T8Q x;P0L0P0`0`P0,0CP0U@xXdQ\ -L -@L匾<1S @⮆ 0R 0tPx00 p` þ4s00Ỿ뀀QU Q 00 Q 00=U 8d`VM$Kk#X\dQ -L@ KhLꨤ`d / -LMp`@똀P0p00S 0C0 0T(0 00  0  0 R0`( K0ZP( K@^ -LpP널`0p00 R * P  0 $Kk@Q05@5: ZP@^ -0`L0@PS0   V0`VPp V  IPW h0 V   T T T W (00ST 003/舦^Q - Ln 0  茦Q00S/剽Q00S/ͽQ -L< 00 0  Khꈦl\ x-H`PLal@@ 1 @T 1@堽x@{ -@PL 0IKh@{ -L0 @ 舦 -0QPsLPTMhP RPPtP UPtP@P `P Pd H lP XP PPP%P XPPXP hPU Z HP0u`P03Z03SdH 'PPpPPP @P 0PLP \ ` PPP cX $0Xi *XF  X@ #X`P0-XE .XE +XDXw 9XP\P PUX XX OX`oX iXe dXb hX@`lXE nX{ jX`tXF qXA sX vxX zX= uXpY 0@T\@ @@d\@ @`PP0*XP0 @όL 0H Q,ӔόL P0 k\PP00H⒅%\P 0H QP0 PP0lSPPP ` `ll0p,K@L@ 0l @2`   p  @@p@ p @@@HDH_T@tP0-p  0X@@4  X@_ 0 +@0X@@$0XPP  @@p@0<p@ ,p  0 p@0 @P@PqpP@`l 0xgp6L@\T  x 8Px@ LP@lUPx &F@L x`【 @@p0@@,pP@9p @@p@p@  @P0)@P0$UUlP    p  @@p@p@@@P0 `00L RkƣL  Q RH S S5 DK0D K T !.P@0 0C 0 0Q000B+TU TA 0x GT00  Cx 0T G@P0@@AD0K l00%0B$2>@P0D@K-0K0lL@L0 X ,KlpPLP @LPUPYTP PTP T00T0 XPT0\SPPXP SPU0cp0 p0ShQ Z H `0r03Z03S   dH x xp00CY hQ Z6H `0r03Z03S,, dH x % h R Z H0q`03Z ! 3R 0   0dH x dH x` Z03S  U\0T0PaUh R Z H` 0q03Z03S0dH x xPELP@e0PThQ Z H `0r03Z03SP0dH x x@DLP@PT hQ Z H `0r03Z03S0T0JTdH @_ \PT0@c PTYhQ Z H `0r03Z03SP dH j@Dt@,0THP03/X(K\^q\Q -0-LMP@ 0@@ 00 R@0@ K0Ț --T0LM1 1l  10 R    0 K@^ --T0LM1 1l  10 R    0 K@^ --LM0 0 00 K --LM<0 0 00; K --LM+0 0 00{* K --LM0 0 00j00Sw K舦 0-LMP@ 0PT00SK0h_K0舦 --L M00  Kx] p-LM`K@`,P0 0)TU U00F0ćKp -L`\1 0S PA1S \@ *)TP R1"!"40040Q0S0 pWAp{pؠ000S 0 0Q 0 j0刐S  @` 0|\@n`U0S <0< 0Q01F*^@^Q^Кa0^=]] --LM -- LM0 0 j K -LM@< 0,K8 -@K R  >KJ] -L@'Kh* -0-LM@P@ 0@@ h00 R@0@ ^ oK0Ț0Q  ^^ p-LM`@P  0P>00 R 0004EKpȚ -0-LM@PP@ 0S 㝂P @Pv0 0 00!K0 0--LM0 0 00 Kx] p-l0L M0@P` T @80 `0KphKp茶x] --LM  K --L M00 z  K --L M  K -0LM0P`@@pRU PL0 0pK$00SKhK茶x] --LM  K --L M00 -  K --L M  K p-p0L M0@P8S`T @80H `0OKphKp茶x] --LM  K --L M00   K --L M  K -0L M0Pp@ @@l0U `  PL0 00S Ki K茶x] --LM  K --L M00   K --L M  K -0LM0P`p@ @@gU PL0 0p`$00SKhK茶x] --LM  K --L M00 B  K --L M  K - pL@W aWP᪶} 1TP 0 00@ K -LMT0,  A*(0KP KQ -LMT0  *0KP K -LM p@P`4@ 咮0`  0K 4RE0AT 0S@!00c100C00S   0 `00V 0Syhn 00040S 0 ,0K`# 000`V 0S`hU 0000040S 0 ,0K`# 000`T0S, 0S)0Y%h 8 440,K08 S@(  (404` S 0  10i1rvZT0`  3/evM4Q 0S   0 @(K@-(AR @ !<  1 @?T0 ( Q T0 -LM K -sL4M80 00@`S@ P1 㑭x ㍭l ㉭\3KX*P3Ap<#@sP R @ 0C(p 3*#K ?# a0X00T1|@P u  R0p L0CXp\p4 0E0M@0KP0 0$ T00pq`00q Z!(B;2 ,11017Sp411P`:E%pqZ01JͅrKh]耐@0@ -LP|@x&fSR D@rUPTX@@P@_@PF3耐@x 0  0  0 0-H0L@ 9PH0 `0R!000 P 0CPC3 0`00000@@@0ăR - LML"00<1 @00`P!0(0 40K @@ @$@,`0P8 1q'0 0! p4 K00K @@$@(`,PP1 00!0 04 K00K @@$@(`,P1 00!0 04 K00K @@$@(`,P0 p00!4 K00K @@ p$@(`,P8 ' T0@< 0 (Kă*]ra]R^^^ăă x-,@LP`8KxhMă 0-\P@L H0  `9H00R!000 K0h1ăă -L$M@P$a$q٨ ר1K ႁ R  䠟`V# `P0 oyP0 1@@ ჈y0|80 嬨80 RS(L KSR404 0Bߨă`^R@^ăă^M]/ -LD - L^ x- 0PL`d@ n9SL0L0V屨;SPP =^ RSxRR p-ALMP 0K0 0xP4 0 X  Q Q / P  x   #9 `SH0H0Q  0_ 00KpăRRR 0-@PPLXPIK0hy -@QLL@T$Q L P0PRP0(0P0L 4oo֧0KhăŃ -LMKp` ` P 6@0KT0 0P0 00 0 00 0 0PuP3PPU0S S0%!*$KR -LMKp` ` P5@0KT0 0P0 00 0 00 0 0PuP3PPU0S S0$KR P0-L P$Pb0@T `0SL0S@堧T D0<@0S U>0\@{{ăŃ p-L4MP`@U 0S 0 LK50<0 0,@@P ,0 "LK hKp@{ -LM `p401 W* 1S 0S~ LPU00z ,0K$@#00 T/ Y H0Y(0W 8c0SLP0QP0(0P0L00L P0@L000 8  00C 0T08 S AQT YL@Z000S  R H0 S00PW4@T L P0RP000 L P0 H@ <86$PPbTpW \PHUP00  (KŃŃă -(LlM1 q0\0 X0 T0 P0 LP p\ Kl0K 嵦 e$@T nP ᧦2@L P0RP0(0L P0  00C 0咦L"`1 04 0SevP0x 7  p < Dt t KL  H 4   $ 8   8  L K01 0``0 0K `0h000ę`P } tL0S 廥r  `LP,`Pb0S ᩥ 0(0?0t0 0垥 圥#KA^I^@^Q -T2LDM1H` Q@2p 0 Rn@ lK⭜PL0?S{P0Sx d0Ss `0SpW XP P PfppL@T $0S H RL0RSOV $0L@80 P0lK@ 0S ᅜ0停ƃ -L MP` AopP>  1X0  0(0K0h00@0\P e )(0<10 (( 0$ xQ t R d R 0(0( (  B ύ 5 $K -LM Q`p1@T NPP0P (⛗PP  0KPP K QK -LC<10/10/ڒ - AL` 垛PP NU0S $0 R ԛ QpP$ cpP pP $0$  ( R p 岛 0- APL ]،PP 墛0 W 四0 0- Q@L F@P 勛0$0$$ ( R @@d@ t0 p-L M a@P  K0㎑@ aTQ K 㡓@Kp -L0MPp A?U`#0 LK(0<0 x0@P 40 ]0``0 0  fPP U LKlP )'K@{ x- Q@L `Ϛ<1S@ T <1S$A(0S 4ae00041541(0S o$c` `x -0 L1` A$!40 PpᕚQ !RṊ`P 僙@Q,K ,K# v,K0YKp@^ -L M0@ K⤋PK 㦑K p-L M0`PS1RR,RR $Ky@P( 1$ D0 0d03/`40P0 $K bP P$  0@@ 4 040@@@@KpħX/ -L,MSR0RXRRNLK 5PD0S@0 S S S rL+0@P+D0S @P U @#P`P 0D @PpPPp`H 0㨖W@ V q jLK 0P{LK⹓xLK ܏Pr_1P10PPb?N`P_ a1Zb  Q -P TKP KoT 0 P0p10l10t1@0h1 1Y bG Q ZG-zP P KTKKT 0"GP000b101@01 ^H bELW 1ᑐX LK Hp 児@s(K耦ՂՂ^^ -P@L`p %ؗ00P0000 0n?@r?v_`ZZ  -@PLpᲗA` ,XH00` P , $0R`0T @^ 0-D0LP@T ,P∗A0 x-L@P`gP ( RU g@j@x x p-LM`@P4 KPP "0K ͎P00S,00C>S04SP RP x0K~% !40 4‗^gKp 0-LM@( KP (P $K c%iGg$K 㫏K0 0-LM@ $K⇎P( K$PP0S ($K @%( 0000@gQ $K 』K0 Q-LY00P P0-L (@PtP@͖@PU L0D@0S x[(嵖$0m00d\̃ -LDMP Z@2 2 0 B2 @h <,@K$2r"0`0P!  0  $(,`0P<42 00! $(,`0P  00Pf '>1 00!   0 $(`,P'>1 00!0 0 0$(`,P'>T1 00!0 0 0$(`,P'> 1 00! 0 0 0$(`,P'>0 00!  0  $(`,Pn 2@P @\\ Z@(K^^^̃ ^^R^^^"^d\7:]LR Q0  ꀑ x-L@P!`P 0R00 `VPP 0 T ]]⤕zKxh -L(P`hbU  Z X@巒 \K ]  0  @@(KR@{ - ML $ K -LM@P $K P$KK// Q 0CSp// 0-LP@m0S ᴒ0 -!LLM`,pK0`'@P0 (00 ``A `$`,0 8 00S$ '.0 0 00 `A0t0$`( 0,0800P0 `0D0A0 `$`(,8 0(KB^G^1R̃q1]0R -LMP` p 0@#0\*0 1S  4K04K+HX<3Up W 1yPp] K̃Q^@xV^ -LMK@p ` `  Q0KT0 0`0 0 0 000 0 0`v`3P`V@-0S@)3@T@# `塑T*0!R0S:T @  (Pԑ@$K̃@x40 P0@1S //̃ -@Lht01@T`P `妑'0夀D$ 圠R$`0 q000嗑Ip0P0U R0Q剑0;0$ Q00C0們-@x@^̃@{@z -@0@@L P 3  U Ġ^̃.R7:] -0ML00`  VpP-@ 0R' P R|=P W0pQ @ -Kp  p@P i K̃@x -0 ML@00  0rVPKhOK -LMP000 00  0ZV@Pu姐 0$`R8@ 8 8 ppR@d0S UP pא @U0u00 F uPU $VS Ð@Aq`V R P 80P 娐妐$ꤐaPPU 08 S "|00Sp2Q劐4刐Q 0K ʈ@@(K@^@x@{@z@ -LM @000p`  0UPP}tT t TPP mPkt11@Tt 1!D01  xB 1RP R AxPxPxxP< uxP,ߏpP%. ֏ `P P#X <1X $QU L0@00 ᩁ Z Q 0K APPPY 0夏00AD01  (K@x@^̃@{ޏ 0-LP@ዏ0S ҏ0 p-L MP@` KT  ᥿PP 00 ㋿Kp 0- QLP@ Q Q00RP 0RP h0T @DT t0P000 -LMpr  wxP0 4 o 0Sk0@ShU A+.PPq\ !k`0 fQL11 Q @T@ 00S <10 R7s40Sh0|03   d)R` h Rt` R` t`S`F8 R8`  0TP8 G t0hS 003/;$A Y (K@{@^ -L M @ K4P0KmK -L MpP7@P R000  !dT`P 1 t`h 1 ݎ0HS`FWU` K -L M@ K0KP K  PQ K K -LM@0 ,K (0 PuQ\,彾pPh $0SW40Tp0S aJMPP后`F @劎`0 兎; Q 5000  S`P@ t+X <1X $AT(0SP (K-,P ',00o` LV```LE,P (K(P ,(K,p K@^@x@{ -LM@p  K U`P(bPP` ``  !0SP 1` 0 Q % 1    ` ˽K -L -t1t!DML@0p0` !,PK( 0 @@ @$@,p0`@%<1 (00! @0@ @$@,p0` 00帀S# 0 00! 0 @@ @$@(p,`p0? 00! @@ @$@(p,` 0, (Q(K\^ ̃b^h^p^<;R] -H0L`AT1P3HAT p`@Khs@^ -'.8ML0 P0 00!<0  00(00,0000$ 0{ Kx^@ -LLMh $dH PT pPAQ\ <Kph0HS H\qp@ 0 TXX1`p d X `0HaLaD1h 0Pl0 HpPc` dd H0L` P P0 D DT EP0PEP pP h oXiyW 1D0T Rp \P p  22P! p @BBA ZPK ͽPPb X  F0PQ W  90PD 0V0   *0P50 0 0 00000 p 3X R0 0 #0 s 3W R  0 s 3V R  0 KU  0 l0 (K@^ p-L4M@`P <K ׂPPpP`H ,0K  #U A@0  ЈVH‰<0S S  R`083  l0 oO3Q 0S2  l0@0 K 6PP70 $ 0( 0,00R0 $0(0,0cQD B0c0aS   Pe 000S S@`@``@0S S. 9V 050504e,dd0S d 0&TE  `<0  &l e $<0 0 0P0 P099P0T& `004T 00S 0S P 40P  4P 0S 00 0 V0404CEEP 0 0 V <$>T 0S0 <0 8 <0  8 !  P NKVT 00000 Q ""k! `0 j! ""h! 0 i!:0=0T0t1TP7- 婄0ܒ1 111141100$1010;0r,!?`0m  0 p: X20S0;0: 820S080:; :S;811V `yP1T pP1+  P!Q8810x!100(101101410?0ZD $1R0 aQ0!x10;0;   0 @ * 0 4 8 <000 0Z  ߘ t0v@<@ڭ  0 ܭ(K^^уVU0SU4S -LMp@P0`0 KX2 0!pS\ hr ` d" p*pZ $4 0,KS00x1 4 K  0Px %.K/P# c凭/@@P@剭W@ P p  P Po+ 0+) 0) $ٱ XW  0 g X t|벚p $(,  R R 0 0@PY0: \B`R  edBhR0eR 1RD D0100CT00P0x1= S:0:x1`0`S000[0201 0 SQ00  x1  P10S:0: 0 010S:0:XB@(P@Ѭ+ 0+) 0)ЬX$h*0P 1 S000 S0000?00O奬!  0 姬(KUуx΃уWVUt\R^ --LIMH0[dO0H0K 0 0 倬. 0.僬K T0 o 0#2S S, g 0 R% * 0KHP 0 Q% *DUY  04#$48#8l0    |0 R% * 0KP 0 Q:Y 04 8 <  $( $(,r  $( $(! $"(#,r S 04 8 , 04 8 , 04 8 , 0S (00l0  04 8 # (   0 #211 S00\0S 岫  0 崫  l\ ?  0 R!0K⃄P 0 Q;Y 劫  0 匫 L   \  0S :R 0@ 00 A 1 1 K ( `K , \ \ 80lK 40 0 @0$048 < P WHp[pJ1j  0 30 $ | P P;H@[@7 KP  (\KB K ,YK90 lK$K0KgPPH0[Ij  0 0 K$0PPU\H0[HԪ  0 ֪481S 0S 0@K4 8 x   04 8 l K 04 @$#4"$8("( i0 p@lK$00PPgH0[ H0[fDW~  0 倪61SD ǟ4 nj  0 4o0 $0^PP <0S*\ ᡼. K⢼᛼K4K. 㙼$K. 㕼 04 $#4K"$(8"( K#8l \  p0R :(psU (p lH0[ 00 0P \ 000 0S  尵 f 0@`@4 P8 <`cVk 0#0##<00 `F4S0C0Ʌ#4PŃ0Ʌ"Pœ ɕ ɕV0SddPũF  0   ? ©`0S 0 $0(0,@0Rs姩J  0   ? 天0 @f$(, " "",  $R`f`&d` P0T (cwV  0 y} `<d h l@  `bV6r_R  0 aV]  04 8 <@ 0bSU<0S/0 $0(0,@0R%8  0 @f9V{ P0 0 $0(0,@0R 0493TSOlK#6KT1Td 冉PC  04 8 <@@ 04 8 <000 0,`( ` 04 8 <000 0` 0@4 8 <@@0@0@ 0~I] xЃ̓^^^Upσ^H?^SU0SU4SууX ;S 00 0kP 0 h4$!  U$  P 00S P ~00!01? @ KUK Q\ \# KK@K 0K4U p⭸P >;(.  !Q !R8!8QT0;" \N! 0!'[0`0`Sk1h1j1i10K L1S .ca 0@4 8 <0#$0 #(#< 0 1T@cd@_w 1`0 ٤R  0   ? ֤ 04 8 <0C1 04 8 <(1}  $ ( ,aQa4 aR]S0  .l1S+ 0cS'L=p1c@=Ql!\M唤F  0  ?   0 勤 04 8   04 8 < c\$P 0#0##<00 L4S0C0Ʌ#4`ƃ0Ʌ"`Ɠ ɕ ɕ@\D0,\`00EF  0   ? B " 0 $0(0,$1R+0! 4 $J?@@P@4>@ @_@0!4 4  04 4 8 - 41 01 04 8 <0#0##<000l0 0 4 S0l0#40 `   1 ;S0S \JӣV  0 գ~0P$!T0X0\ 10Pc0PUI幣R  0 廣0U0 b0 ? 嬣? ; S< 04 8 <$!0bS1m 04 8 40 8 00 4  8 4 0 8 00 4 #$40#4 004#$40#40 1S0 $0(0,$1R0LH00N  0H0  ? Jegu0 `PeP 0S  04 8 [R1   1`0 $0(0,$1R.0S+;S( <$!00$1 P@P嬟. 0./ ?/媟g1  uqdq0K  0P00Ŋ000$10$1(K -L0  0'S( wP H@f  0 h 0V!у`8 8#4`#/ 0R S 4/HP///\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ 0-TQX1L@EQPQ d\1+UP1P01 S 0xSx04 8 /#+; R0Ҳ;0D^t\^ -LM`V(` 4 0S(400 ` ` `` \l  \ V0S lАO\ \ p@b(p bQ `V5 cQb Q*0p gR00$Q0 lR `0lS0gS0` P` 0 bQ000 lR` 0bS0`P 10gSq(KUU 0- 0@L4 P8 < dR@Q 00dS00dS0@0dS@00 -L@Q 0 001 / l\ l 0Sl\ ` /@-1S !lQ 0Q 0cS 0@cT01 cR0; ! 0 /P//`8 8#4`#/ 0R S 4/HP/// x-@LP`T P 4 +P & D0P!Q88!011Kxh[x0S x-@LP`LT P 4 d@P & D0P!Q88!011Kxh/x0S\0`P/  !`80 00,000, !/@^ -0L(@+R3Q! @ AR R+R` RL $'1M  0M X Khـf -0L(@+R3Q! @ AR R+R` RL &1M  㴀0M X Kh諀f0 !<0 `4000,000 !/@^ -@Lh0  :0 0-d0@L00SPPL_Q* 0,,00S 0K0h0XH^0S S -Ld KhS -0LS̀@ S XT `0S d0S h0sp0St0Sx0s T (``pW  0R +k00}hpP 00(0  0RP R9 X @ 0  &a``0 00 00 0 \  `T l  |  0  00 0 ("(  (!"(r ` ` `0 00000p L0 """, " R )4000)<0; )40)8)000`00`0Sa00SSa00S 66& 6 6 6 6 7 p0 Sq00SSq00S 7 70<0000 8#8"8SPl2S0p2S t2S02pPx2S<00;0`0?0ǴU G0@[T Ev400 Q!$Kkgz0S[\^W -@LP PP |PU0 T1S-X* %@`p 0 P0\\1\1S0\1dT` 00X1 @ 0XX1Fa\1a`V050S00  =z -ALtM9KD1pS`P(K0 @0n0D1@|2S |K3|K <|KK 8|K 4|KK 0|Kp ,K|KW0U T24280S KxЃу0S -LM\ $4\`\ $4`p K^b P / -pL`P (P (0V<0` Vl3k``P  ``P ``X G@T`1 :F|H00X Q!oyXl ( `V  04 8 /0`0cS1410cS-ʲ0T#tt1x'xW%*(1W0 :90 0D4 8  10fS 90a0T1 > 0  $K`\xЃ,R̓ F 0-0@PLc  0 K0hcxЃ -8@Lp`P1@@P@$KiPxЃ -BL M`/U0P /pP*  ) 0S& P"JlQ) !`R8K#K. "KL"0 [  0 K& i0(  2sy80A1;08#8;8S 0;$ 0$1Q<AX% 0%T!X1 \1\!C1S01S01S000(10?01S ;S忋( 0(‹0S010S01;S P YP hT!X11X10T1014110L1;S0;0103/TKt^xЃRуft\^ x- aPLlT0@ 86P2;TX! S\`0H1 0c S*!B!R 1$bR Y' 0'\<M% 0%P>00d00KxhxTуу V -qLMP T0@ ``PXlq!& 0&$+(R?0S(0Q(01- R+1S !H! b0R)*& 0&0 $1R0C0000 0C0C00 000?0h00?0 Պ' 0'؊<nKhTууhS^ -P@LS0p `vP01; S 1S P H! bR<00?0װrKhSу^ -0L R   Rh  RT   R@  0R( S00 V^ 0-TP@LQS @00SP 000uK0hS -P@L7SD0 $ 40  yS$0$KhrUу^у -@Ls8q`oKhk/ -LM@K00p0` ` P0 B0KT0 0D0 0P0 000 0 0PuP3PPU0 S0 0$K -LMP Q2 0@ 0U   ` Rac@Pp0U2 \3 R@R T 0S000 (0PK -r \ \@ (  0\,KŸ  02 L02 12  0+0|" x2  0  0 (0Q @0K (0 0  0d"Kc2KL\` R[1K\!K$1 `0X1 J( ,K 0  02 P02 12 \0K+0|" x2  0  0 (0 80 (0dK 0 cK4K 6AL0`2 `0\ [K\K$0,KUK L0X1 p0V00X0S K -JP h0LR  H ͌ 0Fs `@;U2<008R(K -L M 000L 0 0000000 0Z Kу 0-LMPQ@ HP  0K#R #GJP00K0 -LM@( , 000 0`6P (0S W @T !  @ PP 51 Ki KxЃ -LGMPp`!UP| PU0  W @\S R @\Q Y0 @,1 001 EQp@ P, 0!0,R S RKK,HP+1[Y0[ SSr S,1[S0[S$1 S QqB RQq8 ̑KK1PiK?K1@PdQ:[K-K?K@|IK0uP (0S U PU !  P @P:56 0@/S 1S01s000R R r   0"XKKⰣK?K⭣,1[SPXPK:[@( p P@P@+@@(KlPxЃ -LM@`Kp` P00,K 0Pd0,0` 0 0\ 00 0 0ᑓPuP3PPU (`nP00  nP(K -PLM0Kp` ` @0 0KT0 0@0 000 0 0^@t@3P@T 0S0 P6P9P$KlS -LM@K00p0` ` P0 `0KT0 0P0 000 0 0'PuP3PPU 0S0 @0OGP$K -LM@Kp PJK ` (0P0 0 ` 00 0 0\@ L` PuP3PPU< P ,`O@ P(K|̓ \ \]8// -L⼖^ -0dML,@P` 0p! @@ @$@(`,0P 0,0  0,p! @@ @$@(`04P 0P? 0D?',p00!0? @$@ 00(`0408P 0Ι>Ο 00,p! @@ $@(`08P 04H 巙H> 0 04,p! @@$@(`08P 0H 垙@> ,p04> @$@00! >(`0 04`8P 0ᇙ= ,p00!= @@ 00$@(`0408P 0p= ,p00!= @@ 0"0$@(`0408P 0YH= ,p00!4= @@ 00$@(`0408P 0B< ,p00!< @@ 0$@(`048P 0,< ,p0< @$@00!<(`0 00408P 0P< ,p00!<< @@ 0 0$@(`0408P 0,0 ; ,p00! 0 @@ @$@(`0408P D0K,0 ; ,p00!0 @@ @$@(`0408P 80KϘL;, 0 0!4;H @ 00@$@(0,P8 K0Ṙ:H 0: 00!0$ @ @(0,P8 K0H 墘:8*,p0 0 !: @$@ 0 0(`0408P 0ኘP: H094,p00!,: @$@ 0(`08P 0r9 ,p00!9 @@ 0 0$@(`0408P 0[9 ,p00!9 @@ 00$@(`0408P 0DP9 ,p00!<9 @@ 00$@(`0408P 0-8 ,p00!8 @@ 00$@(`0408P 08 ,p08 @$@00!8(`0 00408P 0T8 ,p0<8 @$@00!08(`0 00408P 07 ,p07 @$@00!7(`0 00408P 0Η <7 ,p00!0 @@ @$@(`0408P 0ḗP7 ,p00!<7 @@ 00$@(`0408P 0ᡗ6 ,p00!6 @@ 00$@(`0408P 0ኗ6 ,p00!6 @@ 00$@(`0408P 0sT6 ,p05 @$@00!06(`0 00408P 0[005ş 00!0,p @ @$`(`0408P 0H B5 ,p00!5 @@ 00$@(`0408P 0+,0 @5 ,p045 @$@00! 5(`0 00408P 04$,p0 0 !4 @$@ 00(`0408P 04 ,p00!4 @@ 00$@(`0408P 0H4 ,p00!44 @@ 00$@(`0408P 0̖3 ,p00!3 @@ 00$@(`0408P 0ᵖ3 ,p00!3 @@ 00$@(`0408P 0ពL3 ,p00!83 @@ 00$@(`0408P 0ᇖ2 ,p00!2 @@ 00$@(`0408P 0p,0 2 ,p00!0 @@ @$@(`0408P <0KY"0 @ !42@$@ 00(0,P< K0E2 @00!1@$@ 00(0,P< K014"0,p !1 @ 0 0@$@(`0408 Kp -LMT1!P@ RkTV !`V`B/@ BRp!P ? R>n6 1D@B 0hFS c?Ō*P T. p KQP`  KT15T10:0c? Pa UPPUJ?`~ [ 0 :0\00  B K\!^0s S0/ - @Lp娭 B1Q2S01?0~0B?0P!?0~ B Q?0S0? ~0B0Q?01 -LMP K K K7pW &8K K Kp.xK@@\K@`Kx`K@`@Kx@K$7xK\K@K K( x-@`L\P70N@@@00] z@$7 00S x(DV -LM00`pV3 `V2 `V@0 |@T" 0 S*c7 _7 ]7QP0S  OPP 7 0S 7`Y H03BBB @2dP ⩕ Ǭ ᰙ" 0K@~K uV x _?0 `"K0~K e 7@@T4 P70S N7(0S S 0K d L0!~0Kd!L0~K0S 7$1 Q /0#7$A0K K@0}T 7 @N=0S0 KK(1@PKK00 N=0S0 JK0@PJK00 0 t0⩕ R 0CSD008DF$E@200,d (d @KT 0}K (KC!^_!^|!^!^!^]!^E]3^]?BH'!^ x-jLP@dk60P1B  U c`[@@V6x( 0-L g?@PQ @0@t\, PPg?0U0(!^ x-PL@`*6U 0P @R00V(`0 000 00PP0C0  PP1B  0 PK6x( x-@Lp5`0S0P PQBY |QU 5/ 0PP (6x( -a L0R@PDp0SU  0mPP^ x-0@LP`5P5x( 0-LP@P  W 0 0}] -ALM55 @Tk 0P!`b`ooR`f``  a /oQ b r!`PU0 F121 "!10CS1!1R10!1 VpT 5U! :U& ,000  5 K0:5K W  W   gX P f$5e5 0b5(K@{(DV -0L #P -LtM━P@p`440 P!B  @ =5<(20 !Q[l0X RU T!R PKdPL1 0S5{5p20 4 f0 5<4@20SjU7 4U%L1N ?0!|0U4   x 0 0`c? `Pa  ? 0P0T12 X4Z/ T1 JdZ `1d`#K QJP"P`K0mP T1`PE 40Sʫ04대H 0SU0 PPhH4F0SL4B< 84# 4Z3 (K(@^@{^\ 0-H@PL!40000   PP000K0h^4(DV 0-HP@L 4000C0 0R 00 K0hF4(DV x-Le@` ᭑0 @P(4 @`l xpl N I0 Q!!!!0xSDV!^!^!^"^"^"^ 0-QL@330 Q!!!!01S !1R 101! 3P3ὐ @x(4`l~| ┩I⒩K0hbe@{(DV -bTML 33\ j 2@,KPp@(;0 0!P(P 0 @@ @$@,0p}00,2 (P00! 0 00P 0 @@$@,4p}001 00!00 0(P 0 @@$@,4p@ v}00|1 (P00!(0 0000 0 @@$@,4p_}00$1 0`00!0 `(P00 0 @@$@,4pH}0,`K@& P0(P0P! <0K @@ @$@,P0p2}'>0x0 @0l0 @00!X0$@(P 0,p< K80K}(K(SS%]"^"^""^'"^-"^%]3"^SDV B@-2@ "  !1 S!1$0 !u0@kDV( 0-@L\Pv20U00 P00BY 2020( -@L $˧0  (Kh 0-L@P TQ @'Q "x 00.00>;0 0<0jQQ x I$K0h萧0 0-@Lp2l0 R  g? @ P0000M2U 01;0(^@{ 0-L@PP1320( -L@ $1#2( -TaL .|T8 B\ @P B\ C$ @PC $ B@PBHA% 4T U  V   S    Y <0SPH<? P14 0 TPSP"0000?U$0!T1  T0SH1  eP xfP000PP1 1S 3/P0000  【  90 / f1YY   ^-* 09g1YY T15  T00S 6T15T1O- `1YYa1YY V `1Y Y  b1YY V u 9  e1Y Y 0<0 Pd1Yd1YY T15T10<0 Y    Y@   < S[1Y Y 0S ]1Y'Y%  3 0R  P0S   Q ]3 0>;0 I \1Y6YP3 | P0 P p mp0 P P "lp@p\p0 P PKzV  @ R ^1YY Xjj1YY JT0  0R   1RVRNP PHW @ Y X1Y Y1Y Z1Y   Y 1  @+ 0Sc? > 0  :0/c ᷠmX1YY  P JXEUP#U PE0   d!e1R,Ko(\ 0-P1PL @ /@/0( -L$MT10K2T10@9000 000K P090K -T1L@ T1T 0h1Pi1S -`L@p[/APPP 1RP 0P1B P U Q ☤X Iⓤ/( x-TL@P`8*/Un/"Rx( -LDM0`X Sh p:0 #K4䤟@14@ `@ P@ p/T!T  a1 Q,l ) S& t4b^Pl01 0SH-/p @$ `spTT T!T"$  b\!4M' ( 2/&@Tp RdR@1d@#:'K <P0& @ `KQ(?R 0p@@0  0W#p@@p D44 'Zt 0 @@'(KV( -pD! : :#6aL$P&A@ 0@ @ R  0 P R0@ Q0S@ 0@  T   q 3 00CP QT!"$  R @ 0@ T Q Y ,⼛ &V( 0-X0PQL0A DQ&T 0S |A@t@3@U &0Vh -qL@0P4PPppm0SUP  X`8"&0UTPf&X U ! Q0`P `PR& W0堐aV#TWP,pl%0Z T5&:  TW0Q%&V^"^h - :@:L#FpPx0x0a@%|QU X&L0Dp|1䀄%0003/T1;T1PPPQPV(@S Q0-L@0P0$%0T@@%0Vh -@L( _%T@ {W0hV -@P.SRL`p ": :d#6` Ag% $՚ ,$͚4 Kh%(V - :@:L#FP`pPN8@%4101@0@P`, 1H10L10T1K $1 Q"l  S %TP1 0S l l$S 0P <00 $00"T0S!< $#=` 6000 $00S |QU 00 3/P!@`T0SPU Pl$9PT^$U T0S@T`,$V P(K@^V^( -`4$L Mp :: #6Q4@V`V 0 P0@0P0T1;T1fT1  0 P0@0P0T1;T1T@Pq p3Rmh3V? ;1V! L3VN D3V_<#00:,3V; K0V S3V0CV1*3V I20S)D0S00!`0V `00`0V `0000dS0 0 00#t< $`,#x$P0E>St#T1S\000 0$ 0A>A0BQ3\000 0S00000CS000P{0 -L@pU`W0S 00hhS"Q P%PaUP ᫰0pe`0e00P 0PU00 x-PL`+Q@4 V0@@cT @@c+ L0b # @l dR  0 S! BB.A.A B\" @S 0@ S d\x 0-@LP0U00 U0S  Rb0 b Q 0a R00 Pa0S00K0h x-L@`0 PSxS 0S)h P0000` 0B R   S0QA1 S0QA10 0000S000x"^ -L M`Qp@]l0 0 ST S+0S 000$<g PC0 PSP`P`UP ᷯ0S0`ep000P 0PU00V& 0R! A@Q⢑Š!L"!'*ȠJ ࢑ l Q 000-(K"^@-0S00SQ t0CS0 0Q@T 00cS10CB>A>A0BP3̌l@-0l S0 0 \ @0dS@@10CB>A>A0B\3, l 0-@L RP Q  B AQP 0cS10CB>A>A0BQ3\R  0 0-L@Pp 0401 1l 10 P I/@^@- l@  \@ @' x-`h0LP1 l0 10 @T 4? 0P9xx@^ x-`h0LP1 l0 10 @T 4 0Pxx@^ 0-L0P 1l  10 @T , P00 0-L ( l!  P | Q  Qh@ 1!  Rl @@l[ 0K0hv00at @{ -LM`R@P0 (` ` 0S00S /00 ` K0Spl8ppwp3KYP `K p`\ 001K pP K V \ G p0St0Sx0S|0S 800 S 0S0sP0 `0Sd0Sh0Sl0Ss`000K00K0 40`Q W  yP V00S10`0Sd0Sh0SlpW0 `0 (0 K`KyKp p !0K0K40gP  K9 K+K  ≭`K4S;(0K 00@KKP ^K eP # 5`@Rp0St0Sx0S|0S90N sP0  ,Zf0Bp `` 0X( 3S 8 <0SD00c08  0b0S : 00j0000 00 ,,PP70 0(00 0(0 +\ 0K\ ζ+(K$ p "$ Y,$0 * 8#< 40#40X0 XL 40# ##<0` 0 0D 40RS 4H Ƭ ¬i8)8#4i#0S00SS00S 00  0 0 0 0 0 0 S00SS00S 0  8`#8)8<000000 8#8"8S 000S9`+PP4 V P 00S(01  (K 0Ф`Z& (0J@PH*(P D*101H@T# 0#!T1M  (? Kp0 !<0 `4000,000 !/@^ -L MPp`s0@0 0P K 0-L@`Ph?2{0 0-LPR@&{K0h 0-LPF@^?0 x-@LPp0St0Sx0S|0S -`>{ `{101Dxx9x -L`Pp @?yPu -@LPp0pSt0Sx0S|0S ` y@WT>8 x-L@?CL`xPAU (0AP0 xxtV -(0@L(1M  I>(0M X Kh@> -2LML @Pp` 0 0! 0 @@ @$@(P,p0`kf00@2 00! 0 @@ @$@(P,p04`Uf'>1 00!0 40 0 @@$@(P,p08`0 81 00!$1 @ 0040@0$@(P,p08`f0 0000!0  0040 @0$@(P,p08`e0 0000! @0 @$@(P,p04P8`ePR<0(Ko`?a]#^^V^]V}]p-Stx3^ Tp -LM0@pSPK0SHPF0@S5P? P 10S`9`U) 0 S$ ( 0R*T)<% 40K4 0 $T 3[#[t0u P'3[#[0D`H  `0$r`(K`\0T(Et([\ - 0L`0P@pW W 0S  0S  ᳴@/@@ -PPL4M@`PH0  0S0S1d" d" bPP [0S 00-1P@p0ST000Y00SL  `D 0VD0|S@00!F! 01/P2 0`p00@p0S'000Y00S  `D 0V0|S00!  A 1/P 0`p00  F\ 0 6ST0P 0TL   0 6SP !L C A Y 0 S0/@PS R | Q0  !00K#K $KJX(P *I6P  ,K (X Bp{0 0;0$KP vO J ?P@@P 0K0 @ %K1/\04 K0%K 01/@G@0XY$K ?KR K06#KR0#ӡ £#á0# #妇4@GXvB (K -L$MPd0@)R d0 00  01/3ꨠ<0 ` cD #0KKrK)KSRd R0  R0K0  00[=0[S< [.RSC 0SR ;0[.S 0 SR`(K -L1\M0@`H0 d0HP <L ` A P @0x`4K#1/` P q ?K%KFHZK ` ##K R0KP`%KR K11R K 0 J  00 0080K0 ᙢ@P0 0S80 P0 pGppp L0@ @(KV -LM` p 0PP 0` T0 0@0 0h00h0P3YtP  d040 0JS(0080K0P000  xP80 S0P80PS0 80d0 S0r0S0 t R 0000h0 0H h t 0h H0 d0ZT00Cx0 \Q I ?SR:P`Pl x`PIl @K@Px` T0p T 0CK X0 ?)K(K)KዚT0|0 L d \ `0|S40 N`x @P ` 0@K0 ?@PCPH0SXd0Sd @00@@0S &`X T0` 0cP ` 0S  PH R) 0R  d 8 @      bRhR`\0 HP H dhyd d `R` 00i\0 H 0S+ d 8@  R# 0 0P0\  R @`d@0\@ H 80|0L0  0#Kl0Qd0hxf` 0Lp 0`0 P RL Sl R0`0\0l |0 I@P `QZ<08S8t R3 8S0 ` 8@PH0S (K )K᫙T0HL0 `0TZ`X0p T0 bT\0L P T0L LX @T孂T0XcZ` 0P 00 /Wd0`80@) QP |"d `08 @      0)Q ! 00 0@t0S ZT`0 `0\0Z$ Z[ #KQPP ` d4K <0K@P <0P00P 00 أ@@d7N`XC 0p T0 bT#KUT<` d4K <0Kq@P` @P <.8  `P 80Q1Kp -@L(T0)P -LTM\ X PL H P p`0#SRR0pR\000 0D K0Pd080@2`[1`[V#[0R8@0#SRKp 0P(pp"LK P0KX@TP@P PPP0S p0)pp(K..p`MT/ -LM0 K @ $01/P00K p-L M@K a 0PP`P PKp-/ 0-LMPK@ $1/P00 Q  Q 00F0K0 -X LM0S <000 B 'H0 KW$^/ 00CS0/0SIW 0-@LP0S "K0h00 (00S  0Ps// -@Ld 0Sd0 0 000K10[1K20Kd0 00    H K  01/PD ?)Q ! 00 0)9H0DK 0HIP+d0  0009/P  fE H0T 0 0<  T ET\D8 0C8#880 00 0 080 00 0T PTdT T (K\ -LM@PU 0S 72[d 8S BH#P ,10S; 10S5T 0P-  0ě8 0C8#880 00 08 0C8#880 0 -0 0d0 00    01/ 0㞛^d $K -LTM`d0ph  l A hW X@@a `T0K KPLKL0 HP < 8@ 4 X T LKh 0P @P X4<0X0cp x0 4P\ Ut x00K  㩘0\@XPpU=*Z  R@ b4R㸠@2 lQ  t   ź tP: x0 峐  B l TK x0 KR0 @ P\ x0 `0x0@@ R T  00 0 0b10&K\ 44X14h0 QP000(K 0-@Ld0 00S S00S0h0S !P 0 0S(p0 0 K0h' -LM0`0CSI#ISR8P GN@P#SR0$ #R4@P601T 0Sd@@T  P 903/P #$  1/P ᴏP#$   00\ @ c\ Tl 0= `0 0lS0!  00 $00@`cV T `l`f` 0=(K%^%^&^P0@-B Q 0@RS \ c@0l00 0 + 0a(0(00Pa 0@T 0 \0 (0(00(0S0cP0P00p@- @`P 0 00800000p -Lp@PQ Qb@`0`aV`! 8/P@PfUQ\/0lSQ/// 0-@8L0PPsP<0S0<0 <;~P U&U80<  < 88@  LDT 8 H\ DP L0`Pb@ U`P 0 V 0嬠0cp,2Xp1S0Wp!0 0Pgg0000gS00ppW@TUU@` -L M`pPUPZWphPSg& 0# 0 @P0  0 0(00j(0((0!X h0 “007PP.(+X0P& }@P  0h0000  \00 008<V|8080 ዂ0p000P(K0 -LMr4 `p80 @ p0p(p 0pSpf4 0 0V`c0S00<0 WPPU< UP!R 8 J80080 `pW PU`0 PjU 0Y0$ST 5PD 0<00#8@40 400;P00@HL00 3S"8 <0SD0P c00c0 < 0bSSP10U 1 !0 `iPPjU P 0 3S80< R DP 0` c 0,0 c R ! R !m0@ @Z0h 3S80<0SaV  0PP7yPj{PP V0 0jW!T 5PD 0<00+P 40 4`!000@0H008PL000;00S0p0) 3S80<0S"!1RY  Y 1Z 0@ @ 0 l 0000lS00 P@Y0i00@P0@ `@4 0 ( R((K -PLM  K K -LM00 K x-@PL ``0 0P0 1 4U@x x-@L`PP 0 V 0f0Ó0@0`x -r00LM?Pp 9Q  `  VU_ 0V,0K#J`cP < 80 80P@<  R L2 000$080Y0(0(p0h(0 Y fR ! 0c  R&000 10 008<;z80800w `pc0VP`0wW QE UwA P*9H1ZDT 3PD 0<00+P 40 4!000@0H008@L00  , ` 3S80<QD P0 ` YR ! 00fR ! 0PD00" 0"0(00" 0"(KQ&^i&^&^ -LM& K -LM K -PLp@PH $1 000$08  0  00 008<y8080PU `P `  0  d00 008<oy8080P00" 0" -L0K M#L@Pu0@ 4" 4"K0b Q-L@`p9IPP4 0 0ppp gp,2Y p1V0!Wp!0 X0`g g0000gS00pp@TVV@&82082 -RLPM`0PP00 0ppA<0 d@Pg 0㠑000K `(p80 W0 @P S  < 0eS0!jS'T @0 2DP@0  <  8@$ $  @ H PL  `D ) S`1k#` `S Z<"Q  0`0S  3/ ~80P8@ @<0pfUP (K -LM K, )P K -L(p`PPI 1 000$0800@WT 2PD 0+8@40 4000@0H00<P L00  W 1+# (0g 0pW -P?@8 -PLMP@0 0  7 R 0@0S@PcTUT00S@ p 4 4 #R8 <Y@`e8 U\<  ZY Z 0@P  0S PP@ f R  \<\R 4\ Q8<\  D bP  c , aR Y   0x000p0 3S 8 <0S0D 08  0b0SY0S00f00   0 }0 P`f`@B0ePZ@T 1PD 0<00+8@40 4000@0H00P L00=P; ` e}0`f`0 P0 000H00@8\@P(K&^ x-L` P@! PVT 0PD 0<00+8@40 4000@0H00P L00P{xxx 0-@QLPP P@00$00$/$0S0$0/ R0 / -L@Kh 0-@QLP$@T Q K0h0R$P 0S// 0-@L PP  |0 -@Lp$P`U @PV0$000@$@P`0$0/$// -@$LP (C A P<< Khb x-@L`400CS0P,0P$PPuP3PpU x x-`@LP {$00 S9 (0S :90040080 0 0'  0'00`0:0+>`P@@7x -@Lp`(P$@)TU  Kh 0-@0LP@@T $}zP@0 -@L P Khq  0-L@PP ( R ν@@00 0-LMPK@P rT@   R ᪽K0 p-L M`P$KP $@K00$ᔽ Kp 0-LMPK@P$0S@ @T@@T uK0 x-QL`@0P40P x80Pxx -@QLp` awPP3/Q P[yPP g6P< @X 0$(P0000Qᷯ4ắ8t@?&^ x-@PL T .P @@@@/`P@ 冱 |WxX/0PDP@T 8.x,0mxxx\dT7:] -LM` 0,K%PP0,K@PP&PP 04PP` p P0`S   @  B@ pW,00,0WK耓 -LM Q`p0K(KᒾP@(00$K(00 00  0(00 8/@Pp0 l00R@#*0p4 K@P 0( O040( 0媽$K@\^0@[@ -L4M p@<K0 L0 +%P}HK@KIPxH0 ,K(  ! @0 0 03/PP^<P0 堡a<K@P&|1 0RJ*0<K0L K0P PB(+p #P9  0}P6 `V+P0SP$ 0 S:@ L@R @ 00@@@@0L0 H @ @%LP O PP H@ 嶽0`00(K@\^@ -LM     _ K@[@ -LMP(K`pP.&(P  00 0W00S  ,0K8@P(,  i@V,0 #@(0T  B @@(n K 0 -LM p`,K PBKT0 $,0Q,0K#P<Kɚ; 008 0c80@0 R= 9W7$R4! 1Y b bR R%L   R  8T  '00S@(V $' `@h\W p| -LDM@00 T `pP 0000   4 4 V0 (Y  !80  8  l2QP0l2P30\0 X0\<0 P!0wX4v  00 00U0S ^TP] 00c`S0X 4;P YNULS4Q   ESS   <<o  B< P?eV0KL L000   PvdDH08PPp:L@#*0<00D  4 @ 0$04H 000g00  0  g 0 R0000C0Wz gL pP00( p(p8pXYLP 40Z00S z0pWdP(p p@  P@ 0SGpD WB:Z@h30P0 0P 0S8 W p!Wxl  d lPH d" 80   T0I;P(Ơ HH X6f8 !Td `0 3Y`0 0_dhjY00Z0S K0 4 R 00S2 0{c0 W p0 Y p{ g@04 Y p pWpP g 00S@W 0g0ó00 )J000   198XP! !Y;ö1 0Q0 D00 3/ 0 @T 0 @S, S:  S(!S>  BSA  S  BST Vt!S8  SK MT!S  BS/ BS  S< > S< 514K3040 1 00 (!$!~0@40崀 VK BT0 0, 4KK^@*@N KЫ ^^ -0LP n -L$MPT3`Up0@0  WB W? W< W: W@W6 W WBW W< W+  W  W2W0Wd Wm <KX8@T!d2UT<0AS1001r@K Xj@0S1ppqc@KzX[@QW1W W 0CW X P7H0;0D P1;1 ;0Q@0 @0050Q@0 @01/ <KVEX&CK14 3U 0 cL0 H *UPH L04$T @@ Z 0@0 0W@001*X*X 0S 0S  3/P *P\(K ^^  0-LM@P(K 0 (K9(K @(K#K0 x-PL`P@(P0 0PS0S  0 Zx SP x x-0LP Sx/@P 0S`T PD 0<00+8@40 4000@0H00P L0`  2m00x -L M@P 06$KhLT 0-D0@LPr0S S \0H0X0 1H0H0H000  X @,X 0\|\\ x-L@PPG`P H0S101 $0XS000x@^08 080@0<@0 8 P 0@0/08 0c80@0UTXST@@)]'^ 0-L@ITPXFT(&$0 K0h $R440044,4(0<0(0 @ 0(0</Q$0( , R$ B$4R$ B$< @0R( @00@0< 0(0$0// -LMX0R`A`0X0@Pp$;S,'X0 PP 0X0  $( 01ⴥKh! ! -@L䤥⢥Kh螥  P-L2:̀p@`Q`Uʀ0 !0`1 0 000, !|0 ,0id00 !1`Q 000 !@^W -0LMpQ`1hW 1<@0I@8 !?P 40pH 0WDpD0<0RH0K@^W -RLPp0  ( 0L#`X  0 R`@ D<b8 bR S<@P PPD 0<008@40B300@0 H0L0P 000 jV `0S `T0S@L@T@P` %'^ -RLp`@04q#  j(0T@(P``V`X PP`!T0S@L@T`0S`P`PU/0 {00 @T P1 72'^ -`RL@ 0#0P P 0@DP010 >00 0003/P V 101;Mx -L@LPTL0SP0T00tpL0[0 %0`0 1 V @ -L MPP`pP  U88 G @PA U8 UPD* 0<008@40B300@0PPH00ZT 00 IDP00  <  0$ $  8@@ PH L00 `00P@p(K'^\ p-LMP K@`P  gKp 0-LP@0T @80 x-X (P0X@@L,\  s70`T x -L -0LP -0LS 0@@Kh -LPX00X0X(p@@ ``0T V #X (0 X . x-P@QL ՠ 0`T tx 0-@PL0T K0ha0 -LMP00@p(K 0.P$(0!*!ɪ`P (%. ʬY0 $ 0 ( 0 0(  $K\ 00S/ -LM@ K0 TP00K -LM`P K@pP v   `mhK 0-LMP@KרP PSK0 -LMP@8 pkP (0S >&4K0KJ`P 500`0 HX P { !z !  $Rv QQ  5 $,j  pPf!tW $_ R `4 < P< 40(  Ġ T  @< upH< H W 440000410  娩 00#. ʫ140  80`ᥧ-pp#pp ᗧ@040 1 儩X P (KP]\@^ -LMp` KP@P7  !%@, >@P 0!00 S ! D$$R_ 0@1 P pP 0! !t@ @$@ ]@AK -X1L4M1@ a 0 0p@K8 K0H QPH>@0 <KP8040 P8 K0B@P)<08000 *PY@@T4K  b@P<0 I@4 E <0 ި @4 ب(K@^ -销L@p`T TP V 0S0S `I) V P S``P0@ -LtM`  \0 V  A R R(dPlPK RP  Pl lPK ! pD t K xp |p   Q p|| pWPP MT!P vp Tp ( pnd 0$ 00` K00|pl0KU  (K] -L Mp0`RW!4@P W   Q R P 00 4 Q tKZ004 @TPPpeWT @  0c (K ] -LM`@ KPp6P 0 00p00PᬥK 0-LM@KP !P啥K0 0-L MP@U 0S*  U(0K, KP#(K0U 0(K 00P,1  I  PP (I(K^K0 0-L(M 0@S  0KP -00 8K4 K⩥0P%(K40(K 080!++!8PP00S  S 1, PP,K P(KK0 -EL$M@`P@Xh18K1 q@0 qP@K80`04K 0f`P>40@K0K!*!80!*!`P/00 Ԑ0@0<K 8 (  0K`P<04 ( 00084`4V< @  겦@ 宦48@(K@^\ -LMp K`$@PP  !9@ P  0 2/@ T ᎤK -LMp K`PP@    4 2/P U lK -LMpP`P& C0 0   KP 0S@U P   dS  P T 00 K @@K'^ p-LMP` K0P# 0@ P T P;P ᥣKp p-L,M` @PP ,K PP,K 00 K0000P#00@0P ^T PP rKp -L@4M8K( $ 000 8  0 4 0  0 K<0KP #<0Q@<P -K p-L4MP@`8K P.043 0 (08 KS<0KH@0KP(0S80K8 @0$P8K< wPP @P U 8K 8K Kp] -LtMP lK P\K#FKeKd0T @P P2FKRd @<2PFK0d0 `xKȣP0 PLK S;#T0 t S@ 0Te 2LK 0 pP]t:40 P tp <0tKx Sp0K  L0KlP pp#PpWppB<0SL t0pP 7 LKp pP 0LK i0LK00 0 bpP"40@0S P\KS#&KKPT d0K0cST0 Pl K T %KRptP HWx0@tˢT(Kɚ;6e]ʚ; -L M@K.P #0J@P &K -L M@KP #04@P KS -`:0RLpP7tU@PD 0 8@40B300< @0PPH0L0P pP P0 V@ 0 R "R ÕP\ 0-LMP@K0P K0 0-LMP@K0P K0 -LMp  0$  $  Q R R(@l`K`l`K 0S`  M@P0l`K0 0 x0 0(K 1  D0 | t0 00R || \P0~ QQ 0SK 07@P] Rh0S 1P  K0$@PJp Up ~ p_ 0|0,A0  K4/0@P0 |0 S tT #T T00  Đ\   c@W 0| R @ >l0KV 8P gP c@(K]@{ -LMpP@,K( Kᯡ`P 0 G0 B 00(0,  0 @2 K -L0M0( $ 0K     0  ( K,  0 K p-L,MP@`8K VP3` 0 8 K0Kp -LLMp` TKP KS@P80 P S;#\0 L`K\0U# 2 X0 (PP0@`T  04 Pd /000 X0 (PP @TT0PDU(K]-/-/p@-@T$ 00!R R R  00 0 HP  P`00@P0` !pp -0L M`V# @!R @T` RP R R p B"!WZp0 40 8/400 (K -0LS ,'^a -@PL 480(S 08  @< KhNx 0-@PL P 0  (0 S(0   CK0h20 0-@PL P400C40#CK0h\0 0-@PL0T K0hz0 -L M6@Ps`0S 0S 3 ͗PU <08T80X H,03 PPU'  &* &j?XP |    hC A 0Q Z 0S^ 00S[ |2000 0Q  4Q 8Q C(QPU 2P Q @0 0b ! Პt%X000 000 ,X L <4X ( < 1PUQ (0S 00S 8 R4 S 00S 9 P0S000@000000*P( ^$PU000 '^x^@yW8U -p`L@PX 0SQ R U  PD 08@<40B30;@PP0HPLP P,Ko\\ - L - L 0-@LP 0\0  0 x-L0PL @`U 0 P;U Kxhx -@LP -p1!L`RP+@@ 00 1x0D0H@0L @  D0D0H0H0L0L0@00@01S S S ($00Pk)'^ -0LP!`@pP!0R R@  D D H H L0L0@00@0DB@^ -@LP 0 P PKh -@L- -@L0T&  !R R R R   RPQ   101A00Kh;(^ -L -LM@uP p``(K 0P (P;:;: Vp0pVO` $K -L M1pS S S# 0S `, 0@Q0c 000( ,00 c0@ 8k/0(00M X L5 K(^(^ 0-@LPP$P 00j,0 -@L0 !R R0S P M -LM@`0! SPu@0P%Pq0@01K fq`P[ 00 X00 Q a 嵐 CKvpP)pC?K( W LPeꡝap0p;K! 宀00 80!10;;0 C?K0K`pP 冝p#p\001p$0x0D01Y1H[@0L0@0Gf@00@0p p @0P0@0(K -@LPp`V Ndpp0S `V 62P }`d`0S q_0S0S 09,E KhKhMx -5L@ x-1L@SP S SQ<0S` 000 \ 0S 0S PP0&@PxrP xW (^ x-@LP`0 @ m?Kxh -LTM@P@0`%0@0pK?oPP `u T0D` @0 l` hP 厏< lKt`P ogXpo0S&`^!哪`PXPU!1R )`H 00 1`=`7'0P P` R $x0 $ Y$ $ x0@ P@  `P!0R R@ @00 $0S\& h@00@0(K x-0LPS` @T d@1 |0 $0S1 P[xx 0-LMH@HP  $@  0 0QP K0+(^9U1(^ -LMP0pU`@ 0 8P P500CS0 KPP,0S S' 0S@000 0S@000@00S S*P@0P D @  P*PK -LM`8 P@ APE%Qw 1<0 4 8p +000 0SX 8 QpWp (Y0S8 ugPF40 P W  9倜pGZ3epW:@ 0" 0 p0 4 D0 > 8 Ꮮ ě0  >4  B4 ™D00S8 <4<( ( pp>W0000  cX (KP/ 8U -L4M@SPp< ` (511D0 0S 5R0 SS0C#100 40 080 44_80H @0 00Y@@ QH P=#4 P (0S L= 4 .P% W 0  00SD2T P0 L *0044LP0T 040Z 8080 嵙X PM=X!0 @0<0408@4 00 0 0D@0P H0L0 X1S SL SH<1Q 8 }P 9-mk0S=' P"@0X 1@ἐ  0QP 1701 IGM   7< RS CP RL @ @m@T㼠  P@!R R  ( ,  b  , ( b  8 + (!M   T 9(K@^Р^WJ(^\>(^/ -L MP`E @ D T1?~ 'r03/P  , 0  0 `(0 000 C 0 ?>#20 0(000$00< 0,0F(04p 7/0 0 (04P 5/4P00 40 4 F$(Koi8*Q(^{(^1]\:]P]] x-P BL@0R-XU@XU,XUXU 0"S*$ 0"S (04P 5/(0`8P ;5/03 E  0"S EpZF^FbFx -(@` 0,`00(0PL4pm 8/(04e 9/`,00,0(04Y 8/  000000,0 00300 \ 000Y (04`@ 6/(0p4`8 6/, @  4 * (04`* 6/(0`4" 9/ ` 00  6    60 6 60  60@6 0 600000  <000` /G0000A- a P)S'!60 S#p@X L0x0L0  0 \Cyz W1  0L0(0L0  0 @^pP 0-L0M @| Q p Qd dQQS0 DK U0 DKD0 8 40 ,@ K0@^ 0! R!/ x-LP` @`x0 S   d 00-L0HS@@<0x p-L MPK`%@T P0P0垿 0S P@@ # P Kp x-PP`L@>6ᆿ傿00Kxh -LMP\@  4 K0s/G0@-80#ARD A2@_0@ P SR 0<0000 -LM80MCAT0<0!FD0@AB0!_Q `WV X 0 80 V`P0 80 Q`a @@ LX X@ T000T00C00S0 S   (K -LM#K@0 P@p8 > p@80T20s) #K5P4 00"bP 30#KEP 3@03303 T Yp303p#K*0@#KWpp  @0S #K*0#K80X剾l 0X   #KG5@P@#K@P tho9$Y 303303@ 030!0 00S400 # PR5!H  GY 3   PFhU5X,* p 0303};3@03@(K(^)^ -0L M#6@P  8 !C x!tdX00 C800 YP  * c AV &BN GRP0@ "D00 @P0  R0 x<P0Y80080  * 0.Z l ?X.T@ `@1@SH H0L 40L0@C⢽(KW )^,)^\X@P/ 0-`0LM\@TLP \   @A00@0 0X 0OK0R)^ - L-P  KhF -LM 04 V`p!ZFnK-$CPp` 0nKV!ZF "`0`p@P6!:&R`@4 00V#ZF.K T0"ƠCʌ1,? !Rp  <Z9K4K 0h0 |0Kd 00 0` KnKmK ` IԐ ̐Kp|Kp Z pVl 3p  `"KRR KP`-K3-K*0P-Kp `3# Z 0` 0 038!03000僼Z p0W0 00p K P K\ DUDUUUdUDUh3S30S9(0,#6,`T3P圼HH^h0d S  d 0叼(K[)^)^)^\ -L M&p$K0 K $0 00 0`?P ` @ T T tL$3S]30X$3 $0#K #K -L4M #K0 1#K#ARWD0P0H0 *2A40< 8 00#2AD @ H U^@ AT< L #KP03$KR0/#KQP` $K`QP400pV P X P0 T DX ATP0`p R RL@PcKR`p ?#K@PKP0 < PgD@PX ,v( X0hX0(Ko躻(K 0-LM0@sM sCPI([H0SL L L0H 垻PNPU 83 03卻00 0(0,#6 2xz 0 )s#AR@D <_,XK0hK0)^ -ALp @YM@^ H`V dB#AR@P/DQ0@00S  ^@@^࠱^  R0 P @A@<01S  S00S @P#T@ zP CT V =夺V  -sLLM P@I@ 00MD X  ԺT @P004 c@30<Cc sQ@ 0l#640  ؀! 0 0 0  0 R0"&*4 [ KD X=HN X4K $܃K ˅ 0T 0>00D0   @ 00S 0R/XĠ^< -Q044LM, 0KP K 0 -L`pP@T /) 0/@ 0$Ki3ꔈ\ -Lj0 0 Kh3ꔈ\P/Q  R0-LP@ 尴T 嬴K0h -0L@ 00Pp0U  S  I`P0 b Q50  U$`  p ` 000 -LM0`QP0 H@r@ T pp@p X00P 0T033 0 0a)P00K,  1Pp0     X ./T 7+ 0Dc00(Km*^ 0-PPL D@000   0R 00000 -LM0P`H0p@0 J( 0P 0,pP   $1P p x.p`h凳V *303*<ȳV 02  (Kx*^ -L M@0`PH0p(3 00Q  u,`P I*味3 $3 C03 0P `, |.`(00S i*3 3p03B*phkW (0,#63 3C030V2  (K*^ -(sLM0`P000S21X"\"  X"\"@T) 3S @P" 3 03000 Y  f 00l"00=1 S00@" 02'U 0 0 `(@P   >00060Pk - 3x0 0x0 ; 00 < 吲Y8 3 mX PT;0 0 p,{)ò0 R 廲53  00S X&\z)夲3C030 RY 嚲U 0DcyV   000L (K@^*^*^*^ -LCMp `@KP@p }  K K KPx-0Q >P`=0S  @  0 K 0N@:@ ` 0 @tKP a0V8 4 Q 7 @@4\K[ \   K K0  K( [R$ R KhP 00 0  000 , ;   Hp$XWPP u [R  L P!Pe%VUP! ` P b2, BR    K  P 0ȠW` c q  KD0`K0L0SIUG WX- 0" 0 ! 1 W !11/0SY 1S# 1 :1#RS( ~0Wa60 0Pe0P 0 @0Se   B _0pYH0q 1 0Xv0FXlK  8-P !8!\ Q/0X* 0Y& Q# 01 3(.   ~%1 [S0 0ÃP 0)00,K!@ r jQHK P #P8  0/ ]0 `3S 0Hp0[S000  0S  P` K '+0[h'S( 0S%00KK ,0KP#K  Sp P0 @u'彰3KKA030 0C0@0 0KK00 R 00 ƒ  $PU 0lK Z L 0K  B  0l0K a0Fs70Z4 3 3S  Q:001 ='8  $1 0000[P 0(0/0, K1 [@0R0 "!  Y K 31X" X"cHK1lK\" \" :3  00 0  b0KK L0000n`p 01/P #P,3 4 0/ $Cp PA KXppW` f0 Pb`~&娯03 W 0DcP K V V3 #3 03 2  &~m0[S09A  00 000  1 R9P3S 0H`0[S000  P3 3K03 0000@*KK 0.KH`00K 0Kp! P@0y@0  0 ,3 303  0KK W@@00K(K@^*^\^*^*^(\*^*^ -LMp$ K@` PP  K*P$0JT: T0%*S$0 U tԮy$e\傮$P$0@0S-  #P %U 弮$aK*^ x-@L`P  Kxh -QLpP`@T*Y00 P T  JT0  0!0XT0 0 010X` -PPLpN`h .@  . 0@^ 0X -.  LM. K.  . R0-LP@ 0D0DDK0h -L M@00K -D0ML0800  ; 90 K+^X 0 { 0 u 0 0 // -x0xpDPAD0L`U 202,D0D0K,@P2S Kh@^^0$0  @&0#0@ #@#0"l0@ "@ 1*@*H0@D?6!:PT0%SR 0%/^^ 0-l0LAP=0S ᄭ@0000ct00h0z @ 0@^ d\^+^ -LM0S* N;l0+KK %nnk/%#&/$5T,+. K+^? -L$MP8 UZ p0E0#U*X!WQSZE)QENPc@@N$~@pTH#`U= 40K00080 0P S q  T R) @N@ T `3J3 `#4i\!  @0 < <`Pl@040 00K0pP  V(K0X -@0L @R ,0" P  P ,XP -RLDM`pAvp1 01ZL`K00 !0 0`! P  0 0PH0D 01 0, 4!0 0`  P < 0 B/\1`P@:H0` `00`00!H`10S*,7* | 0w p 00xy 0 00pH0D'(K,X?\'5+^j+^+^@HQ4Q&^` -LM >pR'(~,0' p@P @0  ` P 0pp+V`PT  0 0 0 0*P (K+^(\+^+^ -X1LML1p`0PP0@c0cK凫1 5&#KT0,j 0p"P 3 030 00i`p$JP$2Z lX "\堫@P囫Y <K800X iX(Ko菫(K,X\,^ -霐L@M`pV*@PT#3UX d0K!U'PPJf '`Vd0K"``$K蔈\ .-P^PL`@P c   4Kh -L,M@P0P00 0p1^0 N&,' P 0K PG0`D18P 0Pp5A @0 00<0 0pgD0 80S) 0   0P@0S 0 0D0S 5(P h%#z #A@0<  &80j:C80 $0)0(K,X ,^\ -@NLM@00KP30`PpU' X3A3p0 p 0PX %x00 0 h #ZE # @0%j 0)000(K,,^,X\ x-.D0@N@ L`P 0x) Kxh9,X\ 0-D@LP P @@T#30,X -pL` V0@ 0SP ᜪP 0PUP0A3 0S R #A ##RS0SO!U $`FKh(^ 0-PPL D@000   0R 00000 0-L 0@ P4孩0S 0 -L`pPUA唩3S ۩@3S&3P03 L˩@B"T 0 0pῩ_n R0-L@P 宩U 媩T K0h0 -LpH KlM Pl \ `0 x W l0\ @p H0 D <0 0p <<Dx >P<psD04`d0 d  00b0 S00 500 $@<y<@ <0D t 080 00p0 $0h0 H0S  X X 6d p RH0; SQ 40t a:@PJ 0 P 3 Q3S40HKH$ ;&000@40HK HP y #Y4 /h@ר3S 40HK H3S&3038 @ 0S h 40R $@H屨0Q 40PK" nP LK @L  01/qPgHK #40 PKL b" LK 01/P #P3  / 0HKXY cP0 @_P03 Y 4D0DcP% HK Z ZP3 &P043  8MLP0 0D0 $00!00( 00,00000+ KM,^U8X -LMKp ` `P3@0K\0 0`0 0 P 0 0 0 0`v`3P`V` R 0000 0S  0+kP (K8X -L`P@0 P #6 R Q0b T0`T0006R B Q @b00S;0`*  R: S3# -L P0T0 -LPp`@T a3H0@0P 0 D c"&0$P 00S 3/000D00D   @0@ -tpL@`0S !S P0S m)000@^ 0-PL@!P 0S 00000 0- P@LḤ00mK0hN010/@^ -Lo s 0-p0pP@ ML 0@ @@@@X80@ @@@@  0K0^,^f,^ -LLM@p0H0 0040 0$$ L 80 0  0""P $& <0 T !$K<0P0000  000 000 g 80RM0XJ 000QFTC$<0Z?4H0Q;8L0Q7<P0Q3LT0Q/@\,Z  a$KQP"H RZ  R40 SP  R 2/   e 80l \ \ R00PX0 000QT$<0Z4H0Q8L0Q}<P0QyLT0Qu@QrZ Kl0"SRhlHQ ^a\ H^\Z!(H^ l \0 c40 Q  lb4 h Phl4 h Ph8  R h 2/h\    B    OH R\ D D H H H UX0eX  e ZG K W\UWpP@ K80V` 0<0 T $000 T 00H0(40L0@`80P0<0T0L0 %P D`HD H    p p R  Qp%p @  @W Z (K@-00 S0@Q*: S @T0@T!0 S @T Q:00000 @Q: Q:@0S00 0@ 0 -LM<0 P0`Q8 P@`*80 8L Q HQ0V00 3 -0 KP TV) 00000 T00 08 0PS:U0`8K 0p P V000 0S00 00000e00 0,K 0 00`0 0p P @T 0S:80pV Q*W \ Q5 : Q:W Q * Q*Q Qp!pQ : R R *V  R \@!* R:W{S*V eS8  S8 5`@8K 0pg P> 0S:8V0 08K00e80 0pS P0p J 0S$*V@@V00S  R:@ 0S*V00V0 08K0`0e80 @ 0Vp* P 0@ 0@ P V00 S 000 00V8K   0` e8 0 7p 0S00 080< 0(K -L$M`p0&$R@0 P ]PV p`0 00KP 0 <0圠 q   R \ Ს 20  4 i4 ᦡꤐ0T@04S*!W0 0QP 0P0 c 0  ` p!#(K^0X -LK0  P0L  c""00R#3// -H0L@S 00 $0Kh  -00L@ $0NH0S KhG -LMPpL@Q1R@1Qp1p!0 K80 0`PP  PW W*  C R   0`R  R % %80p0 tUP  RM*T T*  C 0 b@ <0 R W   j0  $  r 0H R t B R    B   V j0 匠0P  8MLL0 00!0,00 00 $( 0 K(V P :<0QRPRT/// -L,M`@p@0 :#:  IH  P0 P:L0Pq*T 0@1 0R 11 AD0@@0 0#K*CKUTW 0 S@PASA 0@@P64 0   0@P Z6 0 03/1@@T@.  )  0 D0'&RPU 0<46SH0 00 0@P 0  (K蔈\@^N/N/ -LM@ *< Dp(>0>0Z|#6@0  0P8 t0 KP& 080 _ R\* R":Z 1D 0 $`"HX 寒V 嫒D0T#:V X 00000 000S6P Q QD T*1JPX 0DaP 0!V00S 00"a 0} 1JP< D@ `8(K\ -L\M@@ @ \ Ap!@H \n(`` R0n#K` h*H  P |P  D 1L0 3/H0S D  @PH %H0 5PH H0 0<0 @0  XbP X 0$\R @0K0<0K080K0D0K 04K 0-^ -$QL M0`AS  4>0>044>0400T4n`nU` 0eS* ꠀp0S* P*|,4`dN@N@T *(K.PH ( 0|J(0L  K@X_-^@-^-^\ -L$M@0 x100 4 S< \ 4QL0 X:<81@ T01P $%00  0(Ko 0QPU` 2X:`2V80 8E≒pZ I@ @J8P00< @040 0P0 0P(K-^-^!.^@XA.^|.^.^.^p@-\0\@0S RbP : P*Qep0C0p@X -LMK p0 0P0  K8/ -BL$M0PPڄ0S bတ@pPX L> U8克20E 020< PQDP @0 8 P08 4K100 4p I0KG ^T!H !0H00SE Q Q8 4  Z    8*08 4   0 Z  8*0 8 0\40@D 000p1PUD@4TdU <孼(K<.^@^8 0 N :㟭< -LM`8 <0 P 告p2p@ p80 #&0 1S $t  lQ ?Rp xR _RP ,Rr (R! SkPUX X 00K0 0pPX Tx_0K 0~pP@ @!0U    Q  ҵ ĵ80I `(0<0#,00S0  p## V  #dYU #X # 8  05pPE(K@^<3/^@X4 - p`L pBB@ q$Ki - L`Xp@P hW  pB $KiO -3LMP0S  0R00>P  r0< 0 80 0 `めP2040 @T 8 RP 0P P@3@庉8 P)h40 #  R 40   @     R   @ 00000000000K <׉P(@ 5@8  P @P@$$u`Vk 0R@00  0`< 000 S[00(Ko<(K@^< -LM K a K3S/r -3L0C8#8S3 0  B  -L@Kh2 -3L@S0   3033S/3038^30388 -L  -8L 0 -#L@R/ PU  O3030S 3 B# 034 0003 G3:#033S 0Sb$Ki PU 0S P@ _P t3 aS030S0C0 08p(.030%T!P 1  0S1 A 0U  $  $ 00 "10!  R!``A04000 R(00ӵ0$KiB4<@^@X -2BrLM@4 @ 㸇| 㴇p2P0A.DXS  0l 02 $$R  Pb E @1h00 R@ 80 0   @T80P tAdT1 Y6 P0PbQ%&P0 `00V% P0  8 < @ D H L  P : P*   8 8` @|$. . $4. < 0( ,  0(K@^<@XU/^P8 -Lp`PUA0Ds 3  3 03 03P - 0LS0S 囇 -@LM0PS  0R d`0& 0K # p Q &(0KX0X 0-0LM@K@!@@@h0 KdP0  ⣆@@ @P0@000S 3/@TK00XLXX<\ -1L,MQ1p0`0UPsPHl1h   6 8 @ <0 H1U@,K 0! 8   0< [P@& U ⁆0S 00 00 0忆08 0  0D0 h D0  000PV @ 0`FZ00(K@^<XD/^/^ -LMfp)0P0@ 0&R ,00 rP(P 0K ! 0S P0^N P %K蔈\Xd0 000dV< -LMP0@ 8  p00 R Q` c&a`` 0@|߅U@ P ,(0@#6 @ Ze8V<`  100 R0@@ἅ庅00320<0 U! @ 0R3 03F U  303303 V 00 P ,(0#60 03@ @030100#  #! !# #V 0S<0S 弅00&0K1峅᱅ -V8$h妅ᤅ\UP@ ULX00X0U U .$10C$1(K -$0LM Kf K蔈\ - `pFf'z1 00Mp'L@ pPU0P 0W 0 ZXPZ$K x-|PL l0 P  P@L0,0S@<@P`(`Ҁ@ wDxxl 0-3L@P P  0 0  (0, #6 0P  30300 0-LMP寄|0!x00R l00S`\0@A@L0L   |0 0,0K0@^</^^lH -T0L  <R8 Kh\@0RMPPH -L 03/ 0-,@LP^0 PPK0h袄 x-`L@V (UQ e. U 40 ! !  0@ 000x -@LP-L @d, @Q0 0  KheHl x- `L@V0PPᦄP V3#03 B#x -5LM!5儕 |5 00 d8 X0HES 0S ڈ R (5(0 %0F000̓ P0S 0R 400 心P 布 0@ 0S00S 0  X1pxp 01App `@ f$D 0T0p 0@ SV ;P 0 0 sPP pWڼ΃ 0*{p# 101X!!  !!#H屃"  1/Y # P# ##! (,  1010 S 00 !|Xڀ,X0t0X0  @R DxX ,K P j Py | x p t #  #A  S xp P   (,! pW p ,0K p @0ᅕPş 065 0 |`B@EyPp  pyW Pp*@%004P0`S 00!$D G4yaP _yH巍P  Py!0 P K .34` VX X !WpP ,KᆗpK!WpP0 d0<0@0S0D0?င4;(0SpHp00Wc 1 ]0 1 ᢋ 1 V" dP X$B¢£ JZLŤ0 Z40 pj$ݾI ">KP0S !0S  0! P 1pp(0,gx0\000,1L  L P pPpxp8pp0P  0V !3WW' ExxH6P34x{Pyxp 0drxp ppH ( (K  ua1^0^7]1^!1^E1^j1^1^@ 1^X1^؍V1^\ -LF 㕡wPU) @T$ 0 4`LP# p ` )8 <0R<00<08 0H  BH V H8@ PT< x0,KoɡpwW 1^ @1^n6^ -TL MH0`pSI0 SQF 00w1PU3 @T.  )   P#000 Yp00 8 <0R<00<08 0800<00@800 00 0T 00T0w(8@ P RWw(K@ -ppLIwX@_`p`p"2=80 0P@T@@~wX x-D@L`P%w(0X  eX $0P$PKxhdw px-L`P P wx(@ 0a 0$0e 00T PeTPKxhFwx00 g 0-h@LM\0q 0\0 D0K6 UPP(vX00CX0!wK0 -LM APDpv`n`n`V(  @0l"QP Vv + Ό&. V(  @0P@ 0(K bm@P v(0`c0&f f/(0`f0&fC`v Kp@-D0S d0&0bQ*10a#fH @0@P0 &*!6UT`pp/R/>0 . 0&W -LM@ P`R 0p@ 40 0 N@ &  040 0 0p(KodWF5G -LMp@P 0'`P0 <# 0 0 0g`P/YJvEZ3 Y030 0 0]u 303 #P010#0 S#0`(K2^2^ -LM P0 `@p( `Ip \109S Q +  04 0 P40 `JTpLP0 R \JpP W   04 0 hP40 `0p(K -鈀@L| MP0 mudX0 0 00  0^uDC(Kou x-`L@PNuDKxhuH/H  /H   ;Ps//^AAA@AATAyG0@-CIJT1! P0\@P4@4@440L00L000 @^X( -L M@, 㶭$0B0 N?'KPV"2^ @-LPQ宻22^ 0(0(0 0 0(`0P R}ud// 0P-L P   -QLMp0 |  BQe00 Y` 00hV 1h #  RvVZq0 Ƽ=tQ0 @TV X  S 3R@H       K$  K ( K0 KKK KHKKLK K0 Mt K l s 0R R 00S0  6tg0f Hr@\PU @ $tU0Y # (K,0\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^P 0%h%#3/( L01! 0R000 R? 0P00/0 0-@LPPQ崹00_Ql孹X0_  0SP Lb@ S d b h0S P!0X(H2^a2^0X -L0P'3l%l 5l !p ( -3C#LLM  st rx+;h0PS00 ,K !   0 K1P`@@P3 D3 @ X00@0@#3q300 @@@ 0d䒟䢟 @tܤ W"'5"0`㔖&8 "28 WQ0P) 0PA@[TPŸH 0P#\0 @L0a1:l 2"0 !p̠0(0L0 ,0 0 @ @$@0p< 1 㠑00!1P' 0 0P @$@(P,0pHP1<00 0 0P @@$@(P,0pҼ1 00!p0 0 0P @$@(P,0p徼0l`0P @ `$@(P,0pw 0᪼(KHQ(V{2^0X2^P4^2^2^2^QXH 2^,V2^`VX2^2^2^ - L  [0P #0V(2^000P0@-P@DǑ  Q IUT\  t0( 0-@LqP0  :+r0 -pPL`qǗ0@S*!R Qt !!@0hrT U\PP0IR 40WT`PV(, E]^3^ x-`L`BB@ @@@@@d@|3 @0@$00 0 0PV0\0 {qT00T0Kxhqx|V -\@L`v9Hs9 0"8 00 , 000 00l0| 03^3^!Ce -RL`pX0p Se:l S80S zp0l@c!c@TS2q8@T @T 0   00Hjq8q X $1! 10R- L t@ 9S9#30000 0" 0#)$t0PSx  $x x0t U  pk#.qH*q 㢲@P  `000p(,@^< x-H`QLP 兲@P GUP0t``0x( -@L8`Kh8 -L@0 Kh蔲( 0-0@Ll805000  p00;0p0000  R :0  3010SQ0ST  0 Sڤ0 2   PP  9 03/Mp0P =U0 ""p 0S*08 8@ R0<0 00$ ?$00 000000@00 ? `0`900000j8 0S l0 CSl L 0 K0h0 (`0 x-,@LP`oJKxh-p, 0-@Lo   0,   C PU 0 0p5/00 pK0h8K0ho%3^ 0-DPL1S A 0R01 0@^ 0-L@$ZP 00@0P! !@A(0"K0hK0h@^( x-`QL@P roUPfQ 0S$00oKxhKxhox x-@LP`T P$0S@@T@@ӣ Kxh -L@PKh+P 9 ( Q 0 3/0p%o#o000T01h" h"!4boo0<0ZoKh,@^ x-`LPV 0SdoP 9S 9 (0R x@00$A@$@ 40@ S T * 0*+ 0+0 00&  nn0 =0n! o 01h" h"n0 =0VT00T0nT000OT @x,@^ x- L =@P X` P0U0e0 `0` 0叫0 0$0xx( x-8PL`@T p0RP@x( -LM@Kp ` P@1\`^0K\0 00 K0 0 0\ P0 0 00 0 0UPuP3PPU00 R0dS) 00pR lbQp lR paQl 坶PnD@l0PcP Tn녶(KX(, -LM@`KP PU$>$0$` `40 VG <2萠0"8 8f葟0P00 pm_P! Qn b!x R B!6 nX 0U 1 !0X  p Ὢ00 P,00m PfPl PUmP4  9P   405/'Pp pR:lR `@@ ^ AJa!Q# &Q 1R 1R < 4  <my0lmP(K63^@^(<^, 0-PLpXm @P 0P P:07GStt0xx~@m00 >0,(  -P0@Lp+   Q( 50l0U0l0 lmX ` ,5d5l0` CSl ^L0 U mV00 @^<,( -LP`p l(  0@P  0P p L*mKQP.  @P  0P /E'7 t\txA7@`Dp7`px8`0 0`p&d 018 1p00p `2 < Z 8U 0  ? " 0"400Z0pQ00 @% W\<0cQDV `XD@D@0@D0 X4 jQ m PE4*k$ 0$ᤀ0`P00pV < R 0S  p 㷬 `A00e0& ?&(KԠ^^hӂ 0-(@L$PjH 0 Lꀕ^f3^Xj -XL kj -,8ML0 P0 0D0  00!0(00,0000$ 0 Kn3^(V -R`LTMP002 0OS-Pp tKJ@ \@?'KD _CK?&KH `@?&KL _CK?%KP d@?%KT _BK?$KX ?$K븲ptK 0/ K -L0 M`$KP0!p,0 0AT 0S0S P Xj0S(00\0 Rj@ K耕hӂ -L 0PX  |!UpAi0001Pai P*jUi0000X`y1 pW X (  Y0  #i jp:P i000i000i 0pi000iii 00 0i!i@^ -L0W00,1RPAi0002`yi  CPiUni000 `XVW0800_i000i iUi i:P Li000iDi000i`@^ -tL Mp40 @`10 qP`*iZ@ Xp$i 00R5@T2 T0 i$  $ `i40S 04 0iS00SiQi"' ChFiDi9P@ 40S0 00 4i h(  ( +i)i(K耕@^ -LM`0P p V$$2$B 0R h ( 0(_i }h   y0P <0 1<0XhX080 h Y \ <  P80 RH HL ᐠYL P R PT ᔠT TP ` @  `,KD @ `! u ` p!R ! YY    R .R .R    Q   8hh(KԠ^ p-l1M@L@0X1@@L1 ` 0@1@Q@a0<10ᝨh 0刓 0傓0@0@0 `0aV@P 0 00s0 00l0 0t0e0 0tX0^l0l0 <0WKp~3^VVԠ^^ d\f3^X0 @00!@ $@(p,`4 K00KC(K3^3^X4^ 4^4^ x-@PL, 0S` P' Q 0S  0 ¢PU`Q 0LS  0 岢0 0000 b xX x-@LPT L`ve 04R00 0 eኢ00x x-@LPT @ U 00S x`v^e0S0  Q    8  Q  0 @e@x 0-(@PL8e00C0K0h}e -L MP0`S@0j 0q00 Q 0 S SRY Q SR 0@S  0  0 R1v40 d4000 0 R P 0 0R040 40%e] 4 40@           R 0 0 a`(KX -鐀Lp@PXh+ `0@000S0  0`00 000  X -L` P@900pQ 0S SR0S  0 0 0C0 00C 000 B  0pKhhX4^ x-L`P\@   \ R  Rx x0SP 0S5:// P/ -LIM` P 1@Q8 101 01 1 @T04@558U01 V( 11S C! /  C(0!BP (! Lpp"FKE/K0P.qD|84!RB /B a!  V B t Rr V d0p4W` 4y8P` Y4Xz 0SU 0U K BP 4<1 2pFKA/K @ 0 q p ;Br4Z@@ q )Z$   bD! DQuڸpD1WWQr Qd 0 00 `` 0000A0$`(,`4Ꭻ0 H`0 ``` ㍡X0L>@ <% (Ko^]4^EW4^Y4^@\\V7:] 0-(@PL``00C`0K0h5a x-`L@|`PU P dP\403/0@Sd d0h 0h``0@@ axX -@L|``0Sp00S S d Rhhh d00<03/\$@d0@@`X -hL``0@T 80S `0<0`0`803/$``00C`0d@Kh`X x-L`W$=#@PiTV <0V00P,x0 %<@xX -L MP~ACK؁R P @U$R P @U A`pUT cKTp`pYX aXp\ @PYX AX`(@@(P!KSR UT6cKVpYX T ,UT) KR YX" UT X` KT 0UT cKVpX  0UT ,(K4^ p-LM$0@KP `K0$` 0dP 0 S 0S(Kp' -L'X 0-L@P,P 48 Q8 0 8 4(P'0 -L@<S0 Kh} -AaWVL(aWV(0@TPA(0@PPq'@ @h'! 0!0,P00! R0!(0(0(@(X -LM$0@TD $`K0&,pKp  0@P9 ,DP3q>P 3 0S 0 1 p1p+x 0P T>0S 0S t+@/p h@ p00 000S000< 00 0p 0/Sp0 00C0S&h0 0d@ 90d R 0S0 d=0S3p0np0 h  0P 0v/+d0h0 0d0 hd@Td+@@@E  n @/TT@@\ l/\@  /^ ` ` R ))Q))  )  R  .P.Q* * hh Kd0K$@P h+000000h P*+d+0000@00* R$ x0 0 S*R0 0Ɨx0 Hx   AD; x 0 0:x 00/S dh *0pd0 00SZh0p d0 0h 90d0SX  ShP Pr**0h0 d* d *dd.p0S hP d dd Q *d*000d0 0p 000S :S;@it 岠 R 0CSh0S dP t*4*0h0 dn*0000@00Kp0d?:p 0 hP d0P*S*0h0 h0@0d00I@. 000 0Q0c 0wh0 0 <8 x A$0 S$ gd0402 0 ?8P * h"*d *@000T 0S 0 00000000 RK 0Fw ښ`0K L0 0$K` 0`LK\ 80 < H Bn0LK s9P   <y 60S A @ 嫚0t /|0 p @@Rt  {R@} /Z 0 S 0 S*0 S P %\t0/Z @ @ /Z0 S S*0 S ۽P\t /Z@@ 0/|0 E/Z0 S S*0 S, 㹽P5 0Sdt0/Z@ @4{/Z 0 S S*0 S 㚽P  \Dt0/Z @ @x/Z0 S S*0 SL |P1 3 \!t0/Z@@/Z 0 S S*0 S ZP g \t0/Z @ @{/Z 0 S S*0 SX <PD3  0St0/Z( @ @=30/0|0 /Z0 S S*0 S P %x \t0/Z@@9/Z0 S S *0 Sd P1/Z0 S S*0 S Pv 0!XKŞ \/Z@ /Z0 S S*0 S ǼPr^0 x!XK⥞  \l/Z@ @t0XK/Z0 S S *0 S 㣼PN8 0 XK⁞ \Ht/Z00XK0 0@t@ }Z {   T"* p0i@^l5^@5^Yd,]q5^]v5^]]$](]}5^$]]]%]5^5^x]5^5^|0S t d 80t P0 ? 'x00S0 x0 .R  .R0/Sx 00 00  (+ 0 /Rx 0 000C0> 00 SCF@000h'@@0?@00(K -LM(0 0 0$    0 0$K0T K -(0LM 0 00 0 0 0$ 0 0$K0> K p-L$M0@PP?\/PPV`(0P4P,P (P 4@ 00 $P ,0 , ,( 0< 40PU :U 0"0 0-H@PLUU@T 0R 0R U0 0-L@,RPL0 \垠$1U/U(-UP 5K0h$0 -$p@L`U8PP eUV00 00000\UV XU,P -PRL@p @T$`T000C00@UWU00 x-LP`?#@<T 0,x R  0|0@0|P0!U@x -@LPT0S x |0Rd |0 0|0x 00UKhS# -d`LPpTx@|0T|0 0|0x TT#TH0 W  7/PTx@x 0@x R|0 00xP|000T0%P x-@LPqTd`V x |0R|0 0|0x UdP 0x0 0|0 0@x@ @TV Kxhx -LMPp尐@`A%0KPW,@ (` @00S8 PP\, KzP %P %$@0PT$Khӂ^L"W -L MP$`P0 TT0 R VT TT@8@@ MTKT@yp40ppW40 @T8  8 S4 @ 4  R ث4  0 PP( 00!  PP 8  8 T4 A r4 @  4 TW T405 %4 P$$4 -S8  8 S`V d(Pc4PS xQ  S R T壚W 4S q DV )$@(Kă5^ -0L M000Y X  @`WV   X ,e =P 0O.000 0⇛ (K 6^46^ -0LM0P0`@pT" 0,08Z  P 0O.0tt 0XP 0 V0  Hdp@V ,] Y(K6^:]@6^d6^u6^ -@LJ Kh6^ -L@=0 !!0`|0x0t000, !  !<0  }P$$Kh6^@^N^o6^ -00LA 00SKh@^ -pSLM(@P\$ mP P6 P-83 SR,  "!啙2 0QP匙R P J1PP 廘(l嵘P2`P +`Pe @0SOP 3/P`00C`0M4r4KR`V @0S `00`0R@03/P;R`0U0C`0Vd`zRV+*R0S`d0oRV mxRPU pedPP^R\_(lLZ(ylP04 R P U (llP,@ 0"$OP`40,9400`  ` P ,@",2P@, 080 080"080PjQK6^0u6^27^]7^7^7^u{]X7^7^%8^=]]=8^S8^a8^^ 0Ἔ00  -L@P㕃`P$ 0@,0@0@ 0 $fQ (bQ  Pp\QYP{Q" @P BQ -L`pgQ0@T  㓶PP d@QP`0p0`0Q`P 040 ⨚/0O0PX  0E` PX -L\M` p| P 0@P (0S ! 0  k@P  3 l`040P 040PM840tK:PT0@0 t0D l h0 < lKtYXPU !0S !! 0^P X! 0b80ܒ080P00000@@P40AWP@X!Yy0SZ pKjPXTrP2PH2 R: `0S58Z2 Q P x "z R Qp!p   Rp!p  xuz Y !X !\P PZ,!,0S p`!p 1, p(!P :HP  0 | 00P'P 0R00 80080gPP L&PP\P  (K8^@{{8^0 c 0 军0   ៛ 0-LM0@SPPP0K!ZPPPP@@t K0 -LM0@` 0 OP.0S S)0AkpP" Lm 0QP  0KP ,PJ 0kPPP @ UV 0 0PK @0S#/ 0-PLM@O00$0003, S033#0: 0 S0D00OK0KP 000 303 x-<@PL`LO00000PPKxhO -LM0  $K$0  K -LM0  $K$0   K -LM0  $K$0   K -LM0  $K$0   K -LM0  $K$0   K -LM0  $K$0  K -LM0  $K$0  K -LM0  $K$0  K -LM0  $K$0   K -LM0 0  0 0$K$  0  K -LM 0  $K$0   K -LM 0  $K$0  K -LM 0  $K$0  y K -LM 0  $K$0 n K -LM(0K0p0@pP 0P00 (` L0ᜀ0L00 0N` $K8 -LΤ KhY -p1MLp`@P\N@ 0/PFW. @@  .P& ; 0| @P t.PU@T(  0|PP0 W 0|300rN,\!NP Pu 4cN$w @ZN(K ,  -LMPd0@< 7,a,!p`0pM 0 00 0E/P4MpW )R|`   0P7p` z tN )R|p`V   0P$M(K, 0@-@PQP000@0@-@PQP000@ 0-P@LP00CS 00!Ñ"0|0S0|  0@0000 0- |0L@SP S|0| 0S H0  R;H0Z0000K0h!Ce x-!|0LPS@ S|0| 00`S%H0 " R;H0/H0` 0S S d0NPT0P0d0S 40@0|0S0|  P`x!CeRRR 0-LM@0 0}Mp3K0 -pLM`p0KV6@#:@:@P  0`MP0,0}`(K -L,M0P`SIQFJL1p@L0K0P0 T VPP, LKWLK LKP  0LK-0K Xp*`0l0`0L LK%EHL` Z B` `Pg pd@LP (KX -QLMPp-d0S`R|1 0<00U` L\LH1@TE K.P>Kd P - Y o Pe7뺔P , KyK DPK DP R 랔 `E K@Pe[L댔P(K - L@ 0 !""0&%$#p`P@x|(( 0-LMH0L P@ P0tK` ? gU ! #Q001|0Rx|  h X  \  t  d  $ t K0S ,K0d\x] ]8^,J] -`ML00@PYPK 0 P,,pKPU 0|  ᒒ300K0S VfjP P`KVeKT0S PKU mK,=9^Y9^ -L MpP`@U I  0p@ 0(Ko 0-LPD(K@0@T Pd@`00`0eK0XH0 P0-L@P%  pM0x000H00*%+&)%*& ; 7+3KO +-0|00 -L,M@pP` 80 :We U 1810SN ؁ 同?, K00" 03P D < @0 [t@00 0< 0t10D tZ  㝌 H0< $1H<P1! @0 D  ㈌@0DZ /j 40K9/P(40 4  40K9/P4 +b^V 8 X0H@RKDD 40K+bG(KX]A]A0/00/d\ -LZP+ 0@PSK@PNP1 0S @P  @:00 00 0 1 11 , CK m@P)0SC?K(@ &0P@K'00 80 1P0;;0 C?K0Kn&@P4 (K@^:^ -LLMX0 P5P  ` pP K`J@PP P1W)A8P0d0p$LK P U4Q LK BLKPf0LKL0KpP LKDLKpP@P0`0 0 s3R X 0S00 oSp000H SP%@#*wP %=@PP? 0S 5Pd`0P 0d C @PdL0 eP  d E40X M85400340@ M840Ed  kTY  =@ 0  P0dL04 \ 20S 80 -@ `P 0 @P P  ?E40M(M8040040800804 " 2  0040X 0PU@ X p@8 40 8 040T\04040MA40S ᳜@S LE  T4\ dV. @  0P&  7404V@  0P  &40040 00`P PK X0@@`0S PP ` U v@(KT\\]]}:^:^ -LM0  K -LTMphKP;h0 8 `0 < d f4 dK`P hPPhd@,~5%`` 0 `P  "40 L0 7P  K -LMpFD0@T  KP l`9D4P @040!@40@040vD K @nDK -L -3L\MPt K]Pt0d`0 SiW@iW|iWiW jWPjWxjWjWjWjWkWtkWkWlW, dKPdK@PdK,  dK0d K@PdK $ dK0d K@PdK$ }( dK0pK ?;@PpKd K@PdK( hpK /;@PdK( );@P|pKd KtdK ;@PqdKjdK@ PdK?dK@ ;@P^dKWpdK@ P:@PRdK 0000BpdK@ P:@P=dKp K@P7pK ;@P1dK PdK@ :@P'dK@P"dK@ ;p @P+:@P @ /@@t KT\ -LM@ ,K:P,KK -L$M !pS@8H !PP[0SH`!@PUN P 弄?,PK00% 03` 8 <0 l<0, 0 08P lU  ˄)00<0 P<0   P 00/S Sd 0SP < + 㣄40o80(Ko5^ p-`\0LMP@ KP 00 0 d0q@ +KpT\ x-`PLHut@ 0`P ;`gtx p-LM@ KP`P  0 0 d 0!09P{Kp@^ x-`PLH=t@ 0`P :`/tx -L$M P@80 < tp(B1@`@ V1 0KP*UT"*80 D D0P D0  0X  X >`  0@P1 0   -@  P B(K@^ -LM x K p-LM@  `P0P$ KP K$@$CT @  Kp -LM@0KPK 6K -LMP  @p`0P$ KP K$P$ U 00 0 d0@ K p-L M`@Po 0P00`P h6` oKp -LMP  p0kPB/K@P'PP 00 1`A 1 ` AK @PwX0,K8010:#:0 $K: S  S  S0  S0)  S0  0 0 00 $K` 00 s 3QS$K`pSR'R' Q )Q Q1A?K( 0K A?K(` ~@P  A?K( 0K @P @@A?K(P X  >$K 0-LM@@ 0 cEK0 0-LMA@ 8K00c 10 c:8 p-LLM`0  1 1 d0KP;`K/@P!000 `0P\@ X0 4P \K, @PH0S@d0S Dd0d R@ \0K( @`dc @\0K(D>DH0PW HP Q KpT\\\ -LM0c 0 K -LM0  K0c 0 c00 0-LHMXKP90P,P (0 X0T P0 N$ TK@P X(@0S(0T0K(<<@0P 4 @P XhT0K(@ <vPP << XWK0 c0&0# 0c  -LMp@ q `P 1 (0S)0S& 0S S S@ @ x K  Z JK@P@ P0@@ (K -LMp0 `P! 0 (0S0S A@0BK0 @P,0K l@  $K -LM 0Kc譜 K -LMp `P! 0 (0S0S A@0BK0 o@P,0K 4@  $K -LM 0Kc艝 K -LLM`0@pC hKPTPP;h08P < `0 d 44  P dK4P e@P hVhPpRV`@@@ #`P ` @O K - ML0 c K -LM  K 0-LHM@XKPEPX0P, P0 (P T TK$ @P@I@@ XK0 -LM0 c K 0-LM@PKPc @0P W3K0 0-LM@PKPc 0P D3K0 0-LM 0PKP @00@P /3K0 p-LLM@`KPPT000 `04 \ X0 i, \K`P `  H@HY `Kp -LM0c K -LM0  K 0-L0LMP@ KP @) K0T\ p-L M`@ K P  0 P`Y Kp 0-L0LMP@ KmP @ K0\\ 0-LMP0@ D0D00K P @ K0\\T\ - ML0 c K 0-LMP@KT P0 P K0 -LM  K 0-L0LMP@ K P @X K0\\ 0-LMP0@ H0H0 0KwP 0 ~@: K0\\T\ -LM 0c  K 0-T0LMP@ KP 000U@ K0T\ 0-LMP@K P 00=P K0 -LM    K 0-LMP@K P 0000P] K0 0-P0LMP@ KqP0@ K0\\ 0-T0LMP@ KXP 000@ K0\\ -LM@S11\p `@K KP 0S  X0P \KP0s0sKP0s0S` 0KP`8r K!P  K%KPQP̀T0XK0 sK0 s |KXK\KU,0K!0,0 PCV " $KT\\\ 0-LMP@K0P 0 c   hPK0 -LM0   @ S K -LM0000c 0 0B K -LHMp`P 0S DK /PDK<0 !R@0/FK\0 ,0 !RA0/EKL0 dK00 0$K -LM 0  @0 K 0-LMP@Kg P 0 000PK0 -LM 0  0 K p-LMP R`#0 KPt} 0S@ @P!@PK )KK!@KpT\ p-LMP R$KP0 ` @hG 0S` x `P Kv )K0K `5Kp p-LMP KP 0L@ 0 0 '`}Kp -LM0KP.0  0 @& 00" 0 A@0 `@PT0`pH @`00 @ @A(K p-LM@ K~P 0 - PH 0 0 `Kp - ML0  c 0+ K - ML   K -0ML c 0 K -LMc 0 Kc0 cc+0 -LM`@$KpPP$  ` KDP P 0*<` 0Q `o 00K - 1L`8@p P `100:1r` p-LM@Pp K a`V0 P0`PKp -D0L M@ KP@KT\ -LM@aJ 1 R0R00 0KP00  @ L 0S@  ` 0H@  #@(K -LM@a$J 1 R0R(KTP(0  @ P 0S@  ` 0(@ $K x-PL@ͽ`P g80`080Kxhgx x-L@PT P `P8P@x 0-@PLp50S `@00DP0S  R R00@(P Q PQ// -aLp$i@PU P@ P 8  RYPTCX? $i@T> 0S2 @@T 0S0$10i$iPu5T g@!5  |0100@S 0 \0C0\5$ii$tip4@@^$ -(@00LRKh85 -X@LT$)i( 4 4( ~00@W0;^7;^ 0-LP@PfP @ @@80 0800 0 -`PLP/ 800- : 0@S0 0"~`p#P 0 0P~X0 L4P4@0 0P400 0-PPL 80  0@S0C 00~00S 0K0h~~$V40 0` K0h40( 0P-L80 P 0S 0Ps -L MpP`X1 @'4`8~0@T  R  R 00 P00 @d@D@P `Li<Q4X X MV(K(0/ Q-@LT 4P 3<3@P '4%4#8ă -L4 Kh4ă8 -80LPp `e@P p  00S 0@ @` -80LP`p @ @T 0S 0S @0S   eT -0LP [P;00Sd`c4`V 800;0F0@S00}0S }N30S @p00300} `V 0  3/pP`0p;00S0C0~}0S }4#300,-i30}( 0-P@LT  DP @000P R3d// -LMPX2@UPPUq 0S3p3H0`* H  aH0;^0\<8 x-L@P,`H0 mx 0-`0LP 0AT 0R 0R P @0H0  4R0 4R00/ -p1@ML 00@@ @@@zr814Q0W,1 <80@10@00@00A10 @0 @@@Xr 10 0B]뜀p  1  p0 @```fP0\ @ 40 KQ;^̨^<Y;^Ԡ^b;^i;^ d\WPW -0LP ds@ ㅿ 0㿢,U 009dPH0|P@1t0@b p`@bV D1 [000 00$#耖(\6^Ԡ^ 0-H0L@  PPZ@X1@2@0C@21㗢,[0 K0h@s -$3LMh 0@pRH0  !PPN0S X0S "H0'| K2"b1 SU H0,6H0x"SZ1d 1S1Pp1W 000l01 "p0@l012 0BS261 P U H06H0,>&1^UH06H01Ke0[S P00K00[SPH0  ,aȤ$ŤH0\ 0-L@GPP.0SH0 )PU .5 H06H0w%00 -L@ P [.H0 H06H0YKh -LM`D.H0 .p0GS@.0 `KAz.` 0.P K -L,M@0 H @ 08 0H `8KD <0 4 0 r .8K @P⬂ @TM."0 0tl?.@P o80K @P0 4 0 9@-8K 0P  0 10 0 Q0L0 .L0S  P oPY H0< K6H00 (pD H07/pP -0  1S0 1 R0 - P oP, -80  L00L0y}-<0|@ 0-v-H0,6H0-@0@  g--PQ P@0@(K^;^ -LM@< <K8 40 '00K,0 00@ @(0  ` o0000P0,0 0(005-0KpP z-  #o 0 1<K00`0Qp<0080 0400_- K -LM@4 4Kp0 ,0 0`(K$0 0(@ P 0 @,(Kp(  $   4K0 @`1S01 R0 &-  nK p-LM( (K $ pP`,(K0 @`1S01 R0 ,  nKp -LP T00CST0  0, Kh;^H\ -H0L@  7H -`L MP@@z,@2S^P +@,0 00KWh,00p0P U `V 0 0100100aP, X(KԠ^ -LM`Pp @ 0 K 0-|0LQ0S0S #  0@SR ,@, ]],00@^@{ H / x-L@` 0S\0PP0S 0S P P Kxh xx -H0L@ +H0  0a(ߟH0uI0p03Y0SP 0 H0 PUPPL0P U tEL0U0L0 *H0;H0*9 0P@p(K@^Z& 0-@LP P 0 -LM`pP @ BR`0"L0<Z !Qx K D @ T0 0c0H8! R0E$!Q @T =0 0 7 Q  R0K0 ? 00(00S P0 p 0PTP)p01 110 @ `<*T Kf@zfzfat @{@^ -`p,0Q0L 0d0S 40 t@@  P}@P 0  0@  U 0Pc  0 V  -, 0p0`S L`9@ 0@  @0P 0@c  0 '  -P2LM1@"82`p0S , 2\0,0  ( 0L0 (P0D0,0P o l@P^U0- SK(PK'T00 40 040 0KȀ @TDP{ 0P0T0| 20S0 00S.      @P$K@PK JK@P @P (X00X0%) ^@-@O@(K@^  x-L@P` (X00CX0)$s Px0  -L,MP`@တpVST0KL0 0H0 $K 0T P S< 8` LK=0 1D040 LK KPVLK 0 <0R0S PY$ (K -LDM p@\ SP1X#TK\00Sa0YH0 080 1T PP D0L 40 LK~=\\-P`10 0E`9 K;^ -LK00$ 00P$0U0-UV0K0X\ -LFMp@`GK 0\PP|0I/K)PPGK 0G/K>K00$ 00P$m0U0-UV0K0`\ -LFMp@`GK 0\PPIK"PP$1GKPr 0G/K>K00 00gP0U0-UV0K0 p-LGM`@PGK 0\P\0.KPGKC 0PHG/K0 @ -TVKpX\ p-LGM`@PGK 0u\P\0.KPGK 0PHG/K0 e@ -TVKp`\ -LFM`@PGK 0M\PKP 1GKp 0PHG/K0=PI-UVK -0L Mp@0 KZP*P@,0K00 0`PU,0PT,0p0@c(0K0 0zP P`( (0, 000-VV$KX\ -0L Mp@0 KP*P@,0K00 0P`PU,0PT,0p0@c(0K0 0>P P`( (0, 000J-VV$K`\ -L,M`8K P.80P@40K0  0@ pP@U40PT40 @c00K0 0P Pp0 004 00-WV(K 0-LBMP@ EK0r[PP0F/KP EKE/K0@-TVK0X\ 0-LBMP@ EK0N[PP0F/K{P EKE/K0@-TVK0`\ p-LCMP@ GK0*[PKP 1GK`0G/KeP)-UVKpk? k7 -PpL`@&.+Dt~̀:00 P 0V`00`00 00<` @0܅A// -LM0`h00~pN@L0Pd0p~ 0p$&x0vP0PdP0S H0( KD0Zϝ ( 0 0ޠ$K<^8^\ x-0L@hh00n^`P``en`g40徠,0 0_vL0000L0x<^\8^ -(0LM0 h0  0K3/ Kx\ -,0LM0 h0   0K3/ K\ -LM(0 h0   0 K3/ K\ -LM(0 h0   0 K3/ K\ -,0LM0 h0   0K3/ K\ -,0LM0 h0   0K3/ K\ -,0LM0 h0   0K3/ K \ -,0LM0 h0   0K3/ K<\ -,0LM0 h0   $0K3/ KX\ -LM(0 h0   (0 K3/ Kt\ -LM(0 h0   ,0 K3/ K\ -LM(!K !Kh0 $ 00$K3/ K\ -LM(!K !Kh0 $ 40$K3/ K\ -LM0 0( 0 h0$   80$K3/ K\ -LM0 0( 0 h0$   <0$K3/ K\ -(0LM0 h0  @0K3/ K\ -(0LM0 h0  D0K3/ K8\ -(0LM0 h0  H0K3/ KT\ -,0LM0 h0   L0K3/ Kp\ -<0L M,0 !K !Kh0( $ P0,K3/ K\ -L M"K !K 0 ( 0 h0, ,KT03/ K\ -,0LM0 h0   X0K3/ K\ -,0LM0 h0   \0K3/ K\ -L M0 00$ 0 0(  0 h0 (K`03/ K\ -LM(0 h0   d0 K3/ K\ -,0LM0 h0   h0K3/ K4\ -LM0 0( 0 h0$   l0$K3/ KP\ -L M0 00$ 0 0(  0 h0 (Kp03/ Kl\ -,0LM0 h0   t0K3/ K\ -(0LM0 h0  x0K3/ K\ -(0LM0 h0  |0K3/ K\ -$0LM0 h0 K03/ K\ -(0LM0 h0  0K3/ K\ -$0LM0 h0 K03/ K\ -L M"K00( 0 0, 0 00 h0,K03/ K0\ -(0LM0 h0  0K3/ KL\ -$0LM0 h0 K03/ Kh\ -$0LM0 h0 K03/ K\ -,0LM0 h0   0K3/ K\ -LM0 0( 0 h0$   0$K3/ K\ -,0LM0 h0   0K3/ K\ -L(M"K0H0 $0 04 0 00 00 00 00 h04K03/ K\ -L M"K !K 0 ( 0 h0, ,K03/ K\ -,0LM0 h0   0K3/ K,\ -L M0 00$ 0 0(  0 h0 (K03/ KH\ -L M0 00$ 0 0(  0 h0 (K03/ Kd\ -(0LM0 h0  0K3/ K\ -LM(0 h0   0 K3/ K\ -LM0 0( 0 h0$   0$K3/ K\ - L@R0 R8 RN ! !\  a0^]>^>^>^D>^ ^0  /D/$ R/cP// -LMp0`PS ) ( K$@P#(d@ 0010!Q00D0  H0(00  9P1( Q:$0ᅥ 0 7   9 8< 1#( !Q b 0$p`\-z$Ki$00$Ki9p^ -P@`L( ": :#6!U% p00R0 S$000S  C $ 0R00? $@?PCD 0$,@  00"P505Kh3p^ x-L@dPKxh$ -f/@`L^!<(0p?0pP,P@ 0 q>?פ08PS^P4 P000 ] ]q> P@SR0<0< ( ><404$0X00008(0 007 ?^]WEV p-L MP@ -0  40S 4  2`|27#: :  0 L<P" 40S }4  a2`^27#: :  0 h .< P XKph`40S Z4  rX0 KphKpX}] x-@L124P`d0dV ``]UH]D@U4 4!],@T Kxh]\?^?^:],]H^,] -LM.2T@Uy 000SOXX0XX XX`X`q `q 0S 1 `qq`50 3/dq`0X00 0077S4]0]V 7S071!0Kh{t<@7S`000S$0  R0 a&778 r< l0R}50504KhK@^?^?^@^?^&]?^]^X@^X -drL MP0@S :: #4 !}#`Pw ( `Qt0$_@PT0h ߬ ?#K0 əቑK 0RU0@PY 50` 3/404 0M< #K@'P0R<ֱ0<Ʊ@<0<(0 0젆0503/P P P]QLXXXXX|\ t\d] H\ 0(KYp^V@^@^/@^u@^@^@^@^@^] x-5L@0P3/P` P< P840S6( 6[@00;000000e664  0 q> !< 0?0S`$0\0`0(07@D00,0̢,0P0  08]`x?^ @^@^ -LM@`0p`s *0#505 0@4 4% e^`_ P @^S0KP  R  ^B R \0 0(QDQ  KaP@X00 R ? `x"K5l K^f5\S00 ]H20 7<7420 7@077  ]2 @8PP]>0P10H@q>@1 =087@ ]1=0 ]1!010 ?q 7Ǘ 4;K!wA7@ 414!0 q>?ṡ1100000<0q> ! K 0\^/@ 5y500 / :8~c| x0Ph] KX]A^|]<\$A^DA^OA^jwA^A^A^ ]Y*XP,X-] - :`:L#f!y!@Pc t/Pa q> ] Ytp0Qx0S U`KP0S P0S7 503/`P=0 , aP ]"707U 0(U20S  X  XH0 UHPL0 ULPH L00P0``P0S503/p^A^ -LM@/KPP0 K0 C(r 0(0 K0 00  00K -LMp/KP@P60K0 C(r1 / 00S+( K(02K0oK2 000  K 5K03/P d] 0  0R 'K< 婇4'.K\@-@K0uA^\A^ p-LMd@P0S00 8 S ( Kޡ0K0 ; S000K0K@0Y0K0K0ZX0 5%XXK03/P p\8[ 0[S [  ([0R pK0 T(p K\KpA^\ B^ -LT.5@03/P 503/ -L=.@707503/ * *-P"VL!p 0t`Y@Q{ W  WH0 UHPL0 ULPH L00SP0p^ : -:@#FpL MP!P%i0aP0@F 0" R`( b`$@ :CP T@ :P Kp^ 0-LP-5@03/P  0 0S%0 -LMQp@P 00@P D$40$80$<0E4H@0`P( K֠00K09K9K@00K0K0L` 0 9[@  09K5K03/P [DD9[ 0[S [  )[0R xK$ Gx K[ K0u%B^\CB^ - :L:#ƌM!0 .503)00 7! ` 0 0` p̙D KTቑ4\;pd`Vf X  ? 0 bP0` (Kp^Z -L @$0 R @@0P 0-L@0PS   0 ᎡK0h 0-LP$0@T 0U@0P -L,MP@PpXwLK( $p1W eX0l a0(ቨQcP^!R[ 0[ [K[8 /K3[LK:3K3[03K0@0K04  ,?$K04K04K@0>0K=0K8040 ,000 503/P010'3[= 3[01B0[ 13[ 0110 @0[?[B [04[ 0L0 !0 #4?0000$00 KWB^B^ -@ :`: #&L6,M#8@ (<0 8 7pP4p   0D x3pD6V .6V 6Vu 0CV6Vo 6VQ t6V h6VD 0V@6V 0V|<}6V0CVO*6V5 5V= 5VN g50S@b5V/ 5V Z5V 5V SU ,@\0X  X Gf/QBf?P`4 f/F8S}E/?px80)001 200$$ 40S fPp4 \ E/"@t707 06pP 40S X4  p$4D$VV< 0$0  6#:: 0$46p7074P'7P00  7P 0707fP`4  8S4KE/ƞp"0  Q`0PSC @  Sp *0S  <0% 0000 1D0000000 P00-0 06000602@00p03Y0Sp  p z 0 080,0 0# 1P0pEE *f\>; {*\p]4  o]/, W^'}`$ JY$p 0S00K $pPd@`0$000xr$ (Kp^wdrdAd@}d(@edAmdedAudgd{dЀhd~d(~|dndQydgdX@0X0 X -L M@, ( p\P`` 5 0 pတ ,$ X030 F^F^\ -R/- B-- BR-.#+#/ x-=L@SP`" sPU =S 4 =PSxx蠆 -LMP! @` P(pp(0KP [Q- [\ d 0GI0AS4 ;I  0 KF^G^ -L M@0K@#PPK p-L MP@=S  09 00009S@=00 K0P $=[S Q Q  Q `9SxXyXyXxXyXyXxXyXyX   KpD -L4M0@pPhhQ񟗇\yXyXyXyXyXt7S 8]`7<`7@=0@=vxy@=X K0@=0{XK XK Z K0n5[!6 Q"/%[pF01001t7GS( 0Z ܍10?0?`70?P K"09P0[ S 00P0K č09 㻍t7S 0 mup 0\t7S0X sh B= 3/(KBGG^A^DsX p-ML M@`PBK|#Pp3K00C0S$4  S;$4 H3 K<3Q< '0CQ@  Q  QJ g 3Q 0Q `2Q >0CQ= "Q0 T?;A0CSOT`:AK @  K$4SS$d =S @=@p2]S @= 9X2\=S @= 1<2N=S @=) 2LS @= "2?9S\ >S$m1$4SgL  S*CLєL 0$4 A>K 0C >=S A.K B0B+PL:d1Q #0CQ 0Q +1Q 0Q(1 #>1 1K 1 0K 0$4 `-$0Q!:$4 0?K00A>K 0C 0$$D0K /  ("(  BK Kp- ^ N \ V R *T Z 0 !<0 `4000,000 !/@^ -LόMpPp (0K`@KK PU0 oP 0P K! -L 0KM c 0 K -@L`0pP=3/`7 5`7"W )90")Kh@ p-L M$=PS00CS@x 0@ӕSd @0.@ӕX0 `R 3 880D0 @KphKp\X _G^\ -LtM@P=S =S@h`Kτ< 唋͔>0| hK ˄(0 p =S |>S3;3i9S iV 0S990090C9hK.0 p02K p 0P9SKP p`P V@ P e`V 0S000000C0P & 0hK& .0>(P 4003/pP 2 0  `Pk' 0' P 3003/05K9S.05K0@  P5[05K8 ' 0W'f (0̇t0 L29S @= L2x # G  t0  D9S X0=00Sx< P 0p1 0:0! "$ 01 0 0#4 0d20$p0t0| |>pi(KzG^\ - =L@S 3/` ]U'& _pP `V|DP0-4=8R2 d X0K `-0CⲈB.K B+P3U@=3U@= p3U@=\3U@= =S"3$K4#0S5 # BS6  S)  BS2$K 2"S  S V BS2$K 2B.K B0Px2$K 2d2$K |2 L2$K h282$K X2$2$K >2$ K0S0: B. S `Vij=S| 1:S0/ӥ[Rp 9Sm $=S S S! 1$K)  0 B>K0C CX0 H1 $K @B>K0C C0{P/0>03AR2' 9S##BK`@ 0P  `9S9  09'-R  B.K BMP $K%F-*V \ R T ^ Z X  -L Mp`P @@T 0S # 40 0 -0 T?40P  1@0@ T0(KG^ -@L`=S? 3p 3/=S_ ]U0-4=8RX2 d 0 ?989? ? $=S? $ $-R9 :S u닎> n: P$("(a :C(!= 㭆0 0\'9  )D% E> 0@(5$ ;@=  5  3@= 4 +@=  4 #@= 4 4:S0/ӥ9.`= 9S $=S>l \ $=S".DB 0 S 0AQ\ѕ  3 9S 3   9 : 3 0======$=S\3 V 0|>>0. %03= ℝ  P  @ p0-4=8R0 ` (02 3;@03099  S RSR0-4=8RX2 d 0S 0CS>02 =' 0'K0h>S 0CS>$=S( >S02K0h製0Q] -LM@p`$P D#P$2V 0CV?*2V_ 2V _1V. 1V> W1V& 0VQ # PPZ#= SQ 9S    @ISPEA.0/P: [,4PP33@ '0 1`04PP" Q4PP3@ $=SP )=09 i94PP4==S  $K2iii6i(9i5i@^ -L,M↝@ (e,0-4=8RX2 d p0AQ>A0BQ3 ! *:S $=S  @=  F K0P$[ d 3 @= @-$-R R9 RB @-x,-Rb?@= dRژ0@=T3R98<ð9Ű9 <9(/@-$,-Rj>0@= 3R2R9;998<99 <9> 2  H0,-@=2R9 <ð9> F K0P4[S909 0@0 X8 K@0Ky`P_@0S\ڸ[80KyZ : ,>. + 0  B0C 0Ⳡ0Ⳡ0Ⳡ QȻ3=4!=131:1:141<1<1<1 0X 0|^3;3 0-4=8R$ H (0|~3;3 0-4=8R  (S#P 9S@=0@=}9Sz3 3/t U l0K 6[ P 06K6[00>. > 0(Y$-0W[Rp0  R R ,B9I  p0K>p`Dp2p`Pfe1P1#lK> 4~^P X)>W01>0# 0 l0K6[fK0 w~6[&[ 06[ `00c05[l K@06[LP03[05[ S 0000 ]~0>=0-48RX4 h #88 @t730S5 P d7`V 0s Z704000000 0Khr0S000  D-M^*M^OM^yM^ -LP`p0@)70ST5 P 7`V 0s 704000000 0Kh'0040S | R \  RD 0+ R E(r0(03/0 R  K; S 0 0// Q-L@0 0Q0 .0!/ 0. 10 .00 .0/5Q0 .0!// -LM3A@QnXXXXXxX`Rd0SP`a 0 U*` 0 0ASh0 Sl0 !0Al h00h0 h00 S 0h0QXT 0bQ+  R 5` R  R  d    BQ / d / -LM<0@`@ d0 3QHi_Q]Q*OQPz MQz NQ0u 9PQ [Q5hP( lFoPP0oQ_ cQ nQ0Z #}QT ~QO |QT<0<<00000@00D00H00L00P0001010 10100010<0  00000@00D00H00L00P01010 1010001<00<00<000B\ 0000000000T  bR` 0C0R 0S 0d00 00CR0d0hP( ln 0000,0A000 00 0-LMd@00P0 0 080\0`0d000000K0 -LMPPp`@ E0 0 0@00080\ 0d0`     CK Q-L@ :Q KhKh-<0<   @0; S <30/ <8SA3=8SA@A310/>08S2AAP0<00  P2A0A`0Q @Q Q !@Q`2\Q :Q Q<2 4202,2}(2{$2y 2w QY (@QU @Q[ @QQ Q\ eQ\ QQ ^1Q= 0CQ= 0Q> S1Q1: 0Q4 KtQ2 @Q6 @Q& Q+ <<Q/ Q0 5$1Q 0CQ 0Q1m )0Q 0Q0 !0b0000000/00 0000000//8\+bO^-~O^fO^jO^nO^rO^vO^zO^O^O^O^O^O^O^O^O^O^O^O^O^O^O^O^O^O^O^ 0-QL@<0Q?Q Q: Q Q *Q+ 0!R0 ,R0!R0 ,R0 !R 0 ,R 0 !R@P ,RP @PU 0@ 0b@.>D d0@ 3D 0 @0 4/K -L$M0 8@40gS :JSv BS @S ASfl0 TS0aS0!0cDS HS VPSP KS] MS5NcSl fS XSHdl0 S00 bS0!D,P<5/5(Ss mSd hS, lS`PJ?u&P^l?p$?h?zP^P^:]o5^]P^P^P^P^P^P^P^ 0-PL@U& U \h0 R/Q :9Q0A#S\0PC0 S\ 0  C!000P^ x-p0`PL@ PU @NgP000 P(P@T @gPx[[00 0S P  B /0/[ -@L4@  0 0R   [\X0 0S P P  R   00/0//[@-P0 S  S ," c0"@(@,Q!<#" 0-80LPS $@ , K0he0@{ S-L S0 Kh !P^\\0`P/  !`80 00,000, !/@^0 !<0 `4000,000 !/@^ 0-PPL@0S00  R0  K0h 0-<0L@SP@000 <O,P 00DY -<0L@S O< 00<0Kh -L M@p0@WSP(3L:x `0VZ #>4 00 `P0 |00 S0%lf2`f s@^o <0V`0 0 2000S0  0fX``V P S``< 0`(KQ^ -LP@p!AP` 0 RvNP1 x-`LPV@ (0H0P00@xx\ - @LmN40S 04080S 0Kh -LM0p @`R <"0bS3:4PKj)`V 0< 0`00000 K0P Q@ Q@//(00S   R0/ x-`LPV@0P0" (( f0`0$ f $bP`b !0`000   @@x"/ 0-00LP@T 05/@0@-X0Q  D P @ ̌    \ x-L`P@Vx S PR V T UQ dp3xxx -t0LM P@`pT P 0P 00@$K x-00LP@`T  5/@x p-0MPL@`PP0P #,  0< 0 0"00Kp -LM@(PPm a` p  l p0ppq`PG 0G<0 0Q30 $02(00  S&*S  ! b4  " 8 R*0 ¡ 瀀X <后.4 8 0$`p0000lP (KQ^ -L M@(iPPb la`Y p  @o p0ppqG`P< 0Q)0 $08(0R*100 0^3040 0 S*á ^ 0圠)L c,4 0 $`p0000P )'(K Q^ - LM`Q`U@pʀ0 !0`10 000, !0 !1`Q 000, !V VY0P    x$K@^ -L@P 0 R0$0 0R$ 0  -L M`P@PU@PU 0HSp 0000p  0 @X 0 X $ 0!!0S 5 7 4:0W 0 W  R0 p $P: H bYQA B P 00 000(KQ^\ 0-LP9P @T8@DT @0 X00PQ^p@- \4 @PA$`0R+``R'@0cR1\! S P Pb R R R0 000q03P0Spp\ 0p P/P // 0- 0LP @@ @ @  0@S l T d h 2/ 0l@0 -L@ T00 -L002 -L M@K $PpPd `P 0 4 Q0 V880RV0 P KRW SW x-L ʠ ʠ\,`P0@S 0 00L00CS0x^ 0-L ʠ ʠ4,@PLP  K0h0^ - ::L,#@LP Kh^0 000/ -L`P~`0@p000000A 0p0SpW0S1`0 $`00`0딐 1 h p2`0 @0d0 0h000000l0`0qP `0t0000(00,000000S 0$@PP W P lG d0HPT }P@$Kk6nxQ^|9YQ^ nQ^N^]Q^`#Y-]Q^ -LM`p@D4PV 44V (4V 4V 4V5 4Vi 4V 3Vc 3V 3V 0CVl 0V 3V3V8 0CV 3VO 3V0 R00  d0h@t  0(x   |   0 0 000d0h 0`0 0 : S7PP4 4W $W*0CW =G Q' "4W0W|$W  P$W  8$W  W0| 0opp0 Q Q   @@a D(R D(R  T R @DH$H@@,D(oR* R >+ R, R R R T; 000 R; 000A T 0S c0C S@0 0@; 0t; S% 00 @ D( T:R  @2T@ 3 D(R@DH$H8T@ /T@ 001A@H$HA$K1%#(*$' -@LM(P0 $0S P* Pp40 CS4 ,0 0, <@8oS: S >; S 0$K0 K3/$4` Q0 0   04,0Kn -L`"pPVP`U@,VPp W'WP$ 0P0R 0-d00h3/PP`PPpX@ 0  PQ^R^0 !<0 `4000,000 !/@^ -LM`T0@S P-X-p0S0 $  LPU% ,0S" 0p0CS004K 40 00 P t0<0d 9P mH<R@a 0K^Q^Q^p\ x-L@L0`S# 0S 0P@S:eP0SP 0U`0P04Pe,Kxhc^ 0-P0L@SP  R 0,d0h03/00 - @LL@  : :-L#`@PP PUP`V T0S LpWP0` L`pPP Lp^ - ::L4#L@T  L ^ RL RL // Q-L TR^ x-<@`L P:  `P@0(0x5Y.Yd.Y 0-@PLPPP8(P0 -LMp`P0@S 00T,0S)  `PP<PP0S 5`0`U`0PZSP@P:dd,LP 00 04` S0P S0ŅP000 4K P 0 K^R^ 0-HPL@0T 04P P0S @00^ -$ L$@T P -0L@DP T RL RKh^ 0-L@P P@0 -L000 0-L@PP@0 <8S@ /<@8oS/: S/>; S/P/ 00S/\ 0-L@Q(0@YD@Y`@Yx@Y@Y<000PPP 0 00000000000000000DG-0S1 @0P`000pQ*!0@TP`P`0 0 궀SUᴀShhXਠ ຀0CⲠಠภP 0`O@!pWpX #3Q0C?@ 0 Ѝlnpn -<00000L \ 0PU@ T 0 @`T?*P@|ExoWz WZ% Q AoP   P >  P = P Q P P PP*@lDhoVJ TQ, p Kh 9R^ x-0LPP@` S Px < P 0  0  0  0 0x -L,Mp \ 0@T@ Tt 0`HTK1XKS  @@Q*\@XoUZ U \TKvP @8 P 00UF*   P = P Q P0 PP*A oZ Q\t  "l`F X0TK1x X (KR^ _R^ 0-d@LPLT 003/X@0 -L 0-d@LPT 003/LPX@0 -@L@L -LM`pPd@T 0\  0yPt T0S L0S0S Sh T0dbdPXPU\ 0 0R0PCO Vp 0`00 XPU`P= ;P8 00080P1 , 0q xSL0S% ,010PL0SP0S  dp W 0  0K0'\0`P/  !`80 00,000, !/@^ 0-LM0P@1 Kp0020 K0p0000 0000000000 Kp000K00 !<0 `4000,000 !/@^ Qx-L@`tSPPVjUYUYWYUYVY0S0<00]0S0;UTVYPVYXVY`VY$VYhVYpVYxVYVY0VYVYVYVYVYVY 0 0000$0 0 0001 000(020<0 F0 P0 Z0d0000000UVYVYVYWY000000000000lxx x-L`@P0#   00CS 0 00Ox0 SIx -L M` P \p3\x0PS@|p@ @x@p00P, t0S 0Sʌ\ P0 0S0Sڀ wP*s0S00T S i@Sypa@T 00 @YhPPF00@S@@$ `NP Z p0SX PT >t1x0: S9X1 4Pl=%Ap0X00T X  T  0K|0W/ 0|p  ȠRR Q C0@dPbb;=00d6=0dX0 RR 0 0 (Ko(K:\^\ -LMp`@ p$4P -%$ &% 7t10: SSZ0s0e00[[[@ 1&[@ 1 [P0P0PP00 0@% 0@ 0@ 0@|0x(0 t0( K 0 h0$@ P H0<0R$K S^]T]YL]Y0]Y]Y4UYs(]@^ -L -L -L@0< 0Kh%$^ p-L M`Pq@IP00 0 0000 0\`P d h0 K(@,0\04`X00T080P0<0L0@0H0D0D0H0(00"40Kp,S^]>S^^Y^Y(]^Y^Y^Y^Y^Y(HC`____ -L@[dKh -L@d|[ -L@'SP0 0000@ 0p3/////@0Q 1CQ -1CQ00/// W@/ 0-@LP2S ZPPZPP,@-0 -LMp 3@pBP0`XP=# #0* R2 0P0 0!00 0-0_010 1 a0 2 `02 2|"St2-P 0P0 0 000 1 122<2  h0$"0P0P0 $S00 (S0U0p 0ZPpP0U0av Y0* R@ 41 S(1@ vYPP@ 0lYP@ 0dYP@ 0\YP@ 0TY00S h <040 h0(@ 00 h0,0 4KX d$K]cY\Dt` \LtcY-]gYgYh_Yp_Y_Y8^Tt`t N0 \$0320c480 Le88h04 Le9>"P-@` 0 / *   %0 0B8 e19 1  a0(K -0L@S 3/<Kh0@-0S P@0@%|30 - 0L03/t -L MR@l     04/K -L M@n 00S:0Si6K R  0 U10 " BPA ` R V u@P@A \R U @00u0S0cT  @ U0S0S030C0A`(K -L Mp P000 0Sl @`0! XQ0S 01Z a1 40 @40UNV`T000G X !8 11-0"0 88 00 ,0 88 00<  !!   0  T"Ġ T 0R@@ 0 0 0,<00 0000(K/00SR080// -QLMP@zRw `bX" 0რZj' * 8 <0 9/8 <0Ppc"8 9/P8 00S 0e"00 40 0 0 0S04 0SPEp㇀X%h# * <0 8 9/8P<0 0g'Qp <0 8 9/P<08 QpᧀWg#h, QU d(K 0 SCR P0/\Rp@- 0A@CT @P PA`DV @U dpS  Rppp0@- 0A CR @ @APBU TS0b0 0-L M@PP* 0S0 R R d4K HlPE0S K!0 0R0 0B8 0S PK1 0SdK0\p@-0M`S* RA0 ܍p@G @QTU*PUQ R1DL0"C0 R L\\* \\܍pR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@H P//R0@- 0@TP@UP PlPU@000 0-L M @PRK0h.D0S0Q Q4K GlPE0S K!0 0R0 0B8 0S PK1 0S dK0\8@-@PCD8R  0\/S // -'LM@ G 8 G <*O* 0S47 0:=B>0CS)<:0<: 0S *  ! ""! 0ɒ0 S@Ÿ@BP,1#"0$"E@"P0QP!0E!`p0E) 0  <:0<:@ P CU0 *P`\vpW R 0`)0 o<: 0<:0R $$A: 0:@`V *R0)V<: 0<:R 0$$A:Ā0:@Qap0㗣#:S(ؔڐ S 0 0) 1<:0<:pW@T @ F< (K(\T^2?f'CT^)U^(\eU^D\U^ x-<@L8P4`@O.0` P@xtAR0:c/ \ @-Q:l@@ -L MQ4K X0K`@W0 QZW Q VSR*0S"00 SR0S"00(K -L MQ4K X0K`@0 QZW Q VR0S"00 T0S"00(K -0BLMR"Sp01` L \X0-\` +\` 0w030\ XRHp`S p ?@ #KoD#KKjD@0@P0L PaLQWLALQ7L\KUT00\00S 0045%0 @_00@P @tPZ SFSp(KU^\ -0BL,MR"SP 8 pP0hh` F VZ0-V` +V` 0w030V XRp`pS pZ@Q@Q ?#KC#KCZ@P Y@ gPi0 F0 S`a FRW`FA FR77`FV4Z P<QP00 V00S3004 1!,$KH KPT &QP00 V00S0041!,$KH K`8 R \HP80 Sp8\(KU^\ 0-L@P00 00  b" 2 /UUUU3333 @--A/ 0SAS/0-$(0@# A  A A A0/Q1/Q!/Q1/Q!/P/P/P/P/p@-@P`+ VPpR00@ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/ -pL@W `.@P0S S @ Pp@- R  0@`PUT00UpQA- D3R@P,3  B , dP @,, q, a  ,̠ (   Ġ ̌ q Ƞ ̌ ǎ  ,,,,, q, a  ,̠ (   Ġ ̌ q Ƞ ̌ ǎ  ,,,,, q, a  ,̠  (   Ġ ̌ q Ƞ ̌ ǎ  ,,,,, q, a  ,̠ (   Ƞ ̌ a | ̌q   ',,j00P@`dP, Ƞ ̌ q ̌   (,,P  , 00,01Q,# \0@-P 0@0A8F @$$SxPx0 C A@0@$$ R9 $1!04& "000"90߰o, @0 !!1!0'Sel0C-P0@0@$O$4$0'S@̀'RP!'^30@PU:p'' p'pa'\```@0`T@0\@'. R P!!!l'\0010Cz+el feX]0@- 0A,S!W!! !pRc'QB"  c  ! 1! !0 00!00V,n߰ 0-9L@ 009Y PepU0 "0  0 / 0- LPJ@ J0 -LM@R(@K0 P`*S SWPPZ?S [SNp0^WpxpW` +PEJ0S0 PR0?p P P5 P)pP0SWp']Q" S0  `Q-Q R[X ]Y PX00` P0r0SPS$K@- "0@ PcUP%\% %PcUPp`XTP`\%\%0 %0S S S0("0$"0 "0 &" [ -L M@0Kc AK -@PL ( A@ (1A 0"] -L4M(0@0 0< 8 PXŸ@H D0 p@H0 0KT hA00@Dc(#("$c4"0T8 p@W0e#%","0  " <0 #  0 "f16#f;#  0 D8P <D < P`@H `(X P  L @ x y'!'X(@ 8c!p! ' LD*  b,b, <H@Q 8< 8P P`D 0    ` `   8000P0P00(K] -L MpP@> $(`QE?PU 0 8S()7 e @S )? eb@38 [@8 V@0(0  `@!(PU 1(Kc(#("$c4" (0 P@h 9@ K -L MR`pC ? @@`Y(4: z@1( dp 0(  ?ZjBLPB@J?Sc @ 00 X@ BLPB00@0C?? Y ( ቑE@B @PB(K ` -@PL ( 4@@ (? 0"] J -@PL ,@ @ P? 0$$] -LM@PƟDK@bDKAEKAFKBFKCEKCGK PQ 4K  ?Kj  &970 '970 &790 '790 IK(K "KD@ KD@ 0#IK " 0#0FKK@@$P@P%PKKDKK !%KDKDK 0DP @ !?"10 ?%1@0 %>2 0 $>20 JK*K0#DP "L@PC@ LDPC@ KK " 0#0FKK@PZK K%KfKKK`p'KEKFKDKEKDKKDK  10, #   t0 K,K !Kt0à 20 ">20 K/K0#< "8̠KÌ ̠<Ì  "0#KK%KK 0%K&K 0PZ Kᔠ fKKK`pEKKKKK#KK$ 0 K 0 K! 0!K! 0!K" 0"" 0"#FK 0## 0#(K] x-@@LDQPUP` 0 pSPQo e S Q e=?~ =p =0P0H D>@ @>Kxh' -L MR`pi @ `YPQ:A '>PQP*$ 0$P hp 0P(AP,! 0Zj)0 40 DKPD0 40UTD@PDဠJ 40 =  QP400CSc Y P ቑ=0  QP*$ 0$(K x-`PLP E@ @@T [=x -@PL ,@ = PM= 0$$]` x-`PLP @ @0T 1=x -LM@ lK~=0@  0@0 l0Pcc4800 p0 ?  %  "h  `b b p d a !t  `̠` "g! " ` ```蝉h`̠`TXPP(|P P P\mia atx pp)@ @! @X ]fabbĠ &   "T MeQbb %  " P ͌dAbb $  "`L` lff$(  `,x `  `&P HP`eledl P@ P P P%@DP吠 -eledl aP P!PP%@P唠 Meledl b!PP"PP%0050?S`P@P` 8?0S*@P eKh8 p-L MP@0$`KS  !1" 0Sh 0~? SL U 0#  !1" 0SKpV^] 0!0 00/#EgܺvT2 -LTM@lK@ 7P `l p pph%0(e 芇 0d )j i 0`(`  `&h`hP)0\pP%iPeZ &0X,fk ͈0%T  0# e[h0,0#P0lˠ霆` 0(Lp 0#h`k0)H0#PiPZ 0&D 0# fkɈ0% 0#@0e[h0,pmvmzNSpp\̀pfk p ph` pe[ pp`plˠ`pp@`fip` PppPeYpa ppll̀pfk p pX` pe[ pp<aplˠ`ppd`kp` Ppp8PeZpa ppHˀpfk p pP` pe[ ppDplˠ`pp`4ph` 0Pp0<0a0c<P&P%fkl̀P#D  P%c;  ,\P "lˠa hp "`` `k !X "0a0c: & "L fk̀PP # "c;` P,TpP%lˠa P dP%`` `flP!8 P%0a09P&P%4Pfkl̀P#lp P%c;  ,` "lˠHP ` "`  `)tp0P!P%a0Pg[P |`pP@:P"!PP | tP8d x0pp`p `p(`b+f=0(K -pA?1@@``PRLA`3:P`  2 J@PH@@ TC` V*  f$Kk1 0-LM 0@"K"K K"#, K#( K0K#$1?0 K@ cR cPK| B KU 0` K0hq1 !B!B!B0S]0S *@,Ġ@,Ƞ@0,̠@/ -LLM0 p0 PPP\lPB @R l`pph X P Pd PȟeZ` ``ȟp ```\pȟfeX p `ȟp P Tp@XlʁPP pP P XpP` PPPLpheUH`p``gp` ``Dplʁ)kGO`F p@ਇ` ``g Pp 0P3: .;?0S*5@P eKh. 0-LM@PK  L!? 7R8 bx bK  X K0hY.]0S *@,Ġ@,Ƞ@0,̠@/ -LLM ` pp 0 @PlKHDP@P^L@ @Rp@l h @@@N P PdP\`芠 \@X@N PPT\P芠 L@H@P@@DP\ @@@@J<  8鞠 P 4P\ @@0J l  \ P L PX] @ < @0K  h   X  P H Pณ] @ 8 @K  d h  T @ P D P] @ 4 @K  ` Ȓ  P ࠒ P @ Px] @ 0 @PK  l ,$ L*  P\.* P[<!@ԑ* @J %(d嬁.$) D*PTp P[!)@ @P4J%h4* $) H.)P PX[!)@ @Ѐ8J%) ఀ`$) @.)P PpP[%!)@ @0HJ* p Ȍ `p` p,(KyZn000 0/#EgܺvT2 -` 1@ R05?@P`02050VL>p 0P3: ,?0S*@P eKh, 0-LM@PK  L!? 7R8 bx bK  X K0h2,Z]a8!` 8a#!` ,4 0@-@P0 -`h @h&d0L`d&0P.p 40D )4pPD 40D 40P00DD0DPU@@@&d C-0Pp0 C R_0S@ ` 0 XR0@`@`  0C YV8@CTY2"0 BRVD .SU< R: 0PS P1 C S\AT> pgpW W WR05,1:R*0<8R0<84 Q b8"8#4b$# "40"8",0  AI Y a0CSA0a00c"0@ Ѝ -LMK{P K/ -LV^-M Ѝ -LMK2K K -LM2 KQ:P:/// -L@p/@-ȠH h,Ƞ$H"X'Hx 'xx!'Ȍx$H'x,H  -OLoMP$Kp "0# !P R0e2K !PKQP:/// -L@  B?QR/ bQ20" /PQ ao@`/`o `//P0aPoa /Qoo /@-p@/ ?!BC @@- p@ P` !LNE3 !@A8  0231  32  32 00Q0c/o/ Q-0LaP$P ! 7V^] 0-@PL@TPRP00P! 0TV^]0 00  b"0 2  ?/UUUU3333 |0@-P`@@PP``\p AO!Q@@PP$".0,@%2P@P@$H$UUUU3333! P-L `V^] QP-L pV^] Px-L@PQxQPxx%t /?`"#`bcQVʕxRV(0aV5W^] -@PLMUT`pWV $ WV UT<% o  X/K0""XK܂KXԃKX\ 5#QP #K(܂KP D0#K r0(܂KP 5$K\W^] Px-LPQ0/?"#@bcQTRaT00xQP -L B, MQPCK0 'SR0O`(p(`V pP "0# R0VRQYX'P00K0(KSRQP r0'P@ Q-0LP$P ! W^] 0-@LPRT00T! 0W^] P-L ?#c"X^] QP-L$ /0 !PdX^] / RC/A 0\R#R! R/`o `/` `! / // -L Mp`P @T#*Y!  0 4 d040 P 0P Q  !Q  @P0W V S@(Kyaratcid0S/0S/ 0-LP |@P  0P 0 x-L` m@P $gPP $PUP ^x000x  / 0-0L@0CS00SPk$@p K0h:0 -HL2@P 00` -@PL 0S  C 0QP/0S   0  /P/0Q27#050205// -PL@pPP T *`P @ 0-LPW@P P00 0-LPT@P Po00 0-@PL00S 0Q0S(P 00S0 0-@PL00S 0Q0SP 0090 -L@KP 0 C0Q*!!  -L M0@S,0,,0( (0g000KK]:]X^X^ p-L M0@Sl0ll0h h0MPPEUP` 0`U*PnHKph8KpW]:]X^X^ -LMP0`,0 p@T ( K00KMPX 00SWG>, K40K?P(0 , , 0XsR R >XU00,Z #SP, , XU00,2P,  , PX , ,P@nV, PP $K -L MPS@p` @  0P@ VSXO@ 0k@ K - ML0 K 0-LM 0K@0 K0KPP0 R0 R R   jP K0 x-L`PV@ Pvx x-LP`@ Pex x-LP`/@ PTx x-L`PI@ PBx x-L`P@ P0x -0LM@0 K0K5P 0 R R   P K -LM@R`P  0P pWO PK 0-@MLP@ 0P UK0 0-LP@P[PO0 0-LMP KP0KP 0@T T K0 p-L M` 0 P@P +POKphKp0> -LM@ Pp 0`P PO KhK0gnts0atad0rbmn0rbmn0loob -@L`P0 Khy 0-@LP K0h< 0-LM@00 KhPPT K0loob loob -LP@`(0 KhE 0-P@L K0h 0-LMP@ K@02P U vT LK0atad 0-LMP@ K@0P U AT 2K0atad 1atad -LP@`0 Kh 0-P@L K0h 0-LM@D0 KP PPOT K0atad rbmn -@L`Po 0 Kh 0-@LPa  K0h{ 0-LM@00 KPPT  K0gnts 0-LM@00 KPPT  K0gnts gnts -LP@`<0 Khq 0-P@L- K0h3 0-LM@D0 K_PP ;PO T sK0atad xrbmn -0`0LpP(*PP%  M@P %0@p0W h0WV@`V`T tyaratcid -0LM1P@ qk P P!aTP@  *K0.`0! dpP`  pP 0HьVK@^yaratcid p-D@DPD`LMT *0  B0Kp([^H[^Q pyara ltcidQg/yaraQ`/tcid / / -@LeP0000 @~/// / 0-0LpP@0S! 0`V  03/P 000 0P S 00@ 0-L@PP00PP0tcid 0-L@P 0P\00loob x-PL`?@PP  Px 0-LP@~X0P 0PP0$QPrbmn 0-LP@^X0P 0P P 0P0rbmn x-PL`@PP  Px x-PL`@PP  Px -LpO``0P PP@PQPrbmn 0-LP,@X0P 0fP eP0P0rbmn x-PL`@PP  .P;x x-PL`@PP  P'x -Lp``0P P PJQAPQPrbmn 0-LP@X0P 0P  P40#P0rbmn x-PL`@PP  P x x-PL`@PP  P x 0-LPz@AX0P 0P@P0P0rbmn 0-LPZ@!X0P 0P @P0P0rbmn x-PL`K@PP  \Pi x x-PL`F@PP  HPU x 0-L@P $0P 00gnts x-PL` @PP  "P/ x 0-L@P $0P 00gnts x-PL`@PP  P x 0-@RL P 00 0-L@P 0P900loob x-PL`@PP  P x 0-LP@[ X0P 0PP0QPrbmn 0-LPs@; X0P 0P P0P0rbmn x-PL`e@PP  cP x x-PL``@PP  OPo x 0-PL>@PP kP] 0 0-PL,@PP YPK 0 -Lp` `0P BPAPnu@PQPrbmn 0-LP@ X0P 0P PW0FP0rbmn x-PL` @PP  P x x-PL` @PP  P x 0-PL @PP P 0 0-PL @PP P 0 -Lpx`@ `0P  P P  APQPrbmn 0-LPV@ X0P 0 P  P 0 P0rbmn x-PL`H @PP  FPf x x-PL`C @PP  2PR x 0-PL! @PP NP@ 0 0-PL @PP <P. 0 0-LP@ X0P 0% P$ @PQ 0X P0rbmn 0-LP@ X0P 0 P  @P= 0, P0rbmn x-PL` @PP  P x x-PL` @PP  P x 0-PL @PP P 0 0-PL @PP P 0 0-L@^P& $0P00gnts x-PL`Y@PP  \P| x 0-L@8P $0P00gnts x-PL`L@PP  6PV x 0-@QL YPK 00P0/ ]:]@-@PTPB P P0P#:tt@P@PUPDTU@@P+ P P% @P!:T!:$$0   Q NnT0V0NnUT:WV:xx0P -LDMP@ `Z @0 L@ L0  R R R<<<<0 0< SPE@PT E"` `0Z QZ <040 0K0Cp8 D H0 <040 0 p0C8 0 H0 L0Y IL0  0 0R3 "Q$ \ 800 ` bp0S>03p05`2W *00<  gd Kd `ppW` <0305`240Lp<S 80Q080 00 0W00 405`20F51XF-Y/ HR,:\8 `0 bp  R> 3p 5`2W * <  g`0 d d`0 `Xp`pW05 `20 SpW05 `2,040 0 Q<0 40 L bL0F\000 L0 :\\Rf=\ 0 00000 0S'00L0 L0\=\ Rb\ f\ MI 0X 3 "R% Y 80 `hD0p00 0S>03p05`2W *00< gd d`ppW`<0305`240Lp<S  80R080 D00WD0 405`20F5Z 0 00Z0 u \& HX#:Y 8D  `hp0  R> 3p 5`2W *0< g`0 d Hd`0`Yp`spW50 `2L0d 000 EL0K L P0K 0K00 T0 0dX 3 "R% Y 80 `hD0p00 0S>03p05`2W *00< gd d`ppW`<0305`240T Lp<S  80R080 D00WD0 405`20F5/Z+ 0S( H0X%:Y 80 `hD0p00 0S>03p05`2W *00< g`Zp` pW=0305`2 pW=0305`2<040 Q+ H X(:Y 8D `hp0  R> 3p 5`2W *< g`0 d d`0`Zp`pW05`2 pW05`200S0 T0S H0X:Y 80 `hD0p00 0S>03p05`2W *< gd Cd`Yp`opW500`20\0 T 0R HX:Y 80 `hD0p00 0S>03p05`2W *00< g`Yp`=pW=0305`2K< gPGT 0pW`0X Z,040 &H0XJ:Y80 `hD0p 00 0S>03p05`2W *00< g`Zp`3 <040 40<S pW>0305`2p 00P0%#0  F\00skpW= 3`2 5pW#0305`2pW#0305`2,040 (KeY^L]^ 0-LM0@0@K0/ x-LP`@ >Px -L`p@P 0P -p-L`P@ !PKp 0-LP@ DP0 -L`p@P P -p-L`P@ PKp -L`p@P P -p-L`P@ PKp -LMK ) K -L M@(cPe cpP W)000 `00 @PPfP`V%```ed&efআ(PfPh(V%`h`eh&efং(PfPhQ%`h`ee&efই( pGW W W 0 00`WW W W0l0h0d0`PRWP W W W0\0X0T0@ \"0 L`0 0PPfPhV%`h`ed&efআ(PfPh(V%`h`eh&efং(PfPhQ%`h`ee&efই(\ 0 L !000\0L !00`0\ 0L !00P0f0h6#hc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a"0(Ky7| ]0-P@  P 0S RP0/P0    PP0/0/ݼݼ --(0LM0S { K舦  B01R/ b120" /  B0R/ b20/QJ:/P/1o?o 0CL/P@ P@ P@ P@ P @  P @ P @  P @ P @  P @ P @  P @ P @  P @ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ /b!@-p@ / ?!BCh  @  0   S/i -L0 ZkY^ -0L@P 00 008 ] -@L0P 58 P-L 0R 00PQp3:] 0- 0PLS@HK0hP (P K0h0~Y^ -Lp@P *P`P7` P 0-LP@P P0 000 x-PPLx p0Rq@P 0000 `P0Q`x ]:] x-PPLx X0RI@P  `P0Q`x ]:]P/ 0R / ]P/ 0R / ] 0-@PL0 80R ⎀PP 0Q0 ]:]P/ 0R0P// ]:] -L M@PP%0 SQ R ` 0`pYP  0DR S 0, 1 `P g K ]:],] -L M@Pp |0R= PP`(P 0<pS 0,  PP 9 K ]:],]0P 0$ SQ R/ ] P-L ,0R0Ptp3 ]:] -LM$0pPS f-`V+` $0KP# $@P 00$  0KP 0$ S `@ P ?P$0@ 0K~Y^0 R -R  -R >R00/0/00// 0-P L@Q P 0< 0 P0 0-LP@AQ P0 x-L@`P 0U* P P<P P >Kxhx 0-LP<@P /P P >P  K0h0 x-L@`P 0U* P P<P P /|P >wP  Kxhpx 0-L@PAQ <Q >Q &Q <8sP0Q0Y^Y^Y^ -@L@^P (hP  Kh9 ]Y^ -(L@wP Kh(Y^ 0-L~@P  ~P0,P0  0~00~ -QL@P p 0 `L \V`` \ <\0 R !R -R -RU 00P/R PEUz Rw 0(0 q(` 0P0 L \R0aXp0  \ /\ >\ \WYU PP0/S0$0(0SH0$0P0>SB0 >R    6 R5  0 B RP R R0'  B R\0c00"S R =R R0 S  0"P P b  >R00`p@-`@PU <PK &PAPaU PmUPpUDP;UA3lUtP:;P7<(gUtP/;P,>pU'oP$sP!;P'qUuPoPtP;P "Q T*@S@Vpp Q-L p3 -LM@IK>`P  pER 0 P P PPIKMKJ/KK?KLP( PIKMK ,1(SST }P@@XP @@"}xxY^Y^Y^} -LM0 IK0a00S 3/@0P P U7 5/50IKK03/U` 5/V*  V V$01p(1 (Q00S 3/`0@ P0JK03/PT 4/T 4/ p003/ IKK0PK x-LP\@P)  PP$0SP t 0P  P PP 0 `P{P|xxY^]P0/ p-LKM8 IK@< T00041 01 8!<10Q :^K0K/K J/K 8<M/K0 Kh跄u`fZ   0-$P@LJ0  -$@L t E  !]00  QP:/  RP///P@-@ 00P !P R!RR !R !QP 0-@L0S ; PP q~㶿PP |\&T @P \<j<)0  P_0u`fZ $8!] -L,M 0@4K!  H H @P4KP KL]Y^Y^ 0-LM@P $K$KBKK0 0-LM@P $K0$KBK0KK0 -@PL 0R!] /P0@-* 0R! 0@P! SRxSR QPLIPUT 0SR00@0 0!]P 0R//!]P 0R//!]0P 0$ SQ R/!]P0@- L\  ATRQP00!]P0@- X\ AT RQP000!] 0-LM@P$K 0S"$ R(K0-S 0S0xS 0[K0 E0[K00K(0(0 P $KK0Y^0Qs/0 P R   // x-`PL zPPxPPW@P @e`0 P`000xU z !] -$L0S 2 Kh諂uLnZ -$@L y J   "]LI -@PLp`T 0P 煁7PVP@D¤@V P -L@vKhr 0-@L@PhPd00,S<SZ  -@L  0 0C0u p-L M@P 0R S yǫl21`P` 0P 0 0C0N`Kp  -L @P`6ypP T  !<T p` Iy -LMp@ `rP3y 00P8  0qPP (0S!y+  0dP (0S$PU00 (0KP (0XP ?P  9P P 0P $KI]Y^|Z x-@PL`P \0RU( P``U≫xxx!] 0-LP<@4P P K0hH0~Y^ 0-LPx@P ,00$000P00 00XoZuZ -`PL@ߪ0SFp,Ko9XP:  P5 80 S1pP- 00 0 00R# }P P :P P 0  03/P  P 0 S %@! 0P0C 0 0U* P P@I]!]Y^ 0-P@LPp0  0 0K0hӪ -@PL& 0R$pW`PP 0U* 0兑ᅡ   0兡 0P 000ᦪ!] 0P-L 00RP 000!] 0-P@L000K0hz 0-@PL 00RP@j00!] x-@PL` L0RP0V@9@Mxx!] 0-P@LԩT $0R@@40!] -@PL x0Rj`ᵩP0U* 0UpP PpW?!] x-@PL` @0R P㐩 S@xx!]0P 00 SQ 00R </!] -LM@Pp` 2R0_0 K&PP @`[00S $. YPP / ,Y<YYfPP` $ 5P p% PXPHU@D 0Q_P7 Z P 0`000000@'0080  P80 S0C00  ! 0P00J c@! 0  0 Q 00 1 `@6(K!]uLnZ  "] -L@PT`pevT H 3P ?  0$Kk 6000P 0, SQ 00\/!] -LM@P`) 0R%Pu0 K9P  0p` b!{ 00C0000ῨK!]0P/0$ S/Q/ 00R/!]0P 0$ SQ R/!]P/ 0R/"]0P 0$ SQ R/"] P-L`Pp7 @TP*  0 S @T 000 1   0 0 0P @IG 0-LP@P Pu00 03/P P P0 -0LpS@P E`P $Q`:u0P> `Kh I] -0Ls@P 00 00l"] P-L 0RR vp3 -@L0P u ˺ - 0PLS@l,KosPR `LqPV$0 !#1 " ?6P=  0P7  *P1  $PP* `FV,Ko`VpPp(1 P ' P VpQ =P =Pn]l"] -4`LP@ pQ A QP Q <Q= =QD  P V@ZhZZ؄ZU` T*hU  R*h @`U  R*h @`U T* h@`V0Y@S R V$܅Z܅ZPZZ0<Rp R B RQ R0 =R <R R 0B RS R L"] -LPpPU@ s`P ` P 0-L@PP0@ P000 x-PPLx p0R@P 0000  0S s`P `xl"]P/ 0R /l"] 0-@PL H0R  P sPP  000l"]P/ 0R/l"]0P 0$ SQ R^/l"] P-L @, T \p3l"] -LM$Pp@UIQ 0!P? 0S<   K 0$ 0 R1$0K P) $-sPP# $ 00 0KP $0 R\ uP @P3s `VP,s`$0 0@KW]n]/ 0-P4L R $C 0U @@0uZ 0-0@0PLF0 0A0"]0 QY^Y^P/08 SQ R0Ps///"] -@PL 0R"]P/ 0R/"]0P 0$ SQ R/"] -0L@S $0S  0 Y^00C0/0 P R   // -`PL crPPPX㬶@P Hpp䳤0 P`000U hr"] -L@Kh P-L`Pp, @TP*ᒤ  ፤ኤ0 S@T 000 0!0 0!0 @ߤݤ 0-@L@PdzPˤ0 p-L M@P 0R S rL`᷷!BaP` 0P 00C0`Kp -L @P`qpP T  !T p` q -LMPp`@ P00 H 0P ( R @@ 0HP K ^xZ 0-LPxq@P ,00$00v0P00 00輍ZZ -`PL@ɣ0S0Kh#P@/ P 0RpP 00 0PP 0 03/PP+( 00C 0 0U* P P@ ^"] 0-0L@P 00Q  0 Q00003P 0-P@LPZ0  0 0K0h轣xw -@PL 0RpAh`PP 0U* 0 0P000ᘣ"] -LP000 0-@PL 00RP@x00"] 0-@PL 00RP@c00"] x-@PL` L0RP0V@@Fxx"] 0-P@L͢T $0R@@-0"] 0-P@L㶢000K0h 0-@LPᦢPPP%0 x-@PL` @0R P㑢0V 05@#A7xx"] -@PLP`! 0Rpv0@0U@ 0 0a000@Ȣ"] x-@PL` <0R PI@ᯢxx"] -LPp@U` P Kh00 -@PL`' 0R#P0 Khw 0q0a S* 0`0 B0 0bKh"]0P 0$ SQ Rf/"] 0-LP@P Po00 03/P P P0 x-0L`SP@ eP $0S Kxhx ^ x-L`@P Px 0-LP@ P0 x-L`@PD Px@-@1 !@@1ARA@@  @, @,@00,00001S  Q   10      x-L@`1SO P&1 R   R    1   0S4 @``@  S Q  Q      x!R  11   Kxhx0 x000 0/ -P@LpT `  `f7/P A -`@LPT p pg8/P PAU ` -`@LPT p pg8/P PAU ` -L M`Pp @0V 0  0c00 :/P00T Ϡ0 a \     S    @ @  !S@      R   A- 00`` Sr (P     0S 0 0    @T0   (K@-Q0@"Q  0c 1S0 S   Tl!R0l - LP`@0 S R   R   10000`V\ 0P00cR  s 31`V  , 1 " 1   P R0000 , 0p ` V" pPp' 0V       ,  1000\0W00 $KiV Rpp  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/ -0BLMR"Sp0A` L \X0-\` +\` 0w030\ XRHp`S p ?@ #K#KKz@0@P0L PaLQWLALQ7L\KUT00\00S 0045%0 @_00@P @tPZ SFSp(KU^(#] -0BL,MR"SP 8 pP0hhŻ` F VZ0-V` +V` 0w030V XRp`pS pZ@Q@Q ?#K#KZ@P Y@ gPi0 F0 S`a FRW`FA FR77`FV4Z P<QP00 V00S3004 1!,$KH KPT &QP00 V00S0041!,$KH K`8 R \HP80 Sp8\(KU^1#] -0BR"SLpP0TT`@ D TY0-T`@ +T@`0 0u030T XR3@P`S P ] 00D \@aDPW@DADP7@DT S T  S RC# @ 0 0cX RpFpSPU^9#]  0S S/P/$(0#   @// / ////H-M 0ЍH-M 0Ѝ -L`p@A#HP0@VP@ -oOLMpP ! "0#P R0&& !P $K 0RR! R/P/0@ 0A0S*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/ R.0 \ B BѴ Bôr- B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@@t@P B@@P B@@P R@/ R/ R Ѥ ä/-\{F ,DP`pL%T\&dl't |@P`p B RR,DP`pL%T\&dl't |@P`p R/ RAn,D R L@Af,HP`pH%XX&hh'x x@P`p B RR,HP`pH%XX&hh'x x@P`p R/ RA:,H R H@A2,LP`pD%\T&ld'| t@P`p B RR,LP`pD%\T&ld'| t@P`p R/ RA,L R D@A /R Ѥ ä// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/ -L@`\pP /bP P10   P101 0-QL@U# \ QR S  T00%bPEQQ€RS  T 0000 -L,MQp`S V #0  VRAS V 0 P V  0C  Vj o`1p00to?ocPVpj@`P7<8 0 4 ԃKXK p5S& B V 0 YQ 0i oi8 0i7YCK?ooc! \ @P 0 \ @0`C38P 01o?ocP \@P0\ 0?က႐ᇠ$K R0L ïP < 8 ԃK#K 0P  P0 /LLp@PV @ (KQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ -LV^ p-LM 1@`xPQ R& _?  0    V6p pApGW0` pApGW0`F V(`p 0A0CS00G S-W A0GS0 p0 QpF`P*.QPcP0X  c u0 84 0 < S $S $S ` S $S /Q 00/Q 0/ //PP0 84 0 < S" $S $S p S $S $S//Q 00/Q 0/ // -L M@T 00S$ @ 06@$9S 0 @0 @DBI@S@ I@S@!I@S$B"I@SS#I$ Khm]lm] 0-LP@ᰛ 唭{ K0h荭~m]] -LCMP @K` Kᔬ00K00K#030 00 0 40 l0KpBP20SH ET 4P20S: 2@0Kp@T T P0[ X20S# X 05X KK,2K( CKKK 1!0 000#0K1 0S  10S [0[ [ [ [  [ ~ [ } [  0K G@P @K\q0[0KTK0\0K0K EKX@ D@ , ( c0P /S R  ׭@*᢯0 Kn0KPP ]KKK0K 00S0[K00K00 0 "PK a%@ K*]] ܚ]]:]T[\m] -LLM(@Pᲁ,`| 00㨀(0S0S1#$4 "8P#R00   0&,P s R6 0lKS 0S0s0480 P (01H0[ W  0P (01H0[ W 080S P .40S   0 4#$4 8#8!R   0 1 4#$4 8#8 A4#$4 8#8 1 0(KG-0PH 0R& <,`p@Ys3\Q0 P@T   Z T @@ S 0ЍH -4L(M"d"",Uՙ/ ,S7봌8뺧1 fH)AN뚭})Xqelm_c_뗈n|DnU}?rUPb@F,娚}/l;K`4Ҹ < 73 PŸ/0 4JC>!Af1;& t|囃JSkqqkmE0  A08S`:ZDs庢P+@3@@40P040A3PiRkޤ;b뼉띸^C|K i & n2@ @2p0 0NP9b_p"ZmghBhRQ P- T000 SR": :#69ߞd@z1@B 1@1d0 1RP7 嗫d~ 40- 04 PL@cQ gK0h(d~00S/  0!ꈦh^$d\ ] p-L M80@`S 00 0V`ZPP   ZPP ,000` 0`040 0` S@502:8PKpY ]:]I]a]0@-DGDG EH@EHFICFCF 0 -LM`@PϘB@A@0pT ᜘Tܘ 0K/_@[ ,Κ;qLr!oADSgEmV1JBچ8{ BB]B]B]B]B] C]C]1C]FC]TC]bC]qC]C]C]C]C]VAC][2PVAC][2VAC][2AVAD][3VAD][3 VAD][3pAD][3qAD][3qAD][3qAD][3qAD][3AE][4D E],[4D E] [4i E] [4`RfE][4 i $E]l [4qA,E][4TrA4E][4TtAG][ A>G][@X/V>G][6^C]C]C]C]C]C]C]C]D]C] D]D]D]D]D]&D].D]8D].D]AD]HD]RD]HD]ZD]_D]iD]pD]D]D]D]D]D]D]D]D]NG]UG][G]aG]gG]mG]sG]yG]G]G]G]G]G]G]G]G]G]G]G]G]G]mG]sG]yG]G]G]G]G]G]G]G]G]G]UG][G]G]gG]G]G]yG]G]G]G]G]G]G]G]G]G]G]G]G]G]G]sG]yG]G]G]G]G]G]G]G]G]G]UG][G]aG]gG]mG]sG]yG]G]G]G]G]G]G]G]G]G]G][G]aG]gG]mG]sG]yG]G]G]G]G]G]G]G]G]G]G]G]G]G]mG]sG]yG]G]G]G]G]G]G]G]G]G] H][G]H]-H]>H]TH]eH]G]G]G]G]G]G]G]G]G]UG][G]aG]G]G]G]vH]H]H]G]G]G]G]G]G]G]H]H]aG]gG]mG]sG]yG]H]H]H]G]G]G]G]G]H]H]H]H]mG]sG]yG]G]G]G]G]G]G]G]G]H]H]H]H]H]H]H]H]H]H]H]I]I] I]I]I]G]UG][G]aG]gG]mG]sG]yG]G]G]G]G]G]G]G]G][[@\|Ax\X.C\A\A\X.Ct\A\A\h.C\h.C\X.C\ȆA\ІA\؆A\A\DA4\A\X.C\X.C\A\X.C\/C\0C0\AL\ȇAh\A\1CT\X.C\8A\Alsllsrasrror K] K]K]:]K]:]#K]:]@)K]-K]P0K]-K]`4K]:]_M8K]L]AL]zK]AL] K] EL]IL] EL]ML]/QL]@K]oTL]K]0/JK]@K]p XL]>]]L]bL]@eL]bL]jL]nL]@rL]nL]wL])]}L])]L])]L])]L]L]L]L]L]L]L]L] ^L] M]L] @ N]L] `L]L] 1^L] L]L] L]L] L]L] N]L] 0L]L] Pj]L] pL]L] M]L] L]L] ^L] L]L](]L] L]L]L]L]L]L]L]L]M]L]M] M]M] M] M] M]0M] M]@M] M]P!M] M]`%M] M]p)M] M]-M] M]1M] M]5M] M]9M] M]=M] M]AM] M]GM]KM]PM]KM] TM]KM]0F&]KM]@XM]KM]P^KM]`\M]KM]p,^KM]`M]KM]dM]KM]hM]KM]lM]KM]pM]KM]tM]KM]xM]KM] ~M]M] M]M]^M]M]M] M]?L]0M]?L]@M]?L]PM]?L]M]M]D^M]M]M]M]M]M]M]M]M] M]M]0M]M]M]M]M]M] M]M]0M]M]M]M]M]M]M]M]M]M]N]M]N]M] N]M]eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfafafdeaedsdeppmz:]:]J]J]:]:]J]J]:]:]J]K]:]:]]^0.01.02.03.04.05.00.510.0AA,QdkdumpAԣAPA$A AtAAAԣA AA$A]ITNR]IGAжAA@ жAA@xor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zerovP]vQ]n`P]8AA|qJNetBSDPaXj)LA]j)dAQ]0AXUA0AtU]BU]0AU]BU]AU]U]AU] V]A"V]CV]ATV]uV]AV]V]AV]V]data_abort_handlerbadaddr_readffs_blkallocffs_blkfreeffs_blkfree_snaph[h[h[h[        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?B|TC}TlBLnBpBDB DBNBDB <#[![ [j)ԢBA]] [@\V\W\W\W\W\,uT \h[T<\\\TX\l^Tt\tT\tT\W\W\W\,.C\W8\WT\Wp\W\LB\W\W\W\W\W4\WP\Wl\W\W\W\T8T\B\0C\1C0\WL\Wh\rT\1C\W\Wx\V\W\LB,\TBH\\B\dBd\lB\tB![@\V\piP\@.C\@.C\DkP\8tT \h[T<\\\TX\l^Tt\sT\sT\h.C\hsP\XjP\,.C\4tP8\tPT\d/Cp\ uP\@B\X.C\@.C\@.C\@.C\@.C4\@.CP\@.Cl\@.C\@.C\@.C\T8T\B\0C\1C0\iPL\uPh\rT\1C\iP\xPx\V\B\`C\LB,\TBH\\B\dBd\lB\tBD#[@\V\H>T\lyT\dfT\ zT\ZT\[T \h[T<\\\TX\l^Tt\|B\B\h.C\h.C\\/C\,.C\.C8\2CT\d/Cp\P2C\LB\ .C\cT\dT\XT\gT4\`kTP\0{Tl\4mT\PpT\$.C\T8T\B\0C\1C0\3TL\pTh\rT\1C\uT\q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_setkeytkip_decapl]$CC,CCCCCieee80211_hdrsizetkip_encap0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-/m]lCdClCC,CCCieee80211_hdrsizeieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_lateattachieee80211_node_table_initPPPPPPPPPieee80211_encapieee80211_mbuf_adjustieee80211_compute_durationieee80211_send_probereqieee80211_send_mgmtPieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_updateˆ]ˆ]ˆ]ˆ]Ј]ˆ]Ј]ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setup5]if_attachifaddrpref_ioctlarp_rtrequest^pE-E|Ed n;0&AvQkkXaM]uE o@o @o @]W]`]c]s]w]]/C]@& 3BI@{]] @(#0:]œ]Γ]ؓ]]]]]VVh+]$]+]8]M]Y]ђ]n]ђ]y]]ؓ]]]P8soo P q q sMkltΓ]ؓ]tt3]] hCҔ]] h&FILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!Zin4_cksum^^)ЁFhBBB^TdE`E(\T^LR\EXE\0EPSS^_OXeO,E(E\^:ChCXeO,E$E\LC^<pA^+@O^,B^C GXeO E(E\( G^)C GXeO E(E\( G^gC8FXeO(E\иF^C_OXeO(E\D]O`^TG?G|JGpIGJG`^ T<F8Fx\T`^R4F0F\SPSS`^JORO,F(Fl\`^CGRO,F(Fl\G`^C| GRO,F(Fl\( G`^)C| GRO,F(Fl\( G`^C tERO,F(Fl\rEl|E<}E`^CJORO,F(Fl\OO]m]y]]Uޡ]U]U2]U37]U1W]eFdF|qJv]U5v]XiF gF|qJip6_get_prevhdr(@AAA==(A*}E#(D(@AAA==A*deadcvj)GΠ]]I]I]I]IG]ITNR]IG]IG]I]I]I]I]ITNR]IG]IG\G]I]I(GhGGpGGGGdGPGV@DGXGGGtG,GGG$Gexec_initm]]*]i]t]]assert_sleepablemutex_vector_enterselfb\b\b\b\c\b\c\b\b\systemdrvctl{|@@ @@ rw_vector_enterAD 0  pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) D'I&I<&I\sysctl_lookupN]V] ]]o]ioexp_set_backlightT JJ%JHJJ!J]IT JJ4#J"JHJ]ITNR]IG]I|^f\L1J1J1JP1Jh1Jp1JX1J`1Jx1J1J1J$4J1J1J1J1J1J1J1J1J1J x"]{ @]?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥJJ2CJCJULn\j)JW]. .. Tn\@\V\J\dK\h.C\X.C\K \J<\8KX\Jt\J\0J\h.C\h.C\,.C\\/C\.C8\2CT\d/Cp\P2C\< K\ .C\`J\h.C\J\ K4\JP\h.Cl\xJ\`.C\$.C\J\J\0C\1C0\`JL\PJh\`J\1C\J\Jx\V\B\`Cnd6_rtrequestnd6_cache_lladdrnd6_storelladdrTHIS is A memory TEST patternearmzaurusj)\K]]nfs_boot_delroutelLt}LlL|Lnfs_sillyworkerLL8L @8t\,t\t\s\s\s\s\s\s\zs\^s\@s\*s\ s\r\r\r\r\r\r\xr\lr\ ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  w\\v\t\j)4L(;^5u\@\V\W\W\W\W\M \M<\LX\;Mt\@M\M\W\W\,.C\W\W8\WT\Wp\W\M\W\W\W\W\W4\WP\Wl\W\W\W\L\L\0C\XM0\WL\@.Ch\M\1C\W\Wx\@.C\W5dv\@\V\piP\@.C\@.C\DkP\DM \M<\LX\;Mt\M\M\h.C\hsP\,.C\XjP\4tP8\tPT\d/Cp\ uP\8uP\X.C\@.C\@.C\@.C\@.C4\@.CP\@.Cl\@.C\@.C\@.C\L\L\0C\XM0\iPL\uPh\M\1C\iP\xPx\V\B\`C5w\@\V\xM\TM\M\ L\$M \dM<\LX\;Mt\M\@-L\h.C\h.C\,.C\\/C\.C8\LT\d/Cp\P2C\M\ .C\M\M\M\M4\0LP\$Ml\M\M\$.C\L\L\0C\XM0\LL\ Mh\M\1C\$ M\Mx\@.C\DEL\`C]NdM4M]] ],]NHNxN5̇\\5X\L\=̇\\=X\L\V\؃\Vp\d\a]f]\\w]]/C]\|\P\~\]9]}\|\,|\ {\%  8  @!!@! ! #/ ''w0 g'' c0c@````` ```pmap_map_chunkEX9]dNN|qJ]|N]N]ԓN`^0N]N]N[[[pxa2x0_i2c_intr_sub%]\ OO O@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????`IOXIOIOWOHO@OOHONONOIOTIOHONOXNOHOHO0WOIOMO(IO0oOZOtXO[O|XOZOXOXOZOYOYOXOYOdYOXOXOkO4ZOlZOLYO @6cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IXq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث XXXXEEEE,,,,????kkkk::::AAAAOOOOggggꗗ𴴴sssstttt""""筭55557777uuuunnnnGGGGqqqq))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<U>UCU6UPUAUd8UWUXU|qJ||UHU~UxUuao_put|Uubc_uiomoveTU UlUUuvm_km_suballocUUUuvm_unmap_removevmmapbsy8AVhAV\\(\\swap_offswstrategysw_reg_strategyuvm_swap_initswap_on]I]I|V0V]I]ITNR]IG]I]I]I0V]I]I]IhVdVVV[$[\\ROOTSYSTEMISTTYMAPPEDMPSAFELOCKSWORK TEXT EXECMAP WRMAP WRMAPDIRTY XLOCKONWORKLSTMARKERLAYERCLEANCHANGINGDIROPD_]9^9^9^9^9^9^9^9^9^9^9^9^9^:^ :^:^:^':^/:^;:^C:^J:^U:^^:^g:^p:^w:^:^:^:^:^:^:^:^:^j9^o9^t9^*]y9^~9^9^9^9^ @` A]](;^]W]9];^%;^,;^ vcleanvrelelholdrelelvwakeupWWWWWLWDWWG,WV>^8\K>^0\ @>^(\ 6>^ \ ->^\ #>^\ >^\  >^\ >^\ =^\ =^\ =^\ =^\=^\=^\=^\=^\=^\=^\ =^\=^\v=^\ m=^\ b=^ l\ X=^d\ N=^X\ B=^P\ 6=^H\ )=^@\ =^8\=^0\ =^(\!<^ \"<^\#<^\$<^\%<^\&<^\'<^\(<^\)<^\*<^\+<^\,r<^\ -c<^\.S<^\/C<^\01<^\1"<^\@\x\\\\\\ \<\X\t\\\\\\\8\T\p\\\\\\\4\P\l\\\\\\\0\L\h\\\\\\\,\H\d\\\\4^XXXX,XXXtXXYERROR TIMEOU DF%X*XXt2XXd+X<.X%X*X0XXt2X]ITNR]IG<.XZC^|C^B^B^C^ C^.C^C^B^B^B^B^C^ C^.C^GC^C^C^C^ E^-0E^]ME^2'EWE^^E^eE^hE^E^E^E^])E^E^E^E^E^]^E^]E^sysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intrXXXXXtXXpXXX]IO^X4XXXXX\O^ XXXDXXX@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!P^P^P^ P^&P^,P^2P^8P^>P^DP^JP^PP^VP^\P^O^O^bP^hP^nP^tP^O^P^P^ P^O^O^O^O^O^O^O^O^O^O^wsevent_copyout_eventsYY@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?8\&h]&\&`\X\o`\\                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~\\a\)\2=\o\p\ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~:Y|;Y $Y]I-Y]I$Y]I$Y]IABCDEFGHIJKLMNOPQRSTUVWXYZ(PYGY8HY]IOY]IHY]IHY]I<d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !     ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_\$\ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] zssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846NBCDB     @ @ Zgg} j(sFK#(%strtoumaxstrtoimax0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG__subvsi3__subvdi3__negvsi2__negvdi2__mulvsi3__mulvdi3__addvsi3__addvdi3__absvsi2__absvdi2X^%]X^X^Y^Y^ Y^A]]W]XY^Y^Y^9]]Y^Y^#Y^],Y^1Y^&];Y^]]@Y^FY^JY^RY^VY^&]\Y^:]gntsPZPZ\PZ8Y^ ^lZY^tZY^tZn]\ZI]ZY^HlZ~Y^ VZgZ$gZrbmn(fZhZ0gZeZfZ8(Y^tcidpZoZsZZ0oZ nZnZnZnZ yekdoZsZmZ  Y^Y^<Z^ , Z^atadZZlZABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Z^loobZ`ZZyaraZċZ(Z܌ZZ Z^strtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALL_C700.201803151611ZNetBSD 7.1.2 (INSTALL_C700.201803151611Z) @(#)NetBSD 7.1.2 (INSTALL_C700.201803151611Z) 7.1.2NetBSDcryptofssppsptmatabusdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmbioaltmemtwacpuctlpadzfstprofisvvideohdaudiouhsorumpblknpfdtvfilemoniscsitpmmfiseepromdtracespiflashluaswapcttyphysconptcqmsofconswdfdccdcgdbpftunfiledescvidcconsoleopmsiplofromscrrndfcomjoymidisequencervcodawsdisplaywskbdwsmouseusbuhidulptscsibusraidugenwsmuxucomuriouscanneropenfirmbiconsdevisdnisdnctlisdnrchanisdntrcisdntelsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomsysmondmoverioapmdevsscomksymsisdnbchanepcomtslcdtwensmbbrgphynsphynsphyterqsphyinphyiophyexphylxtphyicsphysqphydmphypnaphyukphywdcpxaippxaintcpxagpiosaostpxadmacpxapcicpxartcpxamciziiczsspw100lcdlcdctlzkbdzapmld_sdmmcwi_pcmciane_pcmciapxauartcom_pcmciawdc_pcmciawsdisplay_emulcpu_mainbuspxapcic_scoopzmcipxaiicsdmmcbusmiiata_hlpcmciabuswsemuldisplaydevwskbddevapmdevifi2cbusdrivecontrollersocketindexchannelatapikbdmuxdackirqintrbaseapmsuspendpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentunknown error codeAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsmachine_archWarning IRQ's disabled during boot() %s%stotal memory = %s avail memory = %s single-skdb-k-dask-aquiet-q-vatabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitqatadowncan't alloc drive array qidlataactatdrnunable to create kernel thread: error %d couldn't establish power handler %scnfunable to create config thread: error %d atathata_thread: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: not ready, st=0x%02x, err=0x%02x recalpiomodesetmulti%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xfermatch_bootdisk: can't get label for dev %s (%d) no mainbus foundWARNING: double match for boot device (%s, %s) boot device: %s bpf_change_typebpfattachbpf_mcpy%s: descriptor not in listmaxbufsizepeers%s: bpf_setdlt: ifpromisc failed (%d) bpfops: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX, BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacedisksortfcfs%s: curaddr %#lx not in range_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: _BUS_DMA_BUFTYPE_RAW_bus_dmamap_sync: _BUS_DMA_BUFTYPE_INVALID_bus_dmamap_sync: map %p: unknown buffer type %d _bus_dmamem_map: size botchcd9660noplcd9660_reclaim: pushing activeRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660utf8_jolietCD001%/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode org.netbsd.kauth.system%s: %d silo overflow%s, %d ibuf flood%s device enable failed 'ns16550, broken fifons8250 or ns16450, no fifons16550a, working fifoAu1X00 UART, working fifons16650, no ERS, working fifoOMAP UART, working fifois_consolecan't re-init serial console @%lx txfifo disabled unable to allocate ring buffer couldn't establish interrupt configure failed, error=%d MEGAHERTZMODEM XJ2288compatconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_hook: malloc failedconfig_connect: malloc failedconfig_connect: can't connect with shared hook, type=%d id=%ldcnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference  %s@%dNetBSD-COREcrypto self-test failed: %scrypto_core_constant32[0] == le32dec(&sigma[0])crypto_core_constant32[1] == le32dec(&sigma[4])crypto_core_constant32[2] == le32dec(&sigma[8])crypto_core_constant32[3] == le32dec(&sigma[12])block[i] == le32dec(&out[i*4])expand 32-byte k%dKB/%dB %d-way %s L%u %cI%cT Unified cache %dKB/%dB %d-way L%u %cI%cT Instruction cache %dKB/%dB %d-way %s L%u %cI%cT Data cache isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-SARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A15 r2Cortex-A15 r3Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15eabioabiNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcachedead fs operation useddeadtag VT_NON, dead vnode m_pulldown malfunctionlr, rrx, %s r%d, %s #%dthumb insn , #%d#%d ; #0x%x[r%d][r%d#0x%03x#0x%02x{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxstc2L#vstcmcrr#&mrrcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabssqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfsrfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsub%s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu) dkdrn%s at %s (%s) deleted %s%u: unable to attach pseudo-device %s at %s: %s %s: %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) dmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroyno media presentDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interface: failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbufEthernet address %s %s: device timeout %s: NIC memory corrupt - invalid packet length %d ELF#!exec_scriptvmcmdkillsextendscalls: 3Com internal media interface ignoring this PHY, non-zero instance no media present exphy_service: can't isolate 3Com PHYFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: Misaligned Kernel-mode Program Counter %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)start = %d, len = %d, fs = %s offset=%d %ld cg %d ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapuid %d, pid %d, command %s, on %s: %s dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s %s: bad sizebad block %lld, ino %llu bad blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapifree: dev = 0x%llx, ino = %llu, fs = %s ifree: freeing free inodedev = 0x%llx, block = %lld, fs = %s blkfree: freeing free blockblkfree: freeing free fragfile system full %s: write failed, file system is full trimwqtrimwqcvffs_discarddata drain timeout dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevbad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%llx, optim = %d, fs = %s ffs_realloccg: bad optimifree: range: dev = 0x%llx, ino = %llu, fs = %sdmode %x mode %x dgen %x gen %x size %llx blocks %llx ino %llu ipref %llu ffs_valloc: dup allocfree inode %llu on %s had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on listffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dffsdoclusterreaddoclusterwritedoreallocblkslog_changeoptffs_modcmd: can't listen on system scope. ffsinoffsdino1ffsdino2, not mountingffs_reload: dirty1appleufs%s: unknown ufs flags: 0x%08x%s ffs_reload: dirty2ffs_mountfs: block size (%d) > MAXBSIZE (%d) %s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: lost blocks %lld files %d %s: `-o softdep' is no longer supported, consider `-o log' update: rofs mod%s: nonsync dir writeffs_write%s: typetag VT_NON, fifo with %d readers and %d writersfifordfifowr/usr/src/sys/miscfs/genfs/genfs_io.cgenputgenfs: bad op addr 0x%xiicintr: I2C bus unable to create intr thread i2c-indirect-configi2c-child-devicescookiecompatibleWARNING: ignoring bad device address @ 0x%02x %s at %s addr 0x%02xWARNING: intr handler list not empty WARNING: proc handler list not empty i2cexeciic at %sicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeout(src=%s dst=%s tgt=%s)inet6icmp6rediracceptredirtimeoutnd6_prunend6_delaynd6_umaxtriesnd6_mmaxtriesnd6_useloopbacknodeinfoerrppslimitnd6_maxnudhintmtudisc_hiwatmtudisc_lowatnd6_debugnd6_drlistnd6_prlistmaxqueuelensanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ENOBUFS in icmp6_error %d ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceinvalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: WEP data frame too short, len %u [%s] unable to pullup %s header wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u %s: control frame[%s] Missing ExtIV for AES-CCM cipher not enough data in following buffer, m_len %u need %u [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt [%s] Discard frame due to countermeasures (%s) TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, WMEtoo short, len %u[%s] discard %s frame, ssid mismatch: too short (1): len %uwrong version %xnot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %uduplicateseqno <%u,%u> fragno <%u,%u> tid %udata too short: expecting %uunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %u%s: unable to allocate VLAN tag mgttoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortERPbad len %uunhandledid %u, len %uno scan.ratesbad scan.rates len %dno scan.ssidbad scan.ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s link-layer statistics and controlsieee80211IEEE 802.11 WLAN statistics and controls%s: sysctl_createv failed, rc = %d client/peer stations%s: sysctl_createv failed (rc = %d) vap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table 0x%p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %s: free all nodes in %s table %s %s table %s: %s[%u] still active ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set:%s%u start chan %u passive%s: end %s scan refcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate %s macaddr bssid chan rssi rate flag wep essid%s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s %s table, inact %u Cannot allocate key index map with %u entries scanno WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!%s: cannot expand storage not enough room, need %u got %zu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x ieee80211_ref_node (%s:%u) %p<%s> refcnt %d rcvif not null[%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %d (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternalsdlif_%s: warning: unable to delete rtentry @ %p, error = %d inetip6ifqmaxlendropsorg.netbsd.kauth.network%s%dif_detach: WARNING: AF %d not purged too many interfaces%s: could not attach sysctl nodes sndq%s: ifioctl_attach() failedinvalid argument to %sgateway route is not ourscould not allocate llinfohost is not on local networkarplookup: unable to enter address for %s@%s on %s (%s) keeprefreshlog_movementslog_permanent_modifylog_wrong_ifacelog_unknown_networkarp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arp from %s: new addr len %d, was %d arp_rtrequest: bad gateway value arp_rtrequest: malloc failed %s(%s): sockaddr_dl_init cannot failarpresolve: can't allocate llinfo on %s for %s arpintrrevarp%s: discarding oversize frame (len=%d) %s: can't handle af%d ethermulticastlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't alloc mem for enet addr can't map mem for enet addr can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSVECFD605 PCMCIA EtherNet CardSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0NDCDYNALINKL10Cwiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterigmppligmpinmltplsubnetsarelocalhostzerobroadcast%d.%d.%d.%din_controlinvalid argument to in_lifaddr_ioctl%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuin6_unlink_ifa: autoconf'ed address %p has no prefix Couldn't unlink in6_ifaddr from in6_ifaddr ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_if_down: %s marked detached in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: in6_setscope failed in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. invalid argument to in6_lifaddr_ioctlnd6_prelist_add succeeded but no prefix in6_control: failed to create a temporary address, errno=%d in6_if_up: %s marked tentative in6_if2idlen: unknown link type (%d) in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 headergenerate_tmp_ifid: never found a good ID %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: cannot assign link-local address %s: didn't unlink in6ifaddr from list in6pcbplinternet6inpcbplinternet/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d Detecting hardware...fork initcannot mount root, error = %d pgdaemonfork pagedaemonioflushfork syncerfork aiodoned%s %s (%s)/sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidclockratehardclock_ticksprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetmsgbufsizeipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemsgbufmaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfoposixsemmaxmachinemodelncpubyteorderphysmemusermempagesizealignbytescnmagicphysmem64usermem64ncpuonlineostypeosreleaseosrevisionhostnamedomainnamerawpartitionkernvfshwddbvendorsecurityi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfacei82553 10/100 media interfaceip6flowplcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s forwardingredirectmaxfragpacketsaccept_rtadvrtadv_maxroutesrtadv_numrouteskeepfaithlog_intervalhdrnestlimitdad_countauto_flowlabeldefmcasthlimkame_versionNetBSD-currentuse_deprecatedrr_prunev6onlyauto_linklocalanonportminanonportmaxlowportminlowportmaxuse_tempaddrprefer_tempaddrtemppltimetempvltimemaxfragsuse_defaultzonemcast_pmtuanonportalgoavailableselectedreserveneighborgcthreshmaxifprefixesmaxifdefroutersmaxdynroutesip6_init%s: off < sizeof(struct ip6_hdr)ip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s pim6register_mifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not spliticmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmpmaskreplreturndatabytesbmcastechoICMP: redirect failed to register timeout for route to %x, code %d icmp_erroricmp lenttlforwsrcrtdirected-broadcastallowsrcrtmtudiscmtudisctimeoutcheckinterfacerandom_iddo_loopback_cksumipfrenplAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockinterruptCondition variable%.*spid %d (%s): %s write of %zu@%p at %lld failed: %d cpu%dfdcloseincrease kern.maxfiles or MAXFILESfdfilefile2dup2EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMERexecargsshould not happenpspawnlwpwaitkernel mapping failed %d netbsdinit died (signal %d, exit %d)orphaned traced processincrease kern.maxproc or NPROCforkmxforkulim%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbyidle/%ucreate_idle_lwp: error %dkthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx softint%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)swapperWARNING: module error: can't find builtin dependency `%s'too many required modules %d >= %dbuiltin module `%s' failed to init, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size %zu != %zuDEBUG: module: TRUEFALSEunload requested for '%s' (%s)module `%s' not foundmodule `%s' busy (%d refs)cannot unload built-in secmodel module `%s'cannot unload module `%s' error=%dunloaded module `%s'module `%s' declined to be auto-unloaded error=%dbuiltin module "%s" init failed: %dmod_unld/stand/%s/%d.%d/modulesbuiltin %s failed: %d moduleautotimekern.module.path=%s modunloadmodule_init: %dmodule_rele: gonemodule `%s' pushed by boot loader already existsunable to load `%s' pushed by boot loader, error %dunable to fetch_info for `%s' pushed by boot loader, error %ddependentrecursion too deep for `%s' %d > %duse -f to reinstate builtin module `%s'%s module `%s' already loadedout of memory for `%s'cannot fetch info for `%s', error %dmodule `%s' built for `%d', system `%d'forced load, system may be unstableincompatible module class for `%s' (%d != %d)dependency name mismatch (`%s' != `%s')circular dependency detected for `%s'required module name `%s' longer than %dself-dependency detected for `%s'recursive load failed for `%s' (`%s' required), error %dunable to affix module `%s', error %dmodule properties failed for %smodcmd function failed for `%s', error %dmodule `%s' loaded successfully%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistplist load returned error %d for `%s'noautoloadautoloading is disallowed for %sowner field : %#018lx wait/spin: %16d/%d locking against myselfmutex_init: impossible typeMutexmutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) %s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: class suspend %s: driver suspend %s: bus suspend %s: suspend enter %s: suspend exit Flushing disk caches: Suspending devices:%s: bus resume %s: driver resume %s: class resume %s: resume enter %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueueprocplproc2proc_args%s (pid %d) changing logname from %.*s to %s rasplimitplpstatsplcurprocrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitrndreadrndsampleAnonymousprintfautoconfrnd: source "%s" failed continuous-output test. rnd: source "%s" failed statistical test.rnd: detaching source "%s".rnd: bad seed length %d rnd: bad seed checksum requesting entropy from dead rndsink: %prndsink %p in unknown state: %drndsinkdestroying dead rndsink: %pcacheht_timebalance_periodmin_catchtimesoftintskpreempt_priupreempt_prisched_cpuattach: could not allocate the runqueuerunqueue pullrunqueue pushrunqueue stayrunqueue localizeowner/count : %#018lx flags : %#018x Reader / writer lockrwlocksigactsksiginfosorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d WARNING: softint_establish: table full, increase softint_bytes softdissoft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorysoftint_picklwpuse one of: %s[a-%c] none halt reboot wedge:parsediskmd0Cannot open "md0" (root) (default %sdump device (default %sb)file system (default %s): use one of: genericunknown device major 0x%llx %s%lludevice %s (0x%llx) not configured root on %scan't determine root device dumps on %ssched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesetrunnable: lwp %p state was %dWARNING: negative runtime; monotonic clock has gone backwards pid %d is killed: %s exceeded RLIMIT_CPUpid %d, command %s, is killed: %s kernel %sassertion "%s" failed: file "%s", line %d p->sysctl_child == NULL/usr/src/sys/kern/kern_sysctl.c%s: rnode %p wrong version sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_createv: sysctl_create(%s) returned %d sysctl_create succeeded but node not found?! sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummyptimerplptimersplnanoslppid %d attempted to set the (obsolete) kernel time zone callout_init_cpu (1)callout_init_cpu (2)late/%ucalloutwait/%utodr_attach: TOD already configured WARNING: preposterous time in file system WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time tstilepltstileturnstile_unsleepuidinfoproccntlwpcntlockcnt%08x-%04x-%04x-%04x-%04x%04x%04xbind failed %s: this kernel is not support SL-C1000 couldn't register event handler fictitious%s: unable to flush cache %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors lddrnlddtch%s: not drained : <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %sattachcouldn't create thread %d-bit width, bus clock %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d task timeout100baseFX, 100baseFX-FDX, LXT970 10/100 media interfaceLXT971/2 10/100 media interfaceThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directory base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!mdidle%s: cfattach_attach failed md%d: internal %s image area mfs_initminiroot() called more than oncemfsmfsidlmfs_rootmfs_ioctl not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemii_attach: phyloc and offloc specifiedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverbosemiiautmii_phy_setmedia: MASTER on wrong mediaHomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXcouldn't establish power handlermulticast_kludgein6_savemkludge: no kludge spacemsdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld msdosfs_reclaim(): pushing active. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfsRRaArrAamsdosmsdosfs_write(): bad file typerename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu regen_tmpaddr: failed to create a new tmp addr, errno=%d nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu unspecnd6_lookup: failed to lookup %s (if = %s) nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)Cannot enable an interface with a link-local address marked duplicate. %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s.%d: sockaddr_dl_setaddr(, %d, ) failed on %s %s: failed to join %s (errno=%d) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) from == NULL in nd6_cache_lladdr%s: something odd happens %s: sdl_alen == %u, dst=%s, if=%s scope error in router list (%s) scope error in prefix list (%s) nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_output: source can't be determined: dst=%s, error=%d nd6_newaddrmsg: RTM_GET operation failed for %s (errno=%d) nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required %s: possible hardware address duplication detected, disable IPv6 nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rtpref: impossible RA flag %x nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d pfxlist_onlink_check: failed to make %s/%d onlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) in6_tmpifadd: failed to find a good random IFID in6_tmpifadd: failed to find a unique random IFID in6_tmpifadd: ifa update succeeded, but we got no ifaddr defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd_ra_input: lower CurHopLimit sent from %s on %s (current=%d, received=%d), ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p prelist_update: IFID undefined (%s) prelist_update: invalid prefixlen %d for %s, ignored in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: %s is already configured in6_ifadd: failed to make ifaddr %s on %s (errno=%d) prelist_update: failed to create a temporary address, errno=%d nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed ext2fscompat_netbsd32compat,exec_elf32/emul/netbsd32msgcontrolmsghdrloadavgnfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtd%s: del route, error=%d nfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s %s (%d) from nfs server %s impossible packet lengthshort receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs_reclaim: pushing activenfs send error %d for %s nfsd send error %d timertimer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad v_usecountDP83840 10/100 media interfaceDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815 10/100 media interfacepcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! Cannot allocate cfe entry CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for pcmcia_check_cis_quirks: malloc pfpcmcia_check_cis_quirks: malloc cfePCMCIA MBH10302pktqsyncpktqrenqUNKNOWNCASIOCompaqHPHP Jornadakmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lxAm79C901 HomePNA 1.0 interfacerandom_startrandom_pickdoublehashrandinc addr 0x%lx-0x%lx intr %dPXA270Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrapped: can't map registers Stray DMAC interrupt for unallocated channel %d : DMA Controller Can't map registers! dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load faileddmac_dmover_attach: bus_dmamap_create faileddmac_dmover_attach: bus_dmamem_alloc faileddmac_dmover_attach: bus_dmamem_map failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller failed to hook main GPIO interrupt unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %dunable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmdunsupported bus frequency of %d KHz : MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus pxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented QS6612 10/100 media interfaceMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find our annotation rn_delete: couldn't find us radix already initializedrn_init: radix functions require max_keylen be set rn_initrn_init 2delayed rn_inithead failedrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!rip_usrreqrip_abortrip_acceptpcblistrip6_usrreqraw6raw_usrreq%d %llu %uurandom%urndtemprndctxrtentplrttmrplrt_init_done == 0/usr/src/sys/net/route.crt_timer_add: rtq_count reached 0 rt_timer_queue_remove_all: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtfree 210base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT route_purgeifroute_abortroute_acceptroutertable%s: message too long%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countrtts: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registersa6_recoverscope: assumption failure (non 0 ID): %s%%%d couldn't create dma map. (error=%d) mmctaskqcouldn't create task thread "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't alloc memory (sdmmc function) couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short unknown tuple code %#x, length %d %s: CIS version %u.%u couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d couldn't read CIS can't change bus clock can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x can't change high speed can't re-read EXT_CSD HS_TIMING set failed unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x SD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed switch func mode 1 failed: group 1 function %d(0x%2x) write-protected copy-cred-on-forkmodelsTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsorg.netbsd.secmodel.suseris-rootorg.netbsd.secmodel.securelevelis-securelevel-aboveorg.netbsd.secmodel.extensionsTraditional NetBSD: Extensionsextensions_modcmd::init: secmodel_register returned %d curtainusermountuser_set_cpu_affinityextensions_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: Securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: Superusersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d spec_ioctlspec_read typespec_write typespec_fdiscard: not a device spec_close: spurious pgrp refspec_close: not specialdev %llu, %llu spec_node_init: unable to allocate memoryspec_node_destroy: corrupt hashusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interface dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded configure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlers%s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x cfgmiscdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: %s (%zu < %zu)config_devalloc: memory allocation for device softc failedconfig_devalloc: memory allocation for device_t failed%s: could not expand cd_devsconfig_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_detach: forced detach of %s failed (%d)%s: unable to allocate callbackconfig_defer: can't defer config of a root deviceconfig_defer: unable to allocate callbackconfig_interrupts: unable to allocate callbackconfig_attach: allocation of device softc failedFound %s (root)%s at %sWARNING: power management not supported root device %s not configured done. WARNING: %d error%s while detecting hardware; check system log. detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_alloc: no strategyureadc: non-positive residureadc: non-positive iovcntcprng %s: reseeding with partial entropy cprng %s: NIST CTR_DRBG reseed failedurandomarandomcprng %s: NIST CTR_DRBG instantiation failedcprng %s: creating with partial entropy sysctlcprng %s: NIST CTR_DRBG failedbdevsw_attach: block majors exhaustedcdevsw_attach: character majors exhaustedwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)disk_attach: can't allocate storage for disklabelno raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-infodos partition I/O errormbr partition exceeds disk sizeBEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partitionbad sector table I/O errorbad sector table corrupted%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table type KMGTPE kMGTPE%qu%s%c%sdisknamesiostatnamesiostatsiostat_alloc: cannot allocate memory for stats bufferiostat_free: iostat_count == 0%s: busy < 0 iostat_unbusyipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpusetkcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-2048kmem-4096kmem-8192kmem-16384kmem-8kmem-16kmem-24kmem-32kmem-40kmem-48kmem-56kmem-64kmem-80kmem-96kmem-112kmem-128kmem-160kmem-192kmem-224kmem-256kmem-320kmem-384kmem-448kmem-512kmem-768kmem-1024not modular%s error: %s: %s lock address : %#018lx current cpu : %18d current lwp : %#018lx lock errorklogrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) page %p, nmissing %d, time %u %s: too large itemsperpage(%d) for PR_NOTOUCHpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpupool_get: %s: page emptypool_put: %s: page header missingMust specify a pool to print. POOL CACHEPOOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer entry uncontended %llu contended %llu cache layer empty groups %u full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p empty cache groups: (null)Skipping crash dump on recursive panic panic: %s: table is full - %s %s: table is full pserializeexclusive accesspsrlzspecificdata_domain_delete: not implementedspecificdata_setspecificvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countxclocvxchicvcrosscallunicastxcallxcall/%ufiledelaydirdelaymetadelaysyncer vnode aio_process: invalid operation code aioworkaiodoneaio_jobs_poolaio_lio_poolposix_aioaio_listio_maxaio_maxsys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s parkedmqmsgplposix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqsendcvmqrecvcvpsetpsets_max%d:1,%d:2posix_schedpri_minpri_maxdirect_selectnewrenocubicTCP: invalid wscale %d, assuming %d tcpipqepltcp_pulloutofbandsynplConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULLtcp_outputsackholepltcp_inittcpcbpltcp_new_isstcp_usrreqrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscompat_42cwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesglobalmaxholesglobalholeslocal_by_rttdropiss_hashabcaggressivemsltremoteremote_thresholdvtw%s: af %dtcp6%s: could not allocate %zu bytes for hash anchors%s: could not allocate %zu bytes for fatp_t array%s: could not allocate %zu bytes for vtw_t arrayttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutftkstatninnoutcanccrawccqsizettyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc udp6_output: IPV6_V6ONLY option was set for a connected socket udp6udp6_usrrequdp_usrrequdp_abortudp_acceptudpchecksumufs_reclaim: pushing active%s: bad dir ino %llu at offset %d: %s bad dirFirst bad, reclen=%#x, DIRSIZ=%lu, namlen=%d, flags=%#x, entryoffsetinblock=%d, dirblksiz = %d Second bad mangled entryi_size too smallufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2hard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdaccfaccf_streamseqpacketdgram%s: source too long, %d < %d bytes(unknown socket family %d)unix:inet:inet6:msizemclbytesnmbclustersmblowatmcllowatmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)m_copym: off %d, len %dm_copym: m == 0, off %dm_copym: m == 0, len %d [!COPYALL]m == NULL in m_pulldown()unixpsemksemsomaxkvasbmaxsokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembfreembdatambheadermbsoptsmbftablembcontrolmboobdatapiusrrequnp_threadunp_connect1unp_disconnect1uipc 1uipc 2unp_attachunpgcuipc_init %duipc_usrrequipc 4: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d undefined instruction %#x in kernel at %#lxamapplcownowcownowpageanonpllivelockuao_getpageuao_getuao_create: hashinit swhash faileduao_create: swslots allocation faileduaoeltpluao_flush: strange, got an out of range flush (fixed) uao_put%s: impossibleuao_detubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to allocate inactive queue headsubc_init: failed to map ubc_objectubc_alloc%s: error=%d udv_detachudv_faultudv_attachflt_noram5flt_pmfail1flt_pmfail2anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2fltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpgloanagainloanzeroloanuopguser_va0_disablevmmpeplvmspplvm_map%s: kernel object %p %p vmmeteruvmexpuvmexp2maxslpuspaceidlezerominaddressmaxaddressuobjwirepguvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_physload: page size not set!uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_initWARNING: unable to allocate %ld page color buckets uvm_pagealloc_strat: bad strat %duvm_page_bootstrap: no memory pre-allocatedemergvapager_mappagedaemon: deadlock detected! anonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglallocractx%s: swapdev not in list%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning of swap...stopping swap on %s failed with error %d uvn_fp1uvn_fp2vfp fpscr trapsbuf mem pool index %dforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbflushbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestedcachegcnamecache_statsncachenchinit %dnamecacheentries scannedentries collectedover scan targetunder scan targetforced reclaimscwdidirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkspnbufpllf_findoverlap: defaultlockfchrooted pid %d uid %d (%s) detected outside of its chroot namei_simple_convert_flags: bogus sflags /../earmzauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dot%s: failed to start extattr: error = %d unmount: dangling vnode%sunmounted %s on %s type %s forcefully unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system failedvnode @ %p, flags (%s) tag %s(%d), type %s(%d), usecount %d, writecount %d, holdcount %d freelisthd %p, mount %p, data %p lock %p vflushbuf: not dirty, bp %pvflushbuf: dirtyVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dfdesckernfsafsfstchgfstcnt%s: cannot reclaimvnodeplvcacheplvdrainvrele%s: bad ref countdead but not cleanvndsbusy%s: holdcnt vp %pvcache%s: neg numoutput, vp %pxattr-namexattr-valxattr-listsystem.user.security.trusted.vmapbufvunmapbufvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_bwrite: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)Sharp Zaurus frame bufferSharp Zaurus LCDstdstandby immediate command didn't complete wd_standby: status=%s wdstart1: bad return code from ata_bio()ST506%s: (error not notifieddevice faultdevice timeoutchannel reset, retryingsoft error (corrected) wddump: try againwddump: polled command has been queuedwddump: unknown atacmd code %dwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %dESDIwd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEFORCE_LBA48quirks %s drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing wd_setcache command not complete wd_setcache: status=%s flush cache command didn't complete wd_flushcache: status=%s trim command didn't complete wd_trim: status=%s wdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASatarst%s:%d: %s %s:%d:%d: %s %s channel %d: reset failed for drive 0 drive 1__wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xferlost interrupt type: %s tc_bcount: %d tc_skip: %d missing untimeoutatapollatadrdyatacnfwdccmdatardlcan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDLucent/Prism/Symbol 802.11 controlstimeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x detect auto increment bug, try again wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed %s: cleaning outstanding rssadapt descriptor for %s failed to allocate %d bytes on NIC timeout in alloc %s: interface not running tx buffer allocation failed LucentSymbol could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI)%s: emergency X server detach added (%s, %s emulationwsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_common_attach: no memory kbdmux %d: console (%s, %s emulation), using %swsswscreen %d deleted wsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulEDIDdumbwsemul_vt100_output_c0c1: ESC in kernel output ignored vt100OIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~[>24;20;0cP2$uP0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d%s: unknown version %dwsevent_readccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldface mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmux: attach out of memory %s: disconnecting from %s : pseudo power management module : I2C controller unable to attach PXA I2C controller unable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) %s: not configured. can't map bus space %s: not configured zssp: zssp_ic_send: invalid IC %d %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%sKernel RNG "%s" monobit test FAILURE: %d ones Kernel RNG "%s" poker test failure: parameter X = %lld.%lld Kernel RNG "%s" long run test FAILURE: Run of %d %ds found Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d < %d) Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d > %d) %s: invalid base %ddivide by 0/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvsi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvdi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvsi2.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvdi2.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvsi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvdi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvsi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvdi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvsi2.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvdi2.cp->p_refcnt != 0/usr/src/sys/lib/libkern/../../../common/lib/libppath/ppath.cunusedv6v7sysvv71kv8otherhpfsadoshfsfilecorentfsraidframejfs2vinumudfsysvbfsefsnilfsminixfs30%llo%s:%d: abort in %sstringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl %s %s SIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %d Unable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... kern.driversinvalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@FHlll@m mm.   %8E[l @@ffsܚt2r$-t26>B%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedforcemount_puffsrumprump_%smount_%sexec:Cannot create pipeCannot open fd to mount program%s not found for %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfsysvbfsefsnilfsstrdup\flamq  Aw@x bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:ruserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.\flamq  Agl@hlwm@/ l@FHo:mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %ssoftdep\flamq  Agl@hlw@bshortnameblongnamebnowin95bgemdosfsbmntversionedbronlybwaitonfatbfatmirrorusage: %s [-9Gls] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9u:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, flags=%s unknown %s id: %sinvalid file mode: %s\flamq  A/w@= @ i@ȅ ", 7@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacusage: %s %s %s %s %s %s [-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-I readdirsize] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path nodeconflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %drecvrpc: reject, astat=%d, errno=%d getport: %scallrpc: error = %d sendrecv: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s-e <YEmAa%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directoryfree space %number of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %%-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spacefsinit: inode value out of range (%llu). illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2 Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()vN<:8:4:zN0:,:(:N$: ::usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodesDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s Warning: %s %s End-of-input encountered while extractingwrite error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino list%s%ld%lluRSTTMPmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGZZZ[[D[n[[[[[\F\t\\\\"]B]UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1 pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUGHRBD M@dmCXLS1@2 cp0123456789abcdefatalkhopcountinet6llinfolockrestnostaticproto1proto2recvpiperttrttvarsendpipeshowssthreshx25xnsxresolveflushallnoclonednocloningnoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: metric %d, flags: if# %d, what: re-associatedisassociatescan completejoinmichael (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [ -fnqSsv ] cmd [[ - ] args ] Internal ErrordfnqSstvCannot allocate memory%s, %sold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_CHGADDR: address being changed on ifacelink#%d%-*.*s %-*.*s %-6.6s GatewayFlagsAppleTalkEncapInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'hw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)%-*s %*s %8s %8s %8s %s DeviceUsedAvailCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated = %s used, %s available. total: %ld %s allocated = %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedfRfetch_url Kmsendrequestrecvrequest\ ***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20150912%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (ftp_debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnecteditepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Receiving HTTP reply: %sInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'fetch_ftp: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/usr/src/usr.bin/ftp/fetch.crcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. PASVEPSVCan't create socket for data connectionwrong server: return code must be 229 Passive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandsentlocal: %s %s: not a plain file. /usr/src/usr.bin/ftp/ftp.csndbuf_size > 0Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N netrc] [-o outfile] [-P port] [-q quittime] [-r retry] [-s srcaddr] [-T dir,max[,inc]] [-x xferbufsize] [[user@]host [port]] [host:path[/]] [file:///file] [ftp://[user[:pass]@]host[:port]/path[/]] [http://[user[:pass]@]host[:port]/path] [...] %s -u URL file [...] Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. anonymoushttpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s%s/.netrc: %s/.netrcFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)xsignal_restart: called with signal %d %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. ftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) %s; %s aborted. operationCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamNetBSD gzip 20150113malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.3failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintf compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%can't read stdin(stdin): unexpected end of file(stdin)123456789cdhlVusage: %s [-123456789cdhlV] [ [ ...]] can't stat: %s%s is a directory%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzD"D#D%D'L"`"4"S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESlikrklkukdkPkNkh@7kDhcxndaticmvb|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.syslessLESSKEY_SYSTEM/etc/syslessLESSKEY.lessWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:s:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec %s: missing phone number tbprdldvcupndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected %s: must be interactive %s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dlink down PHONESbad baud rate %d%s [EOT] can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-iaua<+Zg`+a"a+/a\+7a\ܽ+CaLa+[aca+{aa+aa+a^l+a\+a\+a\.+aa+a+aa+b\+bt+ba+%b6b+BbOb+Tb]bx+dbLa+mbub+bb+b^l+b\ػ+b\׼+bLa0+b\/+bb+c^l.+ c\L+c\K+eOk e{kzQgggggggg.`ggtg(gggMhh hhhh%h)hF/hhw.disknamesQ2IчHtZIчH2r IчH=rGy=iG}p3Dh& pSFH0eC¶ SFU0eCh-чHoIчHF-чHp (s*K>;p Hah!IdontNeedEFI      !"#$%&  XP6YK6[ T6\P6/bin/ksh/bin/cshmdnsd+nsswitchNoaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-25s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)51210242048409681921638432768FFSv1 [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed usage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] Installation messages in Englishen_US.ISO8859-1YesSomeNoneOnOffunchangedDelete?reinstall sets forupgradeNetBSD/zaurus 7.1.2 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksaverage file size (bytes)mount point (or 'none')secMBNetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk into multiple BSD partitions. You must now set up your BSD disklabel. You can use a simple editor to set the sizes of the NetBSD partitions, or keep the existing partition sizes and contents. You will then be given the opportunity to change any of the disklabel fields. The NetBSD part of your disk is %d Megabytes. A full installation requires at least %d Megabytes without X and at least %d Megabytes if the X sets are included. Choosing megabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'. MB Cylinders Sectors Filesystem Mount point?Size for %s in %s?Change input units (sectors/cylinders/MB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionAccept partition sizes. Free space %d %s, %d free partitions.Reduce partition sizes by %d %s (%u sectors).The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated to %d %s. Type enter to continue This disk is too large for a disklabel partition table to be used and hence cannot be used as a bootable disk or to hold the root partition. We now have your BSD disklabel partitions as: This is your last chance to change them. Start %3s End %3s Size %3s FS type Newfs Mount Mount point --------- --------- --------- ---------- ----- ----- ----------- %9lu %9lu %9lu %-10s %-5s %-5s %sShow all unused partitionsPartition sizes okThe current values for partition `%c' are, Select the field you wish to change: MB cylinders sectors ------- --------- --------- FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9sToggleRestore original valuesSelect the typeother types%s Special values that can be entered for the size value: -1: use until the end of the NetBSD part of the disk a-%c: end this partition where partition X starts size (%s)%s Special values that can be entered for the offset value: -1: start at the beginning of the NetBSD part of the disk a-%c: start at the end of previous partition (a, b, ..., %c) start (%s)Badly formed sector number Select file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device /dev/%s%c on %s failed. The extraction of the selected sets for NetBSD-7.1.2 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-7.1.2 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-7.1.2 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-7.1.2 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. Available CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory %s: %s. Install aborted. Delete after installRelease set %s does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Your choices have made it impossible to install NetBSD. Install aborted. The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that /dev/%s%c is not a BSD file system or the fsck was not successful. Try mounting it anyway? (Error number %d.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbols%-27s %3sSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions %c and %c overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file %s Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-7.1.2 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-7.1.2 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemyes or no?Hit enter to continueChoose your installationSet sizes of NetBSD partitionsUse existing partition sizesMegabytesCylindersSectorsInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryFetch and unpack pkgsrc for building from sourceNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint or 'raid' or 'cgd' or 'lvm'?Extended partitioningEdit BSD partitionsEdit and save MBRSwitch to GPTSwitch to MBRSet disk nameFormat as RAIDFormat as LVM PVEncryptBootable flagSafe eraseUndo changesUnconfigureEditForce umountFill with zerosFill with random dataFill with crypto data0 - No parity, only simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity.RemoveAddThis removes all partitions on the disk. Do you want to continue?Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG) Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. MBR partitions, if desired, must be created before editing the disklabel. To use RAID, LVM, or CGD: 1) Create BSD partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM. raid%d (level %1d) on %-34s %11uM EMPTY RAID!Disks: %33sSpares: %32sRAID level: %22dnumRow: %22dnumCol: %22dnumSpare: %22dsectPerSU: %22dSUsPerParityUnit: %22dSUsPerReconUnit: %22dMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID: PATH NOT DEFINED! vnd%1d on %-51s ASSIGN vnd%1d on %-45s %11uMFile path: %29sAssign exist image: %20sSize: %22sMRead-only: %22sSet geometry by hand: %18sBytes per Sector: %18sSectors per Track: %18sTracks per Cylinder: %18sCylinders: %22sFile path?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders? DISK NOT DEFINED! cgd%1d %-48s %11uMBase device: %24sEncryption: %24sKey size: %24dIV algorithm: %24sKey generation: %24sVerification method: %17sDisks in VG: %-44s %20sM EMPTY VG!PV's: %34sName: %34sMaxLogicalVolumes: %20sMaxPhysicalVolumes: %20sPhysicalExtentSize: %20sName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)? Logical volume %-35s %11uMSize: %33dMRead-only: %27sContiguous: %27sLogicalExtentsNumber: %18sMinor number: %26sMirrors: %27dMirrorLogRegionSize: %18sPersistent minor number: %14sReadAheadSectors: %18sStripes: %27sStripeSize: %27sZeroing of the first KB: %13sLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?8 character username to addDo you wish to add this user to group wheel?Delete partitionInstalling boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)We are now going to install NetBSD on the disk %s. NetBSD requires a single partition in the disk's MBR partition table, this is split further by the NetBSD disklabel. NetBSD can also access file systems in other MBR partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single MBR partition used to cover the entire disk. If you want to install more than one operating system then edit the MBR partition table and create a partition for NetBSD. A few hundred MB is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least 5GB if you want to build NetBSD itself. Which would you like to do?Edit the MBR partition tableUse the entire disk Total disk size %lu %s. Start(%3s) Size(%3s) Flg Kind ---------- ---------- --- ---------------- %10d %10d %c%c%cYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s%ssize (maximum %d %s)Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s) %s%sStart (in %s)Partition kind (0..255)There can only be one extended partitionThe Current MBR partition table is shown below. Flgs: a => Active partition, I => Install here. Select the partition you wish to change: Partition table OKDon't changeOther, input number Do you want to re-edit the MBR table (or abandon the installation)? There is no NetBSD partition in the MBR partition table.There are multiple NetBSD partitions in the MBR partition table. You should set the 'install' flag on the one you want to use.Setting up the DOS partition table ... Rewrite of MBR failed. I can't continue.Log ended at: %s # Script ended at: %s sysinst terminated. /usr/share/sysinst/catalog//usr/share/sysinst/catalogsysinstmsgs.sysinst: environment variable TERM not set. %u:%uDr:f:C:psysinst: screen too small xfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgftp dirpub/NetBSD/NetBSD-7.1.2ftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfix.tgzdisknamemydiskpkg hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/7.1.2/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file------------------------------sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ping -v -c 5 -w 5 -o -n %s-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEeongreipipgiffaithlolo0nsipppptun%s -p -b 16 -c 4 /dev/r%s%c%s -p -c 3 /dev/r%s%c/sbin/fsck_%s%s -p -q /dev/r%s%c%s -f /tmp/disktab %s '%s'disklabel -w -r -i /sbin/newfs %s%.0d-tffs -o async/sbin/newfs -V2 -O %d -b %d -f %d%s%.0d-tffs -o log/sbin/newfs_lfs -b %d-tlfs-tmsdos%s /dev/r%s/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD %s/etc/fstab # See /usr/share/examples/fstab/ for more examples. /dev/%s none swap sw%s 0 0 %s/dev/%s %s %s rw%s%s%s%s%s%s%s%s %d %d /dev/%s%c /tmp mfs rw,-s=%lli swap /tmp mfs rw,-s=%lli kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/dev/%s%cdkctl %s delwedge %sgpt show -u %s 2>/dev/nullPritableSectable:no_mbr%s (%s, %s)%s (%s, %s %s)sh -c 'gpt show %s |grep -e Pri\ GPT\ table'Cannot process disk %s: too big size (%d) /dev/%s %s ffs %s/dev/%s %s ufs %scd0araidwindows,hfsefibios/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'/dev/rcd%d%cCD001/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES//.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xhepf -rm %sfsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%smkdir -m 755 /mnt2 /usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700gamestestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug -async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD60/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootpasswd -l rootsource for 3rd-party packageschroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu XXX Help Stringntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s %dMlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s%s -l %d%s -p %d%s -s %dlvm vgcreate %s %s %s%s -C %c%s -M %c%s -p %s%s -Z %c%s -n %s%s -l %s%s --minor %d%s -m %d%s -R %d%s -r %d%s -i %d%s -I %d%s -L %uMlvm lvcreate %s %sPartman device: %s lvol%.2dvg%.2dgpt remove -a %s-t %sgpt add -i %u -b %u -s %u %s %sCannot create GPT partition #%d on %s dkctl %s addwedge HACK%d %d %d unuseddkctl %s listwedgesdkctl %s addwedge dk%d %u %u %s %s (%s)Cannot create wedge dk%d for %s. dkctl %s delwedge dk%d/tmp/%s%c/sbin/mount %s /dev/%s%c %smkdir -p %s dd if=/dev/zero of=%s bs=1m count=%d progress=100 msgfmt=humanvnconfig %s vnd%d %s %d %d %d %dvnconfig %s vnd%d %slvm pv%-33.32s %-22.21s %12.12sdk%d: %s %-30.29s %-22.21s %11uM%s%c: %s %s%-33.32s %-22.21s %11uM(%s-%d) on %sVG '%s' on %d/%ugpt create -f %sgpt destroy %spartmanSpecial disk %s preparing error Disk %s preparing error /tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks /dev/%s START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dRAIDframe configuring error #%d cgdconfig -g -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d /dev/%s /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %s (%s, %s-%d)%s (lvl %d, %d disks, %d spare)dd of=/dev/%s if=/dev/zero bs=1m progress=100 msgfmt=humandd of=/dev/%s if=/dev/urandom bs=1m progress=100 msgfmt=humansh -c 'cgdconfig -s cgd0 /dev/%s aes-cbc 128 < /dev/urandom'dd of=/dev/rcgd0d if=/dev/urandom bs=1m progress=100 msgfmt=humancgdconfig -u cgd0umount -f /dev/%scgdconfig -u %svnconfig -u %sraidctl -u %sdkeject -t disk /dev/%sdraidctlvnconfigcgdconfiggptdkctl-t nullraidctl -v -A root %sError writting RAID bootsector to %s gpt biosboot -i %d %sError writting GPT bootsector to %s Error writting bootsector to %s dkctl %s makewedges%s. %scan't delete extendedmain-extended mixupUser answered no to destroy other data, aborting. Unknown (%d)%*s %*s (%s)Extended partition, LBAFreeBSD/386BSDLinux swapDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32Windows FAT32, LBANTFS volume setPReP BootUnknown(%lli)%6lli%8s%10lli%10lli %c %s%lli%sdlsize=%lld ptsize=%lld ptstart=%lld disk %c/tmp/disktab.%sCreating disklabel %s in %s cat <>/etc/disktab %s|NetBSD installation generated:\ :dt=%s:ty=winchester:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:%s\ nparts limited to %d. :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:sh -c 'cat /tmp/disktab.* >/tmp/disktab'***************************************************************************************************************************************************************************************************************************************\ usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipe=cF-5M-%uusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host sendmsgping6: wrote %s %d chars, ret=%d nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsff02::2:0000:0000getaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmaprefusedunknown qtype no address %s(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s SuccessRefusedIPv6 addressrtsol_timer_updateifconfigmake_packetmainrtsol_check_timersockopensendpacketrtsol_inputinterface_upget_llflaginterface_statuslladdropt_fill")probe_initdefrouter_probesendprobertsock_input_ifannouncertsock_input-1DdfmDdUsage: %s [%s] interface ... %s [%s] -a <%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %smultiple interfaces foundprobing %sadDadDfm1kernel is configured not to accept RAskernel is configured as a router, not a hostfailed to open a socketfailed to initilizatoin interfacesfailed to initialize %sfailed to setup for probing routersfailed to open a pid log file: %stimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldpoll: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %ssend RS on %s, whose state is %dsendmsg on %s: %srecvmsg: %sfailed to get receiving interfacepacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sunsupported link type(%d)shutdown: %sioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %sinterface %s insertedinterface %s removedbring interface %s to DOWN statertmsg type %d, len=%lurtmsg type %d too short!setvarcontrol_handle_datacontrol_writeoneconfigure_interface1dhcpcd_selectprofilereconf_rebootdhcpcd_handleinterfacedhcpcd_handlehwaddrCopyright (c) 2006-2015 Roy Marplesmain duid_initeloop_event_addeloop_q_timeout_add_tveloop_timeout_add_nowif_discoversplitvadd_environparse_optionbc2udoeifsgMjhiaklmnopkq|rstuvwxz_`yABC[DEFGHIJK LM)O2QUS/>T:UDVNWXXbZh|5~q}|z46val -7HF!MUb'hlread_configmake_varappend_configmake_envm+t{r4script_runreason0123456789abcdefdhcp_envoption1dhcp_envoptionY 2Nt@j1LmGu &Fv.So=^}$Hi 5b=l*O{%AX~6c?g ,X~Aezez4Nf}8Sn+Ds9Wu  ;V|/H\p!Hav}(Ku|-H\K]uDh} )?f ,Jp0Hf~0EUfw  ,]Fe.B\n( ((( 0(EHD )arp_openarp_newdhcp_handleudpdhcp_openlog_dhcp1decode_rfc3442_rtget_option_routesdhcp_binddhcp_dump`iqy&}K dhcp_handlepacketdhcp_initdhcp_start1ipv4_getstatedelete_address1ipv4_addaddripv4_buildroutesget_routesadd_subnet_routeadd_loopback_routeadd_router_host_routeadd_destination_routeipv4_handleifaipv4ll_probed^^make_route^ipv6_getstateipv6_addlinklocalcallbackipv6_buildroutesipv6nd_handleraipv6nd_envipv6nd_sendrsprobeipv6nd_startrs1  dhcp6_addrequestedaddrsdhcp6_delegateaddrdhcp6_ifdelegateaddr-`tdhcp6_checkstatusokdhcp6_findpddhcp6_findnadhcp6_readleasedhcp6_sendmessage '')*PQ'|}wdhcp6_envdhcp6_dumplocalhost.%s_%s=%s/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: dhcpcd_handleargs: %m%s: writev fd %d: %m%s: IAID conflicts with one assigned to %s%s: removing interfaceDEPARTEDSTOPPEDsend_interface %d: %m%s: ipv6_start: %mNOCARRIERPREINITif_managelink: %mpipe: %mforking to backgroundfork: %mfailed to notify parent: %mfailed to read child: %mforked to background, child pid %dtimed out%s: no profile %s%s: selected profile %sipv4_init: %mipv6_init: %m%s: carrier_status: %m%s: carrier lostEXPIRE6EXPIRE%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: dhcp6_start: %m%s: if_up: %m%s: unknown carrier, waiting for interface flags%s: if_discover: %mRECONFIGUREreceived signal %s from PID %d, %sstoppingALRMreleasingHUPUSR1reconfiguringreceived signal PIPEreceived signal %d from PID %d, but don't know what to do with it%s: interface departed%s: interface updated%s: interface added%s: new hardware address: %s--version6.7.1--getconfigfile--getinterfaces--listencontrol command: %s46bc:de:f:gh:i:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMO:Q:S:TUVW:X:Z:ARLM--helpusage: dhcpcd [-46ABbDdEGgHJKkLnpqTVw] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr]] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [interface] [...] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 6.7.1 %s /etc/dhcpcd.confcannot specify more than one address familyInterface options: DHCPv4 options: DHCPv6 options:%s: open: %m%s: interface name too long/var/run/dhcpcd%s%s%s.pidchdir `/': %mdumplease requires an interfacesending commands to master dhcpcd processsend OKfailed to send commandscontrol_open: %mdhcpcd will not work correctly unless run as rootsending signal %s to pid %ddhcpcd not runningkill: %mwaiting for pid %d to exitpid %d failed to exitdhcpcd already running on pid %d (%s)/var/runmkdir `%s': %m/var/dbflock `%s': %mcontrol_start: %mversion 6.7.1 startingsignal_setup: %mopen_link_socket: %m%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carriercontrol_stop: %m:exited/etc/dhcpcd.duiderror reading DUID: %s: %m%s: is a NET/ROM psuedo interfaceerror writing DUID: %s: %mpicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: timeout0 already setnothing to dopoll: %m%s: is a Virtual Interface Master, skipping%s: unsupported interface type %.2x%s: if_init: %m%s: set_mtu: %m%s: no assignment: %s`%s' is not a valid CIDR`%s' is not a valid IP address`%s' out of range%s: invalid IAIDtoken_len: %mauthtoken needs a keyhostname: %mhostname cannot begin with .vendorclassid: %mleasetime must be a positive valuemetric must be a positive valuedhcp6_timeout must be a positive valueuserclass: %minvalid vendor format: %svendor: %mvendor option should be between 1 and 254 inclusivereboot must be a positive valueskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientid: %mstatic assignment requiredip_address=subnet_mask=ms_classless_static_routes=all routes need a gatewayrouters=option `%s' does not take an IPv4 addressIA PD must belong in an interface blockIA with IAID must belong in an interface blockCannot mix IA for the same IAID%s: cannot assign multiple prefixes with a SLA of 0%s: cannot mix automatic and fixed SLA%s: cannot specify the same interface twice with an automatic SLAembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxincomplete request typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringstype %s requires a variable namevendor class is too bigdelayeddelayedrealm%s: unsupported protocolhmacmd5hmac-md5%s: unsupported algorithmmonocountermonotime%s: unsupported RDMauthtoken requires a realm%s: not a numberauthtoken requies an a keyrealm_len: %mauthtoken requies an an expiry dateforever%Y-%m-%d %H:%M%s: invalid date time%s: mktime: %mcontrolgroup: %s: not foundstableprivatedhcpcd: option requires an argument -- %s unknown option: %sfopen `%s': %mallowing interface %sarpingenvreconfigurevendorclassidleasetimerebindpersistentinformuserclassvendorwaitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionrequiredumpleasevariableswhitelistblacklistdenyinterfacesfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv6ra_ownipv6ra_own_defaultipv4onlyipv6onlynoipv4noipv6noaliashostname_shortdefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacia_pd_mix%s_%sTESTROUTERADVERTUNKNOWNinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=trueif_down=falseif_up=trueif_oneup=trueif_oneup=falseif_ipwaited=trueif_ipwaited=falsesyslog_debug=trueprofile=%sifssid=ifclass=pd - %s /libexec/dhcpcd-run-hooks%s: executing `%s' %s%s: make_env: %mRC_SVCNAMEPATH=%sPATH=/usr/bin:/usr/sbin:/bin:/sbinwaitpid: %m%s: %s: WEXITSTATUS %d%s: %s: %s%s: arraytostr: %m%s: control_queue: %mreasonifcarrierifmetricifwirelessinterface_order embed index byte uint16 sint16 uint32 sint32 ipaddress ip6address dname ascii raw binhex rfc3361 rfc3442 rfc5969 norequest%s-%s%s-%s:%s-%s:%s%s_%s=%s_%s%ddefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 2 uint32 time_offsetdefine 4 array ipaddress time_serversdefine 5 array ipaddress ien116_name_serversdefine 6 array ipaddress domain_name_serversdefine 7 array ipaddress log_serversdefine 8 array ipaddress cookie_serversdefine 9 array ipaddress lpr_serversdefine 10 array ipaddress impress_serversdefine 11 array ipaddress resource_location_serversdefine 12 dname host_namedefine 13 uint16 boot_sizedefine 14 string merit_dumpdefine 15 array dname domain_namedefine 16 ipaddress swap_serverdefine 17 string root_pathdefine 18 string extensions_pathdefine 19 byte ip_forwardingdefine 20 byte non_local_source_routingdefine 21 array ipaddress policy_filterdefine 22 int16 max_dgram_reassemblydefine 23 uint16 default_ip_ttldefine 24 uint32 path_mtu_aging_timeoutdefine 25 array uint16 path_mtu_plateau_tabledefine 26 uint16 interface_mtudefine 27 byte all_subnets_localdefine 28 request ipaddress broadcast_addressdefine 29 byte perform_mask_discoverydefine 30 byte mask_supplierdefine 31 byte router_discoverydefine 32 ipaddress router_solicitation_addressdefine 34 byte trailer_encapsulationdefine 35 uint32 arp_cache_timeoutdefine 36 uint16 ieee802_3_encapsulationdefine 37 byte default_tcp_ttldefine 38 uint32 tcp_keepalive_intervaldefine 39 byte tcp_keepalive_garbagedefine 40 string nis_domaindefine 41 array ipaddress nis_serversdefine 42 array ipaddress ntp_serversdefine 43 binhex vendor_encapsulated_optionsdefine 44 array ipaddress netbios_name_serversdefine 45 ipaddress netbios_dd_serverdefine 46 byte netbios_node_typedefine 47 string netbios_scopedefine 48 array ipaddress font_serversdefine 49 array ipaddress x_display_managerdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 binhex vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 64 string nisplus_domaindefine 65 array ipaddress nisplus_serversdefine 66 dname tftp_server_namedefine 67 string bootfile_namedefine 68 array ipaddress mobile_ip_home_agentdefine 69 array ipaddress smtp_serverdefine 70 array ipaddress pop_serverdefine 71 array ipaddress nntp_serverdefine 72 array ipaddress www_serverdefine 73 array ipaddress finger_serverdefine 74 array ipaddress irc_serverdefine 75 array ipaddress streettalk_serverdefine 76 array ipaddress streettalk_directory_assistance_serverdefine 77 binhex user_classdefine 78 embed slp_agentembed byte mandatoryembed array ipaddress addressdefine 79 embed slp_serviceembed ascii scope_listdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed byte flagsembed byte rcode1embed byte rcode2embed domain fqdndefine 85 array ipaddress nds_serversdefine 86 raw nds_tree_namedefine 87 raw nds_contextdefine 88 array domain bcms_controller_namesdefine 89 array ipaddress bcms_controller_addressdefine 90 embed authembed byte protocolembed byte algorithmembed byte rdmembed binhex:8 replayembed binhex informationdefine 91 uint32 client_last_transaction_timedefine 92 array ipaddress associated_ipdefine 98 string uap_serversdefine 99 encap geoconf_civicembed byte whatembed uint16 country_codedefine 100 string posix_timezonedefine 101 string tzdb_timezonedefine 116 byte auto_configuredefine 117 array uint16 name_service_searchdefine 118 ipaddress subnet_selectiondefine 119 array domain domain_searchdefine 120 rfc3361 sip_serverdefine 122 encap tspencap 1 ipaddress dhcp_serverencap 2 ipaddress dhcp_secondary_serverencap 3 rfc3361 provisioning_serverencap 4 embed as_req_as_rep_backoffembed uint32 nominalembed uint32 maximumembed uint32 retryencap 5 embed ap_req_ap_rep_backoffencap 6 domain kerberos_realmencap 7 byte ticket_granting_server_utilizationencap 8 byte provisioning_timerdefine 123 binhex geoconfdefine 124 binhex vivcodefine 125 embed vivsoembed uint32 enterprise_numberdefine 136 array ipaddress pana_agentdefine 137 domain lost_serverdefine 138 array ipaddress capwap_acdefine 139 encap mos_ipencap 1 array ipaddress isencap 2 array ipaddress csencap 3 array ipaddress esdefine 140 encap mos_domainencap 1 domain isencap 2 domain csencap 3 domain esdefine 141 array domain sip_ua_cs_listdefine 142 array ipaddress andsfdefine 143 array ip6address andsf6define 144 binhex geolocdefine 145 array byte forcerenew_nonce_capabledefine 146 embed rdnss_selectionembed byte prfembed ipaddress primaryembed ipaddress secondaryembed array domain domainsdefine 150 array ipaddress tftp_serversdefine 208 binhex pxelinux_magicdefine 209 string config_filedefine 210 string path_prefixdefine 211 uint32 reboot_timedefine 212 rfc5969 sixrddefine 213 domain access_domaindefine 221 encap vssencap 0 string nvtencap 1 binhex vpn_idencap 255 flag globaldefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrembed uint32 pltimeembed uint32 vltimedefine6 6 array uint16 option_requestdefine6 7 byte preferencedefine6 8 uint16 elased_timedefine6 9 binhex dhcp_relay_msgdefine6 11 embed authdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed string messagedefine6 14 norequest flag rapid_commitdefine6 15 binhex user_classdefine6 16 binhex vivcodefine6 17 embed vivsodefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 21 array domain sip_servers_namesdefine6 22 array ip6address sip_servers_addressesdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 25 norequest index embed ia_pdencap 26 optiondefine6 26 index embed prefixembed byte lengthembed ip6address prefixencap 67 optiondefine6 27 array ip6address nis_serversdefine6 28 array ip6address nisp_serversdefine6 29 string nis_domain_namedefine6 30 string nisp_domain_namedefine6 31 array ip6address sntp_serversdefine6 32 uint32 info_refresh_timedefine6 33 array domain bcms_server_ddefine6 34 array ip6address bcms_server_adefine6 36 encap geoconf_civicdefine6 37 embed remote_idembed binhex remote_iddefine6 38 binhex subscriber_iddefine6 39 embed fqdndefine6 40 array ip6address pana_agentdefine6 41 string posix_timezonedefine6 42 string tzdb_timezonedefine6 43 array uint16 erodefine6 49 domain mip6_hnidfdefine6 50 encap mip6_vdinfencap 71 optionencap 72 optionencap 73 optiondefine6 51 domain lost_serverdefine6 52 array ip6address capwap_acdefine6 53 binhex relay_iddefine6 54 encap mos_ipencap 1 array ip6address isencap 2 array ip6address csencap 3 array ip6address esdefine6 55 encap mos_domaindefine6 56 encap ntp_serverencap 1 ip6address addrencap 2 ip6address mcast_addrencap 3 ip6address fqdndefine6 57 domain access_domaindefine6 58 array domain sip_ua_cs_listdefine6 59 string bootfile_urldefine6 60 binhex bootfile_paramdefine6 61 array uint16 architecture_typesdefine6 62 embed niiembed byte typeembed byte majorembed byte minordefine6 63 binhex geolocdefine6 64 domain aftr_namedefine6 67 embed pd_excludeembed byte prefix_lenembed binhex subnetIDdefine6 69 encap mip6_idinfdefine6 70 encap mip6_udinfdefine6 71 embed mip6_hnpdefine6 72 ip6address mip6_haadefine6 73 domain mip6_hafdefine6 74 embed rdnss_selectionembed ip6address serverdefine6 75 string krb_principal_namedefine6 76 string krb_realm_namedefine6 78 embed krb_kdcembed uint16 priorityembed uint16 weightembed byte transport_typeembed uint16 portembed ip6address addressembed string realm_namedefine6 80 ip6address link_addressdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rt/dev/bpfBPF version mismatch - recompilenet.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: del_if_nd6_flag: ND6_IFF_IFDISABLED: %m%s: set_if_nd6_flag: ND6_IFF_PERFORMNUD: %m%s: get_if_nd6_flag: ND6_IFF_AUTO_LINKLOCAL: %m%s: disabling Kernel IPv6 auto link-local support%s: del_if_nd6_flag: ND6_IFF_AUTO_LINKLOCAL: %m%s: get_if_nd6_flag: ND6_IFF_OVERRIDE_RTADV: %m%s: set_if_nd6_flag: ND6_IFF_OVERRIDE_RTADV: %m%s: get_if_nd6_flag: ND6_IFF_ACCEPT_RTADV: %m%s: disabling Kernel IPv6 RA support%s: del_if_nd6_flag: ND6_IFF_ACCEPT_RTADV: %m%s: IPv6 kernel autoconf disabledIPV6CTL_ACCEPT_RTADV: %mSIOSRTRFLUSH_IN6: %mSIOSPFXFLUSH_IN6: %mBerkley Packet Filter/var/db/dhcpcd-rdm.monotonic0x%016llu0x%016llu %s: arp if_readrawpacket: %m%s: ARP probing %s (%d of %d), next in %0.1f secondssend_arp: %m%s: ARP announcing %s (%d of %d), next in %d.0 seconds%s: ARP announcing %s (%d of %d)%s: hardware address %s claims %s%s: probing for %s%s: open `%s': %m%s: reading lease `%s'%s: dhcp_auth_validate: %m%s: validated using 0x%08u%s: accepted reconfigure key%s not found %s %03d %sviaNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s0.0.0.0/0%d %d %02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x %d.%d.%d.%dMS %s: using %sClassless Static RoutesDuplicate address detected%s: VIVCO option too big%s: dhcp_auth_encode: %m%s: DHCP messge too bigip_addresssubnet_cidrnetwork_number%s: using static address %s/%dSTATIC%s: using IPv4LL address %sIPV4LL%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: write_lease: %m%s: waiting for 3rd party to configure IP address3RDPARTY/var/db/dhcpcd-%s.lease%s: no lease to dumpDUMP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_openudp: %m%s: dhcp_sendpacket: %m%s: if_sendrawpacket: %mFAILdhcp_makeudppacket: %m%s: soliciting a DHCP lease (requesting %s)%s: soliciting a DHCP lease%s: renewing lease of %s%s: rebind in %u seconds, expire in %u seconds%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: releasing lease of %s%s: dhcp if_readrawpacket: %m%s: invalid UDP packet from %s%s: server %s is not destination%s: packet greater than DHCP size from %s%s: calloc: %m%s: bogus cookie from %s%s: xid 0x%x is for hwaddr %sno authenticationdiscarding Force Renewunauthenticated Force Renewnot bound, ignoring Force RenewForce Renew from%s: wrong xid 0x%x (expecting 0x%x) from %sreject DHCPreject NAK%s: message: %sno address givenIPv4LL disabled fromIPv4LL enabled from%s: unknown auto configuration option %dreject invalid addressofferedignoring offer ofnot ACK or OFFERacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: DHCP lease expired%s: using ClientID %s%s: using hwaddr %s%s: Error making ClientID: %m%s: dhcp_init: %m%s: needs a clientid to configure%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: delaying IPv4 for %0.1f seconds%s: removing IP address %s/%dDISCOVERREQUESTDECLINEACKRELEASEDHCP_FORCERENEW%s: %s route to %s/%d%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route via %s%s: %s route to %s/%d via %saddingchanging%s: ipv4_delroute: %m%s: if_addroute: %m%s: deleting IP address %s/%d%s: adding IP address %s/%d%s: if_addaddress: %mremoving%s: forcing router %s through interface%s: router %s requires a host routedeleting%s: if_delroute: %m%s: preferring %s on %s%s: IP address %s/%d already exists%s: IPv4LL %d second defence failed for %s%s: defended IPv4LL address %s%s: failed to acquire an IPv4LL address%s: probing for an IPv4LL address/etc/dhcpcd.secreterror reading secret: %s: %merror writing secret: %s: %m%s: deleting address %sif_deladdress6: :%m(no iface) reject%s: %s%s route to %s/%d via %s%s: if_delroute6: %m%s: if_addroute6: %m%s: deleted address %s%s: adding address %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsif_addaddress6: %mipv6_removesubnet: %m%s: regen temp addr %sipv6_createtempaddr: %mif_deladdress6: %m%s: waiting for %s to complete%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: DAD detected %s%s: unable to obtain a stable private address%s: ipv6_makestableprivate: %m%s: Router Advertisement DAD completedrtpref: impossible RA flag %x%s: %s is reachable again%s: %s is unreachable, expiring it%s: %s: router expired%s: %s: expired option %drecvmsg: %mIPv6 ICMP packet too short from %sIPv6 RA/NA did not contain index or hop limit from %s%s: IPv6 NA too short from %s%s: NA multicast address %s (%s)%s: %s not a router (%s)%s: %s reachable (%s)IPv6 RA packet too short from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s router available%s: short option%s: zero length option%s: Option length exceeds message%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltime%s: invalid MTU %d%s: invalid DNSSL optiondhcp6_start: %s: %m%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %srdnssdnsslra%zu_fromnew is nullra%zu_%sra_count%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: %s: sendmsg: %m%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: ipv6nd_open: %m%s: ipv6ns_makersprobe: %m%s: delaying IPv6 router solicitation for %0.1f secondsDELEGATED6%s: DHCPv6 DAD completed%s: waiting for DHCPv6 DAD to complete%s: DHCPv6 Vendor Class too big%s: DHCPv6 server does not support OPTION_PD_EXCLUDE%s: invalid prefix %s/%d + %d/%d: %m%s: cannot delegate excluded prefix %s/%d%s: status truncated%s: DHCPv6 REPLY: %s%s: DHCPv6 lease truncated%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s: option type mismatch%s: IA Prefix option truncated%s: truncated PD Exclude%s: PD Exclude length mismatch%s: %s: DHCPv6 REPLY missing Prefix%s: IA Address option truncated%s: %s: DHCPv6 REPLY missing IA Address%s: T1 (%d) > T2 (%d) from %s%s: no useable IA found in lease%s: file too big%s: %s: %s: %m%s: read: %m%s: authentication failed%s: authentication now required%05d %s%s: delaying adding delegated addresses for LL address%s: adding delegated prefixesbroadcastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f seconds%s: dhcp6_updateauth: %m%s: sent %d times with no reply%s: requesting DHCPv6 information%s: dhcp6_makemessage: %m%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: DHCPv6 lease expired%s: no advertising IPv6 router wants DHCP%s: failed to rebind prior delegation%s: failed to request address%s: failed to confirm prior addressDHCPv6 packet too short from %sDHCPv6 reply did not contain index from %s%s: DHCPv6 reply received but not running%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: no DHCPv6 server ID from %s%s: incorrect client ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: authentication failed from %s%s: no authentication from %s%s: SOL_MAX_RT %llu -> %d%s: invalid SOL_MAX_RT %d%s: INF_MAX_RT %llu -> %d%s: invalid INF_MAX_RT %d%s: unauthenticated %s from %s%s: %s from %s%s: missing Reconfigure Message option%s: missing Reconfigure Message type%s: not bound, ignoring %s%s: not informed, ignoring %s%s: unsupported %s type %d%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: malloc recv: %m%s: ADV %s from %s%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6UNKNOWN6%s: loading for delegation%s: interface does not exist for delegation%s: delegated prefix %s%s: has no carrier, cannot delegate addresses%s: refresh in %u seconds%s: will expire%s: dhcp6_writelease: %mDHCPv6 reply for unexpected interface from %s%s: creating pseudo interface to handle Prefix Delegation%s: dhcp6_readlease: %s: %m%s: confirming prior DHCPv6 lease.pdsetsockopt: SO_REUSEPORT: %m/var/db/dhcpcd-%s%s.lease6%s: delaying DHCPv6 soliciation for LL addressSTOP6%s_dhcp6%s_delegated_dhcp6_prefix=%s: dhcp6_readlease: %mDUMP6Unspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RELEASE6RECONFIURE6BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~" eY̒ @@lge/etc/group/etc/master.passwd%s%s%s 646towlowertowupperalnumblankcntrlgraphpunctxdigitUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*ju,uappnduchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,/dev/ptmtty0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZpqrstuwxyzPQRST/dev/XtyXXw%s%s.pid/var/run/full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000baseT1000T1000BASE-THomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SXDB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'NAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot open `%s'Cannot format string     , 0 8 D L P X \ d h H@unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs30%llo%lld0x%llx/dev/%s%s%s%c%.*s/r%sr%s%.*s/%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbLINESCOLUMNSESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkadd_new_key: bad type passed unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9<<<<<<<<<<<<<<<<<<tcbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo dataseunknown error%s: generic terminal%s: hardcopy terminal[>!A9[A[tE{[I[Nu ansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @1 [%p1%dSzOE}OM7 [%p1%dTODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\R%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{[?1;2c [%i%d;%dR,?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check #+3;CScs@@ !1Aa  0@` inflate 1.2.3 Copyright 1995-2005 Mark Adler w8s8s 8sm mm m m m deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly H@ȃԃH@1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`      L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c     0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfagntsHprop_string_append_cstring/usr/src/common/lib/libprop/prop_string.csrc != ((void *)0)_prop_object_externalize_append_char _prop_object_internalize_find_tag8 )ı̱Աܱ8 \|prop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error/usr/src/common/lib/libprop/prop_object.cctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist