ELF( 4O4 ( TZE0F\\@0 6QQ O @@( @0 fD!@P@Q?P1tР -LThTZe0fdbemain() returnedde   ! X(@@T @@ 0/fefe// P-XQp|e -LM@PL00S @0 K080(0 0 0g KFKdBwd@P/00S 000/dLf -LMPP ,0s ᇓpP 0ooK0 0h@P ᬊ l* @ 0R (0R iKVOoB ᐙᮊ$K9BedA@\ `P/0 !`8 00 ,  , !/deee -Lְ{P|妺0 !!X0`T0P0L000, !  !@ @deee -LMR0S`pP `PX DK~q@ȁ3DK~@T P { ` LVP `0 00CS 0D!@a0C0DK~@DK~T%P DK}@TPPP PP DKm~P Љx"5(KP P$0@0 ỉ  $9LafHaf9BGA(@%A@[@+@/ -t0L0: S㨳X 88S!~㶳0Y㏸ 00 } KhIbe@B -1@0LPS@"@2m4 `1Sʀ0!` 0    !B? S[ 0 !! HиDθ<˸80ƸdLf-deeel@@@@B@0 P000/$@$ 0P0 00/ddPD0 R0  R  BQ 0//be -LM a0@S=pPp}P!  }P }P P|P"0p @* R 0RKh@PlPd0`000 84tPKhKd@@@p@@be` @ @d -LM㳲g)pPY ?gM奲O 7GWR  6~tPp7p00x'x7 t7t'0QdWἤ ᴕ %ḅ5v f V000::RV&fSTS Wi唲6l|P H01 2%V QV11016%V `16 16vP68V#6$1 $1)0C$1}0!10b0`V! 9 Q1 @ P*e1 @ P:Y)$1*0C,$1_},1!10b01u0S 9  1DU @P :$1|*0C$1A} 14  @P :$1D*0C$12}0! 10b01 @ P:$1*0C$1}0! 10b01 @ P:$1崄*0C$1 }0! 10b01 @ P:$1l*0C$1|0! 10b01 @ P~:$1*0C$1|1! 10b11 @ Pl:$1)0C$1|P#K3ap00 V  Ke`v"d `KV좟$`@s@3@ g!0 @K13!0g>00h @K뼂@: K뤢@: K@: K@p: K040`9 K p8 00pW000 @0 0:  K0bS`!L4 `0 4K8K$1Q !1.1  1! 10b#6$1 03/03/03/ 08Q3/PLk/80LL0L!1 !1 !1! ,k! 1p"5I (K@@|:>0 DSBObeLfᆳ@d(eeAiP)i` floe`@@@oefefepfefece \oe?B/fddedde@d d!܊dP d -L M @0 壍PK -p LTMt  P1 0h00!14!S`AT1S1S1ST o@ lK{TTX@@X@[H0[8P[OoSB@UT 008吃@ 0P'Kl`K^! 0 p0 'K 0<SR0 00^Q0 0 t[  0K KK[p `0K KKS0S0S L 0 R0 < P0E?oY20S2 X0, `p(<0,P QPeP tq KP 0 0 Rp ,@y 0S  X ,0SPPA0(K dcx@c @!C@@ -80L`SP@(0S ;{0sf/ty S R8SBPT$ 0d0?o0c SC%P Q 0202 0P 0R* Hf/5yWEV -`pL(M( @PDKx(D` @p C0< BS00\DK$0 ,0S00DK$0 00S40S040 <3A4K8 p-LMP`@婵`00 0 0000 0PP S d(p0$P P ,0d0(@4P00X0( KT80P0<0L0@0H0D0D0H0(0(0 40sKp@@,@\! 8! 4! Q@0! ,! (! $! i,dA0 0-@LAdK0h> 0-@Ld20 00-L@ wP0 0 0000@(00 SP/o/be -@0PAL`(p$ 7/ 0X$ V008#8Kh/ 0-@LP(0 3/ X8#8K0h/ 0-t0LP@ T\00P00 S/o" (SK0h0tdedbe` p-L M`Pᦂ`0@0ʹ' qoPB 00,RP, 305/`P Kphn0 P R TP  \0R c80@40KphKp_@@@ Abe` tded 0-L@$sP /o"K0hB0.e -LP@Ts`P   1,00S  Kh%.e 0-LPhs@P 41U      K0h0.e 0-T0LP H0R<s@P  U  K0h0be` .e 0-LPDps@4lsP  T  K0h0.e 0-LPDWs@4SsP T  K0h0.e 0-L@ >sP  K0h0.e -X0LP L0`R <(s@P  /o"Khbe` .e 0-@0L@ 40R ( sP  K0hs0be` .e -0P 0RL3 rpP. ` (03/X@  R0X8 #8X  0 8/ݳ $Kk9  00$Kk/be` .e -LrPr@P 0 (`6/,X0X`6/0 (P5/, 0XKh/.e -1L 0R: rPrU@ 0$ (`6/0X`0$ 6/T 0$ (P5/?>XP$ 5/0$ (P5/ 8X$ #8Kh/be` .e -pLArP\=rU@ 0$ X`6/T $ X0Kh/.e/ -0 PLT@X`0 6/X`0 6/X0 Kh/ 0-LP@w@0 T000S0d00h00 S0d0i0h0^0p0 S 0d0i0h0^0p0j0l0]0t0x00x0K0h;` be, -LM0PST@ Sa  Be(0K0p0*b7/pP  B(@`0( X` 6/X`< (6/X`0 (6/X`0 (6/X`0 (6/X`0 (6/X`0 (6/X`0 (6/0X`S0  0 (6/X`0 (6/ X`x0(6/X`(0 6/X`L0 (6/000S00(0 00$0 K@y@@@d -`0 PLT@ (03/V V (0 3/  彯@r -LM00  K\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -0LPT@ pX` X0S(0$ 3/@8XP#8$ 5/T$Kk@ -0pL`T@ PW WVXp00 7/(0 3/D0V00 V0X` 6/$$Kk|@ 0-LM 00 K KK0 0 0K  K -LP`~@PP00|xht0 P000 2/   0 2/0 0-@@d -`SL@Pp 0 2/ P lKh蔰W  P 0冰V 0 Kh/@@a@ -H0L0 S P ,rro@obe@ -L@`oPP 0S 0T    V   0p0  T  R0 OoSB@T 0VW0 VW0 Kh|.ed 0-L@o0P Rl0T @ @  00@0  T  R0 TS0 @K0hR0.ed 0-L@o0P Rt0T    00 00T00S0 OoRB@T  K0h&0.ed 0-L@fo0P Rt0T   00 0  T  R0 OoSB@T 0 K0h0.ed 0o/xde/ p-L M0@K`0$ PokP 0 nKpX7 0-0L@TK0hj㟧$0\P 5/0 \P5/0L0I0 K0hDxdeX;>@ p-L MPg}@X1PP厯HD1D0: S0!01   $! 00 5 !0,0$ W0 00( V0 A4  00 0,0  0 f/$  000( 4000`0@ 6/0P pKph` PL{08 8Kph_kxde@bedpA@: @@`7 \ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee 0-L@+0 -1LP@`TKh萮0 \p7/U U* ܫUثU U U!0 \P5/׫#0\P 5/0 ,P5/ Kh迫xdeb;>@ 0-0L@TxxF0PP0 ,P5/ 0 ,P5/P匫 劫别0xdep;>@ -LM1p@TZ90` \P5/0 \P5/P b`m㹮0P ,P 4p 40K1\p 7/0 ,p7/ 㤮0 ,p7/ 0 ,p7/(0KPU 20.0 \P5/$0 ?1 0  Kxde@};> -1Lp@T宭0` \P5/0 \P5/ M0\P 5/0 ,P5/ <0 ,P5/ 0 ,P5/PΪxde;>@ -L M01@P@p(審,嬩0婩4妩00 ,H(E0B4?壪塪 宪 `0 ꥪ (咪 (坪 `VP0喪 兪 ( ,004(KoWxde0 S-L S S Kh KhM@0 @o/be -L M娱@PK -@2LPRp` 0CR*p2R h2R0 X2RY P2R P}008Sx`0p0 `p* &*004004 0$0P`L00 0(0u S015 0 (0 S01X0 0 (0u5 0(0h`l`60d0070( `8(88hiiaa5008S(308S#`0p0 `p*(`cs <*00500ff5008S308S0 $KklSW HdHHdH@qB(@ p-LM@`QzP@d \0\ ,K0,0 L0 P (0 D0$0 j08 8P(Kp;>dp,;>dlE E @ -L(zd 0-Lz@J000: S/ be;>d00co/be` a -@D2LPRV ,2Rv  2RP 2Ry008St`0p0 `p) &)1414$00P`L0$0! 0u S0151!$ 0 S01X0$0 0u5$0 0( 60d0070h`l``8(88hiiaa30'008S&308S!`0p0 `p)(`cs |<)151ff5008S308S0KhHHdHdH@qB(@ p-LM@`^yP@d \0\ ,K0,0 L0 P (0 D0$0 i08 8P(,Kp;>dp,;>Xd8I TI @ -L5y -L.y0 0R/  pbe` ;>xd 0-0@SL S2 SE0 10 1\Pa05/1!\P 5/t1\P0 10 1\Pa05/@14!\P 5/(1\P ! 5/<\P/0 10 1\P!05/0 \P 5/0\P0 10 1\P!05/0p \P 5/5\P\ 5/=\P P 5/{0\< K0h/[~ _f-/0/-/-/-/-/-/-/ -LPpE`@P E/m0 2/ p 00S 0@0 @0000@ -L$MP@`jĩ08 K0 0  p7/0P *4 K *p7/0P 0 K "(p7/ P80@040 0000\1 RL `, K  P 4A,@0X@p0$0d0 10S01 0 0S 0kh0il0j0m Qd  HL|0000 100 0(0K00 8/,0$0(00\0` (, KJ@@k@@@|de@@ 0 /|de/$ R/P// -LM`0SPp )( K $@P#(d@ 0 010S 0100 D0 K0( 0Q05/(000@@ K0S   00C0/$ R R R  d R \0R /! !  / //_W@@W@AW@EW$o  R"%"// -L ko@ 0-@L(00 SK0hK0h1be -QLP0@0CS@@ 0S 0S 0`Tp“ T ` p y @T@ -L@vP@W0 00`000`` `0 P0WPឨ0 MPpᔨ0h CPHከ0D 9PKh~@;>deT @S 4T tT -LvA Kh~ -Lv Khu 0-Lvv0@ 0l0 0K0he 0-Lfv@^ Z0 000P/Qde 0-H0L@T P D0 00 K0h;0de0P/Q1de 0-0LPU/ 0S S* S* P@0@ 0 0" P @T 0 @\0P0000C00 040P @@@0deRW SW 0o/de//D0Q 1CQ -1CQ /00// W@/ 0-@LP2S PPPP,i0 -LM`u@p3`0Pۧ5XpUR V0* R2 0P0 0!00 0-0_010 1 a0 2 `0 2x2t"Sl2-p 0P0 0 0  00 1122,2 h00 "P O00 $j00 (tjp0W0p 0ppd0W0x  0* R@<1  S  1@pP@0 uP @0mP@0 eP@0 ]00S h d=040 h000 l0(@ ,0 ` 4Kced$Kde@beZ P<>d` $=>dZ @^ ^ Z \V V d ddO- -Lt// -0cL@`qWʀ 0! `!#0"   !P0U 0x P 9P0U(0y" ң *0X0p P ,0S -0U0( ## ѣ PP0U 0x ᥣPP0U0p ףP(]0T PS00R  0S0008!0 0U0 S U 0(0l0 S$00Y"PX0@ 0PTT 0!t `q0h d   !YX0S`P\ d<$0deeede$d -X0P@0`0\00`LX0`0s } X 0\00de' 0-L@0TP0 -L0 @o/be//0000/QR R  // 0-@0L@0: S K0hU0be 0-LM@(PKWT $@T 0(Q 0S0\ 0S*0QR0 SOK0'\ `P/0 !`8 00 ,  , !/deee// 0-LM0@P K10p00 K200'p0000 000000000 K0 p000K0 0!< 0`4 0 ,   !/deee Q-L@`tSPPVjtb b d b c 0S0<00]0S0;UTb Dc Lc Tc c \c dc lc tc $c |c c c c c  0 0000$0  0 0001 000(020<0 F0 P0 Z0d0000000Uc c c d 000000000000l -L`@P 0#  00CS 0 00O0 SI -L M@0 P uoqx rRP|`P PxP`Z  R) t0S 0SʌX P0 0S0Sڀ u`廤qU0 SjPSz`bPU 4 [4 h PZP P% `P 00S p0SY0SU =1x0: SXl1 aN4GRA`0W00S Y U  0Ἐ|0V5 P  |`0SVP   Rd d I ccp0 (N 00 0g"N V00R0S P 0 ヘ(Ko(K:0A>be$d@A> -LMpq`@ p婣Q4P PRQ IR *t10: SSZ0s0e00-*'@(1 奟@1 域P0P0PP0 00@ᐗ0 @቗0 @႗0 @{|0( K(0 p0p 0 h0$@ aP <D00uQK-@@Dj ///1/8#81/1/ R  R/ R/ _ 0s S40Ho//0H1S0/d/君@Q0 Q Q/ /;wA@A@ 0-@0LPp3/> `S0TK0h/H2000,,$$#  K0h/0@@PC>@@ -LM@ 0 3/03/PkQ 0 P `%0 3/2S0d 3/P %.!P 3/ p0A0CS000 3/0 80 04 r3%&P0 000 %900p0 %8 t %@  x   H < ʟL \` H  H ,Šd hʟ T h d 0H| 0 X0 0b0 %:030 :   %H   a  0 8 4? %  ? \  %  ?  u D d 04  10 9 00 Q- !0AYS ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ ̉ @ , ̉ ̉ ̉ P ̉ ̉ T ̉ $ ̉ | h ̉ 8 ̉ ( d p | ̉ ̉ ̉ ̉ ̉ ̉ P Ć | D l T `   4 D | 0`c0C S񟗷( ܉ ܉ ܉ ܉ ܉ ܉ ܉ ԃ 7S  0(3/ 03/@ 03/  03/ 0  03/6  12/0P 0 bt0 0p 4h3/l00S0Tgf =b0t 0@0 U 0Q0x 6&0S0J 0 3/50S 5%0S 0L3/`0S0P3/ 0H3/<0S0$ #O8OS0 0 43/0S L,03/0d h h3/<0S 03/6S03/03/0`l0 q V 06l0S0l0  0< 3/ FQ0<3/d3/06`V0<3/00 0T0|0000Xt00@40q040 < D0Rs0D0 0 D/0G0D0\0h0D0887S0( S0~03/ 03/ 03/ 03/0<h g0c b0^ ]0Y X00N0@pJ@0ST`0\03/0 3/0L3/`0S0`3/03/<0S 043/+ (0#03/ 00` 6/0\03/\0` 00 0 0`0 t6/0d3/p0 ABQpR 800S80 <0\3/03/$(K @`C>M>@[A@@HNABr/BM>@#@A<BJA"@PC> @&@i@>A3@@/9@A>@F@P@AV@X@`@b@Bd@h@n@q@x@}@zAŚABB@(A[A@$@@@@@@@@@@@@ N>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O⌗- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8 -Pp`@LP [0118p(0000_K  PMKPH0 b/K1 (01 0PP>_/KIKpGH01!0R$04$0/dO- R\bY I* b$\" ;in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 // p-L M`P@P Q 0K &P 0S00S 0@ S 0@PH0HP0sX0J3/40\A03/0?00?Kpddeded -QL0Sp!; P SaU T0O03/TN 00<000S:`#*;0V0C"#   cN;$F:@#*@;D0@^0C̠"#   c-;000!00C0 $00de!iAi0d@//0/////?  22//-P/6Ċd N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: Nഊdddd1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N// 0-$0L@4s 0S 0  00 000!! (0(d!! (0(8 2$!! T(0 (Ċd ! (0((( ! 40O(0(x  2t ! \0O(0!(H ! 0O(0!( ! 0O(0(d 0-H0L0S @0  "!$0p03/0 !!0`eede03 /0-4@A@P(PPQ P0(00/d 00-@L4 R< 4 @ 8 L < @  < 0/ 0-P@4 LR40<080@0<0L002 @0200< @  000/ 0L 0 00/1001H000S01</ -0` @ P  L       $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@00p<0002X10700 0\1 -LM@81 L Q -K0H0`H2 刢K!@pL2mK,11 18701 01 1 1  o/KeK!.K@ kT 40000 0 00H2 pL@C@P@Cp\C  P1  0L000L0 A 0 ApppdP (d 0-L0M P  t Qh hQQST00 DKA:P0 DKD0 8 40 ,P K0d 0! R!10/ee -LP` s@`0 S   s0 X 0-L0S@@<0 00P,(p$@@ @{%0 P00!1 0000P0,(p$@ @ @e% 0,00 (00!00P$@00 @ @000 0N%(KAȊd-A$ @t @3@ @`ee @d@#@ee/@=@J@R@Z@a@i@v@@@@h @ -LxM@PK`p` WM0T JI 0D 00P @00 0 0 $K -pLMP`K` @3M ,0Kd #\0 0p 0`@R0  0 0p  00 0 0 ?o2P0S  R R  (K`eede< -L|M@KP`p` LP0T H0D 0 0@ 000000  KȊd -LxM0`T@pT 0S PK` LT@ H0D 0 0P 00000 0e -$Kee -L|MPp`V- @K` LW\ VH0L 0 0@ 00000 08 (KLaf 0-@0p pL` Q0S@P@803/00t@0K0h/0 l dede @-Lp03/de 0-P0L @T  0 !!+5K0h;0Ȋd@ p-L4MH!H1HQ03/V01 0X80 P@a4 8Xq 0  (K0&f(K000000 , K0KK9<0@ 0(K 0&e(KP::~ 00KpX0 J T܀ddeee[>pde@i@@T>f@PdȊd@d4/f@ -L M 0K@ P 0S!0000KP 0K P 0S!0@00 0K| P0KhP 0KP P 0S !0000K P 0K P 0S 0800KP 0K P 0S 0800KP 0Kx P 0S0 0700KHsPK@Lf@@@9@ 2A"@%@+@o3A.@-A1@ -LM@00S400P3:n0 00 ሗ Kcece00/G-(@, TH`@^ Þ0P @`|a`P pZOR: R:p\C @h Y p  ` S1^ppVpW p pG`$` V *Y pp' ` `^ p`@ 0S `  ,@H@Ѝ S-LP@` > S SERq@03/L060p0  P@b`b@03/L0 3/W'*@`Pg PU D03/P0 3/X @PL`@03/L0 (pH03/T0 $Kk/deXee\ee -L ^0 \ R:R* a0  N>4@ - @LBPp<`MmP 0 0<0P`PD0 $`0 0(,hd 0A<:m -LM@P00 (@0,@Sp"`!:00VTV1X 0  P`h@ p(,0(0(K0(0,0000/ -LM0 @` T0  04"0 S M4S aV2d0(Ko/ 0PRq  ` pT@g  P"*0pd=0Wp!80 0 @`gV 0Y c P"*pT@g %*0iS0!pdS0p10 0 A3A3C?o200@`g0V 0Y c P"*pT@g "*0iS0!pdS0p108 00@`g (KR@[>u@de@@ -@L$`KM@&(` PTp 0W * \(0 z0 ( @ Pf$K -L M> @N@ta`TPpTv#x3P0 p:?oW20S 0 e:P > p0P0040 W1` ` 0Q%*Tw0 00 00PQ:Q: 0S 0040S0> jJDp P0d(K@Pd@[> 0-P.@N@L4$0O0 K0h9[>Pd0@-ASp`T @TP0 0 01  -LMP`0pV@ 0JW$J(00K4 K40 R#:$&:080 00 0S "88!880 00?o2 >00L80 008 K0JdV@108 0 PP`d(K[>  -LM`0(0,000pS@ 3:RH0DP DP0P80000P0(`Pp0Khd -LM(,( 0@RqP08000P0S[ `VT0A#AR [t!t R R R;0SH0 0H  0 b(H0T d b"H 0Td `@6 100 *V00zbWp4 00 Z04 0 0 kP`g 0 00 _d0D0 0 0PP (0(0000D00(Khd -LM@P(,00 0`p80`0Y P0P(0000000P0S` 00W100 0 0ph(K -L$M S`PS*004K! 0 d@P+4 p Z:0 Z 80 ZP80)T,  @Rfd 0 0 (K -LM@`Tp@P ! 0U00S   0>00>00 0 p 00000 0P P@H8 p n(KceceA-P`@Pp* U'\ R*0.b Q00 \*0 0cS0!>0>00P@-// -LM)0pS@`P  ( "%+PPP@V@PV @!*0 PVP0V0" 00"%`( +0PVPV  P"%KN>@B@p@ -LMP?lA02R/ r/ C<0S00,0B20S10A60S00B$00$".0 ?`0?0?0? 0?p01?0/o0/k/g0 00x0 0000 [ 000L0 S 8KhMfefe@feDfeHfe fe0fe@@@@@@ -LMpPQ`PU2  0@T R  !@0 llŸ*Q`  KD"404"K.L1SKϗ> C K _ KK} KKKuKT:T\1 T \1 ||\1pp\1@dd\1  TPL1L!0S @1*B0S 0!60S1 R0S 0 R0S  T P0AGT xt  KN>5@ЊdN>HNA@Y@n@[AA@>A@@@@@@@@@@@@@AXV,eedee@ @E@s@ -LMPp3OU`l2lB03/0T1\2PXHq0 08@Y02 0z0Y2 00Y2 00Y1 00Y1 00Y1 00Y1 00Y1 00Yp1 00YX1 00Y@1 00zY(1 00sY1 00lY0 00eY0 00^Y0 00WY0 00PY0 00IYKhhHdKhded@@@@@@%@F@f@@@@@@@@@&@;@ dU@a@ P-`@ P4 p!apЗ!$ 0 R LIpL Aƽ 4/!\@P!W d dP! .!oDЍdq~Reset vector called, LR = 0x%08x-DMO-pB P!W d dP! !oDЍN  0O   ! "`"Рo@/@@L@@W@@@@@@@/@B@O@ -LM @`pP 0S00PAP 00(0S 00(0L0#n|@0?  0 L0 (Q00S 0 c0 B 0 000`@$K[@ -L MP \p`@ D0 A 0 0pP K p-LM01@x`QP R&  k?0     L!|0t0 |$0`0|40(L0{0880L00{Kph̊dw@@@@@ -LTMD夤P0a3/0` 3/- 0-00S  !00Sd0 00l0 D1  ( z  0p AT \0K0` 0 4/Px{3( R0 d0SP L0 {@E0(0L0`0d0S xB X<:01D0h0 :S{0d  L0\ R0@ @014CH$H:;:C:Sf ?;>+ R Sa L T@@hl0  0Pp0 .l1(SRZ0V{0`  [d20S(0SL20h0 00S0 \KA P  0L ` \0 @ D l0 \ Kl0So lL00R6BSR  6S 10S 6S 10S |1|A0S@@@p0 (0hk+0P( d0S0lkI7d R ZT0 0hz0 p\Kd0 @ d0\ S S S 0L P0 0!xpPk/@0 0 tz 0P0  0 0P0 0L0 `0@ D0 (Kded,Z> @9@dePdg@@ -L8M`1  PAPUD1  00S  !U 0L 0LP(1`U U*10S0 TKB@0T0 0H0 0T KD0 @(0P$0101D00`o/dd!:!P/  0 0S/<0. T4S Q0 /0/d 0P/d 0P/Nd - L\? - LS?T -0geddeP/0S0 0 /000/de N40-SL@ 0M03/000deQLQP0\0/MQ/R0 S 0@0D0S/0H0/de Q0-L@ L4S 80MX03/000M4S 0<03/0M40de-0S# ^^ <$ B<$ \ Q !! B B!!    B B  0d -`L MP 0@rP \\ S@` 0`QS `SUQ0 6 Ra T- `|1 U VU$ 04 ` p`0 000 4 W !RL 00  D0 N"  @00(Ko/SḠ)T' `" pU 00W00S` 4  !4 1 L N40 40Z@(Kddege -1pSL@!0R00R 0 R^^1,X0`000`? aQP2P 0S 0`0 R\& S YYPU0S 0h0hS 1S 0h   0S 0`0Z>d -P `@pLV DP 0`P R  Tp@`Q 0 "uT 0101D0db4e 0-0L@ b8 #8000P0S0H$Pl$!P$" P1%R DAor800CS0 80K0hcr0d@geien4e -LP`O@<l@Km[PPi003/003/03/0$0 0gede -pLMP(Ko@@@ @X`V' YP0084 0C84 0(<40C<4 0 @h</l_Y(P @T0,03/0(Ko/kede -LM0` 0VPp0j 00@0  a000 0 0m0_PQ 00:#640 4 080 1<0 80 0D0 @& `  1 @ 0@`0 0 0@ 0v @ 0 @ 0X1 00C0C1 01000100 `  0S 0 0S@Z 08 41N0 +</`V(Kged 0-L@0THD 0S `( 0S  H0Q %  % @@EK0hU0d4ege00 Xē Q\\$/05S/edge 0-\ L%R K0he@@\P 0\40 $ 00 -X0gedPd@@-^ @Q@R @    0 0 0" <đL<ā l0 Q S1A00C11 S 0A00C 0 0d/ -L4Mp|6@0PD0 l6`5S00  !N0 0H0 h 6TB0P40 /g%:80 %<18pW 40 ippPY 408p%* y) 4  R <0 WpP <0RC8  `}p=3[ 0:#6<0 40< 0@0 1L0 @0Y  V0  M 8 00p00P0 008 SP S*"E8T 0S$HJ$H$JU@ 0- @`$ 000L00SpP5S d0)H4$7 DP4hr5E00050@@Eged@ 0-L@d P PrK0h @ -LMP@p(Ko`d0d00 00<0 TD*$::6X0140 P0z'u4 408p T*+ ) 0 [J 8 R <]JR<0    }00 S ` NJ4@00 S:0S  O4S (0,03/0O4(Kov(K?de -^LPPa@pb딐ZT*$::6W`1`!5P@ :#50CT*0 dQ!803/@Z,KoAde 0-@Lm0 !:pT8@T8"p;"TP:T8X8\(3C?6C0b#:T. d 0#2. >00` T8峻uuzp1q0p H4!*$0100q0P$0240@,1 0$1@@0 @0@@e1 00 @@00^0 00@@0 @0@@e0 00@@0; @@@e a<0(Ko/dged4e@@oe@<@de~@eTfe4eledeD!@TmeDd@ke !@ieD!@@ge5e 0-LHQR0@ >QR c 0%0ekege -L$M0'g(($g$1P`@@@@( U(0㓆"V8 /*0 1#PP 0 0040K0009  wOP xFl4pW U *DT0 Z p 8`(K@geiedPd@cece@@!\4 \$;0 /ge -L` pR @!: P Rh PP0SPP4k`PJ$Khge@&@ 0-@ !:L 0T$ TD0d ->LPM^0P@P00 |kQ Q h1hkP1Pk `00S;0p40 pU>0p80 Z9 Z\#$ 40FJ00 00\  < P< ptkZQ#,80HJ v rJJ(KY@gee [>~@@0 /e 0-P@D0LM@ 0S      rK0e@-h0:S AP@P 0R `P:p B`pUT0e-T0*R A0 S ^00CQ e  -AQ`**%L 0L*::0; `k` ;/0S0P`k `+ *+* 0**** * U* *, *$ *0?00?ege !i!! -`@0La00>0>0PTp $:3P<j:K#J0?0?0000?輊dd@ -LM@ᘀzT*$::6WxP!P10j&eT*L0 HS @03/003/ tJ 00(Ko/ded0H4 /d0  ")//0 !Р!/0 ! !/ p-LMP;P% OK,`F/02 ~?2 02 0 1`0    R"   0&#(0 <@0?6/Kp`4eʈceld0002?0/S0?0 S/ce 0P/ce 0-l0 0QPL >P P8@ 0AP`0000`4eld -L$M2B<03/0 QP l2 PR0PbS R  :4: #&! h| * *"&!h ;Ps 0Sp 1=@ht(KohPPA0ap P?#K1080 0SG@1<0 1@0 <0 g@006S46SD$h 08 1:0800#K8/P #K 0#KJP`pQ Q Q Q Q |xhplhhd}h`(Kok(Kde`4eld@@;@A@ce{eA[>@q@S@_@@@/A@@KL p-L MP `0R.8J!pJ!J!|J! $K@P%01$ D0 3|0d03/@@`40P@0  $K@P 8 $ 0 4  040 @Kpded/> 9. -p`LP&.-.:~ 0@0@P ".0U P00P p-L M0`xhh00^>0@`0P@e0N@  0  l00  L0000L0Kp@[>؊d 0-$@L !k000@5e 0-`!L@ PP@(@`׶00PKh@5e -`LpPƶ0@T R0@ R 0Th %V k000 KhP g@5e@@ 0-LPd *0W@@8<000❳00t0W 0t0P0t000ҳ00 03/0V00C00 03/~e@HNA@ -P 0@@R8` 0t0 0 L Y 80<8000C00S80 080y80 080Khy00S d4P 00Kh/~e -@L`4PU0,t0Ut0KheL0L/L0aQL/80/x 0-8L@0  xP  #d 0 xQx|00x0 H^x Q @\H@^||0|08 @0P0|000 0-@P0L0ɲL00L0K0h 0-@P0L0ⷲ00K0h -P@L`0⥲0S 800800x0Khز -P@0L`03/0S 800800w -PL@c08 `20S0@C0eSbA [>@ -@`LP00Sl@ T T T pT qT %T 3/p 8008080@ 80 00 03/nTb6npSp0յoյp8[A@@@3@@I@@R@h@ -L M40:   ( 00 K0 1K K' 0-PL Mpp,0 ,K$㌐J2K 0(K@0 ,K`P0 S H.P J0 `(0K@0 ,K`$K'd[> -L M40: 1KK $ 00 K0 K K 0-L M0 K<1K K (   00 K K'` -L@$M  K K*   KK  @KKK -LZ@,M  K.$  K K *  K K @K KgK -L M KK0 0K 0 KKM K -LU(M K# KK0 0K 0 KK0 K -@Lp0`UP0P0⑰pPP P0≰  p0p0`p0 v0{ -@PL`0-T :TUx@5@t@p`ppGTI P 0 S8  0@00S4 3/08 0  S |  8 d   @@@Tup\0Td0S` @ P 0Sdp``0V0Kh -L,M@@Pp0ïd0SW0ST80 00 03/B`0`0\Scd5``40X3/0߯@` 80;8080崃K008:0?4 K0 l0 8K8 8KS80P;80堀 Pd P00d0 d00 03/ x_0⨯80 0_d0S ;0♯td Rz$n!8l!8l!m!Pl!m!m!ll!m!l!003/`u00 03/_d0S0(S@080 D040 0 R0C B0 00 00S00 03/L_000 8 K`KD0S`G 0CD00 80P00!00  x`0PL0!0L00{0/D @P`D0S0CD000 03/<c_00 03/dZ_``0Ův0d00<00<0H00H0`P0d0S 00 0S 3/0⛮80 0֮(K@@d@@ @$d-@t!4@G@ -L MqP@`\P d00e?o2?6\0U3v`` V,`0V)0`Ud0UpP Pp W000 0⌮00 P 0@0(K -PL0 l P d P \ P T P0 0000( 1` q  [>P P P P P0 0000 1d/>/ [> P-L P P P P0 0000 1d(  [>00/00/ -@L0­t0S>x`V; @p 0R L0S80   80`P*P  P0 0◭Pt00t0p00p0Xs80 @00 03/^0$Kk辭 0R0|0 8080;80 P@L 0c0?o 0sPUP 0CR#P 0U00 03/ 4]P0000⋭ w}m@@ -@L`4PU06t00S0CUt0 0pt0SKh\ 0-@PLx00P 0RK0hAp  p r0K0hD -@@`LP0<0QP0 T0 00T00 0@ 00C080 @080 1P;80"P <080<0d0   S L00L0d0S0S80@;8080 @0 0Khd0S0 00000@@qr0Kh -@@`LP003/<0\ 0<00` d0080@80    88007880808S S S 0"0!000080080l08S  00 03/8T 0808;pP  0Y0 03/\]3/\+ 0{l03Z,<0Y 00 03/\@00q0]Jpp p00N?0@@@@:@ -0L@S 3/`a0P00P0Pp0US0]qp 0p003/ 0p00 p0" x 0 Cp 0p00U 0R00 00⢫lplq0ޫ$dT@ -@PpLM4 0@ ,@ (@ `0T P`P@ 004 K00 X q& K- ^ /$0/ -`LPP@$@T @P 5 0-L@P$0S K0h0 0-8@LP:@T 0U@t0e p-LM@P[9$1P^ 00 03/[%PU) !R00 03/[`` @P:0`: 99000000P $00Kph!7@o@@ تe -P@`Lh0K10@J1d0S(,~!@~!`~!~!~!~!~!~!\0` 0b1% 0H!I1lFi!0pH!IqlFa!Kq00 03/|:[ 0 000 03/dL-[0K180 00╪00KhЪ@@ -LM#K(U` "S "S "S0  "S Q -0pL@Pb$W`<@0Lp@00 .$0 S=$P0 ~.@P0d0$Kk 80 P000000X00\00L0,0H000D04000P 0.$Kk舏d@!!! -@LP,0L`   p x 0 t 4   ,  , \ P %P0 L0(0 Tp000000 0 WHp!!ܘ![>!@ -LP#@#`#P0⢢ KP?0Kh֢ -LP`# @0PPcggg4`P0o 0-P,@L P@\ g0e@ p-LM`@#0P  PhU`@S#U`0!S\Q dUP0 X0 S[>@5!A 0-L@.!K0h -pL`P0@  WS0 0 e뜀@P0W  Qe Ο 0PR00 e,ẖmX@$d@eee -!@LPh 0T T T T \0T 0KhKhB01 00Kh 0eUUU R0@o/ -Lp @P0m\0U `P 0S P0Kh蘟 -LP`  @0PP%ddd4`P01 r @ R '/ 0-QLM@ L~R0 @00T@,PnRK0[An@x@fA -L@P3 @P` 0d00`0Q\QR45P 0ݞpXdUdRdpp0 ᣣPlQP\paP@ W803/@$Kkg@A @@@@ Q-L  RA -LMP(0K@p`0 0P40t 40dP L0 8 Y$Q Kh>A!!A <0 80 40/0 8< 0/// -L M@pD1P 0%@P33!B!0 N`a0i  :@0 04TUOQ0)D0gW%%P(K\!i>i> -05 L(M0  K$ 00 K0 1K K0u 0-L,DA@0 P?.8008060 0-L(M0  K!$0  K*K[ $ 00 K1KK K -PL`P@00 R R   H0S@10@1pP $&P$ MU0DQx0t000P 0X00080 080HP<P0 TPKhPdA@i>@ 0-@@0LPhQ P` U $  K0hP0 0-L@P@0♝NP0K0hNGP -l0L@0p0CS@PRn00Sx0SypWx`kP]1 0n00Sx0Sy0Sx`OPA0 0n00Sx0Sy0Sx@4P&(0 0}$dt! -@`pP  M L! 00 0|OK0e - :@:`#FLMP!`pP D18 Q9@A XT00 0*S K0e 0-(0L@#0H!!\@1 0( $ S$0D1K0h0e -P@L`0PP 0S 000 0'000V 0S000 0000`0S0S00 0S0000S$00KKh -R0LM@$ pt@ t0Kt0KFKp@ l KspKPLL6 @0 P0K tK`P5 F0h@ jh0K0FK @`0K(`0K hKd@ @Pr'["448#8SC0\@ \0K0[0KZ0K5 @`0 0P \KX@ EKVpKTPK@P0ptH5Wpp'4U0K(5 @ 0p0 \KTpK@P0G0 c0 @ @ PUM PRP PRpP PRW_oRPU2 PR%rPRWP PR<PRpRP PRWKPRPEX(Pp᐀XpX᐀pnP XPpP W W p W<pxEKP%P PUP<< <P PEP /oQ" RnQ  n R0 岐PP@03 @00 0 0 0hS3C0\@ \0K2 @`0 0P \KX@ EKVpKTPK@PN0t2WG'4U0Kl2 @ 0p0 \KTpK@P9GPp0@ 0 Q  Y0Y R\p@phR  R\\\[A 0PS 00ph   0 00 p07@N  J%[J["448S0`K0 [N0[/`K40/ [M0[4K [00000"20 00 0@0I[ 0@0 0Q<<<;0P0KQP0K MP0K IP0KEP0KAP0K=(K0u  -LM0K0 0  Ki> -L(0M 0 0   K蠶!(! -00ML06 0 0 K蠶!(! -L(M K G0K0K0K0 0K 0 K0K 0KK 0 K0u 0-K L(M1KK0  K( 0 00 K0  K0u S0-L,M 0K 0K@ !K:0$0 0 K K0u 0-@% LM0 K*`  0 8K0 0 0t1P0K KPS0KK Q:; QS  QL;00Q 0 ` K" p䀟7K0 | K 0 p @l0KK P$Rx xKf0[a[wKxKt 'KP$0q Kp0K HpH0K xKP H0KHH0KDcP@0cS00 K0uA  -LP`p@P! jP0""H0cH0$ 0600000$0 0 0P0000@ ! -L$MPDA0d 0Rc80 080'_[@Y H$0pA`a p`QP0409 3K0 0@0K 8?0K 4>0K=K< Kp@`K080 40 3K(0*0,`K 0f p"410K0 K $0 0H0 @P  H0PTp\00D0`0XhPL0i@D0D U0#@0;(K  0u$d! -SLM\ 0000 a0 0 = K N -LM@l4  P000  P000 K N -L,Mp`PHK0QO00D KP XH0S[A [DK!$$D K !( p ` P DK (K -L(M`P8pK0QO0p04 KP UP80S"[10[4 K"44 (40K0"80  Q   4K80 ZK -L(MQ K@ KB0K,4K0K0K K(( K@0 K K 0u -L(M  C KQ,$ K KK K* K@ K K0u p-L M@0P Da 0@P40   b8"8#4b4# 04"400 S0S000Kp 0-LM@  PhK?4X0/KK!0X00P<3 <000 < 0 K0A p-L M0@ CRP`/0 0Q0|P$0S D14  4"400 0b1Q A0C   D!4  `( ("$`$" Kp - :@:#FLMp!P( D)@!8@`@@$R@@T L?UN C@?U %0CU 0CU ?U ?U 0U00 >U :0U 0UQ>U 0CU :0U 0U p>U :d>U \>U P>U (D>U) 8>U ,>UT  >UA 0U~0 H=U 0CU n=U =UM g=U =U =U [=U =Ue T=U| x=U& p=UJ  wyX=U P=U ?A Pn@TY PUf0Qo0 5>KP\N#[M3[0b100 5>KuPN5PJ0 Q> @P:E05^KPC LC @P3K"4I3K0\|H#K@ @@0 D>"@0D,S5^K0 Q@PP "4$("( R !0\ 0 Q 05NK0 0QPD140   4"4 0 5NK sP0 0CS 1KZ5^K d@P0 K0CS 1 0SX 5K@5^KQo7>K00 00+P T@p3S M3[/K"44/K80#8   00PQo7NK0pߏK00 P UPN05^K00 Px|3S !$$K("( K!m#[KK M[      H @0B0 0< @06 @00Q*,  ' "  0S@X0"0P0 T0 @  QP  dP@1 0@1 3  >  9  2<00<0<00<0; 00 00@ Y0PC P3K0LC HC L3K0夦@H3K0 @@0 5K 7>K \  5KX 0 S)!!X!!h!!!!|!!8!![0 p3Kp0fg3K05>K 7K P0I#[0"30[0p3K0 030f3K0PEg#K 8@ 5>K7K @Pw Kk q[0p3K0 030f3K0ʠ< g#K 5>K7K y@P[ KO U[0p3K7>K&0p030f3K0 Tg#K 7K5>KDY@P; L#[20"!0 0 05>K" ([0p3K0 030f3K0Dg#K P 5>K7K /P0I#[0 10 \0p3K0@030f3K0 KO3KgCK  :@5>K 7K P00\0p3K0P030 @f3K 0 KO3KgCKp 0 c@ 7K5>K P0P0[0p3K0@03?0f3K00 00R 87K5>K [0p3K0p"g3Kf3KP0 5>K7K PL#[00"320K3[0J3[0 \0f#Kp3KO#K0 L#K!g3K05>K 7K 0Sb0!!\!!!T@7>K   5K R0p3K0`j3Kz0LQ@ 7K5>K gCK|P_@_KT`  0U00U@0D0U00D0U0D+ (%0T 0P30DV;0e c@c Q c c c c pd c@c cccx@cqdvdcdcccc c<cc c(d@ i>*" *A0u]A N5>K  R 0P#K p3 l3 I#KJK  00\@G#K 7>K 5K Pl3[0k3[0@PP 5>K  R0P3K0 I3K0H3K0G#K@03F3K:00 015K 0 D@P+ @7>K 5^K_  [ R0p3K0i3K?0g3K1@ P7K0 @P "4$("( 0BS K 0B᳉PP 5>K , R0*P3K0 I3K0H3K0 h"G3K0 @0 5KD@P  0$ R @_ ᩉc@ C 偉 x F0*C 3K0_K@@@@@ ,#3K @0 3 ]@P3 04RS#հ00 ;0040  3@,09.K0 [@P@X$3^#: 4P`F0{```3K $43KCK偃K:0D4 `0 3 `P 0 S0 ă0# `L03 , (V񟗍!!!!!!!!!!!!!!!!!! !(!0!!d!!8!!!@!T!!!!!!!!!!!!!!(Vb!!!!!!!!!!!!!!!!! ! !(!0!!d!!8!!!@!T!!!!!!!!!!!!!p `dV . p `dV" Ӣ '``` pf  +@ `  `ffp`p 0 `  ,cV !3 T @03 ,      @h0+  S PQ0K|S pPP|3K"0'嬇t3K 0 P5>K =@Pn 0SB =   0 /K00pS lS PC o3K0p#Kn3K* 0 h3K`0 P 7K @P0 7K00b30 30 3: @0p0nCKiCKhsK@P030 00b3|S@y0C07KpS  PPp3K0  j3K : 0 Pp?K hsK@P_#[[00a8#833##SN[IS[G#[00 10000L3[M[43F#[K3[a43J#[E3[4303    Kn000@! p7c[8[6[1c[<4c[t 3c[5[2c[0 00 00003[(0000埇Y@0D8ST NQ 0DS񟗲 !h!h!!!!t!!*Q# Q  QBQ:CQRQ   -QF QP  QD: QQ8 ?Q5Q CQBQ@*+Q1 AQ/ *QQQ+ RQ-5<` 5K:<\ P`5>K  PE3[T@?0E3K=#=E3K:P5.K<0 P T  T  @  A Q  Q QAQ QQ +QQVA NA F A 0X 5KP3 00P#K  0"K#K*  LK@0 k@0S<@ 5K* 0D@ 5>K Pz20G3KF3[ @0F3K0DSp P0ESk0S 7nK 0`Pa0\3lC[kS[0E3[U0=#=@D3[@00 0D3KD3K0 0@3K0  F3[ECK@0F3K5>K @ECK l? <05.K20  00 008DP'0  00 0 0M#[N3[@ T@c@cPUJ,KAT,0KQ3U#UUTT(K -LM(0P#0!!D1`80pp0((0S  @P #⨄/KK 0 $P?0Hp41  $4)<㊡ 6ᨁ *: & ̟ 0 0,K1K0 =Ƞ40 0c0$ 0c00 p1 ܏KXǟ0K0@ 0/pP$1jP0P@0 p /Z$0K @ 0pP p P0000@㠅W  p AQA$0p0(K0ei> -L(MPDq@0P%jPj0&ViPaV S  0 @1 0@1PP wP~ PU{-UPP Vsv80k;D@0 <0@ 0L14H!;! $(  R   4KP;D@0 40 < K@KP ;H10L1P1800 080 J0L!"H1 (0d0,0000F80080$KAA0 8< 0/ -L M@Dp0`  @P50 4 PQ0Y 0@0 4TN^@0♍ 0׍kJ!@f(K!j>j> -L(M DH0S40<@0 @@5  K, 00 K0 1K2 K蠆 -LDAP0`@1  P@1`0 Xg@@1@0@180 .:80080A 0-Ld@1@  P@1`0 @@@1@0@10A0Lf 0-L@HPf X14D180X00X00 0-@0@LP1@!h@` @!Q P` U $  K0hF@0 0-L@P@0#?0K0h،? -@PL@8 nP00Sn00Sx0$Sy0S 80 00 03/hB=80<80RP l00p0CSKn00S;x0S8y`V xp)=P0 0`"V=0₌800800⿌9(`P` |?0o800800⬌`n00Sx01Sy0SO``;AIA$dt!mAA -@`pP  M L! 00 0>Kl0e -` :@:p#FLMP!|P H P D180 0S9@A VT0`0 0 B$Kl0e 0-(0L@#0\!!@1 D1800S 0( $ S$0D1K0hl0e -LMp`P @ ş 4t%<$  0 ?F V Z8PP0@@K0 KK00$Kj> -(0L@#0t!!hDaP808000 P Kh>0$00Khl0e -`L4MP <K%0 <0KU@Pg p 0 00ㄡZ PpP0 <K 7pP ` p `p@ <Ka0<0K 0 /0K@0 ;`K00@0<KP0 p0 P`` <x0p0`t0p 0pp0p0l  `(`p$``p (K N -LM0K0 0 T Kj> -` 0L!@<!PP  P  0Kh>l0e -p P0!LM`!d@P P D180 0@ 00 00> Kl0e -L(0M 0 0  0 K!p! -00ML06 0 0 K!p!  Q0-L@  Q  Q Q  Q P 00 03/0d0?o ,0cT$< ;00AAA 0-LMP 4  \d @@  000 @@   000 {K0p -LHMp@`TPKXK0  000V0(0 0 QP V,`X0S$[Q0["4408#80S0?0S 0 0RS000P  R0>0$K -p :`: #6LTM!h0 DQh0@8)0!00#R00SV #V+ #V0 #Vl  V  BV  0SX00P0 T0@ P80 H R0 \K 0QO``K `0\ KP`0\KS\0K\0K000Y [Z [PP%PSX0 XH 0` 0\ KP `0S\0K000\\PJn H RC0 \Kh0 Ph0` K 00\ KQPZ`\0KP  00000000S! 0%?0P00 \ K[ K  0\ KD1 \K0\ KD(-&$! @1 P @1P@0`0@10 0 0=P 0 0 0e (Kl0epdpd td@udp -LM@` P*0Dq( 8P 80K$<60K$84P 50K3@K$4@40K&4SK10K0`K0800D0p0L080KP0 0T00$K -LDM D0`0 0D 0R80 080N@ 0T@1 0@1$p Qt ApD`000$(0UX T$$f\  4 ) V` `X0[$KM@KO0K\0[P`KLpKN0KPP@K=U$,Td  V(`*`H D $Kd [C@KH`KF KX [@pK PE K\ [H@KD K'$A K  <Kh0 9%,V``: K%(9 K7PK%$Pd0[8 K',60KX0[2 K'(50K\0[1 K'$40Kh03@K<`K0 K/pK<@KS00 00p$`P 0 ^0D0p0PTPXp\`L0h @H0H  0(#@`00ڇ(K  `$d! -L`M1PS@c< 0D`K 00K p4 00000DT0KP` PL0[M [4 0 DP< 0@00 00l0h J[5:,G[ `I[K[0(` 0H[p$0fK SRWVQ! H7&K!  0#$+4 $0dKD`p0a60# `0 ` K X0 \0 T0 P0 L0 02 D T0K`KX KOP PQ0[S L0[0S S T0Kp`0a J0[K [48I [0d0 -dGP$0 TK1`0K0 000T K Q`P`0S$[Q [T0K"4$T0K(0"(0R 0$( d dDP<d0 d&7#$+4 $01S (17D00(0SD1 80 KP  P  =P  3/P@00 000 5:0>00  > "T1 (0P1,0H100L140$KpA NA -L Mp`@0P 01 1S40940000 R R   H0S@10@1p8!L 8b  0DQP0L100P 0X00080 0808n940 PP RlPe9U U UT`d^ 0# (K|! T1(Kx0P10H1L!?9\X:9<89CD0 @᠊P08KDd@Hk>HNA7AuAA|!!@ -L@DQ`0pKPE$*@*"F9@A0T S  0 NP@ P& @T#808@@.@P RP80080X .r80080@0@-p` \ TJ@80~SL,%DP, $@ 0O @P 01O@S 0-(0@#0L!,!$7$ 3R$0K0hćL0e 0-LMP@( K|00K@00K0K0HK0 5$HHK03/P l-88[ 0[S [  0([R hK$ h K8K00uAXk>A -00ML06 0 0h K8"" -L(0M 0 0  V K8""R/00S  0 r 00bo///\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -L MpP 0  @P:[j0 v`a0i  b@0 0\T3A`z5 03/ |  !s44(KT/"lk>k> -@Є$ 00gL00-(7PS00 < 0(~ 00 'R0<Ա0<ı@<0<0< 0< 503/P P P0  $Kk| ?5$d"A 0-L@PP 0P 5(W0C55S0 -(0@#0L!!#R0P `$p(QP0700KP $0SD ( ": :#6)01Sr> C# P3( Q :$0{7   ;  08< , (,* *"&9 1S 20` x$Kk$00$KkL0e -L@dPKh -@Pf/L$7Qq~(0<⾀0`,`'@ 0?S^P48`HP00 0 t SR0<0>4040X0000< < 8 0 00 AAWEV -L M@ሠ -K <40S +$000CP10 v#zf0AAHNA@JARA -LMT@Ux 000SN@!"h "P " "\ "h!" "`q `q 0S 0 `q`|q5 03/`\q0 00L00(7S02,2V (7S0(71!0/<@(7S5000S$0  R0 &as 8s>   ' Ḩ K50504K*A7AAAFA(@@@$d"TA -LMt`pX0 ZZ0%VH!p@P~ 0(00 Qt0$P0`pn  ?#K9PQ00R0 R0Z0`0pS 005 0p3/4040m <  ?0`p0 'R0<Ա0<ı@<0<00(0 0전0503/P P P2Q$"d$"P$"X$"H$"1 x1h2 L1 0 (K蜐dL0eAlA~AAAAA A@ -5L`0P3/P@ P P lU240S( T6խ@00;00E0@0 0FF4 @*AA -LM`P@PR 0#50S5 0`4 4% 3'4 P 30K  V~ R Q Q P00 (  4Q K VPZ00 R ? `"K4 K30 30S00 2[>0]Q 7<70q~ 7@077  H2 5@ ,25 20 0 70ǔ : S<_.0 80$7$ 0#K 7@ 0 ? !$7 Kd0000003$' !$7 0Q>0$00(07@0,00P  S 0: ¥=l0 hᴄPX2(K"@]A=jAk>nAAAAA!A2ACA~AdA@41"."@ - jjL&fp!{@Pb P` q> 0\ tYx0`QSU`KP0S P0S7 503/`P=0 , wP 2"707U 0(U20S  W  W H0UHP L0ULPL H00P0``P0S503/L0e]A 0-LM_K@ 1P*0B8s 000:  00K0 -LM_Kp `@P2*0B8s/ - 00S)_K( n02K02 01000503/P `2 1  0!R 'K4 '.K,2@-@K0uAXk>A p-LMdP0@S Z>0#& "S00 5( K&[>0K ; S000K0K@0I0K0K0JH0 5$HHK03/P l18[ 0[S [  0([R pK( Jp K 1KpAXk> A 0-L5@03/P U503/0 0-L@707503/0 - JJL$Fp!9t`P@AY~ W  W H0DH@ L0DL@L H00SP0~L0e - Z0Zp%VL M`!P%IPAPP0T 0" R@(20P: MP UP: P KL0e 0-LP55@03/P  0 0S0 -LMQP`p 00`p &40&80&<0G4H`0@p( K 00K09K9K@0l0K0K0@ ` 0 9[K 09K503/P 09[ 0[S [  0)[R xK$ ?x K0 K0u' AXk>E A - JJL$FM!;5P3-e>0 7% p$g0 P TK 0 M`,0Tc9@AV"Kpf W p ?p_P` $KL0e 0-Lt@⚺$0 R @@00茀e 0-@LnP0S   0 ;K0ht 0-LPZ$0@T 0U@n0茀e -L,M`@P-( LKS$p1W X-0P5U 4U*%U$U* U)U 0U UU *9U :`0ESU U 1$Qc-P^Q[ 0#[  #[ #K#[8 @PK*#K3[/LK:3K3[03K04  ,?$K04K04K@0>0K=0K8040 ,000 1% 2/P010'3[= 3[01B0[ 13[ 0110 @0[? [B[04[ 0L0 0 .#4 ?0000$00ᙻ KY A A - @ 0*L⊦$M*8  P p7`4p m0 0P 80pc5U 5U |5U+ t5U l5UMNT5U 0CU A85U 0CU*$5U 7:50S25U 5U +- ,@ X00X0 40S frPp4 E/@tp{707 0x@P+40S $00024$UU0P㊡$C& @P0 @_6*:0 &00#+y@707{4P+7P070  7P0707DfcrPP4 A 98S@E/4K)@rrC0 %P a0`SE B  SȠ *0S  )r<p0 p 0000001D0000000 00-0! 6000 60 080|00P0S  Tr 0 080,00#0 01P0,FPH @Z$p 0S0 0KP,P@0/000@ (KL0ewdrdA}d(@rdAtd@udgd~d(~ndQgd"8"$5"y -PL`@,pP 0 00000000 @0000,0000,0,000(04060hG"8@"K" -p@L `P/ 0,01 0@000  040@00  (000@0P 03/Kh04034 S040  4/0 0405080/ @  / -LMp@0 `7'0@S, P ?000( *z+0 0S040Y 0 Y0'<0PY L 000( 00*x0S 3/P2 0  400( *0" 倀(0 8/! 0!! 0!( 000( 00bS0ڰ0 0408$K A A AF A -L00 0p +40T`86/0  0 00 @ 81P40!  m+(Ko䐟ܐ0( (0긐0( (40  (05(508004000 0p +40T8(Ko/(K'A@vA A A A@@ A A -P @Lp` U  U 00400 80@06# Kh/ '( @6@R/ 0( Pr  "/ Q0-L@ *( }*0 A@ Q0-L@ q* 0m*0) A2 A -LP@6H0S0 ` pH0< S@  `V @  @  00 @X<\ U @00 @00Q!p0S (< A -L@`1S H0S<S@ #" R0 zmPD0P`   00C;00L萀e 00-@MLPP 0L0 00@@8 0ov;K0萀eQ AX A\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee 0-0PL@P1 P1001P1P1 P,0D0%4AL" 0-@@LP P

0K0=0K>S PP^0@0K0=0KD1`cKl80 4@ 0` 0LK03/PP=3[}3[@  0S  0QQ  0Q000Q800K0C?o20S4\0 P S$ $ 0& S$ $ , R 4 40% K'NEFXPiTD -L(M0Pp@( DK,`q080K03K?00 0CKsK0DK3/P3[ K -L@P0`00 0S 0( 000 Kh A -L0 0-1L@T? P1 R: R 4     K0hz,0\0S0@ " @ ##  3/P01 @$ (0R!(00(0$ ,0K0h/0 0-L@"P,;@6T 8 0蘀e 0- L@  0@00K0h+,0`0S 3/PK0hꘀe 00-@$01$ L0P(0101 00S K0hj1 R 0P  000Z0 000@ K0h0T A -L@P`1Q% 0$pT0 R W(0!(00(0$ 40 3/ T 0S 08  000 1 0SKh A 0-!L0,@0P000  !00C0000X8P<00CK0h萶0 03/0< S@ #"0µ00!<0000C0K0h00! !0! 00 0-L@>!P0S 0C0<0SL0 -!@L,PP$!`T 1T 1T04 T6 0T 0T. @#"p@ 0S# 0S @t T``@PV @00 P@PP -1e2A4A3A -L,P 0` S @ <0S@ 3/@P 00C 0 -LM`@UP`~&%@P00S  ip0pP Co  Q x0  0`h0` P T&0H HwP4Kh&K@dO"e[AH`" A|Z"U"@ 0-!LD@P 0 P0000001e 0-L,@I 0P CS <0S 3/K0hV -LM@p,`100<00J1SX03/&00,<00> rP0W 8r@0S<  R0SP  0 ~0  00p002` P  Ki}%Xp\r 0\R00 !8,rHi Ki K萀ee Aee" Ae -@LP00`<000< S@0@  |`C0 10S1 R 0S 00 <000+00<0000$00  Z00;0000,1   B 8 Q Q 1 ,03/Q(4#P0 Q嗴&` A A 0-!L @00001e -LMP@,<0T@`0S P 0 0 00$00(0$$@(K A@ -ML MBK0 I @,p PP00S0002/K,K yP 000#H#0<"S006Sa _ 0#[`CR&# Vzd Rt  04 .P04Z 04 封#04d R  CR````0CSZS 000 3[S R*,# 6 `|3[S&`V* #V V V V#~#0 @00R @@000S0S00ąP }0PP00Z (K- AHNA? AAZ Ai A~ A A A A@ -LM R@,pp` q<0S@001S#0<SH R@ #" RT0 3/0 @P P00S <0X Q <K@0  @00< ( 40 8 1< K0P $ @ PU @0 P)d0S 3/ P<0R @0 0Q Q@0P 0 TP Yp 0LR00 64pEg^됀e A AL"ee  R0-0LPK0h#P@@ 0 K0h裲$d -L`NHP@p0Lp05<0S 5JptP,$0 $03/03/$0 `uc5opooo~oPU  P -LMP`@P)#H"`0000 0 000000000$0 00 0 8 P5/ P Kh"P04P800@PD00P02 X02t0\@`PdPx@|PPo H|o pxo to,L42p 00+z1 00"q1 00Fh1 00N_1 00VVx1 00^MX1 00fD81 00n;1 00v20 00~)0 00$0 0P0 0 sPt" 00 0ITKho@ Ay""AfPAAA#A-A7AAALAWAbAqA$dq"@m" p-LMPd0`@ P0A@d0<0 0`40\P Kph!Kp(n@[Al|"|A -L M`Q00@S Pm p㴡1I_ R W p00 .W00W l&Rh1U "RQ) "DD R U00QPPW   1Q PU  0Q 0U  0S 0W QژVPpP`IO R U8PU U (KJAA@HNAA@AAAAAAA -LKo -H`PL@n000 P0D0L0D0@@D@3KhPn - PL@U H`n 0R0D00 0 00Kh7n 0-L$ 0@ pPm`0SXK0h!n0 -@p`Lm0 03/p PYnW 0Kh_$d 0 -L 0SQ 0 03/ -L$MPjzd@P `0`P022$0 ` 0U $0R 0P008.  p 7/0P@4 K0pK 0 `p0*8/0P/0g?088 8/0P,0 8!8/0P008i/  8/P $03/(<03/ 403/03/6d KA 0-PL@ 0 $0 03/$03/(<03/40, 03/03/K0hd -L\M@X lK^ 05K0lK$0 K6$ -`0L@$0 3/LPU 1SS p-L\M@P`X tK5705KH0T@9C>H0tKX@ ,0 P $0T0  Kp -L\M@X lKAAA+AEA^A -0L@P`&0% niI0Sxc2"`\ LV<KhRV 06(`JVAA@AAJA[A -\0 L@R0%00'P&0,0IoMOP?VP(!l> -LXMPQp0K$K(D`@X tK505K20,0 0X@ 8p 4P 0 3/U0 03/T,00 tK@0,0 hK -L\Mp`Pd@|X |K0|K6K`` 4 RP ?o\ 2?45@T<?oU20S\00 KC' -LXMQP`@$@(@TtKX pN{405K20@tK,0 X@ T00K p-L M 0 K0 0@PP 0P0 0$ 0   #. R 0( 0 0 40 0 0 03/ `(PP0 PP KpAA -L@*00PP 0P80P0800 03/4P`p X000(0V `0p`0808%A;A p-LM0P@`0K P0K R[Kp p-LMP@` KP1 00K;Kp -@LPQ `9@   0 0Z`P:  0P1P1 R004@T  4/0 3/P` M0pP`P ,6000`PjAWA -0L@S00Pt`_0  oP0S 00P0P0PU: h<$d?B 0-0L@S 00P50  K0hC0 -LM 0Kà c  '[ K -LM 0K!à c   K -LM 0Kà #   K -LM 0K!à #   K -L MP`p@@0d@T0  P@@D @  (K -L MP`p@@0d@T0  P@@D!@  (K -@`0P@L=g0  Khrg -@`0P@L&g0  Kh[g -LpF0P(0S`1]@P ]P`]  `8P f0S00(0 3/00000`@00g -PL@0(0S `f 0R000 Q0 (03/0f]Kh] 0-L0@(0S Pf|0StwK0hf0 -P`Lf@T 0 3/@f0 ,0Kh/`8 8#4`#/ -LMp0$ @0 1 ` K␠K ``0P*5/PPU0K0`8P0 5/PPY1P0P0 5/PPI08S (Z `0 :/]P P* X K0YKH0 00<0 $0Dp @p 0KT0 'PP$0 08S ,`V 0 006/ P $0 $03/ <03/ K403/\(K rZ 0-@L<Qda R0 -L\M@$0Pp X K'< XD @0 0H 弆Khp 1thp |13`P T<0 $0KT - 0-`P "N D 0 DAD0 c0?o0cS2 A 0 A$ $0 p &6[SX K 06K0K8h0 x0<0 ~P d0 X K$0K0vK< 8h0 jP `(Krr2 6$ -L\M@$0`p X K< XD @0 0H 弆Khp x1thp p1PP Q<0 $0KT - 0-.PP "N D 0 D>D0 c0?o0cS2 A 0 A$ $0 p #6[SX KZ 06K0K<0 P d0 X KI$0K0vK< 8h0 P P(K222 6$ 0 8 0\ S T S @ Q 080S ///᠆,@  0-2AL0B0204A aA?R@0 -LM00 1`SPT1  Y$02 p0K␠K0 pp0@0*@4/@P\0K0p8@@0 4/@P`1@0@@0 4/@PP08S (Z p@0 :/@0[P @1 X K0VaH0 @0D0 @0 0`6K 1K0`0h` <0 $00T0 =@P$0 08S ,`V 0 0@06/@ P $0 $03/@ <03/ K403/[T(K r -LXM@PX p|K`K06K4408V`0 00|K40 P.@DOoXB@T%ꠀ堐X |K, 06K$0|K08`0 V0 040 @P \0 @   $K6$6$2 2 AA - LP40S 3/  2/P@`000S@  3/@PPT04`V  8 6/0$ 3/P@Ba - LM P1堐PY!0`4@T  4/0  3/P@<1SA - 0LP@0  p `` dX hP iH j@ k8`l 0ma p t=A 0-LXM@PX lK05K0lKPP $0 5K02 -LM$0@P ,`P G`P C 0  P1堐Y!04pW   7/0  3/P`3$0 2 p0KĀK0 pp00*:/`PU0K0p8`0 6/`PY@8`0`0 6/`PI08S (X p0 8/UP + X K0 KH0 0D0 @0 7<0 306K$00T0 `P$0 08S ,pW 0 007/ cGP $0 $03/ <03/ K403/}UV K < "4  4K0  p0K (KW`$0% # $0pX K06K20<0 0 Kh0 aP00 3/P0p 0  W1S GT1  0KpP \C`L Kd 0p  kP 08 0 -`6 0$0            0Ho$##|0媢P1P1 R0Y0 S  04`V 6/Z`0 3/P`  0s夠 x(t0p 0$02 p0KЀK0 pp00*@9/`PU0K0p8`@0 6/`PYL3`0`@0 6/`PI08S (X p@0 8/@dTP + X K0 KH0 @0D0 @0 2<0 06K$00T0 `P$0 08S ,pW 0 0@07/@ K P $0 $03/@ <03/ K403/@TV"KR K nK pcKz Ku KpW`0p p{ב T<FS7@ 4 w $ X  Y  Z   `P# `0K HP 0  ` S T pk @ (K rAAAAl>jAFAA_AgAmAsAyA@AAA -LM@p`040 \$0 p Z 0 PPl P0 P2 0P 5/PP,0ST$00 ,NS4 s0000 00, QP 0 2"4 P2 0P 5/PPV08S (0S 0 0 0R3;:pZX |K' 0`@ |K 0#06K020D`@ 40 @P X |K 0`` |K!0$06K020d`` 40 @P X |K&06K60|K40 @Z$K -@L` PPZ0 @Z/ -L  -LP@ΜPBnq_pU LPP,* ' -LMPhQ@x1B~0t1qo0p10d!Z?` l G \1˄00= 81004 1̈́00Vp @㍻$FL`V` a0l!.1@<x18|10101|01x01t01Gd0 @0(0K0 L0GP 8  KA@)A=ARA""L""eA"nA p-L M@hP1\au1h 1 Q V  0$KK1x $K0pl0  PU :`  4 ( h5GAAHNAAAAA 0-PLh@ 0UK0h0vd 0-LhP@PEN D 0 D (0P000 01=0L" 0-Lh@PgP @@(  @ @!%0#0"0 $1 -@P`x$0LA@p G IpPCA A 0 AWpKh -`P@pLhI x1Kh8 p-L M`@PЄ@?X0 0 h 00(00 $0 .P 0S0 0000elh  0d $0 0X00 KpkX$00 Kpk蒛AAA,"$d\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee04 0S  0 0 40/ᜁe P-@L`p4Q!R Q0SP W㄁ W Z  , Q  Z 0 20OP 0 @`0pq0Q100儡0p0Q 0T0V0S 0W  $[ j AeVA~AdAA 0-0L@S <0h S 01 00S \\ 0@K0hN꜁e P-LP`p! S0 100@T 0S0 8/00@AT 0V0 8/@Ae P-PL`0pN@P0 P0`00 R0 4@0@@p  1S  V  R @      0AdAéeA 0-@L 0R 040 K0hNN꜁e-0^ / b8"8#4b4# 0b8"8#4b4#0/0@-@0.? 2,? 00#?00R0S 00@P$?  ,Ÿ.?  ,? R\ y0@P$? .? ,?R\ d0@P$ . ,R\ O0@^ 4PU @o T\ >0@^ PU @o T\ -0@P$? .? ,?R\ 0 ?\ T!?Q /o" ?P R0000舑d S 0-P@LQ P@ 0P0 -@Pp`LV W@p P` - L0 Pdđd(A/ 0- L@q < 0S (A q  0KAWA^A 0-L(M 0P0 00 @80 0 ,  (  08 K$0 P 08 KK0" -L~>0 ,P9/ ,0P3/Y  X ,0P3/Z  X~~X0 0 !0< pP7/ip L= F 0pw0  P  0pH0 0@0 Plo 0d `(KԁedĒdnA0AAA@A@BA@gAA"PA@XAA@AAl"/G-0(M# #Yizᣋ 0A $00@SP 0$0S !P00S 0@ 0@0 0300@@ ̠01(0=0P(Ѝ0/ԁe -LL 0S ,0 Kh/0S (ԁeA -0LL \ \ Kh/\ 0 ԁeA0/ԁe - L@0`S P p ,03/\ V00Kh/0S Qԁe AN  0O   ! "`"Рo -`L@P.  ^.P @e(030 Khл[>Pd0`0! $ 00/de 0(0S 0`o/e@0 "!/ 0-L@u  PPPD&UT ʀ0 ! 0$ 0D@0Ae 0-L ! Kh 0-P|@|L(P $0dP$0 ,0KO R0 (,0`1S00!0eA"d 0-L ! Kh0$/e -d0dPL`q$0`Oo@dt 1,Wk10, dP2/$Kk_de - 0 !t\l0 10 1 Q      $ `10Med 0-0L`APh0d 0-(0L`A0P !30d -LPpu  PUP\0!H@a10,,q$0 `11 0 ,Aed 0-L@t  P  `0,`PRD @!0!0,1,pK0heA" 0-@L0\PH 5/,0 K0h/ 0-@L0\PH 5/00 K0h/,0P 0 Q>0//ᐃe@ P- L 0,0 Kh/00S 萃eA P-0L  \ Kh/ P 0v됃eA -LMPpP@p00xw00 ` 06/PPLG0@a 2/y/,W 0 4 8 < @ D H L Pt  P   O R0L  P4Kh0@0 0K?ARAe"hA 0!< 0`4 0 ,   !/deee 0!< 0`4 0 ,   !/deee -_QLMpY `ARY@@KPK _YY `IR Y "!P !,080 s  PP_Y0?Y0@ 0`00 00UV  80PZ hL\0 `1P40 ڌ1/@Z4j`∀ (KAd 0-LP @@@@@s  P`|@00/ᐃe -P`<1_QL@0`AOSp _Q`AO_Q`A Lx _Q`A L_Q`AR z021 pp0 0A000S$ SKhGꐃeAA -0 @`L=_T`DPPC0P00pwP_T`D@# P萃e -1xPPL@` Y9d p,0S \'G0 @0P,0Up0,0!b U0  YB0!0Y00 Y Y%_UO_UO_UO_U O_U _U  萃eADAsAA4"x" -01LP`@Q0 p R> < 0  _T`DF_T`D I _T`DCr  _T`D$BC@Az_ ㈀P(X n萃e 0-<0_Q@0`A@LDA0萃e,0_Q 0`AF"Fꐃe,0_Q 0`A I"7ꐃe -`p0_PpP`@C@0Lc   _T`DCKhꐃe,0_Q 0`AR"ꐃe -<1L@P01`aVp_T`DO0_T`D LY "$""$"$"""p p p p dW_T`DO_T`D L ,Ko<ꐃedA 0-LP@0S @0 @p 0 -LM`P8` p400`(K0@ N0P  8/P "(08@p<00D0 0x S &BS@ T S  &S ܹ0 $K謕dA @p@<% p-LMP 0!S &BS Xl!S &S Q0SNpD! @10SFp,!,1  P@@0S;p! 10S3p  P@-0@ '`p 0@0 ̺0P K ` 6/P@0 T` 6/ ``0 3/Kp @p@ -L4M0D `@0 @ p A0R0######################### ! 8  0B0QC11 0B0QC12080   0|3N P@@P  N/[08 0 < H  0(p$0   0 <8/P R̂$80S00 0 <0 9/P0S% $<0倒0L0 L0X*@03/d03/T00K4 KP0 L0 0R0@ 0R103/ $00006  8/PR<0$ 8/PI<0 $ >0>000CP0J0 080S W W 80 0c,"0 wR080 0c$0803,0@00  J0壀000 0<0,P0 000S0@0@0000D0@$Q <0< 3/ R 40H3/0@0 D 0(KpAAddde[>d -LMP@00 K 00`".6/`P #00!01@ 00+P$  0 0\p7/h1 RO `, K  P @ D,@$0|@4p80$00 40<0S01D0@ 0S 0000 Qd  h0000010C? 0(0K00( 8/,,0 0(000 z, KA@A"ĒdAe@@ - 0LS  Kh 0- 0L@S l K0h0P /P/ -LFM@Pp`A/K¾T 00000 8@P!BKP @ 0 ! S 1 Q q 1ʕ S01d K1 @ 0000$00K 0- 0L@QP S `s P0 -LM@`  KpPP)  $04 800R0<01@ʒ S01D00x0 4⠝0 00(A 44/ 000K 0-0LPS @  00C0 0Q0 0Pe $Q <03/ R 403/K0h>A 0-@RL 0( 0R 0R#0 ,P5/000C?o2lR d0R /000   (0 00D00_W@@W@AW@EW -LM p?o2?`@0D@_R0@0  0@@ S00 00`04/K輖d-0 , 0/-0\ / 0-L M@<0PzP RS\ R *R LT 0 PPbX`` 4 ,\\H bEQN 0::0C: 0S = 10R !0X4H << YTbT XP0 HLTP0 ,Y` b` X\ 4 ` B X``\ 4 P\,0S  P 1 ! R Q <0ZS  ::0:0 & o R < &    q D @ HD<0  AD!<(K -@pbL⁁`::S# Y LR0M2L280S0100h  P  d0%S  DPQ  -LMP8   p?00 0`40 804  A  !00@T pO|kh  P  &0S  2/i<0S  ::0:0 00 LMLbD q @P AP R \ R  - @  q Q!4@P4 P ,8,\  , 0   !@8 @ 8Y 2/ ㈁0S8080001@ p40`V040 00000 X    (KA -LM`p@p0000 00P0 5/P pP\2@  P@Ug  P ("( 0 00 00$ (0,0 0S3 ❻0/ Snn2S]LB"B]2L20S P*(0K0 PPp008/P 1 0,0K08:8/0P d(:).  p 7/0P(, P:5/P<, : *> P ʑ:” 0*\, 04  KPARAebAAAA#40P 0S/0S<0//ᨃe -LM0pSP@ X00S- f`0  P  0X|P#3 8 40 0 f  P8400 ` @000000(KHS\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deeeh:h: p-L M 0@(0C*st1`P0d0 0 KLhPh 0SQ Q0 K,XWPW,`VQ Q0<00D00 87 H0R R22H0 0SH01H0VH01H0v 0`s8 4\001 @ 8 0@@0 r 0S#4  4 A 0,0@008000@@0 0S%40040bKp訃e -@ 2LP:D`q@pW{ 0@0 T80S0p@ 0>80T 80S808  3 <댁D.< :VXDXR ** * D01 "0D20LML q @0@00 q' Q!4@P4 ,W ,@ 0S#,8,Q 00 , 0 001 @ 8 08 @@0 S $Kkꨃe A -X2@L,P\d 5/dPX”\0\`0d 6/DX2\d ,`6/X”0d \\Kh/' 0-@L8P#@PP JH >`"R X2\@4/`000 -L MP`p@0X20`rx0`3X?0 0 8/ P  Ki0X”`2 P\5/ X2d ,P\5/L2X”d 0\P0\5/,mX2d ,P\5/X”2d \P0\5/X2d ,P\5/1X”d 0\P0\5/X2d ,P\5/P FX2d ,p\7/X”p1d \p0\7/X2d ,p\7/X”0d \p\7/X=\ph \7/X2H ,p\7/X1\p \7/0 jP^ s P QXt ҳ  nX2`"\P5/0`2 K@s@'X\&GA@fA# 0-LP@Fd  P%Pp0000/-0*T00/-0 T00//- $00/$00/ 0-@$0L 03/$00K0h/// 0-@$0L 03/w0 0-LM>0Pl @.  lP 0QΌŒ Q80T00P05/P  0 K0A -0L@P L00T0X ,`6/T0 \`X6/KhA -L,Mx0@ d0S S04 00 S CS4  C0 (Pd0U,40Ka F#p80 嚱80(003/P`  8 E8 0  0<0p0,0.P  CP(KA&#A 0-@$0L 03/$003/0$00 3/ $003/ $003/$0 03/ \$0 03/@W Ao A p-L M`P5@`00\00`0 6/P dKph0<S@B8008000@ 0$0$0000Kph  A A AHC#PD# 0-L@P 0S[  P<00\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -LM@`8PP 0 ,p7/P+ 4K¯0p,P 5/0P, 8/@?0'0K%3?0(0K0+0K %V20KP4K,0K)PK00 K -LMp8  0\@4/04 K.'0[(`[+P[? )0[?`06c0* [@@bh͖4 P*@%,P[JPRX`0\ 8/0\P 5/d K\///- QP0SP0@00\$ / A Q/0!A -0L@,P 5/ / 0`( P\p,03/0( 7/0\P 5/Pd`0 ,p7/ U PU:0, zKh$dD!AJ!A<0S 4//D0S 4//@0S 4//80S 4//\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -L@`PT0( 0T0\`6/Kh -L@`PT0( 0T0\`6/KhQ 0-@L(P H00H00P0K0hze -0@,PL, 5/0P,`( 6/P zPP0S   H0_ P0@0S P0<0P0H0@$ P0L  P`H0 0p 0< ,9/0,< :/  'W0L0 0< ,p7/0,p< 7/0p,< :/x't | | p$(,L0 ,p7/pH0p  p<0   Y  PH0 0S 0L0L0S@0SH0<0Y  P H0@ $ P $p0L01P PP0Sj  `  P0L H0 P0<0P0H0@$iV\O PJV P`; P`P0 Sp p0gP0H0@ W T@ 0T00pG$9/ X 0HTT0 T 0D 9/ W 0\p$ 7/@P0Sʩ`P  !YU ^!A -L@HP0\` 6/0\` 6/T0( \`6/L00L0J -@L`%TP TX  P`@@@3 -L M@P 0 10 \`?06/14 \`6/18 \`6/H0` ``` `@`0@p`SlW]D0W Q <m  $rPb0L0{ 0\ :/0\ :/0\ 8/H0<0" H0`@00 ,0 00000040 ,0$ $00000(0OX  P $P (%09@ T0P `L0PP0L0@`\p0 7/p0 \`6/0\` 6/`pP0V0c?o20S 0\ w`FP0U<0L0H00H00P00(Koc!A!A^!A$d!A -L@P:`T( W  @o0h TP@0T /0S  `@l p0\@ 4/0\@ 4/@'&!A -L(MP᯶@P402 0P 0P05/pP -0"}P qW  P>N?d0d022dh0l~W  P;<PH`\0`P`KTL2P0P4Hn@0"`0P00  0 0 P0`0 P0$P0( 0,`1,P(0P$> @$0!`$0P$0$0  $0  $0 $0( `$0,P$00P$04 $0 ` DK@018@ D0 (1@0 040 d000 h0,0 H00(0 W  PH0(00(0  DKrPH0P y$P u 0 00P P5/ p$K!A@A A0I#!A,L N"A@A)"AE#DAE"ApE#Ada"AP0P ?R"0/ -@PPL``40T00  T0  Kh4 - JJL$F`(PP 00S `p`4@ T@ L0@0 `VL00L0@@4 .ee - JJL$FTP``44@L0 T0 0L0L00P0T0h4 .e -PLLڦ@`T 80`pPH0400PO4 .en> -PL@ὦ``P3A@ PpW@24 .e 0-L0L@ P R T P 0>10CB>A#>A0BT0(0C#d8   h L000謃e\ `P/0 !`8 00 ,  , !/deee -X0L@S`# P0XP!t0 0!`0`!XT P   ! KhHdedeee 0-P@LXP d0d 0?S5uH0 2 03/P K0h0$dv"AeP' P P- P)/P P"/ P  P Px/P P `P\/X/T/P/L/H/D/@/</8/4/"A"At#A#A"A"A#A>#A]#A#A#A#A#A"A --@LM,  K#A>A -L0MS@ 0S  203/30S&20 3/203/2LKH K03/P0SL 0B S~^# _#_#_#_#t_#_#_#]#_#_#_# 0bS P000 00 00S20S 0020S 0pbSP000 0@bS  0S 20S 00 0bSP0002 0< K3/ sX0S  00 0g~$0S{2@ KDK03/2< K 0^"Q11gQ / 0R X0S) & R0S `X0 `S pXp0 0?02tOT0 203/P ]00 0000K謃eܗdn>#A$A$A$d$$A -@D`L`P1,2ᘏ 0 s$d/$A -Lp@哤``P11W; 1W 0W V|1W t1W- Oh10S-PM J P!000C 4!000P>P0S#P: T c>LB A,A(0B\,dP00CP02 03/PP }P0$0S 0P000000P P1 .eA @A A(@A ܗde5$A Q-L L$A0( o( /ᬃe p-@L00Ņ0@D0ŅPYT1$ 01(KHNAJA@)%A p-LAM 0`QP @ @ 8G/K< 0G/KKp[AP%A -p@`LVB 0s S0sPPc_oRPP! Q uP P Q lPP Q cPP Q ZP YY P 9/PU @`F 0-@LR000K0h/ -X0L _(b%A -L<<1 S`/A -LM(0@S `4(0|XPP01VSV X  D  aP:@ Q , , 0 0 @ @ D  b D H0H00L ZM VN RO NL0P  cH(00   @ <(000Q?0@  Q T RC G +X00X0(P& 0,p  8/P H 0 D  p 08/P 0  2/$. P K%A%A -(0L@S `]X/ 01S 0S P X00X001S X  D  `Q:@ Q 0 0H  2/ 0,  2/Kh%A -L MpX0@P ` lU 0p 7/P 0L0P0CL P0 RL 5P SP0 K%A 0-X0LP @ /00K0h/ &A -LMPX0@`p \T0S L 0 P P 5/PT$TKG&At&A&A 0-X0L@P 8T0S( 0 $ 2/0T00&A&A -LMP`@p㌡ 0W 0 S03C SQ P D4 00 004  9/P$p 0WḀp@W2 0 @ 2/$P 0   9/P,p0W0W 0Z 0  2/$P@W 0 @ 2/, (K'A -pP(@L` 0U 0 P 2/$`P`0U 0 P 2/,` -LMP`(@p 0V 0 !P$p` 0V`p4@pV$@3$p  0   ` 08/P,`p0W0W4` 0$V$``@W,@ 0,`  2/$K -pP(@L4` 0$`U$PP`0,`U 0,P  2/ -P@`LT 6/PP A(@Khl 0-@LK0hA 0-@Lh"0 01 0!0!!01!(1 1!0(10 -P@LT `P q""@0 -LM0@Spa S S S0S00!S  SU "S S0S00001I0S 0 0Q$`6/ 0 0$`Q6/`PVUӟ 0 00$9/P U1B`P00!01P0P!B`00Sv 0 0a$P5/ 0P 0$8/ 0 0$Pa5/ 0P 0$p7/I0SF 1S 0s011S 0 0$`Q6/. 0 0a$P5/1S! 0S0S0S S P 0 0$P5/\P 0 0$P5/P00P pUP!P3U_W 0 00$9/P\p0S 0 0$P5/`  ` "ဠ0180 14 >   0<0 0< R80S800C S   $03/280  S$0 3/   $03/3/   $03/ @   $03/@080P0S1>   40S400C S   $03/240  S$0 3/   $03/3/   $03/ @   $03/@040PZ㴠:   Z$03/*Z 3/   $03/3/   $03/ @   $03/@0 P<0,0<0 00* 0S' 0 00$p7/ 0,,  P1+  +  0 00$`6/P(K&'A -LM " 4}_K  0 3/ P~?K0>K0P`; 6/P 0 3/11 1  1 01 02 2 1!<7R01 $03/P1 0& P wK23/P1~oK~K01 K! $03/1  CR###############P0C?o!2 2 $03/!P $03/!` $03/!d $03/P< 2 0P! $03/!P $03/!X $03/!` $03/! $03/ 4EXPU$0Sp`W !$0R"3/p`2`Sq 2@-lPj @PQe! $03/ 0 !RqoKTU`B!q  $03/@o!  $03/!0 2 $03/!    $p7/ 2!4 2  $03/ PwK23/P 0 3/P02 !1001 2ZZڃ1, K Q U, K }?KU0`p; !8/U1001 01 202 !$03/P + 02 0 3/2S 2PS 2`p0 2 Q}?K0 ; " 5/11 11 2S1001 01 0 2 02 ! $03/P ! $03/CP! $03/IP! $03/SP1!001 02R 0}K3/(KA'A -@LIM.MKO 00 0K/0  $!(! 111 1014!(M/Kp0>   Kxy# -LPߥ<^ Q0S$ SS  N@ɥH`0S B徥(1$!;0aV 5`1V, (@T7`V 垥 d0 S&̖#X#`#h#p#x####### \0Si0 0S S 0S0S p 0Xh0S TA$p<p0XQ 0S AQ ,p0 0 0 0 0 x0  h~0@ Xy0 Ht0  8o0  (j0  e0  `T^A4KO0S Ԥ $KkPV'Ag'As'A'A'AA@AJA[A'Au(AA'AA'A'A'A'A(A(A (A?(AK(A](Ah(A(A(A(A(A(A(A)A)A )A)A)AD/B*)A:)AI)AT)A`)Ae)Ak)Au)A)A)A)A)A)A - 0`P@q䡟LM00 $!0r0b?o20S (!0r0b?o20S0F/8 PU Q40 <0 P PM8 40YT<10S ` 0S T @T3@Y h PP h ۙ0  0 41P041CPdmC/ƙ010B 00 p0S00 (KTn>dd)A@JA[A)A *A (0- Lp0@0a?oq20S !0r0b?o20S(`F&A`C_P Q P Y(H"P|> 0-P@L 0 P@HT00 -Lp`H4@S DT'ᔃ@Pq 0-@LD@D$0@400S 00CS00// 0-0@LL DP@ DPP @D0@400X% -L0M`QP@@D4 0(00 P 5/P @ ($D0,4=PP2 424HU 0 PY Q 4 KBPPl$0 4KPC <2 442, 4,23(23$24 24(4$:/P0004$0 00 % 1 41, 413131414(4$:/P0004X 0S R !0R "0R P0$R0TP5/2 $P5/PP2 $P5/pP040 40304I0P %PG0 %P=0H4{x (K@#*A*A0#̞#*Al&&&& &\&h&&&&&X&%%%%<%%*A+A -L`@(PhP h@P%` -`aP0L APd@P dY0d1`1P 0(1S5Q   <%.Ab 0-@L`d`50d10 -L`PҡP 0@`1 I P Kh 0(0 8 0<00@00D0P 000400000儡tịh0h h>%PX000h1Kh Kh)#*A ##[A%x%(%@0S 0S00// -LM 0 R 0 R Q0 Q0Q0 Q0!S 0  K> -LM\`P,0ph0( 6&U  U@1K#X@  $10L0 00 0HD9/pPd$K -LM\`P,0ph0( 6&U  U@1K#X@  $10|0 00 0xD9/pPd$K -L@`2PS $Q@P -LM 0 R\P 0 00 /P K4> -L`͠0@PU PV 0` P `P RPdR萔f0% -L M`ᠠ@ &` 02 P   P (Kot 0(P000m?h00S01010p1{?0 0 9/P01 01 0S0 1{?0 p0 7/Pp ~p@01D011Y 00 Ԫ#$d.A|#+A0S 00CS00//0S Rʬ  R 0%*0/ 0-L⨟J2PS KtP<Q  10 -@0l-p LR @ PX`t6/0 k`l-p=tR B (`6/l-0p͔R0 XPB 0t5/0L P`l-p tR @ XPA05/0 A`g/A -@L$M`80 P *0 SP*0 SP*0 S 0KU0 0KO0P< U:0S X.0`pl-d0p R8`X: l0t t4t#8:/l-p 0R< x Xt:/p=l-Ph`R00> 0| t6/P`08 0@0 < 0eRH 0 p4 8 `8 V< V  V(V  Vt V(pV|@ X* $X S Bl-p 4R: t Xt#8:/l-p 0 R< x Xt:/l-p=Rph> p0| t9/(K 0-LM01 0 K蠉>0S  0S0?S00// -LCM`Vz@ R 0x#P< `P <0<=2S `0#P P0" 9_l-p=tR ( (`6/ Ptp l-' RX`  26/l-p 2RX`  t6/l-p l2RX`  t6/l-p 9RX` ( t6/PUi0RXP  5/0l-p tRXP  5/0l-p tRXP  5/p 00XP t5/Ql-p=tR0 ` (`6/. l-p 0RXPh 4 t5/l-p b0RXP: t t5/0l-p tRXP< x 5/p=l-I_K8`0Rt> 0| 06/0 S RPU0 0]P |$ > X<Q g/A#E*>n/A -LP@ᇝ`t @ 0d 2 P L$Kk_ 0( 0p= t R R" R pWl-(R @ 9/APrpP*0l}D=) \0S`Qo0P +  P #D02 $Kk@ȳ#*A#@/A@/00S0Q."0/d 0-L@ R `0S0 `Sd\00 0-@LT0 0-0 0-@L 82S 0S 8200 \003/00 0-@L003/K0h 0-@DPL0S00  T0  K0h܃es 0-h@L RPP Q. 80%0R   \00C000d p-@LMP,Ko"K ?$ P0J0 P cR `0e@QN@@@( 40S ^8W_nKp܃ed -LP`V0@S0p 0< P `0V   0@PP U0Pbu`d$d -LP`P@P0PE9U2P 8UPP2Sћd0 0003/D 0S 8 M,Kh*@?0A1A#1Ad## 0-0@L$04P EOK0h``pz 00 0pP6`\0S0 0f4 Kif0 `兛Z 1 000 0P K00S 80 \0 03/ 5`  x30 0n0 PH1 <<|T808 K11A>1AE1A[AP#c1A1Ad1A@#܃e -@L} 0<` 08"00tP-0<傊0 0S! fPP\0$d -LM@5 6Ppᬐ` b@ )1@ 0 0t0000`0qPᅂ 40L0X,@PU @$Kee܃e1Aeԙ?1A[A #1A1A -`PL p@T@T 0R00 00 03/i - L0M!Q`Pp,2R $RBP 2R0!4 v @To1V 1VZ 1Ve0 =^0 ] ` VY0SV  01SP V 0 L0 L0KD0 0#K00?00 01D0H` @ ,0 4` 00pSD Ks@Pp   1  P@ @VQ@ 00SD KT@W ز 0S 0P  $K}f~f  "6==0"3?0? <,<,0 0  "3? =#=,,000  P$K0 -LM K KK K K0K C4KK 0K K -L M@ 0 PPK -LM   K -L M@ 0 PPK -LM   K -LM0  K 0- LM0K0 K K0K0K0K0K0K 0K< K _0- LM0K0 K K0K0K0K0K0K 0K( K 0-LMKAKK K0K K K K K K \0-LMKAK0K0KK0K0K0K 0K K \0-LMKAK0K0KK0KK0K 0K K 0-LM 0K0KAKK0K K K K K K 0-LM 0K0KAKK0K K K K K K #0-LM KB$0K K0 KAKK0K K K K #0-LM KB$0K K0 KAKK0K K K K #0-LM0K00K00K0K KK 0K0K 0K K #0-LM0K00K00K0K KK 0K0K 0Kp K p-LM`@CPP  (Ky^0$0K0#0K0"0K!0K $K( K  K 0K0KPKp p-LM`@#PP  (KY!0$0K 0 "@KDD!@K#0K0$K( 0K K K K1Kp -LMpP@`P  0K 7!0,0K 0*K)pK+0K0 (0K0&@K,KDD0'0K%@K$K -LMpP@`P  0K ^0,0K0*K)pK+0K0 (0K0&@K,KDD0'0K%@K$K -LMpP`@P  (K!0$0K 0 "`K!PK#0K0$K( 0K K K KK -L~MKKK"K KAB$K KK K K 0-LMP@PK~ 0$0S*  P:!Q Q 0K0 -pLMP K`_@P P  0}0 @P t00K 0-LM0K0 0K0 K K0K0K0K0K 0KR K -@LM`p 0P@0 U B K 0-@< 40L0P BK0h0$d3A < 0-@0L0@, =RP )K0h0$d?3AF3AR 0-LMPK@KP 0St 0TK0 p-L M`SP@$K$K$` $KP 0S Ut 0TKp 00 \ 0S0 S0/ -L`p Pḩ0 @P 㯩@@ 0-LMKAKK K0K K K K K K00S/ Pdl3A -LP`p@0@T  0Kh/0 Pdw3A -LpP`H0@T  0$Kk/0 Pd3A0!P/0J Q0-L@ ( 003A3A3A 0-LHM@E0 D0( I ăF0G8 P H00 @ 4,0 <0 0@L0 H0 0$ A0|0 B0P K80Kh4  D sPP 0dP`0h0p0S <p dK05t#3A3A -@PL`P> S   0JP 0 KP tQ -@xQ -@0SED X0$03/0S 4GEF0D 4$Kh/Pd -LdMP0 @p Pᛨ0`Sd !R8 #"!0D0EG IF0H@ T $H0P `P 4PL0 xP 4` \ 0p l h d0 t PFXG0SD0 0Y00@0 000<0 00080 000X0 p0  r \R Sr0x K000`0K0P p R 0 倏p l^c0 Qd\0hh Wʺ ((K53A#3A P-0L  v?@Xe -@0LM$0K0#0K0!0K00K0` K(PKB$"K K0K`P0 $KpP(0S 0 0KK0`$KP( 0 K 0-@Lt Jx KLp K0h -0ML0B4 % K3A -LMP @ᴧp0 G F040E D040 0Xk@ A d @0 @>0?Id H0x   h/0@@0d @0d, ھ00(Koq3A3A4A 4A -`QL@ P  _P $ U[A3A -LP` D@ = 0-92LPSX0@T ?K0h40⒋0 K0hOd$d4A #0-LM$0K0#0K0` "0K KA4@$KP! K0K K KP p2 P 0pW @Kp@-P@0 ă P*0S 0\ :`V`U@PT^ pp 0-L@ Ď PP 0S0P* R  U:0S ST 0 -L`PPpPg 08 @`PUP | 0 P 0RGS*pQ :PP XP X 0 0QP' I00!0 P P  @ P  0)4A4A24A=4A -L,MM0@SpH  婼 0SP0`P U8`Ra8P0TP 0080P0T0 0w?8 KHP[Y  ڥP`` 0 #P PUo0SPj 00CS%@ K?P[XP[ ᳥PP0 P ZᣥP0S P0TPp0pWH0S4 0<夌0 p'0p#30 0PX 2`p p8P`0 0 P pW:8 pX YU 0R0T0 (Kj4A4A -`QLMPp@@M0T ( KP#0[V  K -p0LP `0`P @  00 D008 < @p 00003/`P 0 $0,@(00000400@# -LM K 0-@L00 H003/00!   00C000 K0hȤ 0-L(M@0D ( E0 80 $4 GF $0 IH $, @ H$ A B  8 KN|PP 㣤0dP`0K04A -PL0`p_hPY>M0Y+ h@P ᘋ0 ,P0 wPd" `0 h@Z`dgd`h0TSS :0 4AS0@- \|( | \"| \| \`^0@0P ^ d@ QU  ^ ^0@r0 00-LXM\0K0 [0K0Y K@ Z0KX0KW0KU0KT0V KP0`0K0T K0\K@P`0S@ TKᬀK0 -pP - 4 D0 0A @0< 00PP  d00 YUH  0HDPP (K15AH? 5APd -0@L<P`0 b0000$V 1n LP03 cpQ -19ED I>`$ GF $ IH $ @04A04B04 04 0S004 04`0S`0X2 Vd0P Jprp U52೔`\0S4V0ʔ$`  NR00 R0S \!<0S01`00 40 0AQ  000 ą -@LP K80SP0`P V8`Ra8!PP 0TP 0`Qd 0`0tP xP pP |Kh -LM` @T7 `0SPP00 0Q P0%C d0qWP`0U݈ 4K9 zwP 4K ,RQ MJ$Ka5A3Ak5A- 0  4 P$ H \ S\ R\ Q l? -L`e -LMP`"p0S Q Q$ PP:P :Q((($0Ab0,SY0`n`&f`0@0P B0   00` 6/P100008`0 6/P  0 ` 6/P`06/`P@t03/<0 3/40 3/ 0 ,$K`d`e -LMpap0@SP T⇤@X@T@0N@0 00P@P 0 @7@T' 00U @(0 @0( @ 0@0R  S@ 0l0000S   0  @(0K@ PP  K`d $`epd -LM K 0-@L 0x0  Q$$((0       (0R  0K0h`e`dpd@-00^  @0 00 4Q: 0S #00b 0-LMPP  (@T  ,@T 00 4/K0 00S 00 P/td -L$M\0`PD0 (0S 0S 00 0KP B[  @D0 0TD \00 p0<0 80@0 08001S2@ 0080 p < P1 00480 3 20t@00A   80 #70S  ׸뚉"70S7/ ͸ 80 p  80 p@    @0S(<Pim 뚉#<0S  <{ 80 <p HKK< JP  Fꚉ"1004Q?2   80 |80 ,  p      Rp GR Q 壸<0 @0 0RP  D Mꚉ(7<\0S 03/@@0 $0S P { ^{A0A(KP6Ap6A6A6A6A6A -L$0@\PU `0p: Z 0Sp P    BDP 0S`FH⸞ 0\ P 尞P 嫞P 妞 -Lڅ0p\`@P 0T <Q 0 @@P -Lp\0SP Ե0\ ##<@TP U`0S0 `Sd Qh 0 Bh h`Vd[d```7A R-L@P KhFR `N0 S*    0$PU 0$0z zrKhs -pL\M`\P`P0@0ppٶhz 0S 0 CR @&@S8604& 0s pP} 0S u( TKLz 0S5 00CS1_0h0K0g0K*0e0K 0` KhK`p \p Xp fpKdpKcpKb0KapK 0^p[SW   !R000T0K`0K T0Ksz_0[RpKS0K]0[Q0K\0[P0K[0[O0KZ0[N0K#_0h0K0g0K)0pe0K 0T KhKb0KfpKdpKcpKapK g/oR0["S R 01 0T KhKb0KapKXRp[0S, K!! R0R! 4$44Q0$W030 W᩵0GHa3\TK@0 00CS R  Bት 0` K _ K 0C^0K`KC4]0K\ K[ KZ KY K0P8I` KDP B0S`dP K`P1 00S,     ey ay0$000T2 0 0`00@0 03P $W _0 CR Sל0 }<@P6 78Qd AZDQBDR0 \0  P  0$еW00S 0(00 qPṵP 卜P 刜P 僜X pGH{0\0(K@>AHNA@[A?7AH7Ae7ADA; A7A7A$7A7A7A8A"8A:8A$R8An8A@ 0-@L☃T0<0-0 0-L@ፃ00 S4  Q00 Q0-L@ 奵Q 堵08A8A -LM`Pg@`0TL勵 @ p 0 ᅵ0 P)  z0 0p$000X PxP 0 S00S0p tS$   0`0s6 4RX 0; 3 0ԃ0 0S $0]S(0S<㠃0 GS X 壛  Vx KK嬀 P Lἴ0<0 43R 0S00 3K 3R 2R0S 0V R W RX *RY R W  2R0S^00K00K 00K00K0 0K0K0K`2 KK00K0 K00 (,P x0 CPK`P x0UPFue U  ᦴP ) &p40P p0 囏pUp@  0 叏P 81 K400100Kp p ir4 P 8!0  : & 0 kP 0 dPpU ۚ (0S,D0l0D0u00 '(K@8A@8A8A8AjЙdL??9AәdmL09A5?9A $? -Lp0@<0 P (P ,妚`P00S 40P فC'40Op`P  u@ p-@ LMP $0K?T2 T s-0 `R $0R0C$0 `40P  0@ $0S 0    3' Kb'0$ 3/KpG9A 0-SL$0]S(0SGS(0S 0S S0 (00,00/ -L$M@@p 0` ]P_0 08P0U80URPS 00<1 00@ 08 P0$q? 00P# @ `PD0. 0,0K 0 +0K$0K #0,0K0 0 uP P `` `徙 00 00800 00 0P K'$ 0-@LP 00 P z 0 0P 哙000 -`@L@p 0 0 08PPEU8P Kh P g PKh -LM @Rp00%`XP0 0 v `0 @I$K -LM00 $ K -LM0 Q 00 K  K0/P0 ?R"0/ 0-@LPT0(1-0 p-L M`PB@Py1 00000m9$ K K` 0$ n0 $ h0 $ b失tD  PNHK0 P$Kp.$D.$@i9A9A9A@ 0-P,@LP b3K0h0 W@ W -L|0> 0-@L|T0 0-0 -L`@|PO>S w|DE 80 P k 0@ 9Ade -LM > K |.R! K p.R [xΐ, K X.R [`ΐ, K d>S [l1 0K0 K K -L$MpLK P@qa,0K0 0SS:0 R R0S18#(#00@ T(K -L M@ KK 0 PK Q-L :0S= QQ 0= Kh0=/ -LMp{P3p@0000]0l0 zPP KKo] 厇`9K᫇Pa t "8SQDQ @ < 8KPDQ@S000xP<0 S lBeU 0C#<8K0,PYTBRS S@BL80 S 080 40 HBA=S AB:<0=80K -0=80=]P1. 0 !P. 0 n!P嵈0t!` `⭈0X!`妈0y =0=^ 4=0=S0 R. C> 0 0@ 0 00 O[0P>0>N^0T Kjk(K@F$@@9A9A9A9A:A/:Ade?;$O- -X`P𝤀0 !`!800 ,  , !deee 0!< 0`4 0 ,   !/deee p-L M`0P KtV@@ 0000C 0Kpde -PL@0Sp` 0S٩00`=0=.R0= B0=P. Yn 00PV0P $KkdeB:A -LM0@PP= 8! `K100#S< Q̠= ! pW   <= <=``  R oV ]KP on&0 P  BV Ki4 Kԟ? -@PLp o`耄-0dR ᠇P< ` 030-! 0bP0S030= 9 =P<= <= Yt U=0S  "oD02$V00 ̄$KkY$KkC?t?$dG$ < 0 /de -Ly 0 0-@LyT00-0 -P@`LpP V&`@P V@P @U -L`PQy0@0`pP V,` 00CS0 0DpW  l0mP P gP0U0  -LM\ (8#800 JP K -LM( Ƞ,Ƞ 0EP K p-L M@`=0PS  P00@ "1 `m !0 0@4! " # '0 0&$ SB$% 0` 0 0Kp -LM0S000 t00u  S0 0t0 K -LMp^ @0`PN͌ ĐȀp`PP $Kk$K 0-L@{P p 0S $00CS (0S SPS0000 -LM0S ! ! "0$ B$% #0&0'0  0 6 K -LM@`VP p 0 <N- U H S I B J C K WUV0PP@M@LN@E$Q E(R E,S  OT W sm000pȠ0P`Ԑ؀`00 HP (Ko(KXd -LMP@U`p10 00"P!0#P`0%P&P$00'PS K -LM0@SP+0 CR O$O$0P$P$LP$P$S$@S$S$UB000S00 0IS   m0 00=0S 0  U U00 Q70S lU Hw`#3Vp`` 0t弦Kh 0 0CS000000g004P U S0 0Kh]@  hg0 4i 8j <Ÿ SU0Bg0S0ih0j0 L0L k C$l C(CA=A@////0 0S/ 48 0/S1<11 0111@011/4 -L0MPpU@ 1U*` 4Kh0 40K0Q30K000K010K0p (0K(0    @p P4 K05/1 @)04 3P 101$KY>Aa$>A>A -\@LMK goK g( g0@2K? 82 封4r 0R P01 -  h0'S00S4\03x xSS S$ $ 0& S$ $ ,@T 4"40$K芄FXNE Q-L 剤) A 0!< 0`4 0 ,   !/deee -LM`(?040K0p30K00K0 @4K2pK1pK/pK.0K-pKPP p ,K?g<0 ,0 0`$0 0 ,K(0 bK?d$ -LDM0H @ 44V}H0 R L}  ` 0T&lD0 @0%X@0 ,Po0D0 o0P`uo0@0 n X ,p`(n`P`1( (<Kf D0[W< K 40K@0[; K 8 K%$2 K 5`K3PK10K9 K pp H0(  0 0 K @  p $00 00P0< K 5/0 0X g2P 0400000(K?>A>Ath$'>A -L`ATʀP`!P`Q PPPPP` `&! S0 Ђa`40 p,0aa(` pa0 n,0$0R0$0,0 , S$0 2 03/$Kkdeee 00$ 0-@L0S0=00 ?0-LM0K00K 0 0KC40K0 K K KK K0K K -LM0 X K(?/ -PLB}@D0p9D08 e0`0X0` 0L0 0D0@$0<0,000e0Hp0``D00lk$Xk$j$lo$$0S8$0  -L MP0@pUC0S.\8Q  \  \Q@PP T0 `(@L \XpD7/0S S0 0d0Kh2B4p(`@pLPX@D4/K>Al$S0R R00d0B -L MP`@p@` S3,m$4m$4m$m$0(| We01D021H =0R !@L(0Cl@ @ S@ 00 D4/$K0d0$KkAo "l$?A - QLMPL`:pPG8@P ١>1`@p0h0J 40pK e pKu=P +a0؀Kp K !0pKp K A{CoKp K0 sp0[0K6[@ S/80  0800Kp `  O$K 0-0L@0Po=0SZU - U 00000 00P0000 0-L@h0P@0000@ P000000000_00CS0&0g>'Bԣ! 0-LPt0 @<0h0h@00000D0000@ 0040_00CS00 n$?@! -L M@l0 R 0> P P    40RP 0S K ?! -L4S3 P -LM00K4S ?  K  K KAK KK K0K0K 0KP[ K 0-@LF 40CS 4K0h0 0-@LnTPB040-0 -LM4S@  K K KKAK KK KK0K 0Kn K -SL@\ 3<3 $Kk P PU`RUp3<3 0&00 R`# U?PQPf `&X P /jP` 0-L@L _D PU&n|奝[0~$  s& ~o0 h {d ` K0h ^?A' -P@L SQ MNP `P mP d`P mP W03P `P mP DFP `P mP 7P \03P 03P P03P }03P `P mP[ t03P s`P mPJ 403033=3p?A?A?A?A?A@A ?0-LM0K0@0K0KAK KK@K@K0K@K;P[K -L`Pwm4@S& 4F0T09 %@ (_(RPU4m<峜4SP&P_ (@AP/4S/C  -4L@SP-3@* R RR``# 4B04P p 0XdU$KkQ ' 0'` ( 0(@@A -LMP@4SX3SU {R`VK 3( 0c3( (0#C40 (0 0#P `@ts ᷞ 3;3404PU 0S000000C0(P 40003/3;302Kp}$'[@A\f -X`P𝤀0 !`!800 ,  , !deee -`LP#@P\ pd 8PT 0L00+40 4000P0X00H@` \004<7;(00@AA0f 0!< 0`4 0 ,   !/deee -@L`PX*3Up;㶃3 UU ' 0'`` U ' 0'  P0S $KkDBA p-LM' 0P'd@ѝE 0K00` b 0S Kp{AA -LM@p4`SPZ3@W R RRP 4B04%P Q 0 ᔝU1d. 00K% 00 a00S   R & 0& P0C00 0(032 7P& 0&4R140 00 < Q(K%CA~$ -4L@S# ]! `\3Se2 20S 3030S <$0 KKh$dx$ -LM4@SS@P`4!p0p PPU3    A3S.? P @ ? P @ d001@ 000?>0?P @ ɜ\0333CS /  0PH(0C3F7P? 3S >.  P40P00(<#H    3;@03J0TT KhJ@<kKh9KAAAAy$n@A~$$dx$BA+BA -@L7^6᭮tT3S`&⬮l -PL`DpTw1W o0CW* d:10SR_1W 1WK 1WVG30300SQM0X!.0CS@G 4P@@8 @P93 - R#  @R #   (@@ 33 4P@ 3@ 3@ @ iϖoiX5i6i( -Li4@SD 5JC0T37n _}r3p@ t  m\P|04 40CS 4&@ FF -LMp`Pui@ 4F0T0:4S @( K" K& $K K ETP#K K$K( K'PK!PK0K0K % (_(;PUi團PK(@A -L$MpP5i@P幚[` _ `P  V3@ 843XFP4T;PhD3 P0 43 `P$: 0>  V 8; ᜃ ?  mp0 S00S#`0V8`P ᪚S# S#3S 3S 3S@ᗚ~)4KE` p  ##Zlh4S!`@V ᶚ0`t!@$h13d10`10\10Eh z@1 mP `P e@M `(? $`PP3LC`cSXc 5.  (P4PT04CH3 7P -]e@# ؔ(83S /  P8<0 00 `0<#88J3;@03 4e4/e$宔KphAAAA$BA'BA -LM@`,PX<}3Up;㶃3 UU/ ' 0'e` 偔U((0K00  P  P(0S ' 0'' 0'0S  K@BA -LgMPdp@Pt|lb` T"j0 3043!0  NP ? ``33 $P  00V,0P ! UP! 0 S,0 03,0 `Px D`?` 1V/P40$0Y +Pt 0S00SS$S e3s $3s 3sT`$3spN  $P Tᙖ*01Km?K <Y-dK k/KaPk/KmKPmKM` x0@p3000000 d @mK80z3 a0 PP(K@kA4?YBAnBABA8ABABABABApMf$JA $$$@ -pP,3L@S`K7(1T 1T 1T33033@$00S,j(0 .0CS@# j4P@ b@P3A0S @S 3@ u@@K4TiiXi0@-8@ ,  Q0"P  -LM0   P  Kd 0-@LcTP030-0P/3S/ 8% -LM3S@K KKB$A KK K8K0K 0K  K -LMCT?00K00K0KAK KK8@K@K0K@KP[K -3L@S"i(`k(`m(`oP & 0& @0-L M 0K 0@K80K K K K K K KP bG8K^?A -@L#`s3S1KCPP u`P bPn #TP f`P bP_ dXP W`P bPP ,P ]03P $03P Q03PP X`P ibP/ 0P3TP G`P XbP lӑ0T3XP 6`P GbP  ,‘0X33=3p?A?A?A?A?A@A -LMP@3SXs{U`YVN 30( ^c(0#0( 0B$ !p  #wPp `b | 83;3303PU 0S000000C0(P 40003/3;302 K$' CA\f 0-LM@ 0KK0 K K8 K0K0KK 0K K -c_柀,L@P 0lc0 U,Ko0 Y`rW<3 d !\3\!\3X\ p h]P \@ -X`P𝤀0 !`!800 ,  , !deee -`LP!@PJaɐ"pd 4PT 0L00+40 4000P0X00H@` \00(a4姐7;(00@AA0f 0!< 0`4 0 ,   !/deee -LM0@(0 P3`S]3@Z R RRppS 303yP ` 0WsV2P/ (0Kw 0( fV ` 04 S(0 & 0&<(00(032: pT7P& 0&4壹40 00 < $K!CA$ -L`@1#A8A83S 3`@ P #03U 8 -@L`܃PX-3Up;㶃3 UU ' 0'K`` XƏUT& ' 0'  P0S $Kk@BA -LMP@cV' 0'`\坏 0K0 0p 0S KwAA -LMpP#``@P|姑tI \M P 0 18c =  2 "D40$4 D 4$8 K`P ؑl8<p0 S00SH#`0V8sP pὑQSD# SL#?0,0K 0 +0K0& K,K4 K8*0K)0K(0K'0K%0KvP _p4K 0P @`$03000000u_P 4Ki_ :/1?03F 8 K@kA@AT$$@A>CARCACAA $$Ȭ$ -@LM3`S\P "4!p0p gePU3`   o $ # " P3S-5> D<PP _@ ? H<PP h1P000<#] ^@ e?0333CS /  T[P&S0C3s7P 3S /  PEP=3;@030XX 1Kh+?^8^($KhAA$AA$dL$BA'BA -@`SLpUs1W0CW]*!0CW' \1W 1WV3033S3@%00SMI0@!.0CSPD 4PPP< PP63" - R# \ @R #  \ `@ 3S 3@@ i33 p PP 2iiiX -LM0   P  Kv? 0-@3<LP `P ]P o@P `P ]P L`DP `P ]P QhP 0h3XP 0X3<P `P ]P 60<3@P `P ]Pp l%0@3DP `P ]P_ ,0D33=3p?A?A?A?A?A@A 0-@L]TP030-0 -LM K"$@0 K KK0K K K K KF K -QLM@?0K#40K0K KK ,ĠK0K0K K. K -LMP@3SXckU0ppWN (0\#01K#40\3( 0o !(0` !0?0 0\#XX,P` ]p 哌 3;3!|30|3PU 0S000000C0.(P <0003/3;302K踼$sCA\f -X`P𝤀0 !`!800 ,  , !deee -LMS@\ 3<3   6000`bVʟ 0&0K0%0K2[8U  XP P 9RX00XP` P 3<30008P#P#8   $Kk 0!< 0`4 0 ,   !/deee p-L M\@`rPPP +30K,30K1[883u0P33S 3@ ; 03Kp -@LPsW*C3U`;s3 UU ' 0'\p L咋U @' 0'0S Kh@BA -LMP@cV' 0'[\l 0K0 0pX X0S \KwAA -LM3@@`p41 P$0K^Q0 0S ? #    5@ 1<3S ? 0`P [@` H = 4`P [@P <0`3X3TCS /  @P$X\0p3h3dCS /  <Phl|0 00 0(3 00n`P Y@ I-002 00Y`P Y@   KP Yd$/P l8;8 K`P 48Ip0 S00S4#`0V8<P ᆋ[S0# S8#03S 43S 000o` P Ti>+3:0K,3`90K3[883rPcpu ᡋ0P @$030000001YP e >]%Y :03  K@kA@ACACA?CA?CA?DA^?AGDA@A>CA1AA`DACAA$P$$/ -LM0   P  K?03S/ -L3S3P 0-@Lu30CS3K0h0 0-@LXTP`S030-0P/3S/ 呿 0-LM@P# PQ?@KKBKKK KKLĠ KKo3P0CS3eK0 -LM3 KS0 0 0K K -LM3 KB$S K0K  K P-LpP`4 xX3@0/303UUU U U t0U h1X0T T宇KhO Q B7F?DA -LM0 0K3 S  0KVP [ K -LMB40KB80K3 KB,S K0 00K< K X0-LPD \O0 K0h蒊 㐊@T.' -LMC T@000K@K@K PA[K -3L@S`Y   \ 9<9 / ,Ko&  bV p sSP% P @PpY `Pp9<9 X    T ,KoN&* -`LP@PAW"pd +PT 0L00+40 4000P0X00H@` \00W4垆7;(00@AA0f -LMP@3Sf3Sc ck`p/WY 3( 5s(0;;Sʸ< c4L<0(! /#L3033p0CS3W `V G 壽3;3303PU 0S000000C0(P 00003/3;302 K,$DA\f -X`P𝤀0 !`!800 ,  , !deee 0!< 0`4 0 ,   !/deee -LM@p3`SPoR& RRh L0P0L0P FVL 0 d必LU=30330CS33 0 00Kտ 00 K00S0C $ , 0, P00 0(082s 7P, 0,\0 00 < `30330CS3(K!CA$ -@PL& 3S#?_`3S3 30S 303L1S `$$0 96Kh;$d$ -pPcL@V ቿ4P@C@@ @ -@L`샔PX79Up;㾈9 UU( - 0-yU`? U303Q30CS3C , 0,  PL1S `I$Kk@BA p-LM' 0'P@EU\Ą 0K00`  ;0S !KpwAA 0-@2L3PS5$5P pP U` <叄P ҾpP U` 倄P 03P ҽ03P 03P ƽ03P ͽpP T` lY00P pP T` ,H00033=3p?A?A?A?A` -LM@`SUp},!0 PU   3   3    LY@ PPPs0S 0S/3Sx3 03 0[P QTP 0 KPP AT x弃P30CS3UK0333CS /  婼P2塼0C3=7P, 3S /  哼P!勼0P00(<#l 3|| ;@030$q4u SDS4fg K/.AAAA$$d$BA'BA -LS3@S1 $g4˺ Ǻ*3p0CS39`P@ 2F oY03'  -LMPSp@Px>p$` X, `P C,  3d3D3 d4D8 Kb`P , p80p0 0  B>  000 00VP ` 00S 0R 00S 0R0` 0s 0s 0s3m3S00.040KbP  V4K9 e0t!`@*R t3T1o`9H1H! (1@10181b<1,141(181$1 3 131302100 K2S " "Pݳ4KR :2$&30 3= 03(K@kA@A$$DA?DA1AAVCACAAH$$$8$$$$$$$ P-L@`RP@303VVV V V t0V hoR0T T@KQ HB7F?DAP/ -LM0 $  ߽P  K?4B0 0- -LM\ 0KC4@?0K0K KAB$ KK KPK 0K K -LM@p:R$`K@f@P0 T@`0 @`@0 (V  K! DA -LMpPR@`0 @0K0 0xp@0 `W L PE_o\3R0SPU1[01K[K  EA p-L M @3aS00 sPSQOQ002NPm `0PYPd3 S 00PMPX00 DPSQNQ002N?  0+PCQNQ002NKph$$d" 0-@LB40CS4K0h0 0-LMP2\#F @  "@@ @ 0AOCOSL S @ 0 4@T K0h"K0EA -L`p-Q4@S S U 0 $Kk -L`pQ4PS CT  @ -LM0T@U$0 0 R&0K0 08P p ΂B#2[00 2K  02K'`RU`p3<32[02K$0K00 a2[> K = 0PV20@ P` xLP 3<32[02K  @)K 1EA 0-@LPTP040-0P/4S/ P< -X`P𝤀0 !`!800 ,  , !deee 0!< 0`4 0 ,   !/deee -L$M@8 4PS3@ R RR C⤻P ` U00K ᦹ\S0  Ql 0`A4 T0` $ "* Q^:ᣪ VP3 J" # "`b 0` %0P 5 `!P#!*Z% QL0` d0$04C0#: P=jj 00Q7:Z]  PP +P RPT  RPQ`0P }pP V#81d zPT  L  $ $  0P X Hp`\  2& 0&#,P`"(` EP4s200 SpP0 00 8H4 ϸ8n c0 C(K(CA0f$ 00-23@L=3=/P P P ` NP P P4 B|P P P 64SށP 03P 03P P Pտ 03P P Pǿd  03|P ߷P P广0 0|30$40t?A?A?A?A?A @A -LMP@~3`@ }4S㋁\s?0p 0 B>0*$0 z(4 |pt)4 lpn E*4ph\# \ÄC $> 0 0>;0:00:\3\32 ~ G Ġ  0 (̌0 ̌ 0 4 G "Ġ  0 (̌0 ̌ 0K\3 0 "0!;\30 9>  9>># 0 0 \= hT5P @x !? lT)0P33CS ;. H 圶P6唶033CS @Ѿ */ H 倶Px0p00#H4Y3;@03d0=n.PL7KaaU.*AAAA$$d+BABA -p@`LPa0W sPP#A @R AR R  Q30# S33 4PP(00SPOiϖo -LPM4@S> P04P @P <|P 8Pm3Pp@  40CS4!=-BE  m;\ṵ04 P㧴 -LM3@=@SmP%`eVe \揅% ( P3( p"800W|@p0",#4 03( 0V(``Q #0   `( 3B(` 000 0#bP 3;3!303PU 0S000000C0 (P 80003/w3;302 Kt$'\f -@LPtW(]3U`;s3 UU ' 0'ppT ~U 其' 0'0S VKhTDBA p-LM' 0P'd@~% 0K00` $ 0S 00Kp{AA 0-@PL 4SP $4S 2 20S 0$40S  0=,K0h0$d -L$MP`bL@6L8 (} ~PPȽp ~н ÿP  L 0$  㮷0B~ \3= 40D4/Pp ?  T嶵\3< P3 0S9;H40`h3l3d3 0A o  h~h3 `0VT哵P }\P lpl3 Q  Rd3_< w 000@ uP0,4?S00s3+$?R033s03\3`( `0 `Y.0K0 0RP02K0` I뾂[;X  0Y $l%%8%8%l%8%8%8%l%8%8% % % %RO (( 0'PcQHQ002H"  10PcQHQ002H ` 0PcQAHQ00C1xH 10 i00 PZ ' aH'? YH Ѽ (X /p0PY ' DH'? CA CEA  $d"``\EAsEA0EACAAh$$$,$@$U$̄,H$$,$@pPp CPdk(᧰| z @80p30000000000\3 h">0 m 202020r2tb1儸0000 2S " Ⴘ"`ḸEd,H: =n( %)0<4 P~0 Pz(K/ -LM0  ᙳP  K?03S/ -L3S3P 0-@L30CS3K0h趶0 0-@LGTP`a030-0 0-LM@P P@K0K3KK 0KKK3KK匲3P0CS3傶K0 0-LM@P 3S@K K#KK #K 0K0K0K0Ke3P0CS3[K0 0-LM@P P?0K3KK0KKKK3KK@3P0CS36K0 0-LM 0K0P3S0 KP [ K -LM3@S_B>0     9   < 9<9  p i1 0 $0 0$ K0K0:RU`p9<9 Q0$ K&} K?01 SVC P` BP K p-PL M`P#F3@0300 @   `  0 K 2[ 0[KpP/3S/ ~ 0-L@A :  _1K0h>y 00K P0 : 0 400   - 0-!00 S , 0,0C0(000 82% ?7P, 0,s\0 00 < w30330CS3ܳ(K!CAd% -@PL& 3S#_`3S3 30S 303L1S `\$$0 P%Kh-$d% -pPcL@V ᠮ4P@C@@ q@ -@L`샔PX79Up;㾈9 UU( - 0-D`V tU303h30CS3Z , 0,  PL1S `$Kk@BA p-LM' 0'P@\D\sY 0K00`  ;0S KpwAA 0-@2L3PS$$P pP +D` DsP pP D` sP 03P 03P 03P ݬ03P pP C`Ỵ tps00P ӬpP C`᪴ 4_s00B>0033=3p?A?A?A?A -LM@`SUp~,1 ,KY90, K\  U 0 3  J F U=  5  - PPPs0S 0S/3Sx3 03 0mP cCP) 0 ]PP SC prP30CS3#UK0333CS /  廫P2峫0C3=J7P, 3S /  奫P!坫0P00(<#~3tt ;@030$#b B<B,xrT KAAAAd%$d%BA'BA` -L C3@S1 $x#ܩ ة3p0CS3哱9`P@ 2W o˳(j03  -PLMp`P# B3@0300 @ 0 PK K ETPK  /  K -LMPBp@P tt` lt `P %@ 43 3Dd:3D4 d8 KBP Pt80p0 0Bn  ͭ00000 00Y P l 00S 0R 00S 0R0 0s 0s 0stp3S\04 KzP t M[4K Gt0!`@*A th1`9`1(1\101X1<1T141P181崀03!81o4! 3013(1302b100 (2S " "- Ả4K ٩A :2g$"0 3 03(K@kA@A%!%DA?DA1AAVCACAA%T%%@%x%(% %"%P % % -@ p  L`APCQ  U10 0R -P L0PR* \0 Kh R ^ qw3A -P Lp1PR*\  R0 Kh R *\ Zq3A/ -@`pP 0M!L! 2 @  0XsK3e *0-*P"L@!020P l1  0K0hs03e -p P0!LM`!H@w20P l1 0@ 00 00sK3e - p0!LM@`!xPT2p0T  Z 0 00 :/p0P 0 0 >t(K3evd 0-@(0L(#0!!(2K0hr3e -@`pP  M L! 200 0qK3e -@ P  LM!4`p1P 00 0uK3e -L(0M 0 0   KD-%p+% -00ML06 0 0 KD-%p+% 0-L@;@ |1R00 0-(0@#0L!$!1$hK0h3e -L@P`@^ 0 Kh/ -L @ Kh| p-L MP`?AT 0` 4/@P {oKpvdEA -L p-LM`?1@S PKx!? PQ0Y  K `0 E VPzDDoDᯂ$Kk.$dEA,?L? 0-@L]p%P1!0CSP1 l1  0l1QYK0h pK0hP0S$00?0S0S0 |=;|=//0S0 |=;Ó|=//Q9 )R48-09/ 00-L@M000,00(0X0 0P00@0P $  A0K:  P OmK0FA@?,FA -@Pl-p 8RXp0  L#8`t7/l-p 8RXp#88  t7/pl-p=tR8  (8/  pW0 to9<=\=SMp  =0 ,m9=m]衆QFAnFA -@p`PLl-p=tR` 0 (9/\=S+`pVl-p=tR(P  5/x0PV0 `]o<l-p 0RX`h 4 t6/  0 Jo蠆FAFA000 ͓0 PS& ⦪ -@}(`JL 1嘀,012S !S 1S ᳁PP P10CS1 ,x(0P12202'd -@m(PLٻ 20CS22,YKh -@`pLMPP_P000 :40 =S=Sl-p=tRhl 6 0P:/=0 0=|=   P :40S 5l-p 0RXl 6 t:/l-p 0Rl 6 Xt:/-9l-p =R(0l 6 t3/ P Lnl-p tR(0l 6 3/0P(K4xVFA -LM@PT` =S=Sl-@p=OR@8pl @06 t7/=@M{P K-=  0=p l-0XRh 4 t/  -@P`}Lp= (t8/  \=SnpW n<l-p 8R  X`t#86/0l-p tR  X`6/0l-p tR  X`6/p 8 XP#8t5/FA 0-]Lp1-@P Xm= S-<<Mk=0=^0>030 GA?+GA\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee 0-\=L@S=P0C==0CS=>3;3 K0h0 -=LPS@` 2PT\=S <n =@S蠆 -LM@ !Pp P'`(0K`P"[R- 2[T  \2m0 B R  0&m 0  KFGAlGA -@L M0K@#PTK 0-LMP@X=S 0 9 00009S|=000 KP `=[S Q Q  Q W09SB%B%B%B%B%B%B%B%B%   K0D -L4M0@pPQ񟗇C%4C%4C%4C%HC%t7S 4`7<`7|=0|=vxy|=hhX K0|=0{ XK 0 XK00Z Kn5[!6&R!n:%[lj01001t7GS( /0|V />0?0?`70?"0P K9P0[ S 00P0K /0[V /t7S x0 0d t7S H/oh"_L= 3/(KBGAA$dH% -MLM`A^K PE@p@#EP0U0C0S$4  S;U$4 3 Q< '0CQA  Q  QK f2Q 0Q _2Q >0CQX= "Q2 S?;A0CSNTp; e/$4SS$t X=S |=@NS |= 96M0YX=S |= 0N0PX=S |='N0GS@ |= = 9SP >S$_$$RM:L00R*LB6L 0 $4 5X=S 0E 2PA31Q #0CQ 0Q "0Q 0QN0 6M06M0N000$4 -$0S $4 0?00. By $$E /  ("( E ]K- * 0-L@hP  Pڑ9S 9S00 0 K0hl8%$dH% -L M`@PpU 0S # 00 4 4 Llh00yP  -.00T00@@(KGA -@L`X=S= 04p  3/=S9\]Ul-p 0RXd 2 t9/6= AP=.00 :^^ XX3XR=3 D=3/X]$Kk -P0?L0M0p2K(0K `@KPU 0 P0 P K! -L KM l0 K -PL`0p@P=3/`7 W45`7")")("(Kh@ p-L M`=PS00CS@t 0@ӕS@\ 0.@ӕn T 3 000g $@KphKp??GA -H=L@S 3/`\]U'j pP `VjPl-p 0Rd 2 X`t6/l-p tRX`h 4 ,06/ sP N/=A -L@M3@@ 6= \`=S vS's)"" QPPl> JPPedpK@ ,n` V PB-@U@`0  PM) Sh-d1R X#> H8=`=  S9S    PP&n PP0 S 3H Q |W pp p㤀吐n`0 PP X@`P3@ 6= U|=;|=$K !*(#?$00|- /h'/X-R/\-R/K - SL(MP`p@7" @K\,@0K DK,"0@ KvK -L`MSpL \S` KA,`0`bV  2PT K  ,X@ `@0\S K C$K -AML MB~K pG0G@$84 PPW`Wd A VS 84$@V"  VX=  V $V] V4$  V 3VP 0V3VI V3}  ',0  㕑0 R00 Q0SX=S  - ,0 P3V|=3V|= 2V|=2V|= X=S, W0GR0N0 #AR06M0 R0N0 AR0N0<R06M0 R0N0 VAR0N00 P mQ0: F>0  Q P\ X=S >:S0gӥNS 9S `=S S S0!v90G0 G0G 000G0 GAP,0>03^S2$ 9S# P 0 4P  P9S9  09EX=S  w0 P (K%F*- -LtM@`X=S \=S|hPK =< x0 *=P t0 00 =S >S3;3o9S YU 0S990090C90 .0᝽02K p 0I9SQBP傴UJ ;PU 0S000000C0p& 0&0.0 s(P 4003/x师pP 2 0 x  xPPᡉ' 0' P 4003/05K9S.05K @   xVP' 0'5["05K)(0R  |-   |0 p  G|0  D9Sㆍ/ P0Spx P 0!:kq(0! r("$s(0!a( t("$u(j(2 $008/>p0 p (00D100 0>0cL"C1_0K9S 101]0K|= ?<0 Ẽ(0 3Kt01=|0 |0P( *YX3Z" 0Z! b( 0  ᔼ 0 |qP |gP 0j00 |0 Df' 0'D10=0  0 =0C== S-8t0>t 0>p0pW ᜈ(0'"(0(K\f? HA -LlMX=@S! 4P 3@ l-p <RXP4 h  00 l0K00 l-p=tR0 ` (P5/x   l-p=tR @ (P5/<00l0K R0P|0  0+e76[ 9S16[&[d[80 ;V9S&`ep[oPP V"dd ^PT 0L00+40 4000P0X00HP` \00%& 0&l0K )0`0`< `(`3`20@@00x X$ d[0e0[168f0[(7801 6[2("$ 3(0!08+ 008:4("$5(0*($0 9/0) 00R00S! 蚔 /P 3 : (R B| |  (\`_" q  P`0 00_Vzb0,ᝠႇOx0 .l-p=PR" D (`t6/=-0C==0=1 m2x0` l-p=tR$ H (P5/00P0 RP0'c`[ V 0'd=.00 3~pPQ   נP0E%=Yc0[L'Pd= -0HX0' d=0=0 0F&>>~3 ;3x0 l-p=tR$ H (P5/<0 0Pl0K P0x&Lc0[ S `&P\d=.00 ;b44f[PP JdU a a a l0K4t[X a0S aa'cp[ 0Un'` SPQ 0, ݟeP0E%=Yc0[% d= -0HX0$c=0=0 w0G'>>n3 ;3Sl#P 9S|=0|=9`S 043/u U l0K6[p 06K&[000>. > 0(Z0`-W[p0 R R R pUcJ p0K >p`Dp2p`f P:> lKt&>W01>0#=]x0 Y'x0 0l0K6[ 0fKE&6[06[`0&[LP0bX T05[,06[(03[$05[ S 0P0l0KP &0>l-p >RXP04 h t5/= `3  |=0S PE80=00S0 @ 0l-=0R2 d p XPt5/(K?!HA0f\f?8HA ?FHAWHAsHA?dpeHAHAHAHAHA IA@IA -LM@PX}WD=3/P0X= oo`=bS00S989|=0|=9S*k%k% l%k% l% l%k% l%k%hP > ?989 ?  `=S ? `-R9 4;S ᱮⳎ  4;  cJ(l"( 4;X,1 0%0 (9  )% 6= َ80 |=  6= |= |=  |= :S0gӥ=.P9S `=S ,s o`=S! fF P 0 0C0S000ӕ S O;"J9S 3   t?9 *> 0======`=S`V0.> >'S227m =  P  a 긂l-p tR(0` 0 3/`'bX|ua080 3;@030)9R232  ol-p 0RXPd 2 t5/W 9S `Q  9SE9Q:X+R> S4 0   4K$XQ =IK`=S+ 04 K$|%l-p tR(0D " 3/l-p 0RXh 4 t8/=Z0=l_`.j^(K8  -%3?2D 1CIAgIAI?yIAIA -LP`L4P@XMT  @:ܟ 00-@2LX=PS) >S 0CS>02 |^' 0'K0h>S 0CS>`=S0 >S02 K0hH0IA -LMPp`.P A@P(2V 0CV@*2V` 2V `2V. 1V? X1V& 0VR 6$ @P[#X= SR 9S    tJS@FLB+-0 ƞ@: 4P@33@  0 @`0o@P" .4P@3@ `=S@ )8=09 q94P@48=X=S 7 9$K2iii6i(9i5id -L,M@ h#P@ X @]Om (⣬-,r0l-pp Rd XP2 t5/l-p 8Rh 4 XPt5/0\=P0\=!]0 P y)P X  !#h] ᬕT\0P,K0(0@ K8@P 0 P ^:4K㠠OI,0K10S S2 슄F베YH0F KeP$[,K0RBQ10CB>A>AQ0BQ3!K. *:S< `=6S0 |=  0F K@P4[ d00|= |-`-R R: RC |-h-Rb?|= ڰRژ0|=3R98<99 <9>)/|-lh-Rj>0|=T3R2R9;998<9 9<9>  :$( H0h-|=2R 9<9> 0F KP4[S909 08 K@0 @0KP'@0S$ڸ3[ yS0 P0 80Ks!P0L" f4 <0>  B ᲀᶀḀ- 4 P ]6 E]A G$4A04 L=<4!P=1041;1 ;1<41=1=1 =1$=H!>0 `X 6/@` Z ( >`L1a  ,8 ( >`0l8T G@ 0@= (K]%IA7?IAJA 0JAd[A;JAOJA' Nv'$IAi0AIAcJAvJAJA0W%s%r%j%$J%"JAJAF?_eu'(NO+ JAJAA%|r%B%8%8% L%,5%h5%5%P%\f0 -T=L@S* p\}Pg`H DΆ]y(`,PqoqW uo;ko@ @} 0-@L+Tↄ0-0 -X=L@S*P 3@ p 0tl-XPRd 2 5/l-p 0RXPh 4 t5/0Rd 2 5/l-p=tR(P` 0 5/P l-p 0RX`d 2 t6/@ u4S //0X#R" / 4S// -L MPo0Brg?0᳐ 0 :/3T"0:/ 0 :/? 0T1#"0:/0 T":/)4"T:/ 0 8/3"T08/03.08#80 R0003(K -BRL`p$0 3/$0 3/$0 3/$0 3/ -L M$CP0S`rԢ@aH0$H@ DPd0@`0000S0004Psᰐ Z43/p20p2凉㨁Pᢐ`j(: 00@00D%%X% %%% % %"CAA -3LP,@Ap&0 SXbV3<3 = >X2> ` $P 3<300T<300W -LMpPBb3>sp?pp 09/3"0T9/ 0 8/3Tp#H07/Tp0#7/Tp0#7/3Tp# 07/0Tp #7/3S Tp0"7/ҟTp0"7/Tp0"7/?80 Tp0"7/Tp0#7/Tp0"7/pp 0 8/3"A0T0  #  0K7(K -Lp`PM @P3,(p2WE fWd QPT 0L00+40 4000P0X00H@` \00$ [T0   B0cPcX %XW010!X0%X 0 Ę0; p0@ D0 p! ???`@P`P 00-@L TP5/0TP 5/0 $P5/P 0 $P5/800 -LM K K 0-0@S@0008L0TP <5/80 $P<5/X0 0008<S 0CP  S0ԕ 00ĕ0TP5/08 00T0<K0h/0 -LPpX0@`6@ 20S R 3/00X0@0 x0 0^pjP 0Y'0TxP唉 F,厉 V?``?ede 00 0Q   @0 0 <D 00/ -@HPL80 $`<6/ PU 80 $`<6/P -@L08 S@00TP<5/0S80TP <5/X0 80TP <5/80 TP<5/08S 0 XP<48 #85/0TP 0<5/80 TP<5/80 TP<5/80 TP<5/80 TP0<005/80 TP<5/PU'80 T`@0<6/80T` <6/8/0T` <6/8 0T`<6/08 p1TP< S005/8 T0<Kh/0Q@00000/ R 00 0/S R/0Q00000/ R 00 0/>0 000Q  Q  BQ 0  0000/ R 00 0/lt - LM!?T@p PP 0S 2P  0$` 06/pz0  ^p`n1T ^PhV1TA 1T9 1TU:0T<t1T/ Md1T$ \1%$:81T+ D1T4 <1T' 41T:51T 10S. l(0T %;I\000\0堚 W`ܚ |喚> C CXК`͚$K1e\t]t@yt 1 xt {t 1@Xt@1(@jt@1(10xcf-0S 8<0 <C<      000T0 / -@V_L`R000P1  ᅚ0  :X0 @0 000BRS000R08 @000T`<6/c0S 3/00$dt@ -!L?` @P0@ 003/ʈ0S P 0@0S1e -0P#0L!`?l 0@S P(p 4P$0WS\0X0@ 0990p1WP!0R똀V@᭙똀0B 000 X0      ?   &   +    +           ( Rp!R  R  I R㜐v0 R0 0 (0KS0ږ S~0A0R0000(0l1(0p10P100  R 00 0,08d0h00 000000 000p0 0d h0\0S000003/XS0SP PsL1e0d - :LABOA%0d%%SOA`?@% -LMp`@ ,KP 0 0 0 00,K,p $` K -L@L`x0PS P 0S0U0耄e 0-LX0 8<0T@ 4/0 0-Ly@8<0TP 5/80 $P<5/0 0-LePVO,k0 -L -4@@``3L`?0Tp0"P7/2"$p7/$0 #002"$p7/0@6600T"Kh/ -4@@PP3LP?0T`"06/"T`06/2"$`6/"?0 T` R0"6/2"$`6/2"0@000T`6/"T`06/0T"Kh/ -@L8F0TP 5/2 $P5/2P$` 6/ `CP P @P C P C$P@ BPB#P0 T`O6/d0d ᤃ`Tp0 `⪃VKh݃sOAOAOAOAOA#OA%%? -L M, \`h P@(倠5@p0 $0,3/0 S4 00@S dE 0 $@4/5(K -LM\@`,Ph0(4$0R<0 x1p 0h18` 00 008 RBZ t0S 3/0Tp $7/ E $0,3/p- t0S 3/0T` $6/ E $0,3/Z` <0S dE0` 0K80080 PPZ 00 (K$dOA -LM\pP( @,0h0`@ 'S #R S @$10l0 S $1@00lD9/0P@T_ @@h@0 4/UR) SppgW  (K@(0 \D8/pG$1QAD0gW 60 (0K0X '0K2[8/pGSppgW  (K@(0 \D8/pG$1QAD0gW 0 (0K0X '0K2[8/pG$K -LM\pP( @,0h0`@ 6S 2T00R S @$10<0 S $1@00( p?C \C HCDCp +\q!40TP85/TOAPA PA@ 0- @LP1 011  0S $3/K0h -RL 0 R!+!+! Kh p@0A)PATPA -L M\P,0 @00 (04 00h`40p 1<14010150 01  00P  $0,3/  $03/  $03/ $03/ $03/  0  $0 3/  0  $0$3/1 9I 00p  14 T 0088/ $03/0 $03/  0  $03/  0 0 $P 5/  0 00p 14 TP  0085/  0 00 0  1 1 00p +40T@84/ B@40@ 0##0   4 40 @04$0 00 (Ko 4(Ko\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -L M\`(0,Pph0Q00 @0 t0S 3/ T0$:/ eBp +40T8:/}ZB0 $`6/p +4 0T`86/ IB00S x0S 3/ (Ko(K -LM\P(0,p0Q80 5h`@mp04 <00 X.t0S  3/0T $9/ B $0,3/t0S  3/ T0$0%! 0-L@ 0 S !DQ0D0000 -L` @P0T 01DP@ P P 0-LP\@kK0hr -, (pLPh`` P 0@@ \00 $P,5/ 1 00000003/P00000@( -LMS( p@Qr `k `V 0 S0 ()0 (PP (0@L@ 0 (P 0D (K@T!C000$K$dPA -LM,@lhp(P`PLP\0u%p<0 04 PJ<0S@0Qt0S 3/0Tp $7/ `? $0,3/p@00St0S 3/0T $9/ F? $0,3/@0 R@ < R 0S@0 #K~`@@0 R<0S@p@0 Rp0z?p<0W00SQ@07#  h @ 0S 00/KP $2 $"0KA00|@/K vPs (@0 0Qp d7t0S 3/20_000 T`$6/ >X0T` 6/0T` 6/ $03/XP@0 004 $03/P@ `0`p  T0(0@ `0p@0 `  <0V@0 Q6#` pY(K$d PAPA' -LM`\, @h0( P2*0@ 00 040 0SS #p1@p0S0080 0 0$20_00T 0 2 720X0`2 ` \6/X0\` \6/@ lmU 0X0`2 ` \6/X0\` \6/3PSKpPAQA#QA 0-@L 3033 _hvK0h襁0H 4 ( l -LMH0`P夈X a@ 噟0 0Lp< 0?80 CP80< P0KP@ 0 $0zd 0 Q000 80S:6 00 80`S*3$03@0 `z 0 z 8S (0 R%)00 0z 1(K -H0L`@8S_߀4h -`LMЀ,HT ,H 0,8  0 0@0 $0K "zPPᵀ@$0 P0P$KPIz$04@(,0 0`@ T00,8 0,XK -`LMᔀ(HT (H0(8π 0000 ŀ$0K yPPy@$0 P0P$KP z$0$@0 0@@ T 0(80(XK -`LMX$HT $H0$8哀 00 ኀ$0K yPP>@$0 P0P$KPy$0 @0 00@ T0$80$XK -@_L`$80$hKhY -0LpL0T`@X 0 P y 8 S5900 0 y 8S    P /r1|P 0W0  0 0  00y R 0~10CB=A=A0B1x AxP0(( (8L0$( $8 -LMH0P@夘Y ` 噯0 0< L0?80 Pp80< Pp0KpP`  00 $Fydp 0 Q000 80S:6 00 80S3`03 0$%yWp` 0 y 8Su (0R%)00 0  y0X0`2 ` \6/X0\` \6/$P =2SPx`L@:00  i(K$d@F& -L,MH0P@8S 29 080 804D0 ?H0 0PpP0pL0`P@0 D0S7 000K080D w00<0 8S<0< <`$0x80D S00Lx (0R $000 8 S0400 0$xT0 X02Tk0 sx \"\2Q00 8SJxGx 8S 8S0 330Pdp0 $Fx 8S8 1R8 1R00 8Sp03 ps0P0 $x  0p0p $x 8Sm @0 @0x0X0`2 ` \6/X0\` \6/$P =2SPx`\@:00, He~(K0($d@F& -PᙏL~4hP+V' @ Tq0Gx Sp1YW 8 T  10CB>A>A!0B30@000(0i$0 i,Ko~$d8& -H0pLP@o}0 S * !R P0R(((}Q Kh -H0pLP@o}0 S* P!0R, ,(}Q Kh -H0pLP@o}0 S * !RP0Q(((}Q Khf -@H0pLPoc}0P S(( (80 (S* !R0((0(8}Q Kh< S0-pR@Q0^P.UPEVL`%P0S PP 0Q0@嶓p}0U*01S((P (8O} 0HX 000? H00000 X ? -@@H0P`00BX@1p$FS@!@L@U *PAEA 0@p崄PU 0|,8 0,PE}@D (0S, , ,0( / -H0L@`8S (xe$Kkgh0 0(h0olPh0  B0xLP0@Pp1 0 >v 8 S5900 02v0噏 ,o08dA 8d Sz00T0S X 8Sf 0 v  0 u (0 R%)00 0uhP0h0fg l$KkA 0-PH0L@O!|kK0h]|e80S< < <08 / -LM@ 0'~ u 8xS```PpP0 uXp`2  \8/X0\ \8/3X 03p p`2\7/X0\p \7/pV &1?0X  V (0`V PUd(0SS x]0崃S  8S   H i3   8S( X000 3( ,00V P00L 8S 0 /u0X0`2 P \5/X0\P \5/ X0 X0 0(0f@$ZpWf(QQ 4 p @4 X00`X0000`d0(`00 00 8S00K >0#>00S 0(0V((0S% 8S007  80 S000< .448#8C^0:#:04  P040 p00040 V(0S400dP "f8S0 x(Ko@X (0V 8 0 $tP 8S``P L+ 0 4,|t$p 8S``p(KOQA -(0LP0S $Kk8+H 0p ( L@  0 Wt 8 S5900 0Kt/d`Fm@0Up `e 8(S (0R%)00 0 $Kk)tpQA -`p0L@L0PW 0Tp  0 t0  0 0  00 t(m 8 S^L0$( $8 0-P0L0@P0(( (80 0-P0L0@P0,( ,80 0-P0L0@P0(( (80 -@Pp `L 0 s0 0 0 0 0sP0S 0   Khs -L M0`00 0PHT  $00  S4 P04H0 P 4H0kpP  ZLp P P( ^ ꠳"렣P P 80@S 0 \ʠD40  40\:00D 8S0PP 8S0 2sZ Z Zq 2 H0T0r@Pofy $L~\2H0@0s0S @)@tQpA @0 S*  p RP110?Lp00 .y 1|B 0 0  0r 0 0 0rp 8S/ 0  rRy 001x XxTX4@0@H000P0T0X@x #L /y0OH0x $"yY ox(80(y@(K|????QA?? 0-H0L@P(R _xK0hx,0000000K0h`8& -PH0L@Ox?d`xV0Kh -PH0L@Ox(d`xV0Kh -PH0L@Ojxd`xV0Kh< -PH0L@OSxc`xV0Kh[/ -L$MpH0@O:xcyxH0`L040 ?@0 -x8ST0s 8Sx29T0P@0LP00@q :^#:00 @08 PD0 d@< D0<Sq<0<Y0000H0  H800>0SI0L0 0IT 8(S"(25 "% 8S 8(S 8S00@04(0 #20@p!=08Q81<F4<0 0,pqT0 @ T0 80PL ^P 8S00999!4<#8#80#0<00<0 H000 P  0, 0@0 04Aq 8IST08#82  8S 8(S 8S00@04(0 #20@p!=0Q881<F4<0,0 qT0D 4 X0T0X000 00(040 @ 0p 8(SP404 8S9504 0 0 p@iw(K -H02X@LP|`P& xpP 0X`p00  PP w(80(x?w Pv(80(h5w 0-@LT08-0 -L08 -@LP^P`KiRly=<vvx2S ',piP0" -L,M@P*xR v v<  +0 iP 5/ cv^ 0o`000S4 P 0 8pw100&16 "6&0- R    R    R   "-" R   .R 0  S0@00p8Sphp W` 0S200\1n8^0Sd000 fc00 F8c0S00d0P00@Sg/1!01h5bK01 R!0 S !G101 S  10CB>A>AX!0B3D00@0|/1S$01$K\fbTA?pdtdeTAL&0.R  "-" R   vP/P/////R꼞&&&؞&О&&؞& P p7S00 4 Q 8/0S/? -L M`@0u_00 Pv>0S4" 0!00p눐0UW0 40 P 40X P0 0W  p0@TP(K@xdTAHNATATA@ -L`@PP4!4KhT00000x7vnS00tq 20t7Sh8D!0 pt7S S S0<0<0;000CS0&<&H&T&`&l&08 08 08070B;0;0?TA -LTM`0Ppl0 > `!M@0(S dK3v>hP |0 |00S8 3q0 #Sh7  0 Sh7  0  Sh7  0  Sh7 0 SXU 2t0 h4 0   KXA?<S 0-@L{zSP0@000T? -LM<0`0 @`0P PHH p0pWppS0ppp 3SH0LQT0 H0 00cS0 B 00 j@T 0 (00(0{# 0# 00 `#400`03030040040#400 `<\Kp 1 01(#|K LK gK0 0pgZ pP g  e U  |K0 | K H$~ KKl K }K lKPE00Ss`VUn  |K| K H4l KK ~0K}K lKZUU p0S 1 # R  jP|0K 0 |0K { p0W0b |Kp| K H4l KK ~0K}K lKa딠Z p1p#Wp pe0RlK 0 P0 0C0 00pgslKB0`PV c0p \K|K4| K f(K?XA -LMP<0 0 0 0@1 D@ 0 000` ($ ,0t0K" SR : 0 0  *0 00000 Rdd+K"p|K 1010 0 (00C0b0 l0K 0L0K00K000+K(\0K ANd \K0`P @0`ਠ @d00 0唠S@1hX J4 K~0K}K   lKl KH0$"00 00@00 ] 00S0 TV 0| KKC4~0K0[}0K |K e lKal K@0T`9 0S1# T#0 d0Q* ( 00 0 C0KC$0[~ K }0K  6 lK2l K0 )0`0j0 000 0@@hy0@v lK\K`P3 0@1 0 C0 0 000(KXAYAHYA////< 000/< 000/ 0-<@L1 P lC0 #30000{YA 0-<@LP1 UC%3 0000YA, 40 "4$0" / ? -@`0#800pL40040040P0 縀P 08#80  08#80  08#80  08#80  `V㸀 -L MPpP04 0@00 @Ḁἀ``h&h` X%XP 4("( 4  x008#8000  oH$H@ h(ἀ ah4 &h`00!PX%XPP%P ("(08#( '8@H$8HG0(8ᨈჇ0*400( 0㾀0`(਀(K4< / 04 8 / -LBMIOK \P `PP$PKPqU p \aEPP bLaS 10b U $@K@qT$KXDqHAT@@$pK@qT@@$@ @$@AB,$QS , P !Ġ(K'K!Ƞ!&K%K$K\$@K@QTQLD\ $K JKA\!\0S$K ?YA -LAM@KoK \P pPP,PKPU  \qEPP bS 10b U q `(`ab,K,&,`KpaWYGaIqW``,pK`aV(QS  P ,40,8,̠0 D@,0K0S,KQ\QCL1S00,K0S00#T0(K ?YA -LM0S < !"  ( $  0# KXA ? -LM0 <@` pP 1 IA(  000` 1 8A1 z 10 1n  ($ 0, 0$"SR :0   & 0000@ 1$010LP, 00 440 4X28U00S0 0  0004 40 (0  0C0h }P , 28U0P001 00 @\  000 aa(KYA,? ZA1K=K 0 00 S P@0L! H1 ,0KQH1L! ,KQP U1A 0Pa0(@@D@iQ!@a\ ,KX,K YHIX,K^..#4.PUT p1/ 3>0 u0#ĠD1KCK#Ƞ#1K=K -0 00 S0P  L1 H! I,0KH!QL100,KQP U!A 0(@P@b b0R !@b H! H!Q T ( ! ,K#4", K !^YN!I^ ,K !R(PUT p10  g=0 ' 0#$D1KC!K#(# h>V0x0 j0 |0 Pa !|0E . >x ;Z hQL R1S = h R?h|0  0x0 P|0 p0 4P|0 1 x `K:p0P4!LK:=P =z000ioS㩒Y   P  C%PPt t0[000l09t7S0300S000S)0 )!! 4" !P\ P a^ʐ  00 0;+*000101>0%l00l0 h0S S S`0P]``P 1S L;  00 0t7S8&&&8&&&D&Zp03  0   P1 :0; 000Z Z 1 :*0:000h8U1 ,:`*0p:0 002S1 9 *0:q0 7/ 00 0 2"b 0 S.0002021S LK9> 00 +HS.00C02021 LK9> 0 PQ+ 1 LK9P1   HQ 0SH1L1 P10CP1QP1 S0 900S00001S 3/0@0# `71 7'08Q$00$010120 0Pt0 101' p0@00t0 080  Lz0x0 00S& P | P0p0XPW  0|! Q  |0 P|0  P ] ZV t0S 80 R ,0 t3/P 1 @6T&0d6101db0S*^`P  LKy0pS0S0S 0S 0SYHIY pHDYK0[ 0S S SHK<KQ BKHKL <K<KG 4KC 0e ,K4)(0|0 |0 SV`0Sx0 cZP WY0 YP/]x-]`S00|00jfS ڀ0 X4d gPT0  L  $ $  P X $H `\  H `  x R   Baa  S0 0X0\``W  W (00C8#8#4 0#4 0Vl0@S 1 3#0,3000001012 04"S$ ! ( 0 2"000101t0`'?o2< 04H"S (00(0101p0p% 0%`10`1( A ? At7pSS`7P ]@P0<0' 0'? S"P: 20 h8P@@`  @! !>$T% (N 0RL\07@00 000S@@@@000NT '` 0'( ?(Vk 2S3060,{(aH00H0$}P 4p 0S 04 8 < S0S0p !   0.>P00P000p<0S1Fb= 0S! 0Fb=@0S1Fb=  R1 Fb l=T [VQ1  D.Fb4=!T00T0S[Q pQ 1  -Fb<!~X00X0[@!=Q:1  -Fb<!id10d1ohxU ! c pV101<00<0  0 t7`WSl2Si    9Pa H7!Q0[R 1 lKJ4Q [71 v>0S`77!66`7Q0[71/5[0#  1 lK*4%[? v>Q!65[?0Q 2  Pu7L0S ;!0:1`7 0 00XK00I#08 d7 Wd78d70 00XK002#5[   P X KpP?S0 X0Ks HR0`P00 0P  Bh8W`'1* t7S x'R ``{t W * R 1:2R`  pZ19b  R1 8k Y1S 8d)0`9 Jp W1Y 8p0) QW h R p0 ?Pp0 1Y 8 So`'r} 1L 7(0 8,Ch(US p M  P  PU p1 lK&3  0 00 00 1 6'0 7a0P 6/W t7S ~t0pgW1 47H'0, @7qaἑ lK2` 0 G:S 0 3/P1  5@&06000t7S0q87`7 1A 5%0\6l00l0t7Sa0#W1+ 850 6` 0 C ! 0 %<5I000t 0R+0j R ! 00a00$04. R FRZ1 d40,5S !y 0@40$r0FSt7SJ'''''''''!> 0# 4Mx7S ! 03#V Vq2 ph8U PPpr pp^2 020000PP  ,H!<30SX XK2#W30 lKh8U  2"0l3,P  2"083000 P  H2<"02h00h0 Z820S XK1 /#  `1!q0 00>q0)x7SV V),P ?0,0Yz !|10SB tv XK1 0 45P  ,0a 6/u1 `0 b tQ`( k Qbx7S1 ]CP$_A_A6_A(_A@_AN_Ad_Aq_A_A_A_A_A_A!`AJ`Ap`A`A`A`A`A aA`A5aAGaATaAaAaAaAaAaAaAaA"bA-bA aAVbAiaA`bA@@bAbA[bAbA2`A:`AbAbAcAPcA[A1cA@cAkcAcAcAcA^AdA^A5dA^A^AedA _AHNAr)AdAP`Ad[AW~ 0S! 0 0000t7S` h`0 t7S ' '' ''' '' '! 0d!d1x7VS 000h8U 4PP2 2 02a06/!10S XK0  ' 0S x7VSY !L20S XK0 0 p h8U<10<1h00h01S p2"{d00d0t7Sq0 8 7/wt'R^x7S[ V0000 000 t0pg0S0 0ShxL0Pp0  1S l3"Fb0!2Ep00p0K0S0"|0 0 x0 t0Q *00S S Sx  x 2S  S PP|00|0 00x0S x00SY1Fb4 0 S! 0Fb4S RP 1 t4Fb `00`0U1 `S  lK/$4Q0H P 0 00xt00t01Z0 10 `7 !p50S lK/ /a 00 `X0 T0K ) 00S0t0 !50S8 46t0 S 60S- t00X604S X& R06 X0KX[P !60S 6X 0 `dhF80 t0&h 0C0QXK 0p  ' R H47:R  0 0 p0 B9[at0 CV0[ p!70S7 <00U0K0 48CȠ#8t R`ࠣwQ 8(   ` Q Q`FVt !BS[ !80S 80\8(!80S 8t0 S80S| t00904S ) R0H9l X0KkX[P !X90S_ 9X0 ` dhF80 t0&h 0C0QXK 0p ) RA H9:R  0 ;0 p0 B9[at0 CV0[ p!T:0Sp: A00U0K0 48CȠ#8t R`ࠣzQ :* 0p0 /    Q Q`FVt !BS[  !`;0S l;04;h+\RRK х1Ї45Kp00S a 6/000&!;0S lK-.5[,0R0[0Q 0T0[ 0U0[0W0[0X0[0D<0 ~,P ;0,001S lK.0,Q0<0 c 0 a6/x00x00 x0/S00`'2 1S lK-H-H=Q0P 80 a6/|00|00Z0009[?8[?h80101h8M? M? h86161 X0 0T0K 00 90P {;0|0S 4204P m;|040202 yt7S`x7S]t0pgW ʐ1& >.Fb0!>qhXW 1 lKh-/0V?p0  h8U<10<1h00h0F D0tS*2P  P P \   Pp 0Q1 ?Fb/0?!D00D00S! 0<4Fb8$!H00H00ḑἡ 1 lK-#0V30 ch8U<10<1|00|01 W㺟ᴢ  P202K0202v~`7Q /  67Q`7 76`7!D/0S`77!66`71 lK,`"Ÿ   2Ÿ h"0V0 d 1ox7So t0pgWʐ18 $2!00 200a00101 [PU1 lKt,0 t7S6 1 >x70CS=t0pgW ʐ1 \14!0( P1;L00L0A0a00101 $P1 lK=,0 t7S S h8U  1 3/400401S `p0p 000P%(K!`AdHNAr)AdABaA_A^A_AdA _A[A eA3eAWeAU]A -p-@` LM0 K0 t KP+0K KppeA -0-P@ LM0 K0  K@+0K K0peA0000S00040S0 000u/ -L Mp`t7PS2Sm 0!1Ri (K0Pb@(020100010020 0083/ ? 071 01GS00 D1"02222222 8" ," ZN3254282S887-7  b0c70r0Q   ׸0   04Q   ̸0@@h K? -P LL0R`@<:pL at'R ⯸80(R  ⤸00 R  ✸0" 83/?G/ @0?D01Q001H00000L00 -LM`qFȡ_KT> 0 Ye 0( x2 0 4QS"K( x2P8Q (RK"(   3/?mK l2K? k2K71j2K?1GS0c2Kc"[60S+W*) K+0/K0R"[R 0Q   0   0R"[R 4Q    ]P0pc@1pgq(K? -LBM1`SP% IKc\@P IK`P I?Kp,፷0Q  R ,ط!0IKR1Ł!Z]K -2LPS@ 0aR  6/Kh  -L M0@t7S2S KR0K 0-0L@3A0ASe ╷x00 -LHMP` Ah8BR&'d-'d-'d-'d-'''''$''d-'('$('0('('d-'d-'('d-'*'<('''('`('l('x('<''D''L''''''H('''''*'*'H-'@*'H+'P+'+'d,'d,'d,'d,'d,'d,' -'-'d-'d-'-'d-'d-'d-'d-'d-'d-'d-'d-'d-'d-'d-'d-'d-'d-'d-',-'4-'`0 06 n0|7h7 n0 0}0{ ! F BQP r0e0c0a9_`75S S S`01]0P0!e R #7E`7#2<`7<9`7#=6h7#81h717`76-`7=*`7#>0#&8S3 >!0R1Ł!_!@R'dK>[@Pv[4Wd0K @Pp Whs ^K~⳶8. 0d0K0`0K00_0KQ<<_0K4 0 P"%K#$Kd0K 0 Ꮆ 0R `0[0`0K 0%K$K d0K $T f@ dK[pG 6OopB1?0!6&R!  @ T00!10S 1]J1S dKZP dK-`P 1S01Ł! B2zAT dKZP| dK`Pu  2dK^0K[@)1 Sh0m`d K\0 "1\ R\0 \@TA &6pP R d KX`p \  b("(!w[@46@h7< 1 (R(  0#/AB0)0Q,',',',','0000b&>9b&*9?o2 F8 ?`720x8n01:S (03/$K@d$%'' -LMPPp5D%@Z`PF (5`R9 6@0CR 0CR  R ? Rt7   RR4R x:0Ru 4RU 0CR 0R 0CR4R 0CR`7#2 h4R 0R7 L4Rh 0CR 0CR 0CR`78 4R +0CR3#4 3RY0 3Rh 0CR 7!0CR 3R q: 0R r0RpP |#|opdx7Sch800h h800 80(80?0x7Sh .  㑴++ዴpo V0aP C200  RylNV`8h3/` ⸴0ct8s v.RP1h8D!01008^05`4`75^0-h8?*00B0%^0"h1 ``0P D -1n^0`P V C Vu@`U0"0^000`7=$`00 0,0 i;00 K(0 w 0KWL00 000`0( 00Y`4 KF%*CElbfd ' -L,M@|`S4p(PXpP`0P(V`F``S -' BS ? S  S  S (Sb  SI  BSE'S  BS   S  BSl'S  S BS'S. . BS  BS  S P'SD p:+ S# 4'S  BS*7 BS  S^ / BSM&S r S V00 QQpn` X  (妳V0S!V&R!} 010l8t7SzVs3   R< gRe <3jVd0S`$6'T6';'06';';'H6'h' p'RSh' h' M t'St7DVFP0t8= v΄0S㼀u?0X!S`  YP  Q0%"q? 0\P  t(V > V >   V0S h7  `78`7t7Sx7S`7  8`7 <`703A0AS7SV0S V0S7V0SV0S h7  `7 ; `7  ;`7^V > `7  UV0Sh( 0ծʱV0S h7 `70 `7 0`7V0S.Ұ0ѓ2DV @0SC00Q0S R0n⩞`ⲠX 0FFP0 < @`⋲ VP0mVg W?B0CSa> 3A0ASV13/Nt7SP cP?t7SG `F LKpot!V0LK L1R9 P$  R( S  10CB>A>A!V0BXX6X ,K R3 0B0S1 3/4Pp pj2f2 03A0ASwW4pp4p(K-%EO -LtM?@QpP !?QA ?Q ?Q' ?Q ?QP t?Q F0CQQ X?Q> P?Q D?QD 8?Q ,?Q30@?Q ?Q ?Q 0CQ >0S9!-0 ,! lKPx7Sh( хl0Kl K l K! lKW`> 000`Ph0LFSZ ?'pS'pS'pS'h?'pS'pS'pS'pS'@'(@'L@'pS'x@'@'@'@'XB'C'D'|H'pS'D'$E'$G'pE'E'E'E'F'0F'F'F'F'G' G'pS'pS',I'pS'pS'I'pS'" !:1S|7v>0Sh7  !0B8bS> Ñ!1R71S`700`71S`744!@RIlK;UpPh0[ Sp[@;Yg0[S9t7Sl0K hX] P [  PPh YP :3/0g [l[Pp! h0[S000ȅ%K"0 # 0l0Kh [  Ul0K  Pp 6[S>ñ:3/U \!RlKTpPl[Qt7Sl0KP hH ᢶP @1p$ < @P gQAp!*RlKTpPal0[0CS񟗫\C'C'C'PD'PD't7Sk [il0KR lK 0 PP _Pt'R R 1&[3/0lKP4KP   @Pq lK$l Kt7Sf l0K @P_ l0[S ft7S P/P ` !=TpP 0䈄!> 1S`7 3 31S`75`7!R R R5451S h7`7:w `7:1S`733`71S`722h'P08602ӑ 10CPW !0B8S ȕP8p%1S7 W0h0  P p WY㎐3 1S h% "ґ0( P!0B8S ȕ!I!18h7D1019`7h;괁 X KSpP\ lKծp7 ?o2,K`QQ 6\,K@Q@A QlQ0,0K@PPlUP 0 Sv , K!@ RR! 010l8e lK03A0AS7St7S c6pP1 3/!RLlK尊=SpPX @ P@ 03/P; 1lK6S003/1zS#TI'TI'TI'I'I'W  pP 03/P{ z03/W 03/W 0:03/We $03/!R pWlKRpP lKj 0P f ["c Hh7I !/L8S0 .   tB \ xS'S'S'K'$K' [) \ S'S'S'K'$K'C#!@)(!r)C# Y)') 108101?o200 $3t7SS!0B8SF(ĕUt7SS!0B8#8=S>2 1H:1S`7 0 0`7v>0S<10x8 ii8iiiiiii:i6i(i5ii o?) $'@@CA* *i8(e?deeeih7!H0R!T 3A0AS13/p4W03A0ASgV4``! lK3R`Plp[ W^P al0Kx ᯭ 0BS !R r39S0Sy 0 SpC00WppWl Q@ lK5 RpW:3/~=p`0 !l0KQ`P t0GⴀG 0 P 0 0Gl0K_ GP X@p 0S`:3/VN~⩎0SE@pX0 0CS0 `74`R$$  `'`'S0`7(000>0N@00 p0SPW@@000 O`P0T0 TR`P  > 0S h7  `7 ; h`7 ;c`750000[> 0  H.`7P::`7x7St7S  `gj   r h41$S48 S!V&R! 0108l8x7St7S8(%S h(0!SSl8p8u h(0!Rq x7Spt7Sl`5 000`P D5`0 5Yʀ ! `, ! @aRa/#0 Q\&`PW0a/0 ! 10`00  !<0 0CSO4P`2 o `*4`(`&C#!A)(!s)C# Z)()C#!?)(!q)C# X)&)C# [)))C#!B)(!t)(K 0-L@M,00 `pLP(00 000$ 0 a 0(0KᣃP0(0`0$  0T0,0(0Ka0 ᑃP(  $KyeABeAeAeA@ -L8MP 2 !0  p ` @P$0 0,p(`A Ka0P ' $00  0,p(`A K`N0PP" XX_T0T@TP R T*03/K0eW'eAAd-A7@,FAlf0B0B -`@LMPpK` T0 0, Kd"\  0p 0   ~0?o2P@@T;0P(K -`pLM@K` #T0PK e0@ 0 00000TP 0 0~$K -QLM0 | 8EQR0  00P?o2?y$@`1S0 ʀ0!`$0$   ! Kp h4H0$HIK0 S T QQ R-0  Q Ri.0  hQ1 pR0 p R0  R0h8`p 0 @0K\0⸀ ` 0 T 0!P#0`D#@#<  , !X0Qs#p0p0Q  Z` qZp V h(`Rj h(iT`  P  P  UT?00 ;[K  K9K4 K00!|KR008K0cKC18K8K0K ~0K0}0K71G[0K2PK5K= 20bX0 0 T0 D1 4K?3K3lU 13K5l #3KM?0K3K61.0K<1-0K}OPi0 e00 zpJ ` 0 00 @0T̓ Ri΃ Ɠ Rhȓ  ^1SP0  0Ǔ-  @P @ Q0  ,P @ Q 0 '(Kdeeetd?0S/ꔝdU' -L\M@PD @K1#9 0!0p`0c_D0K$  ,p(` >P0 $00!2 ,p02(` @000D KH0K(P'> 0D2$,p(` ?!(2 0H0KD KPw>0 0 0!1$ 0,p(`H0KD KPb>0 0 0!1$ 0,p(`H0KD KPN> 0 0!X1$ 0,p(`H0KD KրP;> 0 0 0! 1$ 0,p(`H0KD K€P'v>0 0 0!0$ 0,p(`H0KD KᮀP 0!0"M@$ 0,p(` @H0KD K P  <<(KfAK⺧ DK⶧80@ j0 80K0bKS070K"#K 0D Kt?$KfA -LM1@Pp` &0 `h0V00  &K⇧ ,K⃧0, K 0Kk0pKI?KgA Vf@2gA/ -PtLQQ 봒n I$A$Q:|f09@8 #(R \ X  #(#(00 00C0`75`7$Kk0maA[gA p-L M`1@ V00  0"4V92 "!  0R 0 0 0 0S  0 8Kph/pgA|@wgA 0-@0L83/0P F'4P B'K0h>' ' -L M@y0 2 2"%|000""? dY01 0080-D1 < KhgAgAgAgAhADhAlhA -LMP@}0PF`1 -0 0C00 0j0iS V1Tp1 0 T 0!笋P 0R 0 0 0 0S  0 00KKh @hAhAhA -`pLP/hHP |0 0 S*N=00@T -0S 0C8C8S0 1 0 4v@/00$dpMfhA -@L`1 0 pPU 2S :0S 3/"492 "!FKh@%iA -@L1 0 `3/r/0SP 0U 01S 0 48P&00/Kh/@EiARiA 0-<0PRp(L@0!7G ⫥0? -L`0P+VF0&8"T@@S@$ 0!S@t7S?`'@  @(@Rp 0RP @`7    ⶫP @<1S1@@F @=T-+ 4 !  ,0!  # !  ?0!  x ?ppl0!  WL0HH?uiA|iAiAiAiAApiAkiAiA~AiAXAHNAAkA -0XgnLU@` ᣤ}Py0v&P5v6e 1 P``\1 S2  D@PUpV$Kh?@iA@iAJAiA 0-L@P.PPPX000AT  PP@0@hA -L MpP1@` #0! 0c ⇤0 `00! 0>020`003/09909*= 20T1-00 0 0 0@0 01 `a R @`Pp Ki-@wgA?? ( @0( 8408008,08088> 01/4h'g'H'4f'0!20Q PR  BUx7SD1@ G?0R K1  wPP0 miAiAiA/@ jA -@L`8p3/PP\00\0   p-L MP 8`3/@P\00\0. 1 0 : ^h Y00h822h80!P0003/0990920T100PKpB@8jA? -PL`8p3/@P\00\0  h8 0 0h822h822hh80!Vh8 99 -P`@LV,?P, 0-LP@P hG G1S 3/0 -P@`0L0p0 Ӣ Ϣ ˢ0?0?h80101 M? 061071 N? (Q 4r$Q 0m 0 1S $Kk/ -LMP ` p^@P 00 0ZK -t7LPSS` `7M@ iN@p+0 R0S P@hH+ -L Mt7`SS@ `7]P i^Pp+0S TAT-0 R0S wP@hHܛ0S i V1S1 0D D0 0PA⽛+ KU@CjA -@m`LpU+t7S 0 hX⣛4P+Ut7SSPP ⏛ 1 p 0 000s@kjA -LMP@@@`p+AT ݐ  P01SaP1 B00 0 0@;+$K@jA -`LPV;  R 0S RpۧPppp`*@T!  ˧P 0R01 S R 0S R  ᷧP0 0WpP@* -LMPp@`* ᙧP @T. 0S ⍧P000AT  ‧P0V wP @˚1 0( ( 0*$K4e@jA -L MP@U* pU*EP0S0S i V1T1 |0X X 0! Kip*P  Ki K@jA 0-@hLP 0h8i 4P !048@P !0@80 -t7L@SP m`)088$83*hhXP 0 02222000099~0v>01p8{mt7 S13/jA -1L@` !C]Pp)t7S118888$8)PPT p P( Ih8 """" 99>0?`7?0?p'RM?6!t7S`7<`7?0?`7 000   Xphv> Q QG?⯙$KkM@jA]AjA p-LM@PhP ` =P >P 1 <10<1#ₙ"P 1 _`'d0d 0PL  0 0 4`7<`7Kp@jA_ABaAHNA^AkA -@LAMt7S9IKin  `G(VU 83/0$0K1PPS@5)1V6 S2 0S q $ K !RRPq 7S 6S1+ " 3t7S `7 8S l Kii^ P(6S 0SV? $~Q A1 0 h20Sh7  t7S 1 0!0"52+~Q A1 0  0S1 `76`7h7  1 x `767`7+V @c%]Kh%Kh@lAlAlAlAa@mA=mA\mAmAmA -LMPpt7SS0040 >%```|%1 `0".%0V  (Kof%c% %@T 0V `t7S2  P d"|0 0X" S*200h8T =00 0-0C024 S RU P1S080 7 H1S 0 R! 8<0 <0 00aHP 0SH1L100P10CP12 B0 Y 1  0 @D1P Qܑ13/000S(Sʐ!00S 0  $m000Sʐ!00S 0  $2S 0 9/000M@^ $00(Kz@mAqlA$dpMfmAmAnA[A:nA -LM2@SP`up8#8S *  4( ! q0 7/ KiH92492! !000v>0SG? ~0001 g 0 GP202*~0001 M 0 |7S 1 t!t`76`7?  1 3 @ v`776`7pp!10S ! `ǔ   0 W0 K1S 3/8-8C800ᬁ0 8/: 0S 3/  KijnAnA@nAnA@BaA_AHNA^A_Ar)A oA -tGLpT T TgP'V+ ? 83/P@`@PgV 83/P@`@PgV 29S 83/P@`hP 83/U@ἡ 0-@L1 00 0PF#00K0h#@EiA -`iN@L K@Ph{hX~UhH  0n 022220000990?KhQoA p-L M^D2 @R0ŁP`4  `!=P@y>`1 0!01c] G" "07|1 PV8080$8`1W,h08(h P( 01 0!0 15in F " " 0(' 0' 8' j^6D'@7<7VYh8 h  h'         h8  Kp@qoAoA@oA]A'oAoAj' -L` jpp@ mPQ a0QA@ X X X X ,X8V#H@ h@&h@@` 0-P@L Ϙs000 0u  `  t 0S"   @v w  " @x @ @0@0/ 0-0 0SLP@0$ R-''<''<'<'ԡ'0 0 ⑘  ⍘ 0 0℘  ‘  0 x  t p000210000 -LM@P,`P000} <p0 Pݐ0w=0H0 82 t7S0000(001011 pPḼ0\ \X00 0000L7S`P7HgLg0P7i$KzAoAoA-20N 2S 101, ʰ1 016300000 Č\ 0R  R (R R  R RR R    S00t'R8S ">)R1 0 *60@ -LLM0P S@`pe <K⩗`7 t7S <0[ 04(Sᘀ.Ⰰ (X ) >Ⰰ7X 0)7R X#[7R 1 <K >0 07J000㲢p #[d7Rpp`7@@ ppX800  3S H L0S0T 0H  0b0 IR)r+@P 1 &000$Y @W*0X 00@0  B    0@@  0R 0@K.P @@@T )U 0      #[ "$ (0l0 0 3SH L0S0T 0H  0bW00g0000 -@P000 0(00(00000t'R0H'''H'''|'''0 0ⴖ 6K Ⱆ <K0 <K⨖ 6K ⤖h  0 0<K⚖  ▖ 6K⒖0 0 00Z 060S  S  S#*9S00w0 00#"!# #321303ᇮ0( R00XL  0[ #Q`'S800L0  0H0 0S (H0S-: t'R8"Q  @  8 Q ( H0 9/PH01 <Kl 81081%-X 0h@ T0 0T 00L0L 0d0 H00bX0 X (0` 0b\0 0P0 d0\ H0 S11Y Y 0*P; L0 cU( T ޕP0!`001P00P0 d0 c0 0q( 00(0080h0`0 0`0 \0 0S\0 h 000(X0a(0P 8000000C00 P P,X0C1ln00 F ? F(K3pA?XA@(@GpAbpApApApApA -LDM0 08 < 4 @ \P P` ``V``P` `PPPePfQ8@ @H D0 @Pd@Q|pD0?iWD0H 4P 4QpP 4pWPP@P 0 0 @0 0@@ @@T@80 000p W 8<  <0000(Ko(K>@pA 0 0- @LT@@ 0 0-@LT 02 @D @ ݔ0 00-L @є0 -`7L@piV 00h 00 000PS R  ୔0000` `0 0d埔0 000 @啔`0000P P0 0冔0 000 |P9d09#40dQ0d ì`@`7] P"0hx 0P`0P00S P R L DO0000` `0 0 A0 000 7`0000P P0 0(0 000 P9S0Ņ9ׁ#40ŅPdAdQ@d DIqAY@]@i@a@u@y@UqA@}@@@@@@nqA - L @ -L$MP1` p r0$"`0 2‍W0550KJ@P000o0p0 F20080 800 W0   ᰓ00 000 0 0 a (  3SH0LPT0 H0 00cS00SA   *@P/ 0pw(0 ` 0(08@01011011 p` 0T>00L7S@P7HG0LGP7 (K@qAqA -L$M`Q@p 1 0)`0 90W W W# W W PW W W `70KkPP  0h80?0 000 t7`'S000 p 0 ;0h 0 G0 p7S000 +0000 0  0 000 M?0 0#40 00p000 _P㌚0p000 UP00 0 6! 0000 0  0p000 ?t7S0 0 0 0 0 0 00 0 0`7 00 v>0S*00 000>0` 000000B0 0`70   8H(#8CQ, S ZSh JoR Y0K<0 8 PP8 <0 0Y㰠0岀0  @&80 @, G 80 ( Sx1 5 0:0j0R0(0e 101tX1 0 0KPP 00ᰀ00(010180KS>HH}PP t7`'S000 p(  0/  h' ;0  W000 0 . 00 h ݑ00000 0G0 0 `70   40S  0 Q 0弑00 000  000b0(0j30K(PPG `'00 p 0 0 ;X000 0 岀00G 0 "1 1000110 0 `70   40S  0 00 0b0(01 0 A0KPP00000尀00(01011S 0 P#000@z0 3SH L0S0T 0H  0bS00S 00C0000 4(PPT 0 `(0w 0(00000=080a0  , R :01  1 0@001 PWt'R  ~0pp'qo 0 1 0100L7SPP7HWX0P70LW嬈2@ @101(K0` 000000B0 0 00c1 0b( 3SH0LQT0 H0 00cS00S B  &PP 0(0 0(000岐4⅏  ⁏ }붑(K@rArA -@LMf pPt7`'S000 0 0  ;0`7 / 8)9 S!  0"0808S !  !808099`7  P`72`7t7S^``F >P00 U!=0P U *@(Q PU0C0P0SPbUe1Y0 ! 40 m 40 Ⱁ P@!`75`71 00x 0 0S00C00S0  R  R000 V(K@rA sA5sAGsA -LM`T1P!pR@X10X11S 620 0X1v1 0 OKh%>0_Q?UP00L1EUS0 `HaPb0PLaPa`Pa1 ` 00IV1Kh/KtsAsA0 / -2L@SP a0 6/Kh 0: L > 0t808x80|7709010101/* '(&' 0-:L@0S 3/ z:S 0K0h/0 0-hLP0ST0T    00U 00!@R 0100蠝d0@S St7Sh!0S`7 h' 76 67`700@-\0L@ a\ PP 0S00\@ h0@-P`\@0`U0\p00LW^^<<0@ -LM@0 &0R!S"T#U9k:l;m<nSt7S8h82 `7  v> P1!h740!qX r Y sZt9[9 0W900 \09t7S!>0S8v>0 01 r9Y9 00 \0t7So900o9`72`793/1  t7( 0S$9o9KhK@d@uAcuAzuA 0-h7L@ f_mnK0h0 -LMh7`q Pp娐ࠈWv> W W 11@@!A0 @x1A0@@!`A0@t'R  %) &) ') ()00%90&90'90(90)91  )9 0(9 0'90&90%90010>9 ?)@A B  00  1` hpWPh8S  p (Kot(Kr@:@@@@@uAduA -LM`7@*!00S VtQx7S8(00S8. h (0   r 1(Kh/K@5vAkA -pLMP`K` H0K@K0 0 0` 00000 0\@ \0?o2P^0 R:0 R :0 R:0(K -pLMP`K` @00, K0d0"0\ ` 0 0@ 000 0\?o2P0S R0 (K 0-LDM,00 `@P(0x100`$ A 00Kp`PJ<1$ 000K ,`(A `P91$ 000K ,`(A q`P)0'00开$00 0,`0( A0 K\`P0$0t0 0h0,`(00 0A00 KG`P  ,,[(KBeAwA'-APd'wA,FA@ -LM` \SP 0X3#t 000@10@T J^PY:0C@x00SW 0P` 01P 0!\PP0 (KPdwA 0-  0L@2# 0 0  DP <忏8P80PPP,o[X0耖@B -LM`@p0P c0 0S D)P @g0@ 0p0$KPdXewA -L$M@0001PXpH1: RL 0(PF >1 0C(Ko R`R`3`#a 少 b 00 H000S" (P  0PQ`p!P 00  l[ P P00 J(KPdXewAld0xA -LM@0P00@Pe(P 0S S S ``0r RK*a001QB0S  1 00 e(P00 ⊠0* 40 0 [400  T000! Rc 0 ඎ0S= 4(P 0``0S. %(P( `s` p@0G1Y `0 `00 Z00 H8p W@(KPdXebxAld[xAxAxAxA@ 0- @LK0h@ -LM 4,4 8 #8D KxA p-LM@0PS`  (K0 0(0K*KpxAHP/D@P 00S/H/ -L M    0  KT5e -LhMp@PJ ,!0`P  P0P0(000` 0``` 6 2P 000 0C0`&``) 0 0C0000 0\@S2 y K8K0z0K0K0@0*嘯$ 0$圯$KlfeT5e 0-@DMLH 0D1 00 @@~P㟯1 0Ppl!0 000,P(p$@ @@ @@] 0!0 0040P,P(p$@ @@ @@]0 400!d080P0X0,P(p00$@0 @ @`0 l]A(K5exAT5exAxAH'bB --L4Mw0PL0 0@P0   0 !0`4((Q ! 0!(0 0S 0Q PP@! 0!0i p0ip0(P ! 0!W0@K0i00 00PL 0S S S:Ů" 0"ɮ3t.`0V #48 80 00-L@P 0800 -L0  Kh% 0-@PLw88K0h -QL$M@`pcZ@KP ZXV` @T 00S @0S 0@K  ?=@ PU- 00S0L0 $X" 0H0 0 R 0 LYR0P0 RR0P@0 DKD0 0HR0P@ `H@P00@K H0  H0@(K -LMP,P 030```p 1@T5 @DT2 03 000S',0$0K`] 03  ,00,0 03  PP,00K0,0 @ÿ 03  ,00,0Khe -L M`0 @P^00p2Xa 4P UU H@TW 8 RMC@J0 LJPJUH Z  R= 0B @ Q* @ " 10PX@P& 0PP %0x00H06l3[W6 ,19 0;6 06 6 (KPd'xA -LMF`@Pp0+0K0 (K,0KBK,0K $@ @ K0A## # #/l0Sp p l p0 0S  0 00/ -@LPp`1Sl01l dp AL 1` p P 00101S@@eqhe@-n.,Ġn,lH,l  ,  -@phRh2@ML p00@@ )0A10,bA ᾙ>  ᶙ E F? ᬙ6 0P`p!10 00p,P(`$@ @@ @'X0 000!X10P1 004p,P(`$@ @ @X 0!10 04p0@,P(`$@ @@ @W0 400'!0 008p0@,P(`$@@ @PW0 400!l08p00@,P(`$@ @ @P0 W$KheyAxAD' yAApdyA$yA 0-LMP 00S|0@ T @DT \0X 0S @@DT d0` 0S @T@K0pdhe 0-@LMP 彽0HB0S T D@DT 00S\0X 0S H@D@DT 00S H@Td0` 0S@㳽K0pd0SM 00P Ѝ/0 R C\ 0`00/0/ -Lll 0 S0CS \ ^DpUT 0S0CR$!Khlhe 0-P @L`K0h|e 0-@$PLA000|e 0-@L  S K0h,( 0-0@LMsP @(&  H2 SD0CS QT T hT R `T XTH0SD0C K0pd -LM<0PS> 3A0AS:`ڼpHBT/ D@DT, 00S&0K_0 00P  0S  0    03/ᬼ0KpBH@K p-LM@`ᗼPHBT! D@DT 00S0K᤼0S 3/ 0   w0KP H@ጼwKp 0-@Ll1K0hQ Q /p 0-LM@ P <儆801P 0S 0U K0he -@ L M@ 83@ @:4@@K舊e -`QLM3048 pP 0004"@PJ   ~00030K0  `0K40KsK}4 K,p (p |P 3⭭-"P 3᢭ "pQ 1S0 h 1@0L A04 (1(0(13$Khe1ie 0-@LMV3PPEUP 3#0#0K0  K$0KRK}$ KT P P 0@PS   (10C(13GK0舊e2ihe -LM0`S 3/{ppl0@TP P0DS  Q  QPX U0S0CUX@@8K bX XN T 8KA,P 00 $Khe|e -@,0PL0,0 `E{%t x0Rx0t 1x0 0S  0 008$000Khhe|e -L,MR@|PLKS⌀`pLlMQP` |>Qx>p>Q h>UYS VT3 8>U 1CU 1CUE0  0S@0S=0:07@ T4=U( 1CU% 1CU)(@ lK1{ lK{l0K |{0S l0K t{0;0K0<0Kl0K4 0l K8Y00 |0  K|1!(00R|0  <U Km1!8|0 ?HBp|TD@DT  0SZ 0 80 S H@T D@DL<U|P @ lKz lK%{l0K|  {3 l0K {l0K {# 0l K?Y 0 4Y @ lK 6@|;U!  0CUm X;U T;UR H;U 0Ud ,;U0CU;5:;U 0U0S!T lK!1qx:0AT @DT 0Y0W @lK:¸d:P*lUU00U0S Top1@,U0S00T }0SX |z궁18ကX0Sp/ Y 9)UUs T900 p|9  0PT@P 0| 00000080#  0 sᬠԠРܠؠ"8U^  0CU l8U h8UpX8U 0Up<8Ua 0CUH 0Upm8Uq 0Up2p8  0LPT._7U#  0CUf x7U t7U th7U 0U mx7U: D7U `7U b,7U9 0U 0CUYp6U 9 7U 6U 6U[p| p 6U 0U 0CUKp37 h Mp3. hpp|K00 |0Kp 0CU%p3 |K⌠ y  xP|0K ,0 |0K0  p P5Up3  by5U- 5U p0 00 I0UpI `Cy0Wd00`  .`hpp0Z * 0%y0d030 !0S0 0 R W0 0   36 !0S3 x. 0x3  R    0Sxoxlp00pplK+3 F@`W> WO `r E 0t01x0@t010S ؐS S p0ؐ ]0S 0S000pS 0 ]px%X\ Vp@Z * p7  pXVpFpp'TppW lKb>-<:| Yx  Rx w @P R00Q 0S10JG1UV p0 Tp (Kiii ii6yAi@i ii#ii@%ihe'i[yAod"i!i\Xe|e:08 P R ! /  /he !  he-ꈊe-ꈊe.ꈊe -LM@Pp `,0 ;0K08K<0KCKw@0K <K4@ 0@ `P H03H0HBTT L0S H@T D@D4 ἵT 0@0@@PL1@TT 03 @T @D ᛵT2 0X00C?o20S! 0S l;P@@P 0  yT 10@0 n80S 3/@P100(Khe -L M@  048<Q0  048<R'0S$ b$",R R R t00S 0CS #  $(,R0Khe -L`FP 0@0L0`0D00@0 0<0(080,040D00040,000@\'t''l''''( 0-@LkK0h / -L4M0,00PSH L (3PP 0p `p0qQd$PP 00 @4D H 0L#2 1<0 000 / Pq &4dd8$8dD#D$00h 0c40 00&h 080 8 8#<48#(#@  t0 2/Pt0 "R RV VV S  Y Q@lK\ lK 0l@Kl0KT (K -LMpP40 0 U$0(0`$0 "h@e*!4)Ġ*Č"$ Ƞ(,Ƞ"(  0 @T ^ x^^ ^t^ @U $0S PP4  005/P QQ@A(K p-L M(  @`"X",$`("(1P \\t\ 0081P  R&Rt Q P R R 0Kp蘊e -0L S 0S0S Q*t,@ P 4,48#001S00 01 t,@ 4,48#0 0!t,@ 4,4 8#0IQIx,@Ptvf'4Ġ&Č8 Ƞ,Ƞ#80001S0001 x,@tPtvpf'4Ġ&Č8 Ƞ,Ƞ#8000!x,@^PtvZf'4Ġ&Č8 Ƞ,Ƞ#800  -L`P$@PC q00008$00(`088,P@^0 ` R 00@&P4"4 8#8 ! R 0 1  &4"4 8#8 A&4"4 8#8 1 0)J7蘊e -L\M(0@Ბ0SP,`|  R!d0&KP 0  00 "p pŽP lK.vPd0@0d06[0&[4"48#86Kv"44"8P#R0 #0 30 ᣽P|KlK♙ 0|KἠP (01 0H0[  10R<10S   0mP2 (01400S 0\P 0 8(0t R! 8g#b0Kh蘊ef 0-0L@S <xo06 (01 K0h0舋e 0-LM@0PS#0K0 x K$0KBKqo(0K $K8@ @ aK08 -LM0 4 8 <1?(K@Kp Q H0S D0CS  R TW hTT `TQ XTN QJD10S TK` % 0%lZ TKQ0 0l% 0%0l STK8l0S P0010 ً' 0'݋, H0D00# 0l3/ Fo꨿f7ehelfddpee @ -LLM} 0!,9@P`p0,0,P 0 0`(p$@ @@ @9 0!800,P  04`0@(p$@ @@ @90㈘40 0 00'!l8,PP0 08`0@(p$@@ @9 0 0 0!84P,P0P0 8`0@(p$@@ @90400 0 0!7,PP0 08`0@(p$@@ @y90400 0 0!h7,PP0\7 008`0@(p$@ @a90400 0 0!7,PP0 08`0@(p$@@ @J90400 0 0!6,PP0 08`0@(p$@@ @39 040 0 0 0!`6,PP0 08`0@(p$@@ @9 0406 00! 6,P0P0 8`0@(p$@ @9 0405 00!5,P0P0 8`0@(p$@ @8 0 400!h5,PP0\5 008`0@(p$@ @8040 5 00!5,P0P0 8`0@(p$@ @80404 00!4,P0P0 8`0@(p$@ @8040x4 0 00!d4,PP0 08`0@(p$@@ @8040$0 0 0! 4,PP0 08`0@(p$@@ @y80403 00!3,PP0 08`0@(p$@@ @b80 400!h3 0`3,P 00 8`00@(p$@ @ @J80403 00! 3,PP0 08`0@(p$@@ @38 0!20<,P 00K8`40@(p$@ @@ @80 $00!d20\20 K0<,`@(0 @ @80 $00!20 K0 2,`(00 @0 @07 0!10 K01,`(00$@0 @0 @7  P 41tt! 0aC1Q`!00@ TLH! 080<0 04#$44 : a148#(#< 00 :0#40 04$#40 8 #8R 0Ե Ե0b00 4:0ĵ#40ĵ 04$4"40#48 000 80 #< 40#400 P B( 0(!X7@OnD0( @  8  ,0, @00,08 008001) 0)p1H00 0H0 40040 T@0a:@0@ (08#<4 0#400 4 00#40D0@ <  ,0@0,0X @ 00bH R  T R x@崅( 0(7@㷅000T PV pP`(Klf7e -QLM@ 0 l p 0PH4$#48#8S:00 Y` 04 8 <  [0 3S H L0S0T 0H  0bUP 0 .0C0000@000 [ @0 e00#Z(0p 0(0[00 0 $4"4P8#<TP%TP0@ S00 0@00000(]C10@00' 0'10 0S( TK[T0K0 K)0Y 0S 0 (048<R  l PP PPK PK0 |K 8pP K3ń+ 0+Ʉ` `@00 000 04 8 < sR 0 U 0SR PO K`P 4Kp唄+ 0+嘄@0|K0 1pPs  04 8 < sRs 0Po3l0 PeUwPP H0V \JA^+ 0+bH$ 0$400IUXPP IpB+ 0+FA$L哿P II0p+ 0+3A`P|KL`0H`4S0 @0Lp0 $ 00$  0MU %0 00` 0`0  04 8 < sRs<< 000S00X0 HHڃ+ 0+ރ30  #R  3 04 8 <hKdP 80S hKn80 K3/P hK⣿ ZhK _0 48 P3 0S 0S- P( 00S jP ,0  h,0 0,00 0 0 0 \ 0   K|0S 3G 3 04 8 <80S |K80K3/pP4 |K<  Y 00S E;( 0(? Z 3 0  0 4$Q P 0<  0<00 0(DQ  ,   404 0 c0A%a W |K0 "5 0 4@00#40|0 K|Pp R p @0 10K 0 | KKpP0  R# # R , Ġ!!\* 5 \  ,   @    ,0@0,0 3  430S 30S ,00,00 ,0尐K  > 0 0 3  20S 20S ,00,0@DI 0PB0  X* 0*\A P @@ :Q 0Z@0  0  K 000 ZA.Љ2|K90T KSEVJ K;Fp`1 ( B @@00S hK0 101x00h0K>똀( 0(T1, @ , "P0 0 /f` (Klf7e7ed dd edd @{A -LMP@`  ((tT<0S 7 Sp S0#03R0S0S 0 00000 000c00SQ QR $KWR 0 0$0 0 $KLP *K -L,MPpU@\zPP7 0 000  0P0 0CS(((Х(( DK@PD0S@ @K`DKP 3Sᵕ1@20ᯕ@0S4[@@04[0  @0H0 0S0@ K0HKD0K0@ K0HKD0KP@+H0S% #R" `DV S Q `V;@ HDK%a H0  0S0007@1@0@@KHE`,KH` `![0S`H0K@ K>0@ K0H0K⡬P@+` DH 0V Q Q\V1@  0 e U  `0a`0R 0C0D@K-@0S  ,0R`V\z`(K p-L M0@ SP( S* S-0T 0S  KV 0"K1K`P P0 0  T KVɔ K P0P00 K0aKp舋e -L$M0pP`Wd@80 T6W*ppD6W*ppP P00CS~P((((((((p(p(p(p(p((((((((((((Ĭ((|P 0|0ZY 0@0 G!P7Q`0 @0 UZ`10SZ. `V+Z)`SS@ V H0 0 D0 3V `F` ,R )V@ H0`00D [ (V  V| 8KP 00CS0(<(`(t((ܯ(ܯ(ܯ(ܯ(ܯ(ܯ(ܯ(ܯ(ܯ(ܯ(ܯ(ܯ((ܯ(ܯ((H(ܯ(ج(80i080p080 CR0ŕ80S@@80S@@80S@@80S@@80SKK8KP80SJJ 4KP00S3[83[8 `0zP Pᾓ18888ᶓ8KxP80SSS @ y @8KhP8oZ{0 CRz`(((((((`((((((((((į(((((((T((|P[ 0 dP 1P0CSF(( (0(8(((((((((((((@(((H(((((i0+p0)0'0%0#$60$1350 R R 000 84K3K83K($ .  080 8$8 1Pd@*p(K  -@PL`P 0U P p C3 \$Kk x -0@S L  p0`  a   B PU 0R0 0  FKh 갌e -LP`Tp㼀0`AT 0S00e0S0 4~$ 0$8~1!  @p@W<( 00C@SP*輌eee7e 1- l0@PpDML!0 000,P(p$@ @@ @), 0!0 0040@,P(p$@ @@ @,0400 0 0!P080@0'>,P0(p$@@ @P0 +(K谌exAAJ{A 0-@PML000@@ @0 #h0 cL <@@T0200Q00C1 2K0hY{Aded 0-LP :9 Kh踎e -@L=+0"0R S  B! "2 2R2S0t`P #P00S qP P?UP00e?o2PKhM갌edde -LMP0 0 !404!8#$#<8#89#8  CRCQ  R R :H}- 0-}- l4 Q  H}, 0,0 4( <",$\ 0"$#4 0 04 8 < #rp pp'?pq AT !R S  $(,R  Px @ꈧ|# 0#|h7 80 x`P80 00 |M@PM|00 4  P   T ! b  1"R0R "@P 0 000 001<00 0 0 0410 0R R0! R1@ 6App!01X 004 #48#8 S 00S0 ``0`0@ 00Z p004t t#4x8#8'8t!tx'xCWX 0 $04"$#48 #8!04$#48#8QZ 0S0` `` PU  04$#48#Y 8 0P4$#48# 0000S001S c{- 0-{TQ0sS   !00b000C00 P0 `堇V 0  40 嗇 i 40`0 0 8 #< )Q QD0 0100 010c00S 0`(`,0!DBCCom04 S000 S048<:#0##<04 o4 &>CCom0S S#00 c8#<4 0#40  0j n00 c8#<4 0#40  0j P m0S S00`0000c8#<((40(00m00@ĀS SPPH~0X  0 0 # X00S;0X  7(Klf0f$e edd -@ᘑLPM1붋 `tq 9o# @ 0 @ 0 0R@0 0K!P 0! Q1@@T j  0 j 10C1 01 1 S  0S :R 0  00  ! 1 1 0 P 0100P& P 0S S +l0K 00 $400 48 < 0P1 NH[ H0[H9Ij @ 0 @9Kj0 4$D 8P  -K hKhl0K 00$K400KqPH0[9j @ 0 @8j 0$Kq1SYH0[i  0 i(81S 0 SV̀K  K  K 04 $#4"$8(#8"(  Ki0 01 0$l0K000040(0qPeH0[ H0[d@7i @ 0 @ 7i 0$qP I얟i  0 i61S+ 0 S(0̐KS !. Qu .KMu. 8 w. (Ks 04 $#4"$8("( #8 Kze 1S  0R :1P(uY 0P(1 nH0[MP 0 0100P 0S00S ] 04 8  a, 0@`4 P8 <cXj 0#0##<00 4SP0C0ą#40ą"PœĕĕHV0S`Ph @ 0 @  ? h S  04 8 <@ S蓟h @ 0 @  ? h 0`h48<0#0##<004Xhĵ(ĵ Pţĥĥ V ,h @ 0 @h}0@40<<hX6̒h @ 0 @h~hh  04 8 <@ 0bSU<0S/ 04 8 <@ S%`h  0 `hbh P  04 8 <@ S 406URPlK9LX1lT PD 00 04 8 <0 04 8 <``0 h-) 00 04 8 <0 0Sp0P0P 0`4 8 <` `0=pdp{A ee{A{A|A(|AdeȣdH?$dddddd$e eU ;Sx 0(1  04h!2Y1  h |00S P 3000  ʀ1G  K= K=0S S.00K0[ 0K0K> 0K4`1S xºP(>`Y \PD>`H; R 1R8!81-0S0;" n3d! 0!7d!0`0`Sk1h1j1i1 0KL1S /c- 0`4 8 <0#$0 #(#< 0 1S*`cfhO 10 c @ 0 @  ? c 04 8 <0C1 04 8 <(1? 04 8 <`P/40`S+Q/ -lP* 00`S&?p00`Sloc A 0 A ?   0 c0 48 048<cY(!R 0#0##<00I4S0C0ą#4ʃ0ą"ʓ ĕ ĕY 000=cc @ 0 @  ? =`c0  04 8 <$!S\=Cc @ 0 @ ? ,=Ac01 0 48 1 01  04 8 < 0#0##<000i0 04Yiĵ)ĵ ʣ ĥ ĥ01 10 +RS 24Pb @ 0 @bS$ i0$0(0<0 iY[;b @ 0 @;b0Y;;b  ? p;b ; S 04 8 <$!0bSP< 1S 04 8 <$!S000 b  0 b ? :bi0 i 0S  04 8 ,x1cQ 0b 0b  0bS90p10l1$  04 8 <$!S+ R02 '=0 6040I;Lb! 0!Pb  04 8 <$!R00 04 8 <0C0o;S  S3ڇ 04 8 <  cRy4!0bSuʌhb! 0!bs0`0`Sk1h1j1i1l 0K 04 8 <0C1 04 8 ,0aS]`VK1SD1!Ra?ga @ 0 @a#P 0 $ 08 ,0R `k$;S;08C8S; 0  1 b< cR103/PH+0R81,081h=048<$S `0asZ103/ 04!8f 4 0< bR ra  0 uaifa @ 0 @ ? ea 1SCL!R 04 8  ;S;S SSO;0CS1 *)*)*)*)*) *)*)00;% 0;;0020Y!9$eH?$dddddedȟdee e400?0@!V0 0S P; S1 0 RS  0RS 0R0000S 0S0`.0000S[,1,, RPM @1@@ JPE C0S S00S900S5 ῠ 04 8  öP( 00 04 8 <000 00 0  04 8 < 00 0 0S0S 0 s  R0ą0ą ʃ 0 $0(0<(10cS( $1 B0c0SX01@01d10d1 04.[S1 1 Đ  04 8 <$!S/0S,;S) >$1 ̣0$1 @^. 0./ ?/^P1@  \3 [ (0K 0@00000$10$1(K 0-L0  0'S(P H@^  0 ^0 D0 e`8 8#4`#/\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee 0-@L0:0K0h 0-TQX1L@E1Q6 P `Yo\1+UP1L01 S 0xSx00 8; S0Ҳ;0X|A @$d -LM0Sd0 (0`0 d00Sd00 `0  ( ` 800 0Sh0  S d0S0S h0@S S P>(PPpQ l0& (SRTQO.eePPNl0H0#&-d R Qp0 d0x0Pp0 @ eP:TP4 R R r TKp0 4!p0R @ eTp0 Pp0!R ! Z dQZ:Z dQZ:@ ePd0S dlT ld d0`S `T 0S`Z+J;0f S 0!X R01d0 Ld0{S 8t;d0d0P8%815<j;d0d0P<%<156[</PZPX(PV410 0P0  8C0P@H0PA8C@7P2 830P. H0P8()@@$PP%00 0S 1  b0d!!08!R8!8`f V01 0!0 00 00 0 S:H!00b S:X:@0S xRP<:@P @UP:@d 81R1*!d0!0S01Q881 `(Vl `` `Y0T00 9A \ 00T0S , 0,9\?PP p9 00SX)0X 0000 1S ! X101QāA0 3SHL0ST 0 c`00l0Tʈ 00 u000` 0 Sp h0 Sn0l x0 Q2  0S. 2+Rf (w Ts!4 aRn T Q R  70\&΀L 07L0\00 (  p@pp0 5N y $ (     $m $ V (  TKj2  !  `0 p| 00"!SR00i!p$SlQ00S|0 (",$("", Q "  "! aR ! R1(",$ "$ h0S S 0S(01p0S, `PA 0`h0(`Sfh&<&dx0`&d`(`Q^ p0x 00 i00x 0P| !`0R1+ 00 PP`1V4av[)@PI0 $@PD4r[|0S| $100! bR01$1x1000 000S^ !4RT 000 0 0 :0 0Px0 d 10S ʀ!   d 0cd0t0 d0t0 0x0 0  14!0bS `!0QX` c81#UP!;p0;) ;S(XK P$ 81X AT@b@b!?@bPbQ@d@dT@! 0c`0 0R@hT00p0  @p 0S U`0P0Spǃ8:0;p0S#0  ;S`0A0T@h0@h p3Tڤ!810!0bX 0SJT0p@`0@T@hpǃ@hTUp@  0[81P A@ 0S' `00 # `0 1#11S:`00S: S* 00lS ` Q!\P`0` 0;0t0T)ڀ0St@ XtT18t@t0T00À0 0p0  dПddddl @ @di|A0f}|Aܢd)dd$e e$dlfp00 00 p0S ` 0  00bspC`0` !1 b`000cR0T|0  t0Tg`01  0 S 0 ` 0 SW*0ST`1TQ*4!10bp  ?J|0Si$01L!|Pc,R  0`0 3 P 0R5Q300P.! aR)  410aS@P 8P10 %`00S P8P bUh0S(0 S<000 `T KAP PP `P1U1Hh  Q Q `0 `T K+ S`K"RKQ K  @ j1H`L KP T0K h30S 0 `0Q1/Q  * l `bl0b0\l0l0  `(Vl `` `0l 0 003Pt1Pcl0ll0 D1S`01 DQx0Sn 10 l `bl0b0\[ l0l0 l0Q0 0 0l0 0 x00Cx0 ql0 00 kl00Ql0 l00l0 x0S x00Cx0 00 Wl0$00(Nl0P0  #`(V|5P00 `)V 014!0bS202* 0*+ 0+) 0)* 0* h6d kdPT 0L00+40 4000P0X06HP0` \00p`001 !Rk 0Sc01 < 0b0 0 PPpX0 + 0+ - 0-1 0bS, 0,- 0-7QXPP( 7 00SL4d cPT 0L00+40 4000P0X00HP` \000-i7PXX# `p`XP  PP  /P2UAU;SY?PPp0S0@d@0 X 0\)8 S0x l0 ( l x ) R   !BRp)p !0 T 8P4 $ (   00 St0 40<  00 S t040<,0`,  !d`$!hVlF`F`&d`8wP 14!0 bR4114!0 bR141L1S,;P0L18;qW#`pP;ctWp0S !41R!0R 8pFP 0;;0 T`00S 8/PK S *P0 Ffx0 [ 0l 0P Gfl00 l0l 0 4l  8l  <l0l  40 8 0 h0S S``uw`0 1R0 ᶇw00S0 PPD-0 0000TTh `p(K 0-1H @0C10L0C0 0R100  \0蔢de -@00!LPRp$`0 0R[P 1T010p00 0 R 01 @ @! !1蜢ddde 0-LM 00 00  }Y K|Ae0 101/ -L4MpP   ABAAB S@@Q@TQ Q  `d  `lVJ4i\P`1X0  TK, PK,T Pb8"8#4b$#a8!8#4a4#fQT P0 iQcQLK X0@D0CX0 0Al^  Q,K 0X0@SALKX0Yj `10cS1aS   L K!'@PQT0 cR=L K≁ bQ @T3cQb Q(0` fR00"Q0 hR00 @0hS0fS0P 0 bQ000 hR00@L0K!0bS0@P 10fSa(K蘢dd 0-0 @PD 0L8 @L0 cR@Q 00dS00dS0@0dS@00 0-@LQ 00 001 / l\ l 0Sl\l /!-R1lQ  Q  bR nQ0bS0; 1 0/P//`8 8#4`#/ -@LPT`& 0P 4 ~0P f P Q1Q88!011Khd -@LPT`& [0P 4 2\X[0P f P Q1Q88!\011Khd -L0 1Mfe1M/ Q0M/ \K 0-0L(@+R@ A3QR 0R+RY/ RY?zK0h 0-0L(@+R@ A3QR 0R+RY/ RY?yK0h\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee 0-@L0  0:00 0-d0@L00SPPLeT 0r,00S 0K0hJQ0lf\f|Adh) -L Khr) -0LS̀@ S XT x0S|0S0s0S 0S 0s T(``pW  0R '00JpP 00(0 )0 SP S< 0X0@00 00&a0`` 00 00 0  t ) xT   ) ) 0  0000< !#8#(8#8"8|0x0`000` 00000) )d 0###<0420S 20#$ #< 0if 0 4 8 < 40 8 000`00x0Sy00SSy00S 77' 8 8 8 8 80 0R RR  R (0( ,    0("(#8SV0e$d @ddee 0-PL@T 0R00  0R010 H| @0 -L Mp@W`(8V(804!20b!0  ?P\ ïPP 0 08S %#K0@ 0T1TŸ 00 00S 0 00b (#K0 0 X!000 00S 0 00b )#K0 0<\ (0'b0S\* -(P(   ` d/`0:0P 8000W:0 00nǵV pfZPp`( O" 0"($OP(P]V80PT2U(K =zef0e -@0LT(@S(@PT` ;pS 0;(N! 0!(N" 0"(N<VY?`V<`dKhe 00!/e -p`L僮@T 0S SPU P P (N( 0((NT0:0m@Kh蠮꨿fe 0-@L01S 0010e -L(M0@S`Pe0SbP00P0S[0@SSP PQ X10SP UK 0 Sp9 ( 0R*TA 8Ku$80K gT#[0[  00U1'0 0RP00S l00@ C3SR8 KH0 0 0(R(00 p$K@e|X)e*@0S,8! |!/0S,8! |!/ 0-PL0M@ 0K$0(K/0K,0 00 0K00PKLRK0V)@e -LM,0(  įK KLK K V)eP@-0 Q Q1 0S DpWS` :0S DpWS`:@00 dP Q Q ` S01 P S01Q Q (   <R0b0S!dXde -@LPPp (ppaPh2S 0!tQl2S0p"R t2S02xޣPx2S<00S%P" (pkT,aPh2S Ѐ x*Pl2S0p2S t2S02EPx2S<00;0`1U 0kP 0FM+\0 P1Q Q $KkxTd@$de -@LP PP TPU: T1S+`V( %0@ 0 c P0\\1\1S0\1X `T 00X1 p 0!XX\1FP050S00Q γQ Kh'T  =z -LpM@8Kp|2`SP(K$ 2S  JtK tK KtK tK KtK ptKKtK242FU T24280SKdW)e -LM\ 6&tx P 6&x Km]|Ab P / -`LPPp (p2PP (pNSP0X<@@ TL3K@`P K@`P @`U 0P@1 :0DF*x00 Q!\UL ( @T W T29 ` @R5` 0p1$40  048< Pd10S` @0G3WS\p4K !04pK30K 1 0K4 3K! 4K4H81 =@Q= 048 70`0cS0410cS,ʲPT4%T1X%XU$*81U0 :900D48R  10fS 90a0T000000 K @eW)eT4( -0`@L(K1@@P@(KhKe -8@L(`pJ1@`p`($KkJe 0-P@L太D 0404 000ݪ$0$K0h. ꨿fld$e$de -L M@R兪0p .` P)  ( P% 10S!J0aS1) N3K0 2K00[ 0B0000K78K0·2( wv%0Q1;08C8 S; 0;J$ 0$JY?Q<sXpJ% 0%tJT!X1\ 1L!C1S01!S01S00010 1S ;SIJ( 0(MJ0S010S01;S P P OT!X11X10T1014110L1;S0;0103/K訿fPd V)e e @$d -@aLȩ0P 8 P2;` SHT1X!\l Q*1C1S014cS I' 0'I<I% 0%I{0000Kh˩꨿f e$eȢd -LM@Q|0p `` PWhQI& 0&I+R?0S(0Q(0R  Ӳ11* 1S !H  a0R(*I& 0&I0 $0S0 BA B0 0  01h01  bI' 0'fI<YKhY꨿f e$ed$d -@PL 0p `" P01; S !R P0H00aR:<01 YKh#꨿f$e$d -0L R   Rd  RP   R<  0R$ S0m0Ȣd$d 0-(@L% 0 K0h3 e~) 0-@PPL垨 @00S P 000K0hϨ꨿f 0-@L, 8* `( K0h$ / -LMP00`Kp0` @0 0K\0 0L0 0`@ 0 0 000 0?o2P0S  R0 (K -LMQ2 P 0R " p Rqc@P`0U2 002 00@3$@R T 0V000(0 kP -Kh2b 2 2S S: {(  0  02 d02 12 2" S00| x2 ?K(R (dKcKt0`2 I\K[K&W?K x0X1 A(  0◟K  02 h02 12 2 S0+0|" x2 ?K( \(  d"KcK&$d0`2 x0 0[K\1K&W?KUK d0X1 00Z00W0S -KP h0弧 2 J =2 0Gsp @J2U20娧(K訿f -L M    0LC K e 0-LMPQ@ LP g 0K#R #lP00K0 -LM $ 0 埪P (0S W PU !  P i@P 5E KhKe -LGM`!Yp  V @0S\@ R @00S!IoQ㪢 @T0R@ ,1 001 ʦ 00!,,R \ RK_K, P+![T [RRo R,1[S0[S$!0R QqA SQq7 Pc@P_処 @@8l00$NP P (0S !Y`V !  ` Yi@P753 -@,R !R !r   S0S0s000RWnElE,1[SPLP9J/K B:[ (@q+@@(K訿fde -pLMP`K` @00, K0d0"0\ @ 0 0` 000 0Z?o2P@@T (`00  6(K訿f -LMpP`K` 0@0 0K\0 0@` 0 0 000 0&?o2P@@T 0S0 PZ(K df -LMpP`K` 000@0 S0K\0 0@` 0 0 000 0?o2P@@T 0S0 P0凥!ǥ(K訿f -@ `LMPK pK`  0p 0   0  \P L` 0?o2P@@T <P ,`L8@剥(K萡ef \ \?ܣ// 0- \ML@P`!,0p ,(`0 0P$@ @@ @ 0!0,p 0(`0 4P$@ @@ @z040H? 00'!0?,p00$?(`0 08P$@ @`> 00!>,p40(`00 8P$@@ @J040> 0 00!>,p0(`00 8P$@@ @2H> 00!8>,p4`0,>0(`00 8P$@ @040= 00!=,p0(`00 8P$@@ @"040= 00!=,p0(`00 8P$@@ @040H= 00!8=,p0(`00 8P$@@ @< 00!<,p40(`00 8P$@@ @040< 00!<,p00<(`0 08P$@ @ 040P< 00!@<,p0(`00 8P$@@ @ 0 400!; 00,p 0(`D0K 8P$@ @@ @z0 400!;0<,p0(`80K 8P$@ @@ @c0(0L; 00!<;0<8 K@0,P$@@ @N0(0 0 $00!:8 K0:,P @00 @008 040: 00!0:,p00:(`0 08P$@ @  040X: 00!9,p008:(`0 08P$@ @ 040: 00!9,p0(`00 8P$@@ @0409 00!9,p0(`00 8P$@@ @040X9 00!H9,p0(`00 8P$@@ @0409 00!8,p0(`00 8P$@@ @0408 00!8,p008(`0 08P$@ @040\8 00!@8,p00<8(`0 08P$@ @|0408 00!7,p007(`0 08P$@ @d0 400!7,p00 <(`0 08P$@ @@ @M040T7 00!D7,p0(`00 8P$@@ @60407 00!6,p0(`00 8P$@@ @0406 00!6,p0(`00 8P$@@ @040X6 00!5,p0086(`0 08P$@ @0 400!6,p005(`$`00 008P @ @0405 00!5,p0(`00 8P$@@ @040P5 00!@5,085,p000(` 0 8P$@ @0404 00!4,p004(`0 08P$@ @0404 00!4,p0(`00 8P$@@ @y040L4 00!<4,p0(`00 8P$@@ @b0403 00!3,p0(`00 8P$@@ @K0403 00!3,p0(`00 8P$@@ @4040P3 00!@3,p0(`00 8P$@@ @0402 00!2,p0(`00 8P$@@ @0 400!200,p 0(`<0K 8P$@ @@ @0(0P2 00!2< K00,P$@@ @0(02 00!1< K00,P$@@ @080 0401 00!$2,p0(`0D0K 0 X1 1?0 <180   1 Q 0 $1Q 0 1FK0 20 0 1K20 20 111 1 GKżP*P1(K @~A dpMf 0-;L@Sꀽ))))))0;d@00T;:8T6 ;S40S0S (P U; S Q$ 00?0f S0S0S T00  P 000  P @0$ddd 0-0LPS(@@T(@;SK0h 1 QK0h@P 0 0-LM0K K   # KX@P~P K0 -LM0K K   # K@Pf@~K p-LM0K(K( $  #$ K`)@P OPͿ <P  K@`Kp -LMQ0 ps 0S Sn1`11@11`11@1P0K` 0 0, Kd" 0 0\ 00 000 0S0?o2P0S@0S<* BR7))t)t)t)t))@)t)t)t)t)t)t)t)t)t)t))))@) SXV`` S`VU  ӖCjQP1P#U T  CjQ@1@#T0 0(Kpd\dldhddxddd ( -$Ll  Khf )BxA~A~A 0-@1\8LS1P41104P 0P @0 V` @HH\ 00000 080 0X0 XTG 08> @$40$040  0 80< 00#|!!P) P X R#P0R#H0R DDP  L4P@0@P  0 80080 0<0S r`  0 pl 0`WV`pT 4`WV`@P8 UT@ T  (Koꠡe @eТeeeġe -L$Mp@WH 001@0  D R0 01"0`(8` 4` Yd 0R8800 40040 1<0 00USZD  005< 00500 2U5D >CC80080 <000#p!!0PL0 P L0Q @ QPR!HHHH`<0P00<0S 밢0 A 0 A0t 4BYXB\ 8BYXBpD BWV`BSe H (KoТee @eeee -L$Mp@WH 001@0 d D R0 01"0`8` 4` Y_ 0R8800 40040 1<0 00USZ?  0057 00500 2U0D >CC80080 <000#\!!T0PL0  'P GL0Q @ QPRHH`<0P00<0S 밢0 A 0 A0t 4BYXB\ 8BYXBpD BWV`BSj H (KoТee @eeee8@-#Lb"#4,Ġ8` b$,#8("$`$" !AddIA7edXelL* 0-LP @t|p0 R PL| K0h Q @0P@0K0h|7e,d@d -0 LXe -L0M @p048 `|2PPQ7PdRdbd]|\|X 00SP4| @K0@K?0K8KHK @Px @0K CPHK 5m3@K0l5l%l0(0004-M(T \0K( (D20/S0㼊PP? ( \K@0/S0㰊PP3 (0@ (0C0 :00)0K0 (`* $Z* 6pP 0#  <0[0K0㰠K\0KTK0KuKXp Dp /\KZPp 0` p 0W0p0K0K0K( KyKp p 0  0ppp0KK(pK{W0000`00:0\K0 pP1,3\K0000,p0( :*p+p[* +0<00K0pp0 KP Q 1) 0)Q 1( 0V(Y VA V. V1+ 0+V: @V1+ 0+xVP V1? E0<jVP H:Ve1/ 0/^1) 0)0SU1* 0*N1* 0*G1, 0,@1, 0,91/ 0/20>CC+- 0-%1- 0-1. 0.1. 0.D00S 0K .\Kv&p\0K (+(KHdA @UAdA -LMdt@P  0  0`  t  0  'R 3SH0L0S(C@P  0  RU XU  $ ( ,  $(, $(, $(, 0S ,0K #) 4P040:S- 0R0% *00K JP 0 0R0%*!+Q    0 0 #0C?o23   0 ZP ! 0!s(MQMa50 3SH L0S0T 0H  0b/S000C00000 0A@T @10SI 414!4+C0( 0 (  /R 3SH0L0S0ㅈ@P p0 80   80} }(P) C 4-0 8.00, / 0PQ  0 (s(KXe{AHd @ـA -0L@'Sp`(@@P P } P }P 0 $Kk$Kk輆 -LyMpyoK( @mKW[PP 60S60S 0d1 0X00K?K!MP ,1! Q 0$"*1 1S F   0 mKr1uOK f1qK ` | P\|PW1[S1[0S d50S<  .WK$W?KD%D`0S (50S-  .WK$0% 0W?K*!01K0,KX1i_K l }vP1 0 R 0S 40S$ 0q/KyKKKp$0t) yKUP$ 840S  .WKe$0q/KKKW?K$ ) Kv30S 0 yKKKq0#) 9v1[S 30S 0q/KyKKK]p#01[qK S1[000C?o2uK1 1P0S  30S u?K yKKK<"01 (C1(-W =WP20S u?K yKKK%"0r)|!R  ≑ 90 00Y D20St u/K.WK#u?K KK9@IW?K" O)a00000 0|]mKZ? 0ԑ1 ww10SP:wOP KKK WK  0UK+1K[1K1K\QKfKIK,QKz?K0K0 WKQKzP zwuw0+1K0@,K1nJ?K0C@IKq?K(A A } \@mK]C " 0" mKN(Kdd{AXeHd @A:A{AЁAA^AAAA,d7ed ,* -LQM(P( PaKY0P,1  1  0U 00'S (=P( (10@1 @!0S(1%p *>K ( yP 1 Qp%p *8 O( W  @,P(1p,  0 0(!: .@P ;0S `PK ."00+\(  @ 0 @,11  0 @B  0 `V Vk VA V# rVD VQ mVV*,11$ 0$VZ V  :V" V9 VV :0FSO,11! 0!T񟗀xO*O*xO*T*O*p^,11! 0!& pT,1p1# 0#K,11" 0T" T[p>p<,11" 0T" 1:TK. p-,11# 0T#?0  PP 0 3SH0L0S0@!R 0 ؄@P 0@Ѓ P0@!R0(! G?K ({P !0Q:00S ~ U  7! A 0 AB  0 5('YU,1V1' 0'' 0'0 ႄ@P( jOhO,11( 0(Ul70S U U T,11$ 0T$ 0 W@P ( hbh,11% 0T%U 0 >P ( lpl,11% 0T%U 0 $@P ( zc/xc,11& 0T&hU 0 @P ( Y^W^{,11& 0T&O'Ug0 @P( 8%5bT=UU]50S @K .A! .\K=!,1$20\0K0@0&0Sp@pp/U N  0 Q(10@0S0%(!% *>K0 ( kPd !00Q:00S[ P`001 ,V? V +V a3V <V] 0R0%0 *C?K  EPe !0Q:00S\  3V Q? 0R0%0 *B?K  )PI !0Q:00S@   Q%0 S0%0 *A?K  P !0Q:00S  0 & $,R P`0T@(1 xPK 0.. 04 8 尐 @ <:00 00 00 01P 堠 S`K 048 ,0K#0 , 001#0S2 KK3/- ṁK,70S$T 5 @ 0 @{AHd @DAhAe@8felbfXe|d0fhbfpfPd  0 K,0`0 0@!R(1p 0K ( 4P 0 Q:ppW 00K0K0K KK TwPP 1@0,1 T` 0S[v0:SXx0S|0S0S0S  ,xPF0S0S0S0S  wP4 R 0!03* U' 0  P h 20S 0 K,( |(0 K[P(y P 00 P@U h 20S 0 K,( |(0 K5P(S ހP\Z$C ՀZ% R0%^NK, ǀH}PP3 0 @@ 3SH L0S T0@@d`0@4@D@@d@T,~`3(  ( 08T@p 44 \4 00$p̈́H00s04@@(@(0)pD! A 0 A @ 0 @(0  Y0P01 01P(1010S(1%0 *F?K (P 1 Q: 041 41S 00K0K K0KP '@K)QP 0[S0[0S .'+'414!0pt4'txG8<1 01(p(1pc<1`GS_*_* `* `* `*410SV 41Z Z( v<1VS@@ Vo0K 0{01K pP]  K7vPK )Z' K#P@RK8 7PPD 0SC@TD 0!0 R01%% *E?K 0wP 1 Q0 'Z% @0V 81 P81Q TVp WRQQp  FD!  D8!  FH!  DL! D!jR38 cP`P?P?VVH Q' PL R" PV@@V@TP1 D1S81  S P`pP1pc81SQ08 081 <1S S h9@@@<`P``[tP P P P1S   0 L1S pHPUDPEV \KUH%<1 {f0J/KCP= gh10S1  ph4 `KX0X0 H0 0 KT `K \ 80 jP( ^01S 018@uD (KHd0@كAATAPdtAУdxe;x+te$d@@ƄAX@hbflbf -LMp@`0P p@HK 0-@L h K0hKh 0-h@LPh0SB?CDK0h;h 1S B?CS !R P texeHPD0@/ \ H0S/D0CS\ R P $\/ -L@p`_P@P Cr -LpPM`d0@T BODT  `PU)Cp0U APte -HBL`TDPD@ U 0S  xPT@ $4R@HPUDPE -L@p`P@P C 0-0L@S0S0S 0S- 0S00S& 00S B?CS `  "d  " h  " l  " 100te -LPp0`@TBODP T  `P0  ATBODte 0 03 0 0 R/ R-L`P@Pe !P 0 !0cR#QRA Q0-LP@ HK0hD  1RQ00k010$A @ SR-LMP@p4Q 1CQ 1CQ0  0S0S0SS0SS`V\4U` 1CU] 1CUMP`Y KPG1@XK (0S,0SPP Kf4 K K0K U00  00 0S 0K ,U 0p0 0l0 U K = 0d0K0KP[040 00 0 K9H0 0 Kl09 K `F K 000 0K00 000 00 0 P` <"U K$ KHbVR D`FVO 0S H`Z  K~K!j 0KK00 000 000 00 0 P\1UXP, K  KZ0KX U0K,:  M0K ,H0H0 V0 K 3+)-'1PI"0X 0+iPP30  % iPP '00 (KSAikiii -@X8L$MQ`P 88Q 08,8Q08Q 8Q 8U7Q :70S 7 0000(P`0D0 7U 0CU d70S$9ih7U \7U P7UL7D7U <7U x'QT` 0 IHT 6U0CU*6U 60S6U6  6U0CU0C2:6U 6U Hp6U0CU*\6U0L6UDEn86U 1CU 1CU0 `_5U- ]1CU) 5U% 5U\5 L5U 0C50St5U 0CU*0CU:0U0l5U:0U0UppOW 0S R gihP`@ K\4D U% 0D0 @4U  0CU $4U !4U 0U d4U `40SX4U !0U P !44R/`D0S 3U3 11CU l3U 3U 0U 3U(  0CUD000 3U& 0U. DX3 Dg`D <1 .3.1D@p /@Q`TpP 0 xx R@0 0!A`vZ /p@PPV  0 ` R0 0!CAd0n@&  R`0 0&'  R`0 0'j0P0D K@0K&`V@1D W`@KDwD>D1D WD>D` ```@KDb1` .-` w(Ki kiimiHUiWiHMi >diiku(iijuP iLi0?Ni0Pi Ji(KiiildiHeiHyAi%i ni i ߖ>Si i Ii !i Ti PdHd\Xe -`L Mp/f@HRh0 UDPEU+  R#   R`f00ST@ y`Y@$Q@HPUDPET$ H0PD@@T 00S0  Q P 4\H0SD@CPV(Kȣd -LLM<0PSU 3A0ASQ`DHBT@ ,qD@DT< 00S4hK>P0 00HHP  0 0S ` .TKT0K 0 Bp   @RhK>H@TD@D=(㧎*W K$dHd@A@8e 0-@LK0h -LHM@勎W`HBPT/ pD@DT+ 00S#`KZ>S00S ` .LK.L0Kp p00000 o`KP@>H@TD@DK@8eHd@˅A 0-@L1K0h PQ Q /3 -L@00S?CS/ !R( %Є R p WR`:`V p WV:` pWVR  QR@1:@T  QT:@@<2S?C fT0@pfXd 0-@LP P P 00 -8L Q Q Q Q0AS GQ #Q 5QQ Q Q @A -L`9XP5X1XL@d0 00 O0@0L0`0D00@0 0<0(080,040D00040,000O@r*s*r*u*u*q*q*p* -L`@kO0DP0!aB_aXX cKh X꨿f0008C0 04 8 < 0/ -`P L@S0`0000!36 0 -@`P L>0`00000 08C0 04 8 <0 -L$M@0K0KK 0-@LWPWP0 -@L M0QP`Y 'Rh 'RX($"(pt <K@<K0 Sp00SS000CS0p0000010 0S00SS000CS1 1000000 Kh9 A5A 0-LM`@P K0 0 9PK K 0KpX |K|K⊧ K|Kⓧ|KK⾧ K0 00KPpW, 00 00  P03 P 0@T T h P@ AT BODT T00S H Hg 0 0K K,@4@teHd8@_A -L MP_ 00 a00c00>0,0 (0 Pp0@Tf Ki_ODT 1 P,K.`P  &HK0h>z* -L M@1p`0.P,K ,0 (0 P T @&0   T  ,KP K -LM 0 00s& K -LM0,00P'S< @ ((kPP} 0;S<kPPu 0, -@4p4D. 'rH/ q(L  h`PS d8$8dD #D$0j00 8#<48#(#<8 8D0 00S>0 BkP@  h0P40 5j6g 0(08[0D!d8$8#4`d4##,0-##<./08 9 0( 8 9@<03/P00 @4`0i00 U ` i 4`U i (K -LM0 0   K 0 ^ K* p-L MP0`( R0@02K 0K fe"[4"4#8#8P2K0b U  K  01K0 R![0 0K i,0`&,`Kp 0-@ML 0(0@@0 0KrAe0S/8<\\ `P/0 !`8 0 0 ,  , !/deee 0!< 0`4 0 ,   !/deee 0-@L\(020S K0h(0\d*@-0S&@00 0@x@ @ _@-0S&@00 0@@ @ _ -L|Q;q h ^Q[`VXqUR Q` r```` Q R+ Q2Q R R! R rh  /R R  R R  rh  R R` xx0 Sx0P pX  P QV 0PuP  00X0R$0S 0S} p 3/0x0 $0SUnp0 3/P 2t S0S 0S0S ````0S0 R R R S0S0S 0S S0S 0s$0S 0S` xPpX  00Q0RlKV lKlPKl0KU (K p-L$M0PS8` K<P 0S 08 S P XXP3XP.0S@T0s  7 K 08K8 KCK40 0@ ,@ XPS0S 0@70K00KP80KCK4@ 8K @ XPXKp8X -LMP` Y$($00  "x4 *D !0'D"$, (,@!4. ! Ȍ"Ȍ  A 8 0<0 T;  R6&R3& R0 R R R R$  Px R| R R R  xP 804 Sr <00 Srh   @Y  $ R  0 8/(K -L,M("", $H0 (("(@   pD  # " "@ D aA L T  RH R h  &R& RL Rzh   xP0 PP0T @PzU @0D 0aA, <K03K@ 400D 0AaT 0SH0S h0 6S 6 Sh0  <KxcP @0S @T&H0S h0 6S6 SZ h0  XxCP0T 0S   00S0@@`(Ke0@-S 0S0S   Q9x|0, 0# @,0 0#Ġ.Č Ƞ,8 \  01x| F, "4$4, 8 "#8 0 x| F, "4$4, 8 "#8 0 aQa0v,0`V, .|0x$'$,,`4%4,@,( 8"(#8  ! R 0 10v,0`V, .|0x$'$,,`4%4,@,( 8"(#8 0 0v,0`V, .|0x$'$,,`4%4,@,( 8"(#8 0 10  -L`P8(@PH  000l00!00$ ,P(`0 p R 00@&P4"4 8#8 ! R 0 1  &4"4 8#8 A&4"4 8#8 1 0~,00Sh09h0@7ed -L0M0PS`p6S|x0Sy|0Sv0Ssr0SoQ 0Sj (0@K@`K 00L0S/^|1kY@PW 0S" R rh0 @60S-  PK60 O0KP0KPKL00S PK~4P R S 0S0S0S h0h4P 0x01@k T  P (0xP $K脥d @ -LM00 0 0@S` P>0S0S/P70S* 0S(01S# 0S4oXPP 0S 0S0sh0 x0S|0S0S0S08x0S K4!8(2a1(2x0S :|0S0s|0S00s-pW* K00K0刀K 0 (0K!l0K00K00SP0S100 0 Kf0;K0K  lK?1ȠK00K 00K0pKx00 0p KGPؠKQX 0K XP  C67PZ :6.0S100 Q Kw*6 wx0,*[S |0S0S0S 0 x0lKKOPUH0[Rx0S|0S0sS0S Q x dP 90K:[60S (0K 00Lx0K0 K8KP 6d 00d0x00SP `8 8#4`#d0 d 1P0PP0s(K脥dḍd -0L@S4`(P`bp0S   0  0R, 000 iP aP >K8|T$u6tu0KhTef  0-@LT06d (00d0(01 K0h0 -LM0@SP0S0s  0, K0"<K[<0K!(nq :P0 \ 0RS^KQ0FF0RS0\ `V ^QPP0P52QSP5,`RQ&60Z RQ``R```Z0V `RP&`5V0Z`RP``5V0ZP0*P^ P@T*0P050A%d0Z``(K{Ar@ p-L@HKL0K HK0@ S`P*UA, 0S  R V H0R SppW 1% 0%APL@) 0)AU ``(Ke -LM7! lK(2 p1(20 0`| S0 Hp 0 0S@0\@KS 0S P 4PP?PH0KP| KRpP60\00C?o20S 4PPp&H0H04H 6P40S Ap3pL0S UP -P3H0L0 P6|HR0SP0S; @T8 0S0S0S 0S, ` HK~0H`KG0K@`KUpHK0P H0K VpP>0 /0`SPV 0S0S0S 0S pU KUpP00 4 匀 @0T@`BOD0 0 吀 T p KlK UPp0 RHK`0t K UPx K  UPx0t R030Sq 3 0 cQ:` lKP` V 0SlKT T00`S0 0bS0cS00cS0 0   q 2 0 cQ :p 2 0 cP:q  0 cQ*q 0 cQ* 0S 0SjS 0SJ 0<0s XC 0<< R<RQR-0 R | r!    R8R4 # # + lK 0 P 0 Z  0 0 T0 S 0 X   匠 RlK ` ATBOD V1p``0S  0S\K*2Z 00!(210#(2(KdteȣdPddP lP/Q1 00/d 0-@PL 8PP PK0hH@P0 p-LMP,`h (0@  "` `gP "KPP h03h01[0![4"462Kp 0-(@0LHH L00<00e -LMaP`qWʀ 0! `!|!0 t!p  , !Q9@@X00S1X00S+  4Kv0U,P P(P HP0 U ,Q ( H0R:H ClP,0H0,0 40H040 P40Y@#@2P@@T 0 0!@ `q04 0  , !$Kdeeee -1LLM0S@-`H lK{00sXl0K$P l0K0 R0 "K 1 aT# H@l0KP$pT  P ,P( @PtFPH lKD@L00L0PLPHPl0K$@U  Pp ,{P P0W0L0 K蔊muHe 0--L^Map@P$ 0T$ * 0*T 1# 0#0`  ?R0! K 0 1 nK . KJU .PLPCT0<@@0 @`0-K  KeأddPdniAA -LtM0x @,0\Ko1P x0 $0S# 04 8 <# 04 8 < 04 8 < 04 8 @P0,00P 0 ,($@ @@ @d 0!>)004P  00,($@ @@ @N0400> 00'np!>8P 000,($@@ @6= 00!=8P 004p0,($@@ @!040= 00!|=8P 000,($@@ @  040<= 00!,=8P 000,($@@ @ 040< 00!<8P 000,($@@ @ߙ+040< 00!<8P 000,($@@ @ə,040L< 00!<<8P 0<000,($@@ @p᱙ 040; 00!;8P 000,($@@ @ᛙ040; 00!;8P 000,($@@ @ᅙ040T; 00!D;8P 000,($@@ @o040; 00!:8P 000,($@@ @Y040: 00!:8P 000,($@@ @C040d: 00!T:8P 000,($@@ @-040: 00!: 008P  00,($@@ @0409 00!98P 000,($@@ @040l9 00!\98P 000,($@@ @$9 00!98P 0040,($@@ @Ԙ0408 00!88P 08000,($@ @὘0408 00!d88P 0`8000,($@ @ᦘ040,8 00!88P 0 8000,($@ @Ꮨ0407 00!78P 07000,($@ @x#0407 00!t78P 000,($@@ @b&0 400!(70 78P 0<00,($@ @ @J0406 00!68P 000,($@@ @40406 00!|68P 000,($@@ @040<6 00!,68P 000,($@@ @0405 00!58P 000,($@@ @5 00!58P 0040,($@@ @ݗ0 400!D50<58P 0<@00,($@ @ @ŗ'0404 00!48P 000,($@@ @ᯗ0404 00!48P 000,($@@ @ᙗ0 400!L4,008P 00K 0,($@ @@ @႗0(00 $00!303,P0 K00 @ @0l0(00 $00!3,P0 K0300 @0 @0`V0 (00!T3,P0 K0H300$@0 @0 @`A0403 00!38P 000,($@@ @+0402 00!28P 000,($@@ @040t2 00!d28P 000,($@@ @040$2 00!28P 000,($@@ @ MP\Q!0lC1!00@ T!A0Sl* R RRlA ,0~A#Ad1zAd0[(0.@S*:D0K N4[<S#UD0[0 S:D0K NUC[D0[0(0P S :D0K NUC[D0[0Kp訊A p-PS0`@L MPK0%0PT @Kp 0-LPV@P  V@P V M0 V -LP 0- L@VP K0hV0 (0-LM0 0 0 @ L^0  R #' R @ >02SF  0 #  0 # @ 0 @T 1  0   0 4m0 ,=(   S0'S(SP ! 0!T/ 1  0 (0 `R ) 0) \K+  0 K"8P8| 0S ` \K< {  0 |0SK  04 8 ,048<! 04"8#<%$04&8'<+ 04 8 <  048<048<s R! 04 8 <! 04" 8# <s!* 0*%T 1" 0"0( K{QP0` HP pH P G P * 0*tGP90 S#T 1) 0)P9X + 0+$ 0$T?00K0K0K0K K嶊Kᤀ 吀 D0S   0 2 @ 0 @Xb 400S^H080SZL0 0;00< e 04 8 < 04 8 < 04 8 < 04 8 < 0 \K0 { 0[ KTK \0Kǹ \K!  0Sd70S \@K.K .@0K,', 70S ?2$ 0$6T 1# 0#00 Z( P${ P pP 0 0 FP 0v* 0*`000t 0앟4$#48#80 pW\0K KKKP$`0 4$0S!xU( 0(T 1# 0#1  0 0 -B;0)S(0\0K (RP \ 0Q0%0 * S D  0 p0s |4 0S  0(( AR*,T  0 T 1# 0#(0Q Q0(0 aK0S30S P CoB`T$ 0$0S 0S [BL00c0  $ ( ,  $(, $(,r  $(,! $(,! $"#0(<s* 0* Tz 1" 0"s% 0%Z 1$ 0$X A10S  S  0 TM 1  0 F0( 0R  0 T7 1# 0#0+WZ ,WX T 1  0 ( 0(0 ,0|K! 0K3/d0pPA 0N(Kexflf7e4dHd@Ad{Aԣd@ -LM@p$A6PP 0K#`P 100 0Kw"N30Kn"KAK訿f7e -0`@L<1@@P@Kh=e -L M    06 Ke -L Mp@쀟젟0S Y0 Q00AN(KoAP P@T `V x0S 0CSx0000 cN700`S# 0#0X0C0H007P꨿fe e$d%+ee -@PPL `0 fP M  see.N\ `P/0 !`8 0 0 ,  , !/deee 0!< 0`4 0 ,   !/deee -L$M@p0S0̀c0S+ 3P 0?0K08K@ KS& 0R x00@ m0XS  CP8#8 0 K,de @2iee -LtM Hp#P R`*3అX Q> R:p#5S 78S p@p0( zNP\ 0 3SH0L0S0'S (NPJ 0dS lS 0`0 0`0` ZMp0&RS:P HK0  G K HPK0dR lR0`@K U 08@ #80@K  0 H KPVy% 0%7ps( Z@_PHK " 0"#@P 0# ! 0HK!"@P 0"&K 0&&0 &hK  XKx KhK7C@Pt KXK1C@P䄟 Tpb* 0*f': 1<03@|$ 8 #HR/d4CQ 3L$355p KhKCP (D4* 0*8l KXKBPp0x Rl0t R"K 0"#0 #3 @d |3(P # 0#\3I@P P#0 00(0 00fMPhL0 3SH L0S 0TaaaUMP~ 0(P(PG0K0KH0KD @@K000  PB 0@20cC30  0 2H KP\% 0%WP 0 M@Pj 0 3SH0L0S0'S(uM@PX 0<02SU24K0d!F0K0E0KH0K007A0G0K0KH0KD @K00 >P 0'1\ $Q\:\ $Q\:@(  \ R! 0 0H0K \00S 0K(K,defe eelffd 0-@p`\DML!0 000,p(`$@ @@ @ A 0g!0 0040,p(`$@ @@ @ - 0!h0 0`00080400,p(`$@ @ @P80(K~AA|%+bBe8 0 R kR C_ /-/,df l1-PL@A X1PQ 0D`0# $0# 0#$ 0#( 0#, 0#0 0#01QpQ A 0 AU  TP $NP0S P  0 U &#&$'$X0 0S H03#"ku(juPe,de -L$M@8Q00qS(13^ 5 0G0K1@KH K5#@H$H@*S0@H坞QU `V J3 ``3P@ T+`4 X0R P 0 @@@u(K,de @2iefeee -LM0PlS@ `x R `d0CS56+h7+p7+8+8+D:+h;+<;+K,_P1S% 00:S!0S*`7`V $+,7h7'0Q0AUY K^PS[?XTS0S [P`@P 0[ 7GR! m3&03;[20l3S00K6K Km"` V0[ 30@""##;[ R$&00‘` K^P[`y\ K^P |0V0#x 0#t 0#d 0#` 0#\ 0#X 0#01qQ>CC@0K$W  P $`P0S0 p @Kl@K5[   P$ P0Sp0( GP0 0F0 7  R # 0  #/F P0@0@`0 /PP /F0[0K0TK\0K0uKXp 0Dp dS lS 0 0p0 0p /uF/ aR0l0 0pS p唀X08@#8d\0 l\0\ K P $% 0%  0  00Q~H0000 $@0x004 000030q10Q吐s(KeأddPdniA6Ae,de ejA -LMB040 p  0 40`( cZz  0 v/Z0@@ 0RPP00K HP 00 QPPo4 UW  0 [i0  R J! 0!N4EZ0S 00 g4FP 5! 0!QA8 )" 0"a,0 @8SP0c4+/Z  0 00`S 0S " 0"00 4iFPP 4FA0@ 4C0(4P 4K 6(Ke{A,d@0!(21 (/dP@-) QH\ DpW\ ` :\ dPU\ @:@`Q)  Q33̠3(:\!#*EP@ @PFQA \ dPU\ @ :\ dPU\ @:@S -0L@0t0Pt00`0x0x0|0|00S  .PO 000S -P@  ɭ80S ppq-P81  8庭<0S ppq-P<"  <嫭p0S ppq-Pp  p圭@P& ppq-P@  @卭P -P -8P -<P -pP -@P -7- 0/ -`LpP$A@P* Ud PT 0L00+40 4000P0X00H@` \00A VP  4@70f -0L@(S`pUAPP)D7F@( 0000(0C00(00@ @@ -LP@U`p K;P 3 0 P$KkzC 0-LMC(00d P| PK,0 01K00! R![0 0K CK0 0-LM0@)S"0SPP PKXP0 :R0S 00:S000 W*K0 0-L@800t0x0|00 q-``q.QL@PP ,00/U00S00=U00S0t00U00S 6P ,001U00S 8P ,080#U00S <P ,0<03U00S @P ,0H@052UPPU pP |,0p0 -L M` 0p  SPP#0H S à Q8S5V+X+X+X+X+X+X+X+X+X+X+,T+@U+U+tV+V+W+X+X+X+X+X+X+hU+X+X+xU+4X+dX+W0S 0S0S 0S 0S @T.V^00S 0S0S0S 0S0S @P0S  +PPW0  R0W0W0  Rt00 00PW0Q W0W R/S0S 0S0S0S 0S x278@P0+P b0 00@PW1 W| 00Wx1u+08C0 00PgW`W] 00WY#X<@ 2Xp@@P+PD  >W3 WA0 W= R:S8 @6 R330+0@S#  #W#0SPx0W^0 R000W 0 R|07* Kd -LM@0PS`p*P7 +0ES* 0 00 0 00K -LP`*@P  P * 0-@PL  K0h*0 -L`M|@Kp `PNVPj|0Sx0St0Sp0S|!00$ P SlP BsU E|0[SD( LK|0Sx0S t r  g K h Kp 6K`0 d \0 0g0K0`Kh0KKd P hKLK3PLK3P  H0LK 3LK3P U  $Kd -LhM0PDR@  )R  `FVS SR SSF S 0p0F;S񟗗p]+j+j+j+j+\`+\`+\`+\`+\`+d+j+j+4e+j+j+j+j+j+j+j+j+j+p]+j+p]+j+j+j+j+j+_+p]+p]+p]+L]+L]+L]+_+p]+j+j+_+p]+_+_+_+_+j+j+j+j+j+p]+_+j+j+_+_+_+0 00PbK|U0P*&VI VM V VY :$V %V 5)V2 'V! (V& -/Vy 9V] +V':  Ql 'h P (h 0(h P((h &h P'' h P'' h P&& h P&& h P## W h0P1h01} 6Sx0S|0S0S Rh0P99g oh P%%  DKTPI :0DK=KTP<0 K *)P  TPP A)%0 @5)p`|p V  )`P x:`p0p0000 0CS`+Pa+a+a+4c+ DKTP| PDPt  Pt 3St0S20DKTP| D0  Rs900 xKfTP| x0S0ƕ0@9tK!(2q1(20t0 0D K0p0KP|  /p0S l0Sh0sP| 3tQ 3S10|0 * pK5PPtU 0S pK⢮P P 10| KpKt Pt0 1U 00S0  0P0tDKS`pK SP| K`0S \0SX0sBP| =PPt  Pt 02tQ e5P 10(P\0C0K0@P P^3\30 KhX -LWMT1 ?H! D !@ (21(23 700K| DX0S0L1 0SL!00L1 0S0L!0L1 0SL1L Y P9 .8Q<Q  0K !pP  0K !pP@Q  0K  !pPpQ  0K !pP KDpP00D1 PD1 D(@ ( JR(:UKpPDQ 0D1 `D1V@ 8P 0p0` R0 3SHL0ST0  b`00a0 < 0bS00S) p=W8PP 0'0:@V <1 S:T1T!0 4 L1(0\1 $`8 8`#4 CS00'u00?0, ꨿f$dL+fpfJ0S 00S8K8K(!Pe80K< K~!P^<0 Rt YIP spP"PU+ 0V\  00#(  00#,  00#0  00#4 04 =P FDIP+P 0V-wI100 0X R"`0R xI P I0P 4   H V  K T$ \0!d0d R  P ]P 0S .\K 0 0000d00\0Kb@\00S 0K .\Kd0p@0p\0K$ 4M(KHd@ApdDdAIA -LM`p @K TKPP 1P\20S Y D20S| @K \pK.᣸ .៸00 0" i0S0S0S0Sg  0R\0K 0P \ Q0t宽P hA嗬  0 嚬KF KD~KP10S5 ɽ0 R @ A 90 00T 00S K.K@D>@90 00K⫽@0 0K P@QC ! 0!TKI(KdHd@MA{AXeAA -P`@0L@T 0S P @f 0- 0L@T  @0f -L`M10S ! Rq ! !Qi!`pVd @P 01PUPPP$0S T@ X3`VUT PU@PU>T P6 `V1.T @ pKہ TKׁ 8KӁ00K70KS0Ko0K08@KT@Kp@K08 K@0pKT0K@PH 0000$0UKdHddA @fApd 0-L@M080<0\0@ PP L00S  .DKQ0P( 00d00D0K⻼K0Hd@'A -LPMLT@T X0@`P  RP( @T' 0S00S X0 \0`tP\00\0\0 `kP\00\0@ R R0S@LcT; 0S00S2 X0/ \PPUpP 0S  .LKpd0"0L0KM\0X0 *PP 0S  .LKǶPd0t"x0L0K4@GPXr@T@BODT 0@ A1S `P LT6 `*P@T+ BODT( 0@# 1S `K51`P     0  0`KP A"VP`@T BODT 0H HR000`Kuxܾ`K`r A;K00Q \ ` R Q X , \  \ 'DdHd4@YAAtef 0-L@P P P`00S`0`@K0h0 -@0LQ0S   `P `U 00CS0  `Kh강A 0-@L,6h00CSh0K0hl6@8e -LMP p@ K K6KXdK 0K0 R8l0h Kᆬ`P P20S @"@`T 00 00 P 00 00 @0T K BOD  `0 eP0 AT BODTqX@h10SR \!d׺MX  `Q03 ! 0b S1 q0 0b  @hQ 3 !0  b 00aR01 4 00 S&H0  0KH0 P`0K@ႡP ̽P00S D X~11h  h 彽`(KteHdM@ڕApdAPd0f*A 0-@Lt0PS00S  K0h+ -`QL@ 0aV= 00S P $PU P 0R 0 0pW `P 0T0S   pwU 00CS0 ( !KhdfDdZA -LM0rOK p`P 1 *1jKPN 101 PG 1X 8?0S5 [OK .z1PK. t0000d.d!1[S1[0S >0S  .[K\[?K.̹ !0 R100K P 0 Q` z`V Nb  0 ejK Ze/KEIeKYP=0S 0-<㔹0 P( T 08 PK\100C?o22 O~K0U0K 0匠 4$#4,8#89K00  <@P10P 1$E10?011! @<00 048  10S ! S!0… 1. [Kó0[/K01000.  30KAP Y[UV0[P09[100[UI 0R +0 +;0S S:ڲ9[S7 (; $;0R K妧C " 0"婧&(4PP! ( }K\jPU' pWP0P00b000刑Y 0K 01 0K01 p1Y0S{0S * Rt )0S) Rj `)㠸e0S S00S 90SX  .[K[?K)40 KS}00K0K0K0ܠ 0[ 030K0 [2 000K00K048 04 8 1 S0100C?o21 8@T 0 R @0[d RPџP 0S 0[0僑z X3 1SC  R@ $(  P@*70S1 1[_K. ᢲP0$'X$1PU 0SU:@PU:1!0@T H70S 1K. }P`0&!R @ A 90 00T 60S r/K.[K@Da@90 &\0[?Kη@0 0rKX2 L2 8FnC ! 0!q jKfP0000[X  X X00X0Q 0800<0<5 %0[ \0p`P |50S  .OK `0X%L00d00O?KvX`0/ So  X* 04d`` (%0  S  4 @R 0X08X 000X0080<00[ 0 RQ H2 ! #SD0CQ KP ß$"    q  S  R@  ! ~!R{ UPr oKo}K``KPpR̡a`  R3Q$R"Q !r `pK`oK!q oK``p}K`}oK* anP#*a``apnP#*b`arW3Q  ^QK`}Km`n H0SD0Cp廹UL0SI hP0X!d0 R! 0! R8  !l1 [nK`! z pP ⊘!R2 00S ` 0l `LxZ@MAA{AAPd6=Ѡ! 0!ՠ0@  Š" 0"ɠP0;S3@PP1U` 1" 0"#0 0@因% R0%埠(K4fe -LM0PS`@;0S8P60@PS P 00S, T 0p @0p00U0S   0`§P vQioᙃ 00  0 0姤$K@@8f* -LM (  &@S0 ("!("` P  0 0K00qP0K0  xP qp 00S6porDPYp 00:S00 P 0S@PU 0P00 0 3SH L0S0T 0H  0b'S00S 0(0C00(00 (T @T, 0 (0(0(0000 3v800 0 00K00K0x00 80ʬPQppW vd0 "0`0"", 0v00婮K00 00:S SPpw!p 0R3:00 0,K:i(p 0 8@P 0( y K 0 +@P 0, K0" `   00:S0S UY UA U. Uy10  rU: @Um10  fUP ʄU1? E0<XUP HUS10L  R C10  <10  510  .10  '10 0>CC0  10  1010`Pž1@@P@`幞C@PC彞T ' 0S K 7TK 0 (210#(2(KddXe4f p-L$M`1@P R8@ 7 K 00K8 K0K4  R 8K70[S/@08 K"@9@U  Kp 0-LMQ^@0 Q/P K ! ,P (K P#0S )^i^e^^kN^ \" \F  tK0  -P MLpk' 0A000 P3`aVʀ 0! `0     !0 0%@Pl@P l j0Pvp0 ㄗ s Kdeeedd8f p-L M@P` 0R0%0 * 0K  P 0Q0%0 *峮S @圝  0 堝 R  ! @`初( 0(匝0  Kp{Ae@ s`f 0-PL@@@ s20200 -1LpS` PU @1S !S T"S TxP῱ự11@T-1S \  0-0L@SP P0S000C0S@ 0 0yPP000@@P0"  /`f-$`f -0LS0S0S R 01`f -@LPTQ$ @P" 0S 00SS 000CS`P%" L  p-L4M0PS  .LKa0L Kѭ0S 00SS 000CS4  H а`P@KpșA 0-L@P P 000S00S S000CS!K00`P$01S10 CKq0,K B0C?K aqK$C_K6S:(0K 00LKKFP j K P " 5x@^0S0S0S0S90B sh0 p d06p6xP∠1 W0(0$1 0 3S H L0S0T 0H  0b0W ( S:W0(0  c0W0 ( 00000  Y 0 W ( (000(001  1S !0KRI (1W0(0W(`6X 0#401[01#40*8#<40#40  W| Wd0p 0`000""",0 E p p0h((("$Sh"00SS00S 00  0  00 0S00SS00S 08P#8(( 0  0 0 0 000("(#( 0R,B B "$ ,00a00͙$ 0$љ008 0 0}RX(0#=*p o0 08 #8,1 #$$!(01 1[ 0!<(1 (1[  0p1[ 0(1[0( Q p$1 ,1 (     `$! (", *厨`|p0Py$ 0$}`08 0 0 70xP_ v(K脥dd @Af\e-//-/-/ -L M    0  Kf -Ll -Lz菓1M/  0-@(0L((0M  \K0h0 -L MP0p(0 `@P+ h 00S(01  0 (KJ(0 Pf(P b<@# 0# Kf Q0-L@ IT E-0 -@n101㬠9 -L`p@\ Pᤡ@u -@LP0pS0S0S0S > `@WT8 -LP>!'P`@AT ,0 P 0 4ed 0-@Pp`DML!2 000p,`(P$@ @@ @E 0!42 004p0,`(P$@ @@ @E1 0 00!140'> 08p0,`(P$@@ @E1 00!140'> 008p0,`(P$@@ @E040<1 00!,1 0'>08p00,`(P$@@ @E0400 00!0 0008p00,`(P$@ @hE 0!0 0008p04P0,`(P$@ @ @REP?<0(Kotk~AZAd|A|A dzA4e$)w{AD,bBf -LM0@SpPN0SKPI0@S8PB P 10Sa<aU, 0 S' ( 0R*T,!z(40K 4 0 T 3[#[00x. P z3[#[ `0D`D  ` 0$`(K@E,*4e@ - 0L`0Pp@W W 0S  Y0S  @/@@ PP-L4M@`PH0  0S0S~l0 5/,0@ 40 P\  U\\(08pl0 7/(08Pl< 5/V }_(04`l 6/  PU,0 0,0\0\ 00-1  0,0(0, @0"M$dAw, -(0L@`P 4`l 6/  ,0 F 5    p  U 幜P , ]@[ 4  [y8el0 9/,0@ (08PZl0 5/00S$Kk&(08PIl0 $Kk/@A -(0L@ P'  P8P!4P*l 5/(0P4`"l 6/P8 0R80 < S$003/p  -,0@i!k(0L8Pk0 5/dP(04`k 6/ ` 0S㤞PU, P (08pk ;Kh/,0/0,0@hL$00/ -(@h L00PR,0Aol RQ `  0<03/00h0,0l0 -,0L@0(P  ",00 <   0 1H#HHڝ 4c  ##̝c0pz 0 #"弝pb00  0 &"嬝b00  0 &h"P圝pLb00  0 (,"匝b40 X   0 <0,0 0,0+0p!va40  0 <0,00,0 0+[!dap`a40  0<0,0 @0,00<0 00C,!Ia40  0<0,0 @0,00<0 00+ 1p`00   0 d!W ,0 05<00h PTL$KkǜDAHNA@MAJAUAaAkAyAAAAA}ADw,@A (Q-/ 0-Lj,0@@P DK K0S   0 0-P@LP 0P 0 ?>#R @00 -,0LP  (04@dj 4/(0@4`\j 6/,0A0  KT   P T    0  P@@@ 0 /@ -3L l:P 0-PlBLR000,000 0-P(@L,00(0p4`j 6/(0`4j 9/`,00,0(04i 8/  000000,0 00300 \ 000Y (04`i 6/(04`i 6/`,@ 4  (04pi 7/(0p4i 9/p 00  6    60  6 60  60@6 0 600000  <0000 000000 -LP \@ -P4@L`V (08pli0T 7/$@ -P4@L`V (08pYi0T 7/D@ -0 L@R(0 R8PCi08P>i 05/(04P6i 5/`(08P.i90 5/(04P%i 5/(0`8Pi 0Kh/ L -@(0L8P i P05/(04Pi 5/(0P8`h 90Kh/p 0-P(@L,00(0p4`h 6/(0`4h 9/`,00,0(04h 8/ 00300 H `(08ph0 7/(04`h 6/0004 (08`h 06/(04`h 6/ R00 R 0 R R0 0 00000660000 5;00@005<000 -LP`h@p  ⺚`(0 000  0d?>#20 0(p000,00<0zhP0p0 shP0q0lhp0Sq0S& x ;PBt v;P9q0S | j;P- a;Pt$,0 d1 \1R 0S ?Sq0S814101$0c(04g 8/0 0 (04Pg 5/4F,0  0,000900040940q0S x0 0  5d!X$Kk\@֜AAAAA A!A(A>AKAgArA@ @@@HNAA@ -P@@L`V (08pg0T 7/(KhW@ -@LgP 0 )S )St }0S S S tS .ShY n00Sjgd(08`lg 86/(04`dg 6/`(08p\g;8 #87/(08`Rg 06/(04`Jg 6/`(08pBg;8 #87/(08`8g 06/(04`0g 6/`(08p(g<8 #87/pW (08g0V 8/0 0CS 3,' Rp`V ,0 x0x0 fpW (08f0V 8/x0  =fpW (08f0V 8/. (08`f ;6/(08`f 0 6/x0@(08` f 66/(08`f0 f 56/(08`f; 6/x0x0 R epW (08f0V 8/ `5R 0S(08`f0 6/x0=8q0S9 5R 0S(08pvf 07/(08pnf 07/(08pff 07/(08p^f(04Yf` 9/ 07/(08pLf(04Gf` 9/ 07/x0 (08p7f(042f` 9/ 07/t0#:0SP!(08`f 06/(08pf(04f` 9/00 7/(08`f0 6/|0@ 8S (08`e 06/(08`e8 6/(08Pe0h?Sl(08`e <6/(08pe(04e` 9/00 7/x0 (08Pe 25/(08`e(0p4eP 8/ 06/(08Pe 15/(08`e(0p4eP 8/0 6/(08Pe <15/(08Pe: 5/(08Pze1 $Kk/t "88S (08Pge 05/(04P_e 5/`(08PWe< 5/,0 $Kk2@@4@l@  @ WW Pp W -@(0L8P+e9 5/4P(04`"e 6/ חPU: 0-@80L$003/,P < S`P^0PS 0\ES[RPl`Vll(08pd0 7/(04`d 6/(08`d0 6/(08Pd <5/(08Pd< 5/ 0-P(@L,00(0p4`d 6/(0`4d 9/`,00,0(04d 8/  000000,0 00300 G 000D (04`d 6/  P00!  P$  P  P$6 P  P  P666000(04`od 6/ 00< 606060000000,000 000000 0-P(@L,00(0p4`?d 6/(0`47d 9/`,00,0(04+d 8/ 00300 # 00 0 000(04`d 6/(0`4pd 7/00 660000 000000 0-P(@L,00(0p4`c 6/(0`4c 9/`,00,0(04c 8/  000000,0 00300 A 000> (08`c 06/(04`c 6/`(08pc0 7/?, R00 R 0  R  R0 000 00000,000660000 000000 -0BL@P`S񟗱ġ,П,,l, 0"S 0"S (04Pec 5/`(08P]c; 5/03 $003/00S S Sp S S p S@pz06S(0|80c 0:/(08(c 0:/(08 c 0:/  RS13" 2N(08c  0:/(08c< :/ 1R:0S70 (08pb 0 7/+0 #RQ N  080(04pb 7/(0p4b 8/8 0R80 < S)h 00R  F/ol,0"Q00S h0R0S S S00S'! -LP @ 0-P(@L,00(0p4`}b 6/(0`4ub 9/`,00,0(04ib 8/  000000,0 00300 0= 00- (04`Pb 6/(04`# Gb 6/(0`4p?b 7/00 6 60 60@6  60 0 #b 6/00@000000600 -,0@i!k(0L8P b0 5/_(04`b 6/`P   0S}㯔PU, P (08pa ;Kh/ -LP`b@pM偓   `(0 00(p00$00,00<0(04pa 7/0L000 0尓 $Kk@֜AA@HNAA@ -` BL@0R?,T,@,(, 0"S<6 0"S (04Pa 5/`(08P|a; 5/&03 (04Poa 5/P(08pgaV>0 7/  0"S p -LP @ -,0@i!k(0L8P7a0 5/}dP(04`,a 6/ ` 0SܓPU, P (08pa ;Kh/ -LP`-a@pz宒  M`(0 00(p00$00,00<0(04p` 7/0L0>00 0ݒ/ $Kk&@֜AA @HNAA@ -` 0P(@L,`00(04p` 7/(04p` 7/(0p4`` 6/,0`0,0(04` :/  000000,0 00300  00p 0 0000006 0060000 -P BL@0R-T,,ԫ,t, 0"S*$ 0"S (04P_` 5/`(08PW`; 5/03  0"S plpp -LP @ 0-P(@L,00(0p4`"` 6/(0`4` 9/`,00,0(04` 8/  000000,0 00300 0- 00) (04`_ 6/(0`4p_ 7/00P60 P P6 P P6 6600000 0-@L(08P_0 K0h/ -LP`_@p(\  `(0 00(p00$00,00<0(04p_ 7/0L000 0勑 $Kkԑ@֜AA0@HNAA@ -P BL@0R-T,,ԯ,t, 0"S*$ 0"S (04P__ 5/`(08PW_; 5/03  0"S plpp -LP <@ -LP`O_@pА  o`(0 000 k 0?>#20 0(p000$00,00<0(04p^ 7/0L0U00 0F $Kk=<@֜AA@HNAA@ 0-P(@L,00(0p4`^ 6/(0`4^ 9/`,00,0(04^ 8/  000000,0 00300 # 000 (04p^ 7/000  000000660000  000000 -P BL@0R-,,,8, 0"S*$ 0"S (04Pn^ 5/`(08Pf^; 5/03  0"S p{ -LP @ 0-P(@L,00(0p4`1^ 6/(0`4)^ 9/`,00,0(04^ 8/  000000,0 00300 0 000 (04p^ 7/00  0 0000006600 -LP` ^@pZ厏  -`(0 00(p00$00,00<0(04p] 7/0L000 0彏 $Kk@֜AA@HNAA@ -P BL@0R-ꌷ, , ,, 0"S*$ 0"S (04P] 5/`(08P]; 5/03  0"S 9p 0-@L^(08Pd]1< K0h/ -L`P|]@p壏 P(0 00(p00$00< ,0( R0,0(04p8] 7/0 0@Kh:0ᇏ~ Khu֜AKA@lAAHNA@ 0-0@0 LP#R pQT T T03 ep$((0褤A 0-LP@AP 0? 0 ]P 0>A -LMP @ 0-(@P,0 000(0L4`p\ 6/ ,0`0,0(04\ 8/  000000,0 00300 0 (04p\ 7/(0p4\ 8/00 0  000000 6600 -LP\4@`p &  Ŏ(0 0000pS00(`$00#20(0 00(p00$00,00<0(04p[ 7/0L0g00 0X $KkO@֜AAD@HNAA@ -P BL@0R-h,,,, 0"S*$ 0"S (04PZ 5/`(08PZ; 5/03 *  0"S p -L(P P@ 0-P(@L,00(0p4`Z 6/(0`4Z 9/`,00,0(04Z 8/  000000,0 00300 0 000 (04`oZ 6/00000000@6600 -LP`Z@p  ⠌`(0 00(p00,00<0 0?>@S0$00$0嗌$003/(04p0Z 7/0T0ᆌ00 8%w($KknP@֜AA@@AHNAA@ -P BL@0R-,,t,, 0"S*$ 0"S (04PY 5/`(08PY; 5/03 G  0"S p -L@ 0S ,0 (04PY 5/ P 0x(08`Y; 6/n踈 -L!P @ 0-P(@L,00(0p4`Y 6/(0`4Y 9/`,00,0(04Y 8/  000000,0 00300 0 00 (04`iY 6/00 6  60 6  60000 -LP`qY@p  ⑋`(0 00(p00$00,00<0&(04p,Y 7/0L0ႋ00 0!s $Kkj@֜AA@HNAA@ -P BL@0R-,,|,, 0"S*$ 0"S (04PX 5/`(08PX; 5/03 E  0"S p -LCP@ 0-P(@L,00(0`4pX 7/(0p4X 9/,00,0(04pX 7/  000000,0 00300000 -LP`X@p2  ъ`(0 00(p00$00<,00<0e(04pkX 7/0L000 0` $Kk詊@֜AA@HNAA@ -P BL@0R-,,, , 0"S*$ 0"S (04P4X 5/`(08P,X; 5/03  0"S pAEE/ -L MP`,X @pX T1? (03/P  0 $D 0 > 嘉`(0 000 8 0?>#20 0(p000$00< 0,0(04pW 7/0 0 (04PW 5/4T00 40 4峉$(KoȥdAA֜A@HNAA@ -P BL@0R-,L,8,, 0"S*$ 0"S (04PW 5/`(08P~W; 5/03  0"S .p 0-P4@L P@@o0 00f -@dL0S Ts`0HP `$`(`,00`,`000@@Khed,f 0-$0L@S 8g4P 0$R00 K0hKAff -@L` 0S6 pP@U  P T 0R:$ $0Rp@p@PT`@p0H0 00S 0  0 ` 0$00$0 ff 0-@LH0 000,S   0$00C$0K0hf 0-XPLP@T  0R 00 0 T 03/0f\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee 0-8@P0LP 0C  0f, -0 PL0 0@0 ` 0000@ 0@0 0 ,0 0,0@0,00000003/ 0 P 00$ /Kh+A -@pLPu 0`R00 00C 0 0p0 0 00 00S TP0p 0@@@&  0 Khff  0-LM 8 00 00  Dw 0 K2Af -`Lp0PS 孀@P D KX U yPP ̀ 0@P4 0pf 0- 0L@ @  0K0h賀f 0-< ML4@ 0 00 $ w00Kef8A -t`L@0pS yPP T@P z0@0 @P f 0- 0L@S 吅| K0hz>Af -@P`LU  0RJIP PE @ 0p P/P ///$0l1(0p10P1/ -L MT K0S 0S 0S 00K @0 4/Kf/ 0-\0P  L@R 00S 3/ 0S  K0h/0f -@4LPP0 0S+ 0Q 0000``06/#P`p0 c0 0U000P00 0X, 0-LPT0@ T   0UA -`@PLtV000000Kh -PL @`dUEP΅A0D00Dž00 0S 必Kh軅˧AAtAARA -LM`PplT0@N; rU00004PRoQ5PU 000000P0|0SX0 T0 H0R0` 5/#P  KhQK莧AAէA,,f -L`PpT0@2 R&PPU 0s 0400000 00Kht R00000  cA!AFApA -L`PpS0@居 R܃0PᢅPU 0s 嘅0400000 00Kh*0 40S | R \  R@L 04/#PP  Khc莨AAըAAf, -PL`P 0003/H3U@p 0 V @T7S$0Kh%5D@ - JJL$Fl$@`PD0DS @1S P  0 0Kh/1e ::0-#FL$4D0S( S>0P01eA=A - JJL$Ft$@p`PD0DS@1S  0P 0Kh/1e - J0JL$FP`X$ppDPN 0S08ESC SC0X? @T7 0P`|10 1萔崔P0@pᬹ0H10L1K[M0S0 p(KoBS0 p(KoF0Y X0  (Kop0p $00+ R E(r0(03/0 R ` K6/PU 0PE( 0  2/Kp -PLpLu@ U`J01SE  ku40S 00Uu`60` `000P}4P0 0 0000S  | R l  R  @0H 4/#P 0 $Kk`f0, 0-L@@L4Q T T 00 R  K0h/K0h0 -0L@SP` 0P`4 T   03/P  0R  4S000//?o2\Q00//Q1S ///40S0/ q-L@P4000T0S 0  @QqPU 40`U@ 0H 0 00 0@U@ 00 0A 0-L@K40S T   0@K0h+0 ::-#FL$P<`K0S8 9S7 0AT3 0S 0S Zpq`003/0S 03/0 R   2/80(0S 0  2/ 00 01ef 0-P000 P$P@T >P蠨d00 0S R  B /0/ᠨd 0-@L:00(0@ 0R  00蠨ddX0 0S R P  R   00/0//ᠨd8- 0000 0f -@PL`P@   0H0 00P000 0000f -LM0`P 0@5/pV] 0 CR3---|-,---0S0C0pP PE0bPPeSP1009/0PP0 P05/pp0S0C0 P 5/0 0S0:p 0 0CR 2 5: P 5/0  PA05/0 0$Kk/ P/f; S 0 0//f Q0-L@0 P05/0 00 K0h/0 -LMP@ `$ 000 0 0,00$(000$0 0(000,0400p0 $7/P 00 004`$00 0S 4 3/0 00`(0, 6/P400K<Q %Q 0Q0 .0 AQ BQ >Q0 .0/0 .00 . 1/0 .0!/5Q0 .0!// -L M3A@Qn - - - - - -`Rd0SP`a 0 U*` p0 7/PD0e` 6/0` 0d0Fd0SCpPP`EQEPv 0p 08/`FPEP0U *D0 `0 6/P0 `0d00 00CR0` 0PS 0S@ 0 p E07/PPP K \Q-L 6Q-L CQ-L$ 6Q, 4Q1 %Q0=Q( AQ 7Q(!QQ HQ KQ EQYQ ZQ RQ0 .0!     n 0-0@00L0\P 0\0`P 0`0P 00P 00P 00P 00P ۽000T K0hҽ0f0S 0S Ҡ /0Qh0:9Q;Q0h0  S 1l!0Al0 S 0$Qh0  / /tQl0S0000 / 9Q-L 0Q*$Q !0AS&Q ;Q :>0ASh0 S 0l !0Al h00h0 h00 S 0h0 T X0lQ \` 5R  R  d    BQ / d / -LM<0@@`P  d0p3 7/p 000 00V PZTPEU---------`-`-`-`-`-`-`-`-`-`-`--8I0S0C0p<00<0\ dP0 30bS0A Sh* Re031b0CaS00[00pX wv0 S 000l ?o2X0SF <0!0!S^<0p0<00 P.010S0.01.01pSQ<0 d 1`Q A02 ":/0d X0"0@000:/0 d2!cR 00X<00 B13/N<0@  d03 (Ko/(K谨d*A `00-<040@@0D00TH0$0LL0 0P0 0X0\P  0 00  00 00 ;0 R\ 0 HQ0-L@ !/Q-Q*#QG  Q0(AQ0=Qw 7Q9 8QU DQu EQq >Q<00j_Q]Q*OQPw MQw NQ0r PQ [QhP( l_;PP0oQ^ cQ nQ0Y }QS ~QN |Q0K0<0<<00000@00D00H00L00P0001010 1010001g<0 d 00000@00D00H00L00P01010 1010001<00<0F009A\ 0<0090004000T  bR` 0C0R 0S 0d00 00CR0d0A0hP( l: 0r0,A0 00 -L MT@0 080\0`0d000000Kf -LMPP`p@ E 0 0000@080 \ 0`d0     Kf Q0-L@ :Q 0K0hK0hz0 00 <@K0h/ 0-@0L 000pK0h -QL@<0Q?Q Q: 8Q Q *Q* 0!R0 ,R0!R0 ,R0!R 0 ,R 0 !R@P ,RP @PU 0 @`06/0@!R0 ,R0<0 Q Q Q/0!R0 ,R000// -XPL@Q`1`!PfU0T p07/`0S T 80Tp D07/`P T0 P9`0S  0S 0d00 00CR00d0 -XPL@Q`1`!PfU0Tp 07/`0S T L80 PTD05/`0S T m9`0S  0S 0d00 00CR00d0 -QLM@`& Q@ QKd 0D32aP2"5/ PPEPaU80 pD07/`P> 0 0' R 0PD05/`P  9D0d 0P2 5/ 0 PD05/`P  9`0S  0S 0d00 00CR00d0K -QL M Q Qd 0D32a2@"0Dd 0@2D 0 @0 4/K -L M0 @480gS :JSv BS @S ASdl T0Q0cS0c0aDS HS TPSO KS] MS3LcSk fS XSFld P12lS0!D2P"5/3(So nS lS- ]hSh`PPh0U! Ph0U, ,Ph0U, Pl7 <7 ll0S 80 gwQ\PQ S00&P8Kr8K 80  |l0d S01P`UP!0cQ2 `"6/Dd 0`2"lT X0P00a0CS00` 0R0d0h0S 0d00 00CRW\l Pd023a0CS00Jl 0R R0b0c0<00<0D<l0 S0T X BS00S0 S0!0C0`0S  0S00pd0 Qd0<23S0!0C0l T`XPR 00nS10f!0cL\X0TuT`XPld P01PcUP!`Q2 `"6/d D02!e`!16/l0S l0S\ 0 S \7 HPLPph@R10S+ S& S SP#SP SP SP%S SP#C"*SP SP(0CSPp P R40@0PP 08 K 0`` 09/P 0`` 0``   0` 00 ``0<K09/PR<0@080Jl0SK0p!0 0l0S S S><0T 00b 0 ! S S   ,  8Koq8K   8Nl0 p S0S0!R 0CR c cR X < T00000D0HPLPp$Kw$p$K?c>J?u&Al?p$?h?hAtABHNAzAAAAAAAAA 0-PL@U& U \!60  Q  /R :9R0 B##S\ 0PC0S\ 0  C p000ªA -@`PL 0!0P3/UpP407'n 0!0P3/U@ -@PL 0!0P3/UPh` 0 0P3/ UP<` 0 0P3/ UKh@@; S <30/ <8SA3=8SA@A310/>08S2AAP0<00  P2A0A`0Q @Q Q !@Q`2\Q :Q Q<2 4202,2}(2{$2y 2w QY (@QU @Q[ @QQ Q\ eQ\ QQ ^1Q= 0CQ= 0Q> S1Q1: 0Q4 KtQ2 @Q6 @Q& Q+ <<Q/ Q0 5$1Q 0CQ 0Q1m )0Q 0Q0 !0b0000000/00 0000000//0f@+A-AAAAAAAAA"A AAA'A,A1A6A;A?ACAGAKAOASAWA0@-P 0R 0R0<" b0"@0(, S00LR%B00 0-80LPS $@0,K0hl0  ho@A\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee 0-@PPL0T00  T0  K0h 0-<0L@SP@000 W<',P  00`0- 0-<0L@S <W00<0K0hO0 -L M@p0@WYP`(Lxl0 SV #>04 0P 00 }000 S`lc`cs @ ;V`<0  2000S0  0fX``V P S``0 <`(KA -@LPp!A@` 0 Rך@1 -@L`TP (0H0P00P@ 0-@LΚ40S 04080S 0K0h0 -LMP0 @R <"p0bS3:4`KpW 0< 0p0 0000 K0P Q@ Q@// 0p P/P // 0- 0LP @@ @ @  0@S l T d h 2/ 0l@0 0-@L=T000 -L=00+ -L MPK %`@h PpP 0 4 R0 W88RW0  PKRW SW -!LX`P/0@S  L00CS0l1e 0-!L0@P.LP  K0h0l1e 0-!L(@.LP K0h0l1e0 000/ -L`P9=`0r@p00p0000<0S 0XNo0S1`0 $㼲`000`딐 O h `0  @0d0 0h000000l0`0ZP m`0t0000(00,000000S 0$@hn oPP <o[nnX P pn0d \PT P@$Kknd#A4fM-+Ad>AA@QA7-@bA -LM`pP<X4@V H4V <4V 44V ,4V5 4Vk 4V 4Ve 4V 3V 0CVn 0V 3V3V: 0CV 3VQ 3V0 R 00Y d0t PT0h5/ 04x   |   0 0 000d0h`06/ t@000000000 0 0 00#t@B0000 0 00S000 }P@B }x @0000000000M@A00000/000 }PA YT XS 0z p`P  @1` zჱ500- P< S0< S'< 0S#`P``0 0,K0(P ,0 PL d0 0h8/  KW W @W@W @W W@W @W@WW WWW WWdd -LM@`pl;1 P T 0CT #0T) 0T L R$ 00080L0S ,0@! rx0L0S ,0@10@S@ 00 0@@@00CS0K}f~fvt -@P L! ,0 pKhl1e-<0(Q$P Q0/4f-4( \0^/4f0Q000/\ `P/0 !`8 00 ,  , !/deee -LMQPp@ 0q<0 0 X `VT0 6/P0T 00` Vz0 Kr0K@t5V% 0CV 0V`* \5V 0V 0CVW YWUWR ``*)` ~WC`0 0J: S=PP@9 4V $V*0CV =F Q+ &p4V0V"0c?oT$2V  0c?o $2V  $0c?oV  2o@@0 Q Q   @@a D(R D(R  T R @DH$H@@,D(oR* R >+ R, R R R T; 000 R; 00A0 T 0S c0C S@0@ 0; 0; S% 0 @0D8 T:S00@2T@ 30D8S@DH$H8T@ /T@ 00A1@H$HA$K1%#(*$' p-L M@(P/ $0S)`40 CS4 ,0 0, <@8oS: S >; S 0$K K03/$@P Q0  0 104,0PKp4fd -LP8ppUPPW@+UP` V&Vp# 0 URP0 0Dd00h3/PPPpP`U@ 8, 8 jp腬AA 0!< 0`4 0 ,   !/deee -LM`8T0@S Pp0S 0$ -LPU% ,0S" 0p0CS00 4K40 00 >P #< p00` JP 68H8j<:@*80 K4f$dAA@ -@L\0`S" 0S P|@P:d5P0SP 0U`0P0OP0O5Khd$d 0-P0L@SP  R 0|d0h0K0h/0  0-@LL@ 0 -!L`u)PP@ @T@`V T0S LpW@0`0L`p@P Lpl1e 0-!L0H)L@T  L 0l1e RL RL // Q-L i辬A -<@`P LH  `P]0(04f,B-A-pI- 0-P@LPPPU(P04f -LMp`Pn70@S 00u*0S(  `PP;PPP 4`0zU `0PtPP@P:r40k4LP 00 04` S0P U0P000  4KP 6 ugK$dʬA 0-@DPL0T ,(P P0S @00l1e 0-( L0$@T P04f 0-L@@w(P T0SL0SK0h00l1e 0-L@P6P@0 -L6000 0-L@P6P@0 <8S@ /: S/>;:S0P0S/ 00S/@ -LQ(S-S-S-S-T-<000 00000000000000008A-0S.`0 @  Pp R*"0^0@P@P0 0 0CTaaQ ! 0P@/ !`Vp`W 3#Q0C? 0 ЍDd <-00000L \ 0^@\ 0 @\ P>*lNhoVj V. Q AoP   P >  P = P Q ΁ Ƞ\ @T*\LXoU  \Qڰ  eKh" A -0L`S@P S `Y < P 0  0  0  0 0 -L,M0P ^ @T|@^p @C| T0K 1 ^ 0lChoVj V:#:PLttK T0Ka p 00W@*  Q= Q S Q0 0\ p*0C oZ: SQڰ \?e02"v@D S03eTK0| S (K :AA 0-Pd@LLT 003/X@0 -L 0-Pd@LT 003/LPX@0 0-@LL@0 -L Mp4Pd@T 0`V 0 6/PPX@U(K -T0 JJ0$ QC@L`LV@TL@脮d ʠ ʠ,$  !LP  /ᄮd ʠ ʠ,,  !LP  //ᄮd ::#$001LP /ᄮd/ -L Mpp@P ^PP`0d`h08 0pmd08@0p0l`0 KzAd -0PL `U p @P@pDc 0P (@Puc0A脮d_AAA -LMPP@5 0TPX0h0\0h0X0h0P0S00S 3/` l0S 0`l p`07/LQ 003/P 0X T0R\0\0h0\0X KW 0-TPL@P0S 00S 3/L0S 003/X \0R\0h0\0X 0T00 -L$M`P33pV 3LV G0CV 0V X3V 0V @3Vc 43V ,3V= 3V 3Vd@p`o LP Bb`qWʀ 0! `! 0   , !0 D0 0DK@0 * 0!!`q0   , !0S S {KzPu T0SqL0S0mS Qg T0ed@T_ 0 0R20PHX@ Vp 0`002X@T`CP> >P9 00080P2 ,0@! rx0L0S' ,0@10S#L0SP0S  d@T  0 0 :/PX@X T0V0l0(K~f`W|fbWvtaWdWcWdeeeW$ 0ꄮd - JJL$FPb`P@ @ @@PU T0S L0S@0P0y -QPL@P PM2 cpPd`V 00S 3/PPpX`WPX22@ /2 c腬AA 0-@LJ2TP0 PQ SS K0h00G-p hPW@bEQP @R!  1!4$@DAR! n@rA@@0SH:PUP@ X         XgPL X         @ U Z@ЍC80&0G-Al0ST0 QPP 0bNㆁ20hQ0bN0tP 0  00\ R:p^ AZ A\ \  W @^@G-TP L0   lP0c C p@ bPB P5$0 0c\^a@  p  '0@TK:PU PS `VX 0000`V0 ^ 008#80PU0 0@T$:`PV Z PPPP`VP Q PPX%XP`VPPS ```Q`ЍG-@M1. Q8 X N&B@P0@ R:pPW`@P\ pW@@0N Rx:pPW`@P\ pW@ Rd:pPW`@P\ pW@lpPg``0f`0``@ @H``PDH`P R=:p`W0`V `V `V @`V@``\ pPUpWp W 0 V pW0PU `VPU @\@ Ѝ -Pp@LM`T 09/@$K -LM`p@TPp0U p 09/P@$K -L M`l @RpP%:pQ":fQ  A8/ x  Br'p 0%\ f Br"0PQ0  R!%0 * K -L M`l @RpP!:pQ: gR  B8/ l00g0C#"0%\P 0Q00S!% * K -PLp`0cf`@C@0A!b"p0@`W  #0`@ -PLl` a bA B1!b&p@`W  j#0`@ 0-LP@I P 00000P0 -P@L#@"pT`@p Y  6#0S  $0@0p`  R($000 0// -`T0L@Pp 13/ULpP`T0 0T01Kh/0T0 -P`pLQ  0R00 㘤@P p 0000@Kh覤褮dRQ-\  D10^0\(00 0$!@ -QLMp@PU!`000 p0V`00  `P@DT P`p0UP0 P(K -LMR`p@P U00 0 P@DT00 0 $K -QLMp@PU!`000 p0V`00  `P@DT P`p0UP0 P(K -LMR`p@P U00 0 P@DT00 0 $K 0!< 0`4 0 ,   !/deee ̠ S /C-@ 0@NQDn@.00^3@@8QDP!#8`pp pBWp pppppppYppppppp\A-@0 @N\Dn  ^"@ PA``0`pcQ@ ``````p`cV*@``````\A-Q@0 @D5\@d DL 4"`pp1p p WQp ppppppXQpppppppQG-0@ 0@00pb|P PU@P P U@P Pe Y@0SЍ Pi Q@ -L M$@`Q`Uʀ0!`$0$   !@V`YPP 400$E0@04 00 $00,000T 40 mE40, @S*S S S  ,i( !p00CS\T0 X     V `Y `  d`Y` Vd` `@` 00  )ld)p)pd)l ɑhitPLx00| _!Tp 000 0h 1b 0d00c0# Q0j 0    1 01R01010101011000 0000B S~-~-~-~-~-~-~-~-~-~-~-~-~-N zpTp`.Tp '   Aτ00000000000  Aτ000000l00h00p00pTp(KdeeeA\p-@e-p-Dj-g-q-Hh-Pq-r-00 KP0 0C0員!`Q;[0(K4!@0 0RX D0D0R0/0Q  [X0Y\0Z0] /Ċ-܈-(00S   R0/df -`PL㢝V0@P0# (㙝( j0`0፝p $^0$pQ₝P`J 0`000   @@df"/ 0-P,0L@T 5/@0df@-X0P H ^ @ , Œ   dfd -LpP@@\ @@) @S P R  \ \t0 b\!d00l@l\@l@cV WQ RP!N N' -`L MpPd0@T 0 0 0VP`@U00(Kdf -P`(0L@T  5/@df p-0MPL`0PP@P ,  0< 0 0"00Kpdf -LMP(㚜@Pj Z`ኜp  dp0``axpPD 0F<0 0P0 0$ .8 0S#100 03K @`$P01L!00L00 X10CX1 H10H1 (K0 Q T0 BR##PZ/ 0-0 ML $ 00  D KeʮAxf/Hxf 0|0 8?o20/ 0-@LL4H| G|0xf -LM00 0@0R9(0E 0SB  10cK ? R5 00 R1 (,( @(@ ( ( ( ( ( ( ( @( ( S K  K![   K  K![  P 8[?08000K -@0Lv YP` 0 p  0  S0C10c<@Dd@9)P@@AIh 0@ @@@ <0  00dS$0 00o| 0-LMP@l@K KKK K 0KK0KK0 0-RLMp(0 XPx@h`(00 0S- 0(K0c ? ( R 00S=P   PPX (P LN$K 0-@LMP K0 K00( x00/0 <#<0@00( x0 0/ / -LM K K 0-LP@  0 -L@p` 0V !6DF@F0 P PL@D0&\D@ P@PI000 -LP@``` ` 000 -@PL `0 00000CP   -`0PS@0L S @ h}@ h0 Xq@Xh0$ xd$S@ h@ h0 X@Xh0 xxh000 -@LPT T T T T 0@`@` ``FOb@`@`( 008#80"$R *0( 000`ff$ $0T`0$`00hbflbfծA@ 0-@PLO K0h}A -L,M`000 0!p PP20K@ 3[S 0\0P P`P00K0 S!: R R Q\ Q\<0 2/<0P R  Z R0S) \& #KK( ?P00@0 ! @ ?R0K B@00 0P0000000P \ 3/p0S(K 0-LM@0 P0!$ 00PP0000(0$0S S (0"00 c (0 .00(0PK0@ -L MP $p0@0( 00 `00ZV*T"V/ ` ǵp@T T$ ":T+ #T T T@pf `!@ pf`@4 40@ N뼂@@"`V 0( 00$00a$0  p (0$p`0@0S000(K@hbflbf A -0L`SP U U T @ DP  ,P0 <0'A1A@R  Q 4 R  Ă\?   //d -pP`L M@Up Y.0S+ @"$2!oRQR R R@ 0S@?C 0S0Q?0?6C HpPb@PEVU .0K `[;P!TJ ;TP 0EW 0 @ R> 0@@ pV .0K `[ 0@@ d+P A0@8S 0S a0D8S @DH$H`V .0K c2[.S ;S X .0K UB[;T(KdD>@ -L M @T=0`@plP0PVO .0K 50`00W0S2[ A C(R 02K  R;ST4 0U.S@D0W2[& R# >  d R!#&-- ##? ?0,<,< 00  R##?0-<"-< 00 R 00T?0@0հ@(KP@d// -LM K K p-LM@0PS@ |`@,K N",K"K BKKp 0-P@0L00 0( ?! 0!""##$$000 -@L$MP4K rap@@ a04` P$ `(00 (0pPB $0`0 RpBp!(LF<K I"0?pP  A$L<0 000S A<R0 K[H XL0H 0P00x01|@0d0AX0S 0 0S " b80K0p?080 8  8 8P   <8 #61t00CS--м-м----00d0 00d0)JL 0 =t0S 0=P0H @RL00L00@(KxfNArAAA>@tfz@lfpf -PLK00!  !?pP1 0pT1 0P1  1R RVa `TA @0S01 T hڐh Wr/K0 Lp (0!0(0100000(0:(0,0<,0;40 0001P010p@@P0!0 @ B">K000?PpPW1 0f\p0P00ãp001 p /000 Xp 000X0p0 0S'V' 00EXp 4 @$POo B@P T/ @  p@&p@ V!(I!pppP DT ?V :Z R  q /(KedAc@AAAA -LM`RP} sRz(  Xt p t mj  0Sd 1( Kq18P\(t0S 2Up0P()L<(M00(0' 00[@P7(0 ((@P.(+0 (s@(.T (((+0( S p p0!QP@  +(0 000 (+($Kdy@ 0-LxM0Q0P K||*@Pt 0K @ #@P t3r8kK0dfAAMf -  L`PPt0S -HL {(@f00(0:(0 0-L M@ PR$K0( K $!K1/P0 (0| XUoPF0K0 p-L MPK a0 `Ps@P F`Kp 0-LMP@,P 0K0@-0 R; r8Ap`UT2bWV.0 r+HUT' r$x r!| r r rcP@WVDUT r "SR 0t0 CSR-- -LLMP0SP00p|L P00 00t0S(Q @aԑ@P L \0P R H0 0 000|P XR`K K%KP00@00 080K< K040K 0@$K8@ )P8<0 0P0@bT` @ <FT&0SV $KK uD $0@K0`cP0 0V`!L0$K P0RK}< K 0@$K(K -LM0|@(`X0SK pP v G(0K0000 00P8"($@0  ??QP $0 10R@0 Q@@p0 Bp0* KP T 0 C(@(T[  HX0@ C 0 0a00 [00a0 K[>xf -L8M`@p|P8!!""8:#:0900 000X0Hh0Xx0)(0L "LX#t0S  i\0KD0 0 @0 00 DK\ #KX 4 R0TKL P0 0H0 >P04 +b" l0|x0(00000L (t00$K -L ( -L ( -LMt0|0CSG#iSR8)PP Pr80s $ 0 P80sc(0 Ki) KA -LF*A -L M`@|P t R02& XY t8P Irpr@p0 !<0 PY K00C S!-8-8--- ---8--$-0|0(0X0S  0%  0+ 0, 0  0 // -p0@`   t0L00H& R*0X6\6S `&R \&``60C`6H& PeN` -B^ L@R -4=S< `0S !>00CSڇRyP 0S = C!P$0S c> P0\ V0  = C! c΄ B` -LTM`@0 t0pS0` @0| (P$ ?``,db `H0@S\680 <0  0#280 80< \`60X6 0`@&D6 0K@0P 80 80L0 0&KB> 0D0  0K&KK= RK 000P 0 K = @Y`P0 00Y ܆K   ? P` i Y 0P0 0 Q 0BT 0 0 S0 QB> 80< B$+4H L0 $K ? m 0 X0BS  0P2 KD20[S02 * 0C  ?o  20  20K !D -4S S ,D0.0-40020[0X0S P` P`fX0S`B.0`o R V <G`680c00<  0P e> 0X& 2`(Kh@@-P0P R0?0A@P00" 1dG@0@-PQ10SU- R@@T00S Q 0T? 300QS\06? Ã0T?0 08#800cPE b00@-A@@n@T@T\ S@L0bQ Ӂ0ѳ 0ҁQҲ0/ -LM@`0pQP0@4 KD#KSR%,[+0[{.B B2$U  d0hGV <<bR\UX0V00U0 K; -LMPP@p` 0P "  4K 0,${. #K>2,0K>;5)0K~>@2P@4K(0K+PK'@KCPd 0 K耖0@-0S00R0100 ^0S*0@PTR@?0 Q .T@0 Q R ^0N  0B@ -L M @P0A S0 00.SR0 .QR @000U0S8J \.\ B0` V.^ZSD Q` c a \^'^C ܁ p`\00R0S`1\R_000S00Q< U^\.VQ Q0 p`bX QVL`0\ L S.S 0W S0200`V QS B 4pK`U  :0f VPP 0dr Q  cfP0b~ 0 p@V0405:(KB@ -LM@P`0 Q s.R R 0E0S /K/KJK[ y0` 00pp 0?KP `a     Y@PP$K -L"M@P 0@pPS ` 0?@@DW /K/K`KV0@ `d V mK   ~ z@W?K@$ pD@0P X0S YT0Q\  01PpW Q\00\00000#S$KB@ -LHMP ?00CS`pz 0@P00Sh@K    00 R/R SYL`K 0 5  'XQ: QP6R0-Q P.R& !3?=#=0P!R4 !6==0!3?0?<<0&R0S @Q0\ c@f X0 ( "(R !  d3 0$K0 P 3 00/ -L`0Sq.\ \ R  0  /000S/| 00/0M000Ѝ/ 0S0S0`/ p-@|P|`|0ML 00 @`@x3P0 00 @`@3( Kph茐xfeEAOAE@/ 0- @L77K0h~xf -LM Q|L  KE K -@L$M`0K 00PS rL S,x5@x  !008P 0,0$0$00040X 0L00s0X02P L0X0 \0!0M $55%5F<0K0$ 80K ~ pP 6i0>00e 0 0y \ 0M1 Ki KzA -L,Mp0@8P 40 `L0 0s <$ ?0 L$K(1\0V {ppVpG0dp3wG 0$KX0X`40 080  80K Pch 0 Y# l d8T0b@ BV00K000p0 0$0PF00p 0 hE 0  w p0  hH0<000Y0\` 00000$K 0FK8 r 0040KPd0`F6c80h`l04Q 00#0 (K蓰A -@L|Pd!P 00`+5喎|`֎4xf p-@LM( `$ 傎(KPP⾎(3Pu(0 0$00 001 0!00姎Kpxfhf -LM X  V KH[@P4咎$>勎4KhfXfhf -0L`|@@ RP 4 R`0(  \PU 0P0$ @0 8Po@0 0C?o20 -LM L@   K8P$EF00?KhfXf 0p-LMP( p$0 0 (K` @T 0U  8`( B4@KphfXfhf -`|@xLp) D2H ` \ !PW!!X0U x x 0 pf-   1 `00C`0`0  0`0 1 / -LM K7 K0M000Ѝ/0@-`x@TPPtPU \ PT^\  0 -L4MpSQ00`R00XS4 S8@&X0S@0 (L00! d0\ RW l 0bP 23Y l 0bL 3 0 W00Q \0d Cp0X0W 0Qp0D K00D0 @0KD 0bS<0 0Q000h00000 PH0 D @0XU PkS\ S4Pp mP 80K000K< K<H0 S 4P l <0 B"40K000000$0XPM<800@P4S:PC @0q'00@ S@!@ @H 0@0 D00D0 0#0 4P |Y@ d0l A`T0 0 D0W`0di4W P dD0lP0Ch0(Kpf0 `\!'0S/ -L$M@PP`A `0S 0 03\0 S ~ !o0a00000K00l 02 B"0$0P000p`0$K00! z0$K 0!{0 0p 0#*D0l `$0 B"00$$ 0 0000 0P  PP<p.0W P < KF@԰AA -L,MRpP`@w\0Rt< 40K08 K00Kl 80$ B",0K0000000MP[ 0, s040$- <1R00S < 0!S s *BS+,0040,0J 0 40$ K ,0CK$0 40@,0B040,0@04$K@! "8 ,0,0 0t0,P E K -LM`p@0 0 0KhPP T 00K@-@0 aoac cR\ P0#03Q0#S\ 0l olQ1! -@PL4M`H0 Q pbU{\ 0H0Sv`pءVf _ <0K0@ K80K#l @0$ B"40K0008000pPXH0`Vp Q<  q# <Q340J  : # 40 0<0KR <004)ᲔK0<0040 0)0K04 0#<0 00 R<00<0 80< R*V@ 4'0t00S0P0S(K -L,MpQP` 8R 000l<K4pGu\0 9D0 ? 0@@0 0H D T !@p  @OoBd@ L0 VL0 X1@@ 5@@ @@0!0 00. !@p  @OoBd@ D0 VD0X1@@ 5@H T:@ @X 0Z0 0@ (KmNA 0-@PpL(M00 Uh\0UeU(0K0$0K, K,`W 0Q  ol ,0$ B"00K000$000]PJ,`/0!S s% *BS1000(0700 00( : 03K#40P000(0#P00K0 (0000(0 P00K 020!(0?0pP0Q , K 0-@L$M00 \ S 5702:0``0\00PV=x=UQp 0s000U 2P(0K, KP~l ,0P B"00K0(0$00P 00L S `U  K -LMpX @R`L0|1  h8Phhq Rh00Kp0l0t0-l  l 40K P_X0 Sl0040 440KePQ4 00X `cX0SX 0 B0h040 0 Bl V8 0l P 4e+h00L0 00 CS0 4 lT040 d0 B$0l3 L"p000$ 0W -p(KpfM!Ѝ/ -LtM0 @p`0 0H0 |Pl ` 80 P9x0 `0(0 00CS``0`0000 _P `00St~L0 0 .R  R R0.SP0PP b0 8K ?P P P0p0 S  >0  60p0 0xPl00 C/oQ" R0 00X0 0d0 t0 h0 80K0| 0 d0d 0 \0StL0K0D KP0Kt `P Vhl K BNH0K0L0` 0$0xP`00d0 L0VKH00 \ QQX0 S0X0 d0h0 Q8@ S0X0 \0 0S 0- 00\ 0 P$!\U d0,0l0SU0I0009p0S  \8KP\0 PP P `Hst00t0 |0S3 40S0  PX0Sd0h0 0X0 X0 Sh  0c2h0 h0,00I00\\0 0RK\0 QKU[q \RK\QK[XLUz R UPP `PbP dR`HX0 'X0 Url LPRx R: vZ  lX0 X@PQX X0Pe_oSRPU" l`0pCl  Q R ` ( v8  X0 6P9X X0Pe_oSRPU/`0 P)X SPe_oRPU ;`0p`0 PpP0`00   SP P (K -LTM8P0`(,0\pSX :p 000ad3000 H @P 0 \h9d0\ H3\0,d@0K00H0K4 KAP*K,0P0 H0Sh0P  P l BD0K000@0 0$0@PhD P0@ 00  /H00I0 0J0 0L0 0M0 0L0,K \@ @! 800s@0 T0 00SM Q 0\ `0 0,d0 00 H0h0 h  0Z=*h (T0DS @P[d@0K04 K08@PQKl B~D0K000@0 0$0@PAhD  00 I80 0d` 00\0 H0 0P T0DS @P X0SX| L0 X0rH0 L S0H0 H0S20P0 <0KP H^P0<0X |00_d,p@K04 K7kPSKl  B D0K0@0 0$0JPCh0P  D00000  P P pG Z.h&T0DS 7sP'd04 K76PKl BD0K0@0 0$0Ph0 D0000 0CT0DS I(K -L$M`8p<0K04 K0@PDo8l K B80K0<0@ 0$0P(8<0P U*Q @Q " \<P H6P   P `(K AA -LM@L0P,@ e L0b X0X S@^ S@[ 8` rL ST L0P lX d0T B0`3 @",0K000p00$0@P=,00p+07  P1:0(0K;0'0K0帒[s4 ( K5 ' K"[X Y Y sL0Y P,(0K ,P C@P ( @P ((0|P@@,P T ;5U $KA"A -LMQ`p@Ppd0l P1b\Lh56300TAb B p0$PUh0 `00``$K -LM 0$ 8 K -L0>00S H00o$r #K0P0 H0P  000800`P-T0S 0S&400 #88D0 B8@0 0(C8L H0 K$KSR |pp  0P #K 0P `\ 0V80  |cKP0` pK 0`0000ZXV80V - 0<  a R0  R1 (Ko(KvAM!Ѝ/ -0 L|pt0@S|`P EPW -PL|`|@V P  p@P 00 -&0@ B@ -LlM0` `p ` d0 ` Rp S `R @S@p d0VZgdP c  `0u@P`|PL@@ 0S 00.S |0S 0 p00 0 @000l0 l@ |0h0 d0`S|00 h0,0t0 h000|0 p0  @` || l0XX Q00Sx0 0 T9S d0d0 "h@P0p dKs@P"|0h0 d0S' |0S$ L  0 LP l0S0  hW@P ,d)0 dHdd@ l R @\ Kp|@PV040 00[ 0 `K/@P O `0S l0S Pl7 `|0U l0So|@,00  PK \K h0t h, |0h 000p0 x0Pp0  PK ` p0@40 0400,0P]0 `l0S8 $@0K,K( )D $ 40K ( t d 00@ hP `  @W t0`40 80Sh0t 040 D K 080D K` 040$00(0 00 0x0S2 XP$C+l dT0@b B@80K000p0 0$0iP `  @80h 00: 4rh0  8噹P ` @` 7` dP 000`(B@@(KAA p-L M@0|P0t00CS*)QP`808`d l0 c0 0#`P 0#QP$ 00080l B#SR Kphe ៸Kp۱A -L M0X|@$0 X)0< #   0 "$0))KA3A@0|0\ <3 -LM`|t R02& `0(0"L08p@0 @R00 @m<t\ I022P 0 0 g<$Km00C SE.E.E.E.E.E.E.E.E.E.E. 0`  0+ 0  0 // -LlM0|0\0 L0 00 0Sp0  $K0 0\08Pp0!0o0@Sl0 X0  0#2l0 o0X 22h0 \0X0S rL S 0P0 $K@R00P0 @0T0 $K&KL0r0P0 Wʄ0s 0Ll0d P cT0h,<, 0W 000 0,, Ⱪ000S: $K`P 0$KX0S KX 0P  P Pl RX0 pT0Kd P[T L00bh 0t0 t p00bS0!0 \0\pT0pL0pcW@0K04 K<0K\`PKl By80K0@0` 0$0᣺`P8 @00aS00pt pS  t 8t 000W:޶`VQm Q 0S0 00 D0K]p4[0z w. 0B0K0A0K0[s 0x B0K0A0K4[8|0 'K0 0Ll0d P cT0h <, 00 0 0 H0K/0 "2- 0 0X  ] 00 04K00S*8h/ P$K 0&KX0S KX 0P  P Pl R8L`X0 $K 0 p$K[$K&K@0T0 $K&K@0T0 `&K 0 T0p 0b0\0\$K R? Q0R0 0 0S VP   03n0 0 0,n(K@@ -LMP@`0@p0 R@,K,@K0V 0T0TL0 0L0800"0 WT,K,@Kp0R 0<0 VT`,K,`KM00P N0*000K p-LM0P|@X0S, \0R#6* `x K'0K@ P*00< 8  0!0H0K!'K00 80\0 00 0 80K 000 0 KK@P 0 Kp 0-LM@|Pv0S 0 80 000 XvK0 -LM0@|P8`rr0 000 =!!L0d Tl0 XP 0 P c '1# PL 0 P c '1#$ 0"L0t 1 !Hp P00000 00X0000(0#"p 0 8080  0M  00|0L0 8|00x80p000h0\   0(0t00$Km -LM``0p(PP|@Y0 80 000L 00L0G40SD, K0KVPP> @,m,H00@I00@J00@L00@M00@,,,,,L0,p$K\P P!B800sP0 YPP K -LM p`P@P 0 0  |0 KP00"D01200)0 qP @Kvdd -LM0p|PX0S, \0R#*8@ 0(0K Px K0l@ 0 吠 0K00 ld0 T0` B3 @"p00$?`p 0m@ 000[M[J[GW [ [B[?[< XrL Q:!1[0.[.+W [2- [&[8#[6 40r[@ ^ꚴ`P0K@ `P0X0K0H` L0 !(K0 KK0 0`P% 0  D(K0F@`8 8#4`#/ 0-@LP(0S00S㰃P  0S0S0 -L C QP\@ i0#0 0Ps  0P d3U`# H0<000 0 qpPm P 0@0 K! 0 |a ?0. wq|0 lKK0"0K#K P 00d" 00X"0 $KK 0 p0SH $K"p$00$0!#KK808  0QP!1LPQP% WPPU~pP:~#P0PPx 0 EU !KQP 0!q# 0 0  Y3 @0SPPp0S I2qW#D0 9 pPp|p@ lP?d`ԃK   0 z(Kd 0T pR00S ! r0PP0 &\0S.8#10#W00S Vk0S!0Bqґ‘V VkT0S 8kL0KZ   >P<T0S' V%K8klPkk0P   ! 0P0  ?&K %K&K %K) 8V08\k0S!0BqґB‘(K1fHao/ -@LMP`K  K0 0PKᙋ@P &p0@ K4/@P9[V@009K K0d4/@P PV @0@ 080%7K蛲AeiAiײA$dA$|. -p 0LPMP0hK`P@P t,@@ dK8 dK0W30K4@K0p VS0K0D0K0C0Kl0T@K@` @P 0d KTh4/@P @P808 000֬h$KAei@A$d2A`}. 0-@@LPLP-010輆f9A -PLM@ `K K50 K0@P h `P`0p K7/PH D` P0 K5/P $喋KSAe~ioAiA 0-p MLP0Kᵊ@P !` K K0 KK`0KLK@ @ `Kp OD0 K8@04/@P  X K裳AieóA  0-LM!K000K00  z K   -LM 0K # 0  0 g K 0-LM0K00K00 !4KKH K -@`PLLMd ` P@ @TcUPڐc`0S xP0T M  `03/P F 0qd  7/P B7 pT PP cwPp TP ^wTp 8<0 X0K04Xp pT0KL KPK:/#PXPTK03/P0ST0 0T;w 0SP0 00P0 7PP .w< (KٳAA n|. 0-@PL K0h`8 8#4`#/ -@P@D0@@Lp1젟0@Q04``&c` 000 bI?7l0 <0 ,0K<#0p0K040KL K8/pP at#0J?oU20S 0 #Z Z0Sp0Sh0PZZ l0< 0bl0 l''1l0 S<0   N. &0E zE $t0 Z0  0 0N> 0PP H+,pW @, 1T6倀Kl0 <0 ,0K< # 40KL K:/#P  P#P l0< Z0bl0 0SZ s00 @!f1z0C1+]fT 1 Tt #T 800, 4P s0 |0 0x S0x0  t K xK |KPt 40Q $(10(1sn@xet4pW} 0S0X p0 0|00x00T40S= , 4@ğ80P# @0! PD0TT0C1001008ࣟ0h000l000D  T $ ( J 0 00t3 0x30S0C<ౣ<\#00lh0X4 P:ll0 00 0h0 qq800#0 00 0S0@0 g/& 0\囫F@#V@!0  qB0Ԃ`` R00 l00<S<00 @@4C0  0 A`000 0q0 S089980 `000 0pq+@@%iq8dq/0@0 @ ,0K< #00K 4:/P#P00p  0P< R l0R  b N   S (K`8 8#4`#/ -LDM`X0 P`000<40 ' 5 H$(`ş !::00D00 0 H#KL0 P$KH %4X4 H 0 40 8#Kp ? <0 $K00Xs0H0 *|p":t T0 RXtD40d0 X8b 0HS40 0d0?#K'x {L x-P SRX@ 0P R 0L R 0T R%KSR`0H R 0-T000#K$$K%H0 `00&0Pp0`0X ?! X X<;00 840S`0D.040S3 (L0 0P0 0  0   0 48 0 <@|@&L0 0P0 0 (,0p40@0 ?@0|0@x 0)"`ASR:SR 3#,!0SX0ʌ$b0 00 !x0Z &  8   (088 Hp(KZ@4Z@z@\)f`)fHd 0-LM@ P`0 0  K0bT D P0 dK0 0-LM|P@8  :8a0 00 o!K0hK0 -SL4M`p@q XP1\ #K$SR P0S  P0 t0Rx!@@SЀ QP`0S00X000S(1@ `0T& 8 za18  410cS0`00N 0P00H0 00000`00X01814011 4 10c\ S@Ja1 `<N 181a(KHdAAQAeA -L@MP` pX WL K 0R_ 0 00bM@_T 0 000꜀嬐 0R@Tx0  0S$ $  $0 r_00$_00C0@ _$KfddA.$dA -L KhM_f -@PpxL⌠1 :10X!0 Y4 `P 1:?;1V>000 0`0吐0ס1 0 0 04 ` :1P`V U 0 000 0001 ;;1;;1⦡$dAA -L$M@`LK pP3 ?ༀX  Z0 ?R0 5 0R00 000帀U 0;000<@K0TK"RQP(04 R 0(0L0 0D00(KHd -L,M@0 0P`<KH D 0 T00hv S 0D0  @ K DK HKy @P@r< K414 bP`KPcʴ!0 S008;@@0S   0 0R00 p$1 , ,0K 0040050000@@?0S0 ?0 ?@?    SD DKHK @P k@H0 0D0 0(KHdd 0-QL@PP @Q 090 00]#D R0"0@@^0D# R0"00 0-@LP]0S 6K0h] -LM1࡟刁]0ASiQ@TS KPK 00 0]0 cKx"K>*KWV  !3 !KQP0| R 0K"KQP(0l R  t0K00 R 000H] 040 0"@0SX0@}]KL0< !/ "00"l](Kdfd$d -@PPL]0T00  T0  Q] ]0`@T" 0U4P 0 xw"0S0C04n"0T D0 T0 @@Kh#]fd Q0-L@ @Q<  0@9 0$0@0$00PP\$@ ]$0$$@0 0-$@L \K0h'"fA 0-\@L0S \00o"0"0S\\ K0h "ff -LM1Q0S S-l1h1H0 KTaT"K6q\ R  100 12JPP \4`V 0T) `)@H0P0@ `|0K l0K0400!0P0;\00pP@x\L!,t\000 KdU@U@fA.dAfP0// 0-L@QPP0|0S L0 D U P6#$K0h꼵AU@ -LP`p@[T㐛@!\0 $Kk 0-@P0ML 00x @P@h0 00X @P@0@0@04 44P ( K0eеAfڵA f.A fA 0- @LK0hMf -LP`? @@V0T0zT0px00tp|@0 d0T$ 0h-h d`dX\P101, 0&VT 0 fd)f fdV@ 0-LMP0K P @P0|00 YK0 -LM`pt0|@SP PPPU 00|0 1_8 6008o<08t0S(0S  U 0 #Kdf 0-PL|@t0S (0S y 0 (%@QT\XTP P t0S8ZnB|0'f ff`8 8#4`#/ 0-@PLZ0U K0h 0Z -,PL@U 0,0,|1  Z`p1Sm k z ZKh{ p-LM`\P40S|1U 0@ 6h@S ,`V@0 080@0 0*hH 000! 1S00 00A4/@P@1U 7T1S 0 T 0 0N> 0  0@ (T @0 07T1S  L  DR23200#0   (TKpdAA -L$MPp` d4P@0U;c$0 00  \P/$IV   Q d$Q  T$P   B ,$ $  $  P@  #  <K/Z @ @ R @ R  P  HFQ9d.p...\.0  #RHL RT a`  ` , aR  R c0P0 4  $ PV   #RHL RT a`  ` , aR  R c0P0 V  ` P[ *o PMX @ @0@0P2O `!101JP! # <  0 3SHL0ST0  b`00a0 < 0b S00S {c P  4    D @ H #D@ P<X00PX00P(Kpftf'f'f'f'f'f(f'f 0-<@LP " 0"0K0hb0 f(f 0-@ML HX. dƺ \P\00P0g D00(0` ,00p0YK0 f.BA'A3A 0-<@LNHXPW(UpK0hQ f0/ f 0-$PLH@vX00K0hX f -QLM 000 3 Kl90P KA -LA(f -LMP`AH @k1q崡K80 !P pP[ 00 80Ѐ#K X0ʹ@ʴP 00  呙a`qWʀ 0! `! 0     !ȀV0S  U (@- 0%W 0!` `q0T P   !@(KPd$d(f@dLAdeee f f -`@PD0@PLp1&c0`PV1  z0+ 0S *%P%4 +P  P!<,!P V  ,#P PP`#P0V PV$d 0-@LoV1  <1K0hVSA -@Lp@DT000  0Pd@@pp@U8ZU@@Y0H0`0000W@00p   00 0000C00 0 `UpppU`E! 00Pfpp`p@0 00(KM0 0SЍ/ 0- |@Lh0@P\0O(0S (PPH0,0\00 OU 00 K0h0'f'f 0-|PL @\0OP0SP@@\0OT K0h0 X0-QL`@ \0O(PPE(P\0OU0Khq'f -`pL0C |P(@TA Y "?X>Z <0Z0 @dDA@\0SOY @T 0S , 0$0,@\0  ,(~{ 0 u$0# 0 n0(,0i0$f4 c88`<@]@HZDPWHXTL`QP1$L 1R01C(@0=0S00 504 / ,$ )(8&,@p Ȫ0H4Pp 㾪8X<`p 㴪 @V@y@ -LP@Q`p 0d)  3SHL0ST0a`00`0<0aS00S CW0@ 0000h00+ 3SHL0ST0a`00`0<0aWS00S W0@ 00XX00d00@'f -L M` pQ@P0  弁)  QHLQT``l `QQ V @  h00: QHLQTa`l `QQ V @  d00,:(7H4 P1X.`+0 0@p(Ko'f P-L P  0S00co0S0 o p-L MP@`8x$K KP"8$/$K191LxKp.@-|0< b a<  AV añBT ñ<  < 0@-P|0@< R "R0000@-P|0@< R #R000@-p|0`<  a< BT ñV añ@-|< BTaPV P`Vp@PPT"@-p|0`<  b< BV bñCT ñ@-|< CTbPV P`Vp@PPT#P0 H R L01H0 P P// /`Q П/V@ 0-0@Lt0S;t:P K0h'f(f -LMP008 < 00 U00`(0fS40 T40S0 0 b000000p 3SHL0S T0`0g0<0gS00S@  U0@p0 00 <0 @<tp   0X Xx   #RHL R T a`  ` , a R TU0@0p 8  pp Z8 VEQPE QZ 81 H [ / Q3HLQ/T` alqp& #R7HL R3T @` d@@d@ T @!   0 0 d@ 0Y  Qp nTfYp#Sp  L @b@00PeU  R PP  #RHL RT a`  ` , aR  R 0T0@00 pS0  00f # YN0 #RHL RT ` b`rP0,0RPSfYPRP0p 3SH L0S T0@` 0d@@d@0 L0@c@ T @!  0p d00000@ 0 000bS W 0004 000(00 00@(K'fV@A -@L M3 0K#0 QV00K`8 8#4`#/-// -LM`p0PK` 0@0 嵿0KT0 0P@ 0 0 000 0P?o2P0S3$Kd p-L M|P@`80S@@T0  K @ 2Kᆿ(T₿Kp -wL@ H181I(` PP9W0SxP9 (PP n'1p 01PP 0  `['<JVtHqz {W ~H181H$dA -0L`(@ PP@ ~ -LM(K@t`p p(墢PP P d H/o``" P@f(o$Kp/ l0-SL $0Re j@ p-LM0PS" C  0C?S R000K`P0\@@K 5@P #`Kp -L/ 0 0404/fT)f -L:0 Kh -PL T08D 00 000bS0D0  @ K  8K@P@  xP 0 08K0K@P <GSPU <0S 0S <9SZ8 DZ0 00hU8 D0 00hS Z0400D0 Z4  @K8KoPP@00|0x R 0<Z0i 0& #@P 0 pb/? 04;$0   0 /? 04;T0 4P0 %K! EK0 /? 0+4@TPR 0B" @P 0  $ 0  0$  0$##$0`|0 ၪ<~RP<3S4 aUW.L0S0T0a`0 0b0S "OW400004 H0 4H 0P000H0 w0Gq qG1(TWT HK4K3PP X(Kd(fAA -p#@`LPP|||ßʀ`0!``a `0```) ! 00cS0000`V700 `0#g<`oက0 !`!0    !0 ,Yڌ22 ݡX@<0P@@0 00SdSd0D0  : 0S:8 R/ R,|| | R`| S|0| R(|   $ R/ R,xx x R`x Sx0x R(x  ( R /  R,  R* x S00  40S$00  80 S00  @0 CRt000 S0400S00  `4 , R``V E00STP  KP 8*0 (deee(f$d?A[A -L4M3p0`S (PX /QP i0P00@Q10o [C00q?z?H0 ҟ `0 0 SP>C22 0D0:|0x000$000 0@t0@0 0 00Po< 0 00040|0x S0 c0?o0c00 04000S :D000 @0KPM  PF@0 \`9"p)0  t0S         0  9(`t0S0t0L00L00 <K`p0p < KWoB'%q#z! [P P(KdbAiApAwA(f$dd~A -L$M@Rp 0GS(`/ V Q <0 ^P00 ~0P000 040PP000|0 0x0$00(0@0,0D000$0400TP #\D00D0 D <0KUU@,   8PPP #RH LQiT``la, aU #RHL0ST0  b`00a0 < 0bS00S 8K,0000, <0 , <0 00 T 0<0 a0040K0 08K0PK0|1 P1 P RA0$Kp 00@P(0t0S00  R,0 4BN9U.L0S0T0a`0 0b0S JU,0000, <0 ,< 0000<0 0EQ QE1(T UT <K,KPP N$K(fdA 0-@LPB@0S 9K0h{@ -LtMp`0 `*0|`P@|0| 0|0D  00x0 x h0KTP jY@X  8  #R>HL RTP ` bPPeP, aX,0 3SHL0ST0  b`00a0 < 0bS00S MJX0000X h0 X h0 00T 0 h0 vX0 3SHL0ST0  b`00a0,000cS00S JX0000X h0 X h0 00 0h0 |0TDW@JM`?P}x0X0  #R<H LQTa`l,000cX)X(LQ0T0` a0c0S Xh0t0 000t00h0 t0H HPt0 01T0K0`0K00dK\pK0 p0 zPPY |0\d <0 000bS0d0 @P\d |`000bSl K  .0Pt0 l  ``LtP| T808|0|0V|0_X3L0S0T0  b`00a0S cIXX=X0000X h0 Xh0t0 000t00h0 t0H HPet001(T{XT hKXKoPP|X 8PPP   bU8T hKXKYPP eL l K  `Pl v `YLP@`Q HLQ T`anUUHL0S00T c`00b0SXh0t0 000t00h0 t0EQ QE|0t001|0(THUoX0000X h0 HXbX0000X h0 X0 hKXKPP Q0 0<K>`P<0|0  0d0  X2 0Rx  ?\ d0 00iS0d0  l K  (0Pt0 l0 #K 4 0 $K'K'KD QP tQ SR@00l?o2x0 0x0 \d P 000bS0d0  l K  0Pt0 l [`P% 0 0PK0Pt0 PY|p0SX0%(?o< K2LKP x0SX08pX0 @ ``ZKT 00U0SP(K(fA'f -LdM``0Z 0`` P\ ើU$H&t00t0 |h0K    U@T  8    QRHLQe`T`f` `f`] `R@ QHL0ST0  b`00a0 < 0bS00S GT0000T h0 T h0 00 T 0h0 ϳ0SJP?`T    PHLPT ``n lR hKTK`P Jh0`h p0 yp0B! !B01 ፳`0K0d0K 0X0K0\0K00 041 `P aU Xd |@000bS0d0  l K dK XKPl b3 0R@p@ 8Xd 000bS0d0  l K dK XKPl E$K 4 K( SR00p0 t0D S #YX@@ `oᩒ@Xd Pp 000bS0d0  l K dK XKuPl  PP$ 0d K0XKPK[P \J`PpT|p0SX0%(?o< K2LKPYX08X0\IP| U808|0 0 ᶃ C`VP<RThp 0`000h0 0p B! !B1(TRT hKTK`P L0S0T0a`00`0Sp TFp R4-T0000T h0 (K(fd'fA -LMt0S00 K p-L MP@t0S |`P u 0 hKp 0-@D0L ;00CS0K0h;4f 0-@0L|8(<6#0 001K0h/{@f 0-@0L|8<7 0 001K0h/|@f 0-@0L|8(<60 001K0h/{@|f 0-@0L|8<70 001K0h/|@|f -LM`p Pm@P  0  zh010000 @P0 ᥂Kd -LMPt0Sr@{{Xk `0 0`0000 00P R  )"40 0 10 40 Q pp AY 0000S 0  0 /\Q V*^  ؀L@ `Q f  f  ` (K(f[>A 0-@H0D L0S0K0h9P0A -LP0PE_oSRPU@|0 0 000 {Pb  PP P 00 KPP K|#QP@0| R U ᑷ00 0 ~ 0@ 1UP8 0 $᡼Y ᛼Z n KP |0'KSRT+000 0}b00;  L  L <$ H 0 0K t0`S  8  P Q9HLQT a`nlU&0 3SHL0ST0  b`00a0 < 0bS00S T@0000 0 0 00 00 0T|YC?P80  #RH LQTa`l,000cZZLQ0T0` a0c0 S   0P 00 00 $0J J 1 90K0ؐK0K 00 0@81PP0S ` P0 0 0e S  0 0C?oR20S0(F VB 000K `PPa0\`0S+ ` 000bS K  SPP  BU0S  /VP0 00C?oR20U00S `0(0PP TPBU3HL0S0T0a`00`0S o?U(I0000 0 00000 00 0t0E! !B10(T UT KK|PP Z/ 0 KKrPP; !QH @ 000bS 00 CP)hB K  `P  \BPU`h V Vᳵj῵g?Z0000 0 0 0 K`P@  000bS00  K  PP 0@?S`BHPK oPPP 00  P 0 0 KPPP` @ 000bS00  K  GPP P 0 0 K-PP@ 0,K` 0 "PP` V  T PAH0: 000K `P(=U00K `PP A^0\`0SF ` 000bS00  K  PP _P 0 0 KPP`@ 000bS00  K  PP s<P 0 0 KPP@ e,K` 0 0 PP`[0 ?o2R0S  `@A`tZ T C  KPP ᠴ (K(fdA p-L,MP |@`,0K (0K 0 0K0$0K0 `0@P A$AKp -LlM|0 `0x /0|`H0@0H0 <D h0K ZX   8ppp #RH LQaTa`lY, aW #RHL0ST0  b`00a0 < 0bS00S d=X0000X h0 X h0 00T 0 h0 卩X0 3SHL0ST0  b`00a0,000cS00S 3=X0000X h0 X hP0 00 0h0 pH=00 t 8=R014 p=00 ,p<00 $(! 8@p <HPp 2 00`0K0x0dpK\`K0 p`|0  PP QZ \d |000bS0d0  T K  jPT g; 0R t <\ d0 00hS0d0  T K  MPTJ0 #K 4 0 $K'K'KD QPt tQ SR@loᨂ\d P@ 000bS0d0  T K  PT  P3 0 00PKP `? P|P@Y|@t0SX0%( 0< KLKPXX08@X0 0,K@  0 0@P `y?PU`u?RW3L0S0T0a`0 0b0S <W8 X0000X h0 Xh0t0 000t00h0 t0Gq qGP t001(T6WT hKXK*PP0XsX03   #RHL RT `0 `0c0,000cS00S ;X0000X h0 Xhp0000h0 700.  #RHL RT `0 `0c0,000cS00S ;X0000X h0 Xh 0000h0 00 0sX0 2  #RHL RT `0 `0c0,000cS00S g;X0000X h0 Xhp0000h0 (600 p- #RHL RT `0 `0c0,000cS00S 4;X0000X h0 Xh 0000h0 000sX0 2  #RHL RT `0 `0c0,000cS00S ;X0000X h0 Xhp0000h0 400 - #RHL RT `0 `0c0,000cS00S :X0000X h0 Xh 0000h0 00"SX0R 5  #RHL RT `0 `0c0,000c S00S :X0000X h0 Xhp0 00 0h0 200,(- #RHL RT `0 `0c0,000cS00S b:X0000X h0 Xh 0000h0 00#SRXh SR04  3SHL0ST0  b`00a00,00c S00S ':X0000X h0 Xhp0 00 0h0 4081@.c 3SHL0ST0  b`00a00,00cS00S 9X0000X h0 Xh 0000h0 440 3SHL0ST0  b`00a0 (f'fy@'fA'fHd0,00cS00S 9X0000X h0 Xh 0000h0 00$SRXh SR04  3SHL0ST0  b`00a00,00c S00S 9X0000X h0 Xhp0 00 0h0 40HP\ 3SHL0ST0  b`00a00,00cS00S L9X0000X h0 Xh 0000h0 4-0 3SHL0ST0  b`00a00,00cS00S 9X0000X h0 Xh 0000h0 00X0 3SHL0ST0  b`00a0,000cS00S 8X0000X h0 Xh 0000h0 00(K -L M@|0s- P|0s 0 QP$SR0s `0(0"p`SR|J `ASRzt R02pQP #SR0|s0s_ 0".(W""a!"081 1;P  0 ;X""QP #SR0s`p tQ0 1Px0 10 QP X X0 ba0s(Kd -LDM`0T $0|`P pT0|0T0 D H0KWP4   8@@@ #RH LQT``l, aT #RHL0ST0  b`00a0 < 0bS00S 7400004 H0 4 H0 00 T 0H0 00<0K0T0DK8K02 1 |@Ps WAP 8D 0 000bS0D0  @ K  <PP@  P 0 0 0K"PP <:@T%8D 000bS0D0  @ K  @P@  P<:?@fP@ 0P @P<:ZT8D 000bS0D0  @ K  @P@ _ P<:H@;WT.L0S0T0a`0 0b0S )7T400004 H0 4H 0000H0 00DA AD1(TFTT HK4K:@P> (K(fdA -LTM`0`T   ?P ASR0P0|pZP0,0d0 0P\0 X0 VN<68&X00X0x0d V0`0 H0KZ@4  8  #RhHL R 3T b`  ` +, aYU0 3SHL0ST0  b`00a0 < 0bS00S 6400004 H0 4 H0 00 T 0H0 峢40 3SHL0ST0  b`00a0,000c S00S Y6400004 H0 4H Z0 00 0H0 T0 bT0^`[W`T00D0K 08K<0K00 031PP QZG P08D 00 000bS0D0  @ K DK 8K@P(@ $P 0D K08K00K@P00P0 U <<9k8D 000bS0D0  @ K DK 8K@P <%9PS@ X P0,KD K0 0 0 0e@P00P0 8D 000bS0D0  @ K DK 8K\@P@ x0@P<8HP"P D0KT8KfP <8 P<8\0Z`d0\0 OoX0BS@T0`X0 `0S`î \9 R/HL0S0T0  b`00a0 S r5YL400004 H0 4H 0P 00 0H0 y0I I 1(TYT HK4KPP Q(K(fdA -LM0 `0(P@P   00 `AWV10 <0 |0@K0 *@0K 000 0P SX0400 00 00 00 0SjPT0Sp` |p X0pH0`x6U+0 V0b0 000 0 00 ?oR20S 0b 0000a0 000 `Rp0`0 00 P 嶽0S @K!(000C00 @0K`00S@K@KV(@K (@0K0 U 00x5p R6HL0S0T0  b`00a0S c2W=p0000p 0 p00 000000 0Gq qGP0d0010(TyWڐ KpKT lPP p0 3SHL0ST0  b`00a0,000cS00S 2p0000p 0 pP000 00 ! 0pp (KFA^A(f:/d'fA -LlMx0 `00 '|p@p0PL0p0$ H 0p0 t p h0K TP T`X  8   QHLQTP`aP PeP `Z0 3SHL0ST0  b`00a0 < 0bS00S 1X0000X h0 X h0 00 T 0h0 幝X4@?PRp0X0  #RH LQTa`l,000cZxZwLQ0T0` a0c0 SXh 0P 00 0h0 _0J Jt 1 tT0K0`0K0x0dK\K0 0 PPvTO`j4| T808|0Z.L0S0T0a`00`0 S  1ZX0000X h0 Xh0P 00 0h0 0J! !B1(TkZT hKXKPPd Z0t hKXKPP 4\d |@000bSl K  j0Pp0 l  `4pP@0ZX0000X h0 dQ0d0 (2 0Rp`tp 9\d 000bS0d0  l K  30Pp0 l K 4 p`dK(SR00t0 t0D S #WV@`p``oobp`\d P 000bS0d0  l K  0Pp0 l l@P& 0 0PK0Pp0 PW|t0SX0%(?o< K2LK P VX08X0T000U0SP(K(fA'f -0ML00 $ K -L|M`0p0-|`@x0P0x0H  00t0 000 t0  p  h0KTP Y@X  8    QHLQMTP`aPPePE `Rw0 3SHL0ST0  b`00a0 < 0bS00S /X0000X h0 X h0 00 T 0h0 ֛WfX t0P QDHLQTa`l   bU1U0HLQ T ` a b R<Xh0|0 0h t0 ~ |0tE1 1C!t 呛Y7 |X 8PPP' QHLQT`anUWT hKXKlPPZ@u2`?P0PX0 < #RuH LQT``lUiLQ0T0` `0c0SaXh0 |0 000|00h0 |0EQ QEp|0 01-T0K0d0K 0`0K0 0\pKp0 0᭻PP=Y2 p0\d |`000bS0d0 9 0R | ( p0\d P0 000bS]0d0 Y`P_\d |@000bSyl K dK KPl t `1 P@p0V| 808| 808p0|0T|0R7HL0S0T0a`00`0S| z.| RSX0000X h0 h0X |0 000|00h0 |0P||0 0B! !B1(TRT hKXKPP U0 hKXKzPP 1 l K dK @Pl d `z1P@`..UX    X h    bUlX0 3SHL0ST0  b`00a0,000cS00S -X0000X h0 X h0 00 0h0 |0T%,000cU5HL0S00T c`00b0S -UYX0000X h0 Xh0|0 000|00h0 |0EQ QEp|0|001|0(TUrU 0 hKXKPP `nQ\ d@0 00dS0d0  l K dK 1@Pl@T0 #K 4 0 $K'K'KD QP| ptQ SR@ loᩒl K dK @Pl  0d K0PK@PP0Zp0 |@|0SX0%(?o< K2LKPYX08@X0|0d0 |2 0R| t >\ d0 00iS0d0  l K dK Plm.0 #K )4 &0 $K'K 'KD QPt tQ SR@00l?o2|0 0|0 \P d 000bS0d0  l K dK yPl -@P$ 0d K0PK_P!PY|pt0SX0%(?o< K2LKP |0SX08pX0 @ ``/,U+X0000X h0 T 00U0SP(K(f'fA -LM40 1 0000 0 0 k Kd -LtM`00@X0 X0 0|`\ <ST0 X0(0d0 0Pp `0 P0 XZ4 `0S X0 0?R*:L;H+000H0Kd 'T0S4  8  #R?HL R PT b`  ` H, aY,0 3SHL0ST0  b`00a0 < 0bS00S ,400004 H0 4 H0 00T 0 H0 140 3SHL0ST0  b`00a0,000cS00S +400004 H0 4 H0000H0  X000D0K 080K0<0K00 081zPP +QT0SG \08D 00 000bS0D0  @ K DK 8K8P$@ P 0D K08K0KP00\0 U8D 000bS0D0  @ K DK 8KP <.P@ 0 00$0<.8D 000bS0D0 B @ K DK 8KP@ 8 00h 0 +0 0i00 00 0iT08D S000b S 0D0 Z X0190 0|0 0x K00CT0S  -PZ T08D S000b S 0D0  @ K DK 8KP@  0p t0 ԇKKS0D0  @ K DK 8K~Pj@ K0@S<.HPGP00@P|0  A Pt0S% X` 000bS0`0  h K  @Ph 1opPP3 ?'f(f'fV@Hdy@d'fAp PX `0 0 0a S `  hK@Ph00 L0K`^@P \f#0L0\Pt0S- X` 000bS0`0  h K  XK@Ph %W P X` 000bSST ` T XK@P WY 0,KP  0x@P@@p@L0K `)PPL0\@;\h 000bS0h0  d K  |PPd &X P \h 000bSST h T oPP XP 0,K@  0HPP<@ `Pp0\h |000bS0h0  d K  :Pd h44 0R  =\ h0 00hS0h0  d K  PdK0 #K 4 0 $K(K(KD QP ptQ SR@loᨂp0\h P0 000bS0h0  d K  ݶPd  R`P* 0 0\KPKæP `o PP0Yp0 |p0SX0%(?o< K2LKP XX08pX0` @ ``LY@` pA(K -L|MP 0.x0 `0|` 0ppP `P <0 x00|0 d00d00S$ H  <|0pp l0K 㰵0@ST  8  #RgHL RTP ` bPPeP, aYU0 3SHL0ST0  b`00a0 < 0bS00S T0000T l0 T l0 00 T 0l0 ~|0S`p?P'T0p  #RH LQTa`l,000cWYbT lKTK⋷PP `p@| W808|0` 00U0S0T p0K0;x| 1 0x0 0PPp0\@ 0d?ot 2R0S PU Ty Z ͈t Ỉq Sx  00P@VcYL0S0T0  b`00a0 STl00 0 000 0l0 0I IP00 1(T]Y4 巸T0000T l0 W.LQ0T0` a0c0S WT0000T l0 Tl|0P000l0 0Gq qG1x0|  } Wx |0lK TK϶PPC0ST04  Yr 2  #RHL RT `0 `0c0,000cS00S qT0000T l0 Tlp0000l0 l800z- #RHL RT `0 `0c0,000cS00S >T0000T l0 Tl 0000l0 00T0 3SHL0ST0  b`00a0,000cS00S T0000T l0 Tl 0000l0 00T0 3SHL0ST0  b`00a0,000cS00S T0000T l0 Tl 0000l0 00T0 3SHL0ST0  b`00a0,000cS00S T0000T l0 T0l 000l0 00#SRTh ,SR04  3SHL0ST0  b`00a00,00c S00S sT0000T l0 TlP0 00 0l0 408}@z\ 3SHL0ST0  b`00a00,00cS00S >T0000T l0 Tl 0000l0 4-0 3SHL0ST0  b`00a00,00cS00S T0000T l0 Tl 0000l0 00$SRTh SR04  3SHL0ST0  b`00a00,00c S00S T0000T l0 TlP0 00 0l0 40HP 3SHL0ST0  b`00a00,00cS00S T0000T l0 Tl 0000l0 4-0 3SHL0ST0  b`00a00,00cS00S pT0000T l0 Tl 0000l0 00S  #RHL RT `0 `0c0 (fA'fHdy@'fd'f,000cS00S 8T0000T l0 T lP0 00|  0l0 0A0000 089@p Wb2H/Pp Mb(`0K0\0K0x0hpKXK p0 0(11ÛPP Q`@0S7 Xh 000bS0h0  d K  ဲPPd  \``P@> Xh 000bS0h0  d K  aPPd  \@` @X h0 0 0a S h  dK DPPd00 L0K`ҨPPL0\@0S- Xh 000bS0h0  d K  XK"PPd %V P Xh 000bSST h T XKPP VX 0,K@  0 PP<@ \P0S Xh |000bS0h0  d K  XK߱Pd h84 0R  >X h0 00hS0h0  d K  XK±PdK70 #K 24 /0 $K(K)(KD QP tQ SR@00l?o20 00 Xh P 000bS0h0  d K hK XK₱Pd  pP) 0h K0XKPKhP \PPY|0SX0%(?o< K2LKᑡP 0SX08X0p`p\\0@?S@\HP(K - LM0PJ|000 t0Si$ @m!Pp1pl!0!80 x` y H!80FFFf` ` 00100 P000zS0!Z 0 1 000 0VP Y 00K0100 00P@ԃ$᭜ (KfAd{Ar@ -LMP0|pSPt R@= S ` 00J00 1ȏP@* 100 P0S  K᳒P0SP0S K᳡P@ 0@S8:8 7P@ 0& Umz$K舸Ad -LMP@`0` SOT`  ` SH0S|0P0St0S 0 pPL@ 1 1 00000 00 0 up WWt0S 00   IT t0S 0 0 IpTT   (Kd -LlM`0P`pA@~ %000|h0KD 8 @@T @ #RIH LQT``l, aT6T5L0S0T0a`0 0b0S  T ܲT0000T h0 Th0t0 000t00h0 t0DA AD0x0  t0x0!(TxTT hKTK @P T0 3SHL0ST0  b`00a0,000c S00S  T0000T h0 Th@0dK 00 0h0 忿Ἷ广0XpK0\0K p00 0 0 W@P AXd |000bS0d0  ` K  P` 2 0Rt x >X d0 00jS0d0  ` K  P`|q0 #Kl4 i0 $K'Kc'KD QPx tQ SR@00l?o2t0 0t0 Xd PP 000bS0d0  ` K  ἮP` <1P! 0 00PK⡞P/PPY|Px0SX0%( 0< KLKϞPt0SX08PX0T-X dP0 00eS0d0  ` K  P`P \ @aq夀  V}P <@ yvq\(K(fA'f1u 0-LMP|@=0 00 8@08K0 -L MtQ |@80 `000 `0 1 8081 F 0&8@08Kd -LMt0S 00 1 Kd -LM8p PP9/02 @` 0,0@Q00@aP0 09/0`,VfJ`@,0V0P 00009/0,0@`T@0(K -PLM0,@`A  ?t 0AN1 刁R`08 p0`B`Q0ad0C00 00!03O.P8 0 040 00 3!B.P4`@  0 00e0`00000ᩰ@ `!, P RR00@BAA8B0aX3\0p`0`fP@ ^  0$|(KU D_@^@Aha@a@A -LDM8@$K2@0 @ L3008 St 0T0<0 N000 \5P S08 b 8  8 `p 0T  BG\40K0000 00pAP;400P$5 R #R2 0S/ 0P x0 S =000 \5 SQ0`VN 0x xc 0Y0Bt0Y?*4=08D0 \54` P Sᑐ ^\` [\ 0  ?%`p8eKᑐ @IxJ\eK` `T ?` B[00K00 000 00 0D"Pq 3#\Q-R ( L3R\$K 0 K ?Os`p/0 !. 1R R  \", `00``cqa -P` -Pp@@008 pp倯``000 HLv c0?oc`000S 0 0ot000 0xS D L0 TD L0P0,x<TQ 80S  10CB>A>A!0B300/ !X.0X0 ( 00C 0 R@ L30  B 0: S 000? 80L#8202<0P =4=4?=08 4P <0P {<<(KTU HdT^@ A5A -LA>A!0BR #K ?\P@@ $KJ$0A0$0 I ? I00bL30  @08D 0aS0P 00 `W  P 8 $00b$08I PIL30  l 0 C!000 A 0 AL3`000\%2Rm=SjT`嬐 `Ff ZZ0Pu<0 < 1RX000W D0 9G ᨠ L @ZL  @0 ,G@01# &G0ZD0A>A!0B304(KooHdTU ^@QAA -L,M`p t0P@80 ?qp < Ё«\ <0Q  0T  BVY00K0000 00>P0h 00\ Ó\ :8 0  R   ` 0 I0j;(KTU -L M@}PU `80 CST YUP! P0 TU ? 0PeP K -LM`Pp@T X ? 0Hፕ0 0C  S R0 Kh -L$M`p @3@R`8P0 0K 0Yp0 QP (`p800c`#KIp` Y"8P0 0S 80 00(``Yf r0 00C0 A R0 A L32  B \%1Rr=SoT0 J 40 X!0pS80 P5X   S4 @ D0 E`X<0 E<01#ED0<0 X<0@ 8!<0 QX b```S4 E ᨠ 8 X8  40 vE401# pE<0yX00C0X0 QT0T00QT T 1 ! B 0 0 0 (KU T -L4M8P$K2<0 L3"00@S00 S3 T\%4`R 0 0T  BW00K0000 00<P 00T$0`0S Q R0Z ğ\PQ0Z7R 00 00$KT#`Rp T00A@DBNANA1@BD@z0SZ0 p0000 cT0R3@_@00 00008S`0?8080 T0Z p 01WPSpPR  00 00$Ky p?n 80P0S10CB>A>A80B30j$0A 0$0 A ? A< L30 0 040040T#R T00A@DBNANA1@BD@0K9 Y$Kp  Q 0S  10CB>A>A80B!30$0A0j$0 A R? A< L3 W0  j 0!040j a0C4040040 `T#0Rc T00A@DBNANA1@BD@080P >8_(KTU HdT p-0LMSPh`@ 1\0!0k?0x Ъ  1 00k?00x0ªKpdйAȹA -L M@0"K\:Ѐ 8PEΟTQ`şU @"K  @H[؀AR  a` 厩 $KA6ATA -L,M`$K 08 P<0 ?m1@\!Q-R ( 1帠R\ ?ᵟ m#K400 1>4 `0pS7 00#K ? $K0E=S   K0w0p0 QP405005 00 080T`  0 L30   <0: S 0?0C0  R0 L#00C00T#0R T00A@DBNANA1@BD@(KoHdTU ^A^@A -LM0 8@ 00PS  A0 T!s\` AUA> C`p< D4@Ĕ1#c 0'm 0R0= CP0 000 ĺP 0 ?m 0  ?m0 00000 P00Ȅ0S h0h ! ?! 00 00 (K蟺AA>0 -LTMh0 |0d ` 00 8080 000T0L0 80; 0 `0: SP0 008@,0[ H0 `0l04  El00P0L0. ,pv 0bWL P4 X U0`QLb ^p4X`U0n? 0ql`4pV00C2S0!T0 40 SJC0ZUp4< GqE WpRKK 00X? Gl$KR0K܅K0D @ X" $K04l<0PS< PR<TPP1UP0 ?l 00HQLÔTœ ^ \QHQ.0RLÔTœ ^  ZWHU02HQ L40\0RL4P0c80 ,?WV`#p#kP0 S80H30 R R  B @h0@@ 0`0 0000h0 L( d8\80ئ(K,0غAA -Lp0P` 8@  ` S'\ 4AQ 1J1SKt ?V0  ?dk8 ?,Z J P  ?Sk P?Vkt,`AP A?Hk0"SL P00 8 L#" P0S8 -Lp0P` 8@  ` {S'\ @Q 1C0St ?V0  ?j8 ?,Z H0  ?j P?j ?j,`@P? Aj2\ L#  0P800S L#" P8 080 -L,M`p@P ?j\%04R0  0T  BR00K0000 0 08P030PZ #R d43 ( ?jjh3`Z`pT @ pq00 S` Vb KP  0 00C0 A R0 AL3 2  B  T0R380  0 4@00S10CB>A>A0BQ3  80R8 `0 b`V3 <0 P! 8 $0 0$08A>C CL30  0< 00C0 A R0 AL300C0V00a`FBnAnA1<0 40D0 <08`BaP\04 80X@00S  10CB>A>A!0B30$00l$0A>C PCL3 2  l <08 0Rfa0P0D s0T0Q Y 10CB>A>A!0B30 044(KTU Hd -LM@P`P80pZP 0PKhK^@ -LMp,oP0@PPPh hP`P ,a  [ W ӹ:0pK:0AA -@`LLP U 0000r ɹP|U Ĥ p2PU00oU Q᛹д,$Kk$d"A -L,M܀#Kp0!`@#Kᶣ#KP@ nPi#K #K@ P_pW#K @(Ko PX KT0T3 SR0 0S K0 S @(Ko 00 X  0 00 ϴT" 㩍#K `@0T0SX @000 (Ko誴(K^@ -LlM8@;P` CPA>< `CD4@Ĕ`p1#c 0chP0 000 P TUx9\%R01'#K 1K#K0 "K0( $囤T0X0 0SK ?.hX< 2 x0 08`0bD0 L3 "T0 0D R S $40K000 0 0 05P 08S9@0 <0@ L0 \0 ?'KԇK#K\ 0 R0 ?R00T0P0 E\%7pR 0  0T  BGP00K0000 00p5P000p7X #Rh7h'\Q-R (K ?g$K 7TX`?0T0 0S̠ $K ?&K@0S&K&K 0&K`0/0 T0!.&K 1R R P" \08܄K@c'K 0&KQ&K&K 0&K`0/0 T0!.&K 1R R ^"l 400C40@0S @0c40040P] 0TS$K ?$K@0S+܄KH0/0 T0Ό $K 1R R 0" $0AΆ0C$0 L R0 Lx L30  B $K 0$K0T0Q Z 10CB>A>A!0B30PU01cK0P 0P`p0@ 00SD0 h0h ! ?! 00 00S& T  B@O4P؃YX  0x/ 240D 0 0,h4040 , 40 00S0gg= CP0`ˡ0S`< D4@Ĕ B1#d 0fA~ GR00`m2` 00 0 P0`p009Sm 0t0Si 00SD0l h00h0 00 00S T  BN4P N240 00 b 0g40g40 , 40 00S `RS'< R,D4@Ĕ1# 08fAn FP010S Ȣ0000S 㽢00@ 0w`|# 00#K! ?!XV0S 4/P D.(KTAA_@U HdTA>0 dA̻AAAA -LG,Kk 0S00 0|`KS00R0Su " K 000 00 0L Pa00 0Y \%9开RT 0 B40 ^h1"p#0K B4 ?^0`0`? K# 0p0 `0" 0`p T B F`pI)0K00 00 00  0 P 0 5)=(00C~0S0  00 0,0K p0K000000%G+P 唚0H 00 ) p`00Xʰ0K00 000`0! P(0K00 `pK0W * 000?00`V h0dCh` 00 0P?o 2R0S qfPP 0'(K -LtM$K0 0P98h0 0#K0 St< <80!! K8 8 R0#K]K %K00K000 00` $K@ @P00 l4!t20t20$ ;60 0R< #00{0z%@P0 f@P 00S000p00p0?@l0 h0S@@T@@ " 0q000 @ 0#_T0T 0!t S\0 01(0@0S@0p$Kt` 0F$K 8?'K<0p <ɔ"!KP 0?'K1D0 0K&Ka 0d K&K%KR0U0 RD  FKK ; 09S0 S0t0S SK0 000C00 T B^E$KP J# 000%K00S0D 0 0 FK0 0  K#K 0$K&K R0&KD0`F0CD0 l 0S  R   R ap1`0 0000C0#K\ T  BE$K00T0S@0 @S 0ᡁo0婒? 0}&h0S 0i'T@(KdA -LM`P 1@0SpZ 4KM 0 Wp00S0   "0 0S00D0 10S 0V`00S0   "0 0S00@0$ 0$ 00S UP00S0   #0 0S0$0H0 0@  R0 0 00 0 0:0 0 K    -L$M``0p(P|@ 00" R 0 z00S{ P8 `0(0@PPP\%1R,5S0հ մ 0մ ն 0\%帠80 1R ?[ b1!p[00`?,.0.`p`p ?[x ?[` D0T  BD00K00000 0808)P 00`0 0\%p0Rx ?[0 [0,C]U0 a&!& (K TT -LCM.K 0-Kt0C CRQ|@?KP =S*#SR :^QhQ Q(p\ 0*Q  !KSR  < 00 00  CK)QP=08P *K.K =0 000 .KR0kKP` 61 P0BK .1YX< =؀C.K 0H0 .KSR- 0 *0p 0.KX 0 .K `P+0S KH0+A?K#000  A?K 0 y.K 0 00 .K R0p ` `P 0p 0.K9.K ᴇ 00 00vt0S u.K*00SK0 85Kj0&j  ܎K P   R S KPp 00 P0K 0 00 .K R0p  P K ЊBYX:085@5L0n`j ?AK K B ?AK`WVp1`1.KWV0  cH0<0 .KkA0H H)`pKԎK`p /KV060 S'0%00/K  0xPu 10K.K K0`P P20C?K P0AK tC?K R0R-K X?Kp,K41 ,KK0`0V !?1- n000L ? V0 q 01 0 Q* 0/K0 !   R `aƟKgoKoKԏK,KgAAK`V `p`Q R   oK0`p SoK 0P0 0 0 s0 KQ((`g0 S0D KQXX `m0S.KK*00S0000C?K F 00R0S 0 +K 0t `RVß X0*K!GKkK? ĐK00S0 1p`1m0; EK ,0K1)C/K0K0 T  BzA/K-0P0 E?K R0# 00 0000S0   01-KGK 0-K IR0X* 0EK A?KEK R00S0 1G?K1GK' 0 AKQPj !0S0 1E?K1EK' E?K 0U A?K R0jC?KP AWV:08`@`L.K*K0S0A?K R0jC?KP @WV:0`8%`@%`L `VDԔfX009S t0S00  T V"E?K0 S-KȄ K0#S0 S#00 .KR.K.K.KK*00S000S h00ah0 K! R0`pa  00 0><:G?K 01 jE?KP }@WV8550`%`0@55`0L05`009S t0S00 # `G?K 00S 0 !-Kd KE?K  R0(KA00S/!/P11/ -LM`|@8PpP )@90 KS0000 0T`P  00 0jY9 Sڇ"`tK -L8P`p pp00p0 0$0@` ?T B?Hp0p0!"000gkP  -LM`|08p~lPU 0 $p@ Tp T B-` -0 |@0;!T Kf  -LM` 0 PF @T8p0T@#)K K @D O-` M-=KC ?)KR0+ 5 ' a3S$x×h#l3|和K# tC00 4ԊK;$p$ R ԊKR 000S^   B\ ܈K0?0YX P  CC 1R0 uP!100V0  0$ 00R`00`0010 0 0 X 00Y (K R0@|0 80 0K0|0K0(K&@P`2!20R=0, K 2&CdP . 0 + 0, K02X  0T)K)KT@ 0S 00Vt|00S0  !0/  + 0 @0, K@2 K 0 &C#@P0儠, K2X 0b 0 )K+ )K 0)KF0S)Kw011!10R/ zV0 (K |x@P `(K B@P 9Sڜ09S @T0 RC D@ @~000V A(Kdl0ff 0-L@z0@P @0  @@@0 00-@L0K0hz-/ -|PLx0@ `V V `V ac 8E0ȟYX S  P 0S E?01 000$KkE/ ! -LLM@ P0 70` H P@P+ p0KT0 ywd4D 10#K R0%K0 @L0 T #K R0 0< 0S0 !01'(KP =00K 0 0 00 0 0`PKt ?3U000D M 0&K:L0S&K 000 S:SR/Y t#K R000S<  1 0< 1 00 0 0 00D 0F90S0L #K R000#K R00< 0S@0 @P0 0@00P0D 000090Sڛ[00S0 h00h0 !`a 00 09S`H0 P &`00ToC#K R00xW0l#K |`P  p#K `P 9SH09S `sV0L R @`00TW X(KdʼA -L4M|@8`41D0 0PpGE 0S T 0 0R000 0R  0 p 0 mk 0 0ec \ l\pP 0p0p0P 0R 11KKPQP0R$`  Q<#KQP## 000#K]P 00Sh 004Bh0 4c! ?!00S0 PqPQY X0 B ?SK$KX0fP  <00K 000D0 2 00000@PO= CR#K  0ptPU<0PhW=00 00@0  P0SRK 0@  &`  ;#KSR # 000#KP 00Sh 004Bh0 4c! ?! 0  000zp0t0ß0 60 R d0X0 00 0(K0d0 -LDMP0 p@H "00!D0,0K P#D @0 0\$R80S 0H 00p00Q[000L @0$`?6/PL 0坎}8|`0 6S \ 哎8+_E/ 8 0!S Q E?01 PEa0D08 2B0I> 000=C ?RP 2;04 K fP @_ 0#K4Y408 1L0 D0B20I> 000=C ?RP ;L0 8 fP 5 0 p 0S V 0 0000`8 ``L00L0RpPU[^(K#Վd0AA>AdAA -`0Lp@r PU 0`R000 0p RpY9S000p^T000V   $KkZ0 -LTMp`0|@`0X 8P00\0 4 *$K=T C:K0,pK0'X0Z X0؀$K R 0R%K0aP0 `0 +(8%0@KK%Kh P1 R0 `0KK T0 R:$KQP:KT0 J: ?KKQP*@ET0cD0L@@0p0@$Kh 000 080K040K0p@$K8@ }P<0 @b ThZ0X  ,]P<< <P \ (K -0x L0@S0P`?Q HS0 ) ) d l p t0qQ,4S0 ) ) X P  00 -LM` PJP  0 WVc0S 0$ 0R 0 #R0 Y@P '00KC-8P`@@8\ T q 8 ^ X | pሀD_@a@ha@ -`0LST08000@o01S00 0030B!0!000B볽A -0`LQ0ܹ0ȹ00o0 !B1  2 P" ؽA -0`LQꔺ0x0\0P0BBA -0`LQ,0000BBЌ'A$ŐG-\}l@hS@ P RP^N౮pQ` RP^N౮pQ`$pPY!Uࠡq``a`FBnAnAΡ`Bf ^`BV  qpGepPhA!_ BB.A.A B pW`````"Y`i  X!V !! c!^!0c1$5 @ pG I R0CS P#1Ѝ -PL@T 00040000 0= !` J:8T A>`CE>`p B%`pa< D4@Ĕ1#d 0OWV`Vpb 0"0, ? R0#X  ?#$ 0$e@ -L$M@#K\%1p`RP K?~O Ÿ 1! vO ?  0  ?.(0K ?]Ox ?XO` 70T   B700K00000 0 0P- Vp P`8@ "#K# QE#K 0 00Px0400|p(d0L0 0L0帀(KTh)f)fa@ -LTMH  0 P3p Q0 `PD0K(P$KH_@P $KP H0|@)0R ԄKQlPQ`0@hA 0A ` 0tt1Q 0 !0h0S.!0+ $K%K0L0 0QlPQh0 !!00%KA00S 0!Q !00S000|000b0 0S0Xt000 %X0S0p000 0 R d0X00YP(SR Q0( ' H0K  P%Z0 00 R l0P0\%d0R<K?K04 0L *HD{ 00@@(Ky@a@MAA۾A|)f)fTd0@-h0VQ # 3 QQ]0  B PWBT4L \QN@AJ QG QD QA ,Q> \Q: \^x" RQ0^PQ &QT^8P@T@`@^H~L ~RQU R  P 000T -PL ) %< 1S (030Ņ(0E 0X4S 0 0X4840`A33LX)00p800X40pfE>p CT  B240K00 0p0 0P4 0 D0 LD04280`$5SP00Kf/4K, S$%!0H0< T7P 准VP 0/PPgl[P ?V\5!|S ? J b1,dK@00@0 Ip` ?$KDD ?@0# ?.&`0pdK ?Ix ?I` C20T `dK`p B620000 0 0``P U8` # 4 4U0.8(Ka@ATTHNAAAοA -L ) %< 1SE 0 (0404(0X4S 0 0X4ph00 S000 P@00@0 = CT P B=100K0@0 04000fpP040$ R@000 @0[0 5  0@0S000004pAo1$5D S,0q0H0 m0L<0 <0D S/00< 800D R0< b40 E> C<0T  B000K00 00pP00 0 0J0]80<  0p 0$5SP0, S$%0 , H I4PS9Ӭ4հ4S@0Ӱ40T3L0`0/0,000(5 0S,0@0@0,0P000 040(0:(0,0<,0L0P0T0 0t0D0t0 c0?o0cH0T0 0CL080P004080ނ@0S (pF @\4S  5  0 00(00 3(0pHLlppT hl㩂0P V P lPl00p(Ka@TTHNAAAAٿA -LM0Q0SP1 K@.@P S&  (07(0@P  , H,(07(00 `u/0PpH0Y  C^8 o,9KdfAAMf -LMP00`SP p,@P ,PHX0  c@'e Ke -L$Mp@ C00K00`p 0h0$`0+4P2 5h q1 5000H000`\%R=S04, 030304040 50H0" " 20 5X p u (KT -L,M@< 408 A/p PLU,800`T 0W40`e BE>C9/00K00 00` 0^P0 0|H<00S8 P8Y80oP 0(K -LMR@q0 # R (P/oAQ" R`e `XPU  $<40 K*P00t Rp0DTP U 00 S p p0!QP R000 00S0 RU,0(0#1000#S0W00' 000dZ(0U$( PP0W 03a0dZ 0PPn 0tW 06a0c0BRP=S,0 (0 P P 0 (0 S 50ó 5=S,00000(0=S# P h,0 5< 0!00(01 T000000\4S (0 0S0H0S? 0 000 6`Pu/ 50 5=S 0 00C^   N~ p1X$E> * (0SN ` (01(00Q ```(Kdy@HNAٿAAHdA5ATA -@`<1LPqP 00 P==S VP0 t0S V QJ`hQ$%0,RL1/jh,jP 'jT)K j(0:(0d -L$Mp`@=S =S ll_4K(*V00V80 00P,K`)<0 04M*P 80P`pp0 0%KK#R0 0QpW  L HpP} t |'KH0 0L000 'K1/ptWe H0<000@0 0)#pKR0 0o0l0 WKt0Sz(8 8\0 I8X0 0(C8d `0 K%KSRj 10  0 0 0 papPV #p0Sp #K0H #K#00 `J`p0x ȟ` p0 0 #K  0Japl0p 0D00#K H0@ (K! 0- 0L@PPM{ P0K0hO0 p-L M@|P`.`9S ʸ;S ` ( 0 0PQ 0 SL0L0~yPsH|`|P 0 pyKpl)fp)fh)f-/-/-/-/-/ -LdM|@t 0X )UTP *UTp#*,0K\0 0\ 8`0"\ @T *$K &KK$K R0R&K0pxPK  0%K#K0 P0KK G*$KSR:0PD08UP@50LPP850pp0 p d00cP@1d0 &KR0K @K&*$KSR\0PX000$KM"%K R0K *$KSR*p0Dpp@5pL0p\0PX0000 080K040K0$K8p MPp<0 PbTU @0d0 LpP<f  !0!Sd00S 0 Lx00<4$Cʍ=0Adf4A)f -LMp`|P$C@P '"h0@@1 )P$B@P 4 y$00嗍 K)fdWA 0- 0LP py*\Œ\\0QVQ :LP8840=40 0@0 daATAX4e)fp4e P 0SR// -L$M$K`ԄK`0V@0p@0/()X X0#KH0p <0 $#KR0#K R0@T#K<03 X0 T? #K0d0 @d P$KKSR KH D0pb0C H0 XH0#K!E $#KP R0T#KP@V@(K -L|MP'K|`0U ` p0 @P  000DvE0@0 ܇KY X 0eW000| S0 pa1gL Q$0V000 \00S 0P V0 0 :0\+U4 0S/`pY X, 0 R(0  !01/P 0000 R0ሁ1' '1/P 000`pY XVl`KWppK'KP0p0 0 S001K1-(Kp `p00CSp0  ЁF'K SRW(K0 W P 4p 0 1 0S000000 D00 08pP KL #06000DY2!t20t2 P  00S01p!KQWUQQ 00K܇KDX F QB0 01/P6 'K 0'K0000!KpQ'UQ! 00K܇KDX  Q0 1/P 'K 0'K0000`JW K0P &000R00S 0P P0KL #00 0 6SP | x,L #0 (Kfd -LM0S |   0S ,   0   ` K 1 -`0@00L|P`06/ `000`06/P F00 -LDM`@%K`0K,pK00Pc #R 0|<K1/K0f>0K#K 0 0 KR &F0PPC 0'_k!1PP00p 0$KXP kRT0`F`%K R0%K  0`p |00  ` %K1/k|04 K0 P%K 01/ `@0UZ$K ?KR0 K06#KR0 3ҡ0ã3¡ 303PP8 @Q ^ (K\1f -LM@`p|P`0 0001/P#P*WV$K -L MPp|@``9S2 9S#(0 *000S  0( 0 00P00)9+ 0 00 0 0 `0000 8/9 ?o209S&0Q 0 !0 h0S !0 Q#`؀h@PЁA$$A`t xu$Klh@A۾A -L M0c0@`,(0 0 @04/KШ6A60@-`@,0@0S00000 @@PD @bTSl0h0d0P  0 S P 00$0P0008AAFAAA -@00P00`0 L p: 00 0`0,0@09#60 -L0[=0[S< [.RS#QP QP00; [.RP (K -LTM@1`0P0 `0X 0P0Yp1\0 J]1@T0 C]|04 Kp0 @#1/ XW ?K&KHP0TK #K R0$KK&KR0&K$KD0S $KK D0 10$KD0@U 80K0 0@D @0000000 @P0 0 08 S X0PEP00P0P0 \\T\(Kd -LM `0pp0 0|@p t0 0`0 00l0 `0,P0P0 0h0t 0h0RP890  `0(0 `00CSP6p00H0K0000 PH0 S080p00SPsS080`000 0 000 R00S00 00000 0\0 `0D00C0 `0S\P Њ? SP :0`0 d `d  00 `PK`P @00 `0 0 l00C 0 ?*K܊Kl ? +K;7l00 0|0 x0 h0 l08#80 `0 R640 '`0PP 0` PK00?P \0Sd0 0S|00|0 \0Sd \0d0 |0 P00d0ഐY 60S d   P %`0Cd0 0i )U\0S' 0S 0S00000 0cS 0` S\Qx|0|0 S 0hx0 x 00\0 0S' R  R  0 >PP0S0  R d0`x 800h0 0\0 0KSdo m`0d h0 0 `0d Rh M0S0`0\00 00 CPP e0S `0SA08S=0S6 9S3 t QP\0S  jK+K`pL6l0h0 `0\0 `0`S000cTT0x0T0h0S0h0 0h lPl0X0`0S 0p00 =P0`S*YX |"00S0 00 0P0` R00S l0c`0\:`0S70SQ K`000T0cT%K$K#QP6BLp L0K DK`CPTt L`QP9 L |0t Vh0 t:P? APB0` R00S t PP+%KK#K#QPP- L0K <K`CPP&%KK#K#QPALp L0K 4K`wCP p0L000  PL0p 00SL(Kdd&A1A -L,M@0 `0|@,p0`<0 0P*QP 00S0 00 00 040K000K0?Pp0@080 pW Spppppⴠ 0g Z0p p W0p 8  Rppppp0g D0 6D0<  R R <0 =P<0pZpő Z0őpɑbq80S0   0 64O 0PP0 0P ? SR *`@ 1/(Kyh@BANA -L4M @R`p0O`0 |P,0刀H0 0H q@K0  ?1/P8  ?*Q ! 00 0*a@0 0 0@ D 0@00H    I6@*O@<K&`0< K00P05/T0 (Kh@ZA p-LM@P|` $0K K @0?P8 $0@$0 0 l?P) $0R    U 9 0C8C890 00 0 N 0U@0 0 0 9S`00003/Kp -LM@$K K`P pP& 0p`0,0@ 0  9 0C8C890 0$0 0N 0@0 00 9S`00003/K0@-@TPP@@D@@TP@P@D@P@A@_A @TPP@@D@@TP@P@D@P@A0@-p@`UT@@@@UT@0@P@@QP QP00 -L@M K  40Ka Kh@ -LM|0#| K -LM|0|| \ |0 00c K -L$M|@P)|@`|@\yᰀ @|@@H@@ p0c K|| 0 Dc -LM||)@0;c K 0-@LP20S )K0hk p-L MP@0K0! `P P` P|T0 00 Kp 0-@L,@D|0*0P00 -LLMpX @L H P `Z ?|0#SR?0M00 p`0D K < P`0,0@2P[1P[U#[0R0|8 QP$K sP0@&> P0K LKXv@>YPCP P>P@t0S >|0*0> (K.. -LDM`| < 80 9 @pSf0t9|0)0 | 00 0 `000P05/PPC0XI0oW㪢@0 \0<0 & | 9S209|0)0 | 00 0 `000P05/PP | 90C9|0)0 | 00 04 %i |N 0 0 02P44 CiUc <0S | 90C9|0)0 | 00 0 `000p07/Y0 X  0|P |09#60P?|PPX00 S | 90C9|0)0 | 00 0Y0|9S "0| 9| 0`0< 00 -  01/0X0 0P00P0|0# |0 0|0c0 .XW^0 P 0 b 0 R0RQ U U RH `00 00D0 0,0K #000K 0 ?P4 0 P<0 00@0 00 i 素R`8 , @RH0 80 I9PH0 <  R jR P@ 0 PD00CP@0P0P40080| 0PW|009?o200 0t` P| 90C9|0)0 | 00 0(K)feA p-L MP @ 0| u`P |0QKp^.1/ -LM0 K @ $01/P00K p-L MPK a0 >`PB@P <`Kp-/ 0-LMP0@ K $ 1/P 0P0F0| Q  Q0 <0F0K0 -LMP 0S 08 00 000  B2f0 Kd{A)f/ 00CS0/0^gd)f -LMPp00K08 ` 0`>Pl0AP 0o<c000|@ 0 0 009 R0  09  H10!0 000 t?b0  ~P9 ;900 0 00 R d0X0 0`000`06/P  g` 60 0 8 .gZ000 0 90 000 0< (Ky@)f 0-@LP0S ۓK0h p-L MP 0@| 00T ^`P0MKp p-L M 0"| 0@0T F`P00 0| 00 0iMKp0|0 00S @o/ 0-L0S`0|00@0 4/0 -L M`@|P t R02& `0(0$ Q 00S  } t9P Iprr@p0 !%a0 } K -`@L`0|P00p0 7/"!#"9:#:0900 000#"00St00C'S0 ( 00(0 ?#00@00 ?$00P00 ?%0 $0`00&0p00h ;$0 &S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 04;00400x00|0t0S; S8`0D000t00$) -L MP0S10s.!p`SR(bWV$00s!(SR0sx0s|0` s|p \40S9 ` (@ @  0#  @#88S 0t `0  |PZ:|0 8000 R d0X0 00 0| x30S z0s( `0(0|@z㰠t@ 0@  l`0  |P0@0S0t@@0尠0S0p 00 00 QP t00CSD1PP JL|@L!9SJP@(! R JP60 8C890 00 0`000P05/PP  d 60P 0 TP ,dU 9 0C8C890 00 0J(K)f -LMp @P|TT T' T/`00@T-@@*감 c@0`0 k. 00 00 P0 @c 070 @h$K)fA -L0K020K`01`K=`K00      01/`PC ?*Q ! 00 0* YH0 DK0-HF`P*`0 0009/`P0 b #H0 0T 0`0 cVI9 0C8C890 00 00 90 00 07(Kh@)f -LMp|`|PV p0S 77S9S B@H #P 10S@: 1@0S4@0 T @P, 0  #9 0C8C890 00 09 0C8C890 00 0`0 00 -  01/ 0u7$K -L\M0pd0 `0 PAP PeY U@@`at 0`PKX0 LKT0KL0 H` f !0- L@P ! (K0 -P@$ML m04 00 0 000 0@\K)f(A 0-@LP ; PQOLLL IL$0@sCL K0hv^*f - H@ 0D`P0b #6SLp`#Q1*V * 00S P `P0D 1SX!`0V: 1P  -0L@ KhHP(0`S, p, ,0( :0U*0! 01  R` `1 040 P00Khu)fd -LMHPѱp0WH*0 0 0S? `3S;#  #   @P 0 0 0 <ZT T 0000C0d.A = L B A獱 =,̱#A #p(Koñ/A6A1f 0-P@ LkKP$0$00 00 $0eK0h -@LP`"vY$0S000  Kh茱C-p^P P \0*U @` AT &@ AT`3`#T`3V` `N A q H\    LL\@ -`LM@$Pp T80K< K800Z `d0<  80<  0f8` 80`@T00@ 40 4 00K4 K.80K< K800W d 0< 80< 0j8 00<  T< 4R80<0S08 a80@T80(K -L p ၣ`F@80X/0s& #Ko7P40#00bP#KCP 3@03303303 0X Tp#K*0#K0Wpp0 `F@0S #K*0#K80XZn 0X 0 #K 7@P@#K@P Ep:Y 303303@ 030 !0 040S40#00 P+7!  `KϪZ 3  PKp循,7` p0303y3@03@po(KQA]A1f -L M*0P `p00  0hAc80 YX~D@c80(A0UP0 Y$ cAV0&lGp/oVD0"J:P@ Y WDP<[U800800 0 "|000S d AX0PP C@1@ASH H0L 00L0@C|(K.feAAh@.f8e9eP/ 0-LM\0\@T LP\   @A0 0,0@@0 0XRMK0.f8eA -L5P  KhiJ -LMP @4 00 v#zf 0-K-p$cvK#zf Ԁ` p#P0aZ4 00v#zf-K V0"ƠʌC !1,?R0  <Y9K4K 0 h0 |0Kd 00 0 0-K -K-K @0D̠K0 00 Y |0KXo 3@  -KP000P 0S-KR0`-K5-K*0P-K@ 3# Y 0帀 0 0003<0 A280 40#2>D0 B2@0 H0VZ@ AT8 0L0 #KP0P$KPR0PU(#KSRP$KSR040pq0SP P0 H00 P0 B P R RNL@`cKR` @Pp?#KKP0 < PH@PY ,[( X 0iX0(Ko薨(K8e 1f4/f 0-LM0@sM PI(@H0SL L L0H z53PU 3 03i0 00k(0,#6 4xV 0 .O#ARD @78<A.XK0hAK09e1fA -AL @AT)`ZHPU T٧#AR0`p,D R-@00S `YX\ Q00P ` B@<0!Y00X0S `p#V0`P ڧFV U @匧@U8e9e -L0#600 1<0 00M0ԡK` 0 0 0 1 g< !0     0 K %K1/P80Hp0P0 4180#RP &L .0 Lp00WL0 L0#R /0S \0w02Nt4L0 HL00X0f 00 0D4P0 PeE3P0 U^80(K.f$d_Ad[> -L4MX 20 P4bP5@0 3@C3 U@0sY !#K܃K00" 00|"KP KK 0$K R0"fjD 1 00M%K0L  T  00 0堤垤L0C1X*< T0 0 K0'.#H #0T0Ǥx1|1L1廤DDat0 !0000CS0AX00/ d 1 0 <0 n<囤 00 0(0S, , ( ,0 80S< < <08 0@ 3@ t0 0 @0R04@0@@040 X 00 0000@0040@00@@0i(K.fd1f[> -L,Mp@`&10P@0 #KU) 00K0`#K 0P T 0m$@@0T00S  TTT0 IK00TKPc   (K i@iA -P`pL$M@0KT 0 0@ 0  8 8000`p@c(K 0-(0LPS" @屣(0S R*2:8 R<<8< ( R,,, (  K0hԣ0.f 000/ -L$MpD@@p P`0p q@0SH0 @ K05P@00@0 @00 SK 0 4<` R 1 8 , 4 0 ( $QH\4 -H\ Q \  P ( QH0A800X*@DaP004  R 0 R4 @0H0k<K5/P Ki@ 0-LM K0" K 1 0-@L000K0hB  $/f 0-LM@P0S0C0K0h+,0 0,0"P0p %80S< < <08 ,0 ( c)@K0h<(/fwA R0-L@P U T K0h30 -L,Mp@ 0P$`@PD0  H ##Kk%P 0HP@0a" 0K#20#H0 <0@ pcD0pU2H0 U00S%1s" K0 0 0(pL ! 0L 40& P 00 HX1*0PPP00 H~(KA -LM@`p %P@x 0!SS ,0T 40#00SX  0D(p JPHtt h@T #WV 8@DA@;00 P@x(Q( #WV/ 8,0 0,00 00)0,0֡000ϡ,0 ,00,0P80,c8P<0<<0T(@;$K@C6$/f(/fi@AP 0>0>0000 0, ( S 0Q/$d,/fd0f -LMQ,(( 0K ^P K,/f 0 v_,/f -pP@LTf +0 3@ 0$Kk[> -L 0 Kh[>P/Q  R0-LP@ 兡T 偡K0h -@P0Lp 000U  g  `P  00aS0500 U$`   ` 000 -LM0pQ`0 H@r@@ T 0PU0 0PP 0T033 0 P0>+P0P0K- 2Pp0     X Y0T -00D aP(K4/fA 0-PPL D@000 (  0R000 "004/f -LM`00 0Pp0@H**0 0S0000 0 pP &G2P p t0p`dgV ,303},8埠V 0 (KA1f -L M@0pH0P`)3  00Q `P *v,i3 3 C03 1P `, /`(0S I,3 3p03",phCW (0,#63 3C030T (K1fA -LMD`0p000PS$30 !h2l200h2l2P3040 @T* 3S @P# 3 03000 Y 0e 0"0002 Q0\"0 0' 4W  0`)@P  0>000\1P_ / 01x0 0x0 @P0. lY* 3 U P?0 0 6<W+,喟Z 叟13 3Fc+兟3C03ZY | W 0DcV 0000Y Z U Z(K4/fdAAA1f -PpLCM `@KT 0L] K K K 1 ,-0 p 0Q  =0S P 0@    K0:PN@` @ 0 uKP 1S08 4 C@4\K[ \   K K0  K( [R$ R( KcP 00 0  000 . +000  H$pXW@@ U [R <+L@ & @d$@Q@1. b @  l2. BR    K @ 0ȐX` c J0 K D`K0TL 0B?o20SE X 1S 0S # 8 1 +1#RC* f T P0Ss   B mWf 0" A?K A?K 1/XO060 0@d0@ 0 @0@yH01 10T0BSlK 0 mP0Z !R01-010T( Y% Q" Ý *  01 \'0 Q[0ÃQ 0 0@, K!@ rfAHK P #P7 0/ 10 `3S 0[S000 9 0S0Hp P` K (\-0[S$ 0S!0 0K,0K @#K K  TPP0PV)啝3A0300C0P0 &0000 S0 0Ã0 0 KKr$@Tq 0 `V /B 0 K  @l K04/[u00000 00"  @L RlK0 K1/ R01  0,K1@ H0Js`161 0V90V 3 Y %0S?Ҝ )0Y003030000[1 Q 0  Y& 1 00, K1@`0[ S00#100V0K 3!h20h2m1HpK!l20l2 ?#0` 0000 0 ؂ c000L00`0 00K00K0 0:/P #P3 0/  pP PP- KWX` J0 @FDa(僜03 X 0DcP KmVk Vh `0[ S4R00000 000  1 RR>P3S 0[S000  0Hp0P73 3K 030h00+0$0K0H0 0KKPP0vp0     0 3 3030 KKwP0`0K#3 t3 03 H 000(aW(KdLfA4/f0i@1f$dAAj@AA -L M, K`pO PPLS,@ U,0@0S?(%P 'PjV*( KP,@0 V:@0U L妛,4],@@U 嘛, K A1f -@P`L  Kh Q-L`pPWppU*0  #@P U   ZT 0 PdT 00 0Pd` -@pH`^NLP@  .0  @x Pd -L.  M.  K.  .  R0-LP@ 0D0 D`DK0h0 -L M@+0 1K -@0ML040  0  ; UE0 K(d9A0/f 0 F0/f 0 F0/f 0 F0/f// -P0PpD@QD0L`T bD0D0SKhdhd0@-EP@0 C@@0 CCP@0B@@0 B1P@P@*@*D0@ 0#6TP0QP0dd4/f -l0LAP40U r@0000ct00h0h @t0 d(n@$d?A -Lm" Kh0 -LM0SYK N]+l0KK "x&X'F$L-63 K4/fCA=f? -L$MP@ 8 UY p0E0#T*TWPSZE(QENPc@@N@TH#`~0p<0 U: <0 040K00@0P C/o T" R& @N@ T `J3h U148  D0 `4D0 000K0PipP  V(KPd 0-@0L @R ,0 P  P 0LdT>f -bL@MPpAvp1 0 1UDK00 1 000! P  0 0_P< @001QH1 00$Q0  P kJ 0B/ \1?PR=000 0:00!&W1P0PX0 0x0wy0l0x0: 0 0 p DDW$KLd 1f?1f[>'_AAA=fL!7X7(B5f2 -LM >R(',' @ 0 N@  0 `p PP ||I0@@U2P0  00 0P I KTi@AA -LMP1p`H10PP0@c0cKy1 p#KT0, 0}$P 3 030 00Z$bPp$@Z lI $\刘@ P僘W <<8 0X0pgXp(Kow(K1fLd[>A1f 1f4/f -LDMplKW*P`pV@@U@#T !P`ZgVV !x$@p(K[> -L. .M   K .-@N@L`P@ W  4 Kh -L,MPP000 01`0 N  n` 0K PG0E1@08` Pp5AZ@0 00<0 0pgD0 80S)  0! P@0S 0 0 D0S ^)P h'3z03#!@0< H80J:C80 $00(K1fLd!A[> -P^L$MP00K]TP5A33`@0p80 V& 80 0 @@@0! PX &0t0   06U 3jF03 @0 z 0000(K-ALd[> -P`.<0@N@ L 0t KhULd[> 0-D@LP VPV @YT#30Ld -pL`V/@ 0SP rP0 \PUP# 0BQ30S 3 B0#33SQ0S,#U `FKh1fHA -`pPLUA奖3S @3SF303"PԖP@#T 0 0pǖ1f 0-PPL D@000   0R000 004/f 0-L 0@ P4Y0S s""哖呖01f R0-L@P 兖U 偖T K0h0 -@LlMP`0 H0K0l \ x0 Tm l0@@ 0@ H0 \0D0 l0<0 <x D<P<@ND04pd0 d  00b0 S00 500 $`<<` <0080 00p0 D0t0 $0h0 H0S 0X0 X0d 6p RH0 SR 40t a=`PK 0 P 3 Q3S40$ "000`40 HHKP y% #Y4 0/ k`嶕3S  40HHK`3SS303!4` 0S ەh0S40} $`H叕0Q @40P L " `LK PK 01/UPK HK!40L  b" LKPK 01/P #P2  0/ HKXY AP0 `=P03 Y 4D0DcP HKqZo Zl 0ZPKnP  k[P00C0 = H`21X&0 0 0cP1? HK$HKwPT V 3dC003!H&04ޔ3(03 1h H"X00S <P)@`0c0S0A`(KP3 mP0|3  P!`꧔P HP 303X0Sn X0\ 6@c0\0 g$d2A1fA8f 00 $K@2cAXdL1NA -@LMpKP` `  K\ 0p 0 `  0  0@?o2P0S0S 0000 R 00 TP (KXd -L@PBp 0 R 0  R Q0b Rc0R R 0B Qpby0P*  U S3#4/f -L =P0T09f -LPp`@T 0H@0P 0 D c"&0y$P 00S 3/000D00D   @0@ -@ppL` 0S !S P᱑_0S #W000d 0-PL@ᎾP 0S B000009 0- P@L႑00LWK0h轑Ƚ%010/d -Lܾ \1f 0-@tPt0 ML 00@@@ @@@X;<0@@0@ @@@0  ;K09f_AgA-00 S0^* S Q05:^!0 S Q* Q:00000 Q: Q:0S00 0 0 -LM@P `R8 @`8 8L0S:X00R00S 0V00 1 0 KP UV00000 #U00 08 0@S0#03R0#S0` 0 8Kp P V000 0S00 00 0,K 0 00` 0 0hp P PU 0T80pV Q*W \ T  SW Q * TQ Tpp P S: T V Q  TPSW{S*V  dS S*8 P` 0 8K pf P> 0T8V0 0 00d80 08KpR P0p J 0T$VPPV00S  TP 0TV00V0 0 00d80 P` 08Kp) P 0P 0P P V00 S 000 0 V0 08K0 `0d80  0p 0S00 080000000d((K -@PLT HP 0 D b00"&|00 $00S 3/`@ -@PLM4P0L S@!RP1U@1( KdP(00(0 (Q*00 H0$?oP20S bQ 0d 0 a`p\*l `Vp`.)) K -P@L M`UHP0`U @0S P000 000Pv HP00pS 4 R @ R  `0!0D !6S P`V 0<4V*40SPU@0S00 80$0S 0 00@00@0010庻H`V, @0S `080 PP 4l04 R@  B@ 0WHpV 40S @00CS@0 !pዻNP K4/fd -P@LDMD0 NP0L0 KS!1Z!Z p1p! |Pg0@D 0 Z0  YQ @ R P Z0R D0 00CX0 W{*H`$0V@0 T D0 Q 00cT0 0Z 0g0gL0 }L0<0 0H0 L T00< 0bRP0 8 D0P\0 PP- 0S* #'X R#11X1X111 RP0 TP0#R#Ri匎 3SPD00SH00HP 0<0:C<0 H P@0Z P1S "#K@0`)@0 X #Kf Dg0 @8/@p(K1f -LM` KP@pP 0P T *R 0T:400 @  K 0-@ PL000K0h% 0-@PLDD0D00 -LMHP`U@4 T 00P i0 4 $p0 U8 Pa SXH  R 0SR00ZT00#$0W4 40R8 80R< <0RL L0R@ @0RW 00"QPxX  0PWp 0 00U000U0000C00  0  \X D0D0H0H000000LP00 SF  \B40 % H R;  RX6H R30 Z0TT  "+$ W(44 Q$88 Q << QLL Q@@ QW   P0SR?X  0 mP 8X00S 3/W   R 2/  R   Y    B    X D D H H 0  0 X (K -@L ppP`00DH0PPPLp`PP)R  $Kk褌|i@nA -pP`@L 0 SA00T @0@0 -LMP`p $8@p0 K@;f -@L 0Q`VD`JKh -`LM LP"# p0 0H@00 Ts <0SmL11011P1 00 0b0a00 0 1 >S 900P 000H0S 0@0S 0 @0SH0 S6 82S0 00-80 40 000000 00P 000HP 0 D b"&0DH00 $00S 3/00$000@@?ᆸ,00S R 3/$KXd 0-@ PL000K0h -` H0L@SP`f   DDG00 $Kh " 0"$0S 0S Kh/ -`LPp@T 3 00000   @0@KhG -`LPph@T  000P00@0@Kh) -L,MP0%$S@8 ` yPry 0 K8P 08 0S000  * 0R*000 0P08  80K 0 00S 0 p<0圠忷 5   Z SE 4<0 0 P<090 T@p84PX8 0 QP 0P0 0c 0 00P !#(K$dPd9f -LM`( K@pP|PP( 0S0V :(0W 0V$0SH0SU  0QP0  0(0 I00P000U XZP0Q00Q0000C00  0  h 0   f 0(  $K -SL M`P@p207. P0L( KSP!X!XP1 (@P@ 0S* 0S 0PT 0S * 0S 0U 0R@%@08 P00 PT EZ A0P& p#T @08 $00 0%K"H000T00T0D0H0T @08 00 0%K"H0$00(K -LXdAi@`>f -LM00Aʌ . 0 o K p-@LM `ᶅPPEPU(0 0000S R 3/0S PP 0KL P% P ጅޱKr  1KpXd@;f -QLMP@0 ~ [PQ 0S \ 00 0CSP#*T 0PPP P 3 @ 0K 0 PPK峑PА T@  ) 0Hp@ h`00 00W T 0 0dR|08#hF0 u009 $#0000H00S#P 0K"?  0P S)#"Ft0000$K!F*K"F+K!F0 00< r0 `"S0 T"S00$00 0 0H00P00 L&F0 &F"%F@0D0<0,0P0<0L0@0400808004000>?L00    L 0@ 000L0   0L0 000 0Fnp00 `qL0s 0s: P P 0 фZ-`0S1!p00 W#2Y 0dR 0 !SP0pP0 Y  SP 00S P PP(Khj@i@h@ -@pP`LM 0K p P ]K -0pD@LP `R!S00S R 3/0000L PP`Lp |`bD``$Kk?Xd -LTMP000 0X0 0PD 80 P0, K 0"$6 0 )6 D P800y 8@4 K P 4p pg0Y 0Y* 240p00p>40040 D00@0 D00\0 40T0 0`0 00h0 0P0 L0 H0 00d0 4@ 0Rd0Q `0S 0@ R*#400 @0 0 0400  Wp pg400l0 ~@P H0840l0 0i0  c0\ \R # 3\ R0 0$P$ 0 00S 3/40" 0"40 0 0  8 4 48  4 8 8 < < @ HPHD D 0'D b"&h04 L0L0`0ST00T0L00L0 00aP0P0 H0S@0 @QdQ R40 pH@ fZH00X00K0P08D 0L0 0 06P@UPXy ⠯v0@pD @0 T 0 R  YT  pT 04 4@ Q# P! S 4  T0 54 ؿ4@4 H 4 AH T0ppX00S VTW00S T 0P7 400K0P08D 0L0 0 0@3T@ @ @@@%Z  0P ^X0S8D   (K4/f -LMP@`080 P0L S@!R`1V@10 K0P000  0T 0T* 0@00 S  V0 \8 [ $ \P ` ( O0p TE 0VB 0V* 804S 0404408Y j0 400   0 o00 $ 0S40 0 0@000Y0S 00 0P p@5p px(Kj@ -LM0D^ K 0-L8M,000 $00@P`!30x3 000`(P @ @p0$0H3 00!830 00`,P(P@ @0,0N?$02 00!202 000`(P @ 0!202 000`,(P$@ @ @ 0,0p2 00!`2 000`(P$@@ @P 0*,00 !2 000`(P$@ @@ @P0,01 00!1'.00 0`0 (P$@@ @0*,00!x1 000`(P$@ @@ @P0,004!!,1 00`0(P$@ @@ @Pk0,00 00!0 0000`0(P$@@ @PU0,00 00!00`(P00$@@0 @P0 ?$Kk+2A=fA4/f*2A&2AddAApdAA"Ad4Ad-Ap -_LM⥏K KK@ $K4``A```` `a`abbbb`c`c$`d(`d,`e<`e@`fD`gH`gL`hT`hX`i\`i`j`kokmlnlmmnmlnx`c?Kn```_?K`C```[?K`C```W?K`C```S?K`C```O?K`C```>`C```>`C```=`C```>`C```>`C```>`C```=`C```>`C``a>`Ca>`C a`a<`Ca`a!>`Ca` a">`C$a`(a#>`Cp0``p4` =`Cp8``%>C oK?#K` \TĂ R  0S0!2 0` 0 0 000000(K4/fd -LxM@|0KP`p` 5T0 <Q< < 00 0 0000000K -LM⬁@P`` K0 0 K\ \̀ p\1+[1;[P 0`(\̠ $A \ 2(1p3B(108C8$YKW+K^;K0hK  0T  0a0 00 0 0 0 0K00  0 0 00  0000X(K0 0>00 : "F< S3 S:LSr*Q 00C0P 0D@ YXY  Q'(Q' 0  0! 40 P 40S8   2/3T3  / R 0D '6S0S 0 <46R*y000 000 00@P 000   (K[>d4/fN/N/ -L$M@:0>0>0 T< *0!P#6DpH0 D 0H 0P@0 |B0 KzP+ 0@0 g <Pc <P%<$`Q 1L 0 $H0S80  }V }L0T$:V }80S }00000 000Q9Q R* QL0T* JP80S 0DaP 0!V00S 0 00c 0g JPD0H Dg@(Ki@ -LLMP 0@T0Q`H0 @  N(@@NP@\K  0h*H0 DP S:L Q3:STS  D!0Pp@0 7/H0S D  @PH %H0 5PH H0 0<0 @0  JpP X 0$0SR D0K 080K0<0K0@0K0 04K$J0Pd@01N@Dp0U  LQ0!03P U03S T( KP(0P @@eX 000 p K -LM` :.#:  . R `c01@VDp00LPU03PPVP!P3UY 0K P P 7K@-0*>"*0b .01  QD00L@PT03Q03S@00*-0*>"*0b .01  QD00L^03PQ03S0k-0*>"*0b .01  QD00L^03PQ03S0S:2:2:2:2:2:2:200 -LM000ʠ>0,ʠl  Q00DL@T03P@Q03S XP@DP,FT@P"*0b .01  QD00L\03P Q03S 00]P KQ 001@ D` / -01LDS,0,0 $0. 0ab/dd -L M`0PS@D0P@09/@` P T 0T 0 0@0 `00000 a0D^$K -L M0PS`@x0D0Pp@07/X0T @ `  0 0  0 D2K -L4Mp8 P0@`0:  0:0Q@0 * 0P*0G|<0  W0w W:80L0W*X 0pG0<0SPXp ,0K  #0(0 f 8Pp5X Xp pD! 0P @0 z%K0"$000000 000T00T040408080<0<0L0`L0@` `PV 80WS 000)<0S80SW <0@ 8t0p<0SP80SM0GJ80SB0>000>0000N@NHV@ 0fT ꠀp0WǹW|z(0@@N@N@T *(KPH 0 (J(0x Khd=fA=fAA[> -D2D"DRLM0 04 8 p  v v p?( `@P N> ``(@1 pR  @ D 4넠 nh200 Ba<00  p1W aP0 00  00 P 0 000` 00  @00 C$ x 40>0>0008 >000D (00 ,  (K=fdl0f1f1f$A4/fP=fhd -LMK t p  K8/ -L,MBP0S0S b<pdCv0U80 Lv20P@0 0E 0 20D0 2<0 1PL0 0< 4K1000 4 0K1H0 80\R1P0 !0P00SC Q Q8 4*  Q    8*08 4*  0 Q   8*0 8)0P4 \0H 00D 1L0PU<@0P`uU @(K4/fl0f1fd=f0 N0 : vl0f -LM`8 <0 @ pux2xP8  00"600 M1S $t  l?RQp R _R@ ,Rr (R! Sk@TW W00K0 0PWU0pKp 0 P p 0 PD 0&0!T p  p pQ  ҵ ŵI 80 `#(0<0,00S0  #i V j  #DGuT #W # 8壬;u (K1fd4/fl0fPAhdd/f -`@ PL Pp"": Kh - `L@VP U  P $Kk -LM3P0S 2 Q004uP 080 00 040 p00aᖠP2 0<0 @T 40SP Q QAAt8ҶP'0 et 0#! P @!    R   @ ``       J@tP$4 5t4<0<0 P @Q@$$yXpn Q D 00 p000 0 80S\00(Ko4t(Kd4/f1fl0f -LM K a KE3S/ 3-0C8L#8S3 00C04/f 0-@L,K0h} 30-SL@ 00030304/f3S/3038P30388w - L  -8L  Kh' -#L@R/ PU v3030S 3 B# 03Q0 003  3:#033S 0Sc$Kk PU Ft0S PD*P v3$q尃S0300C0PP 0`8 .s030! 1 0S1 A  0 X00$00$00 10PA0004000Q(00ӵ0µ$Kk;sd/f4/f1fl0fdhd -p`PLUA0Ds 3 ᚵ3 03 03GP - 0LS0S Ls -LM@P0S  0R dp0& 0K # ` a Q &0(KX>f4/fPd 0-LM@0@@@0 KK@ \P  |r@@ @P0@010S 3/@TK0tdPdX>fl0fi@ -Lf4/fDrAzA -`LMv80PR0 @ 06S q00嘴 rPP 0K ` q0S P儴0 r: P K[>X>f4/fd>f0 0 0 2e2l0f -LM@0@ 8  R00  Q SPUpp 0`qqT P ,(0#6PTp P`P` Zf80W - P@EV`1 00M0 vLV0`0 0 W0 pupۮ,K -x@L ^ P  P X00,0UPf 0-3L@ P P 0 00(0, #6 P 3030 0-LMPbp|0!x00R l00S` \0@A@L L0000 00(吲K01fdl0f4/fA$dl>fx0fD/f -T L00<S8 Kh@ S!PP4/fx0f 0/ 0-P(@Lp0K0hPp1f4/f -`L@V (UQ edU 4  10 10 v0004/f 0-@LPoL0 0d0,0R0唲⑲ 0 K0hp1f4/fx0fl>f - `LPV0@@TpP V3#03 B# -LM5E!5 o 00 do00 ToP5LU0S 0S ڈ0S  5$%00ر000oo `0S0 R 00 xoo` qo@00 00 000 0S Pdo1xP pP 011p0 kP IP  `PPU o0 ű@oP 0c0p 0@ !WRʑ# ro101X!!  !!#Pbo"  1/ o Ὦ#* ծP# ##! ( ,0 0 m1Z 010 00"/oXڐnh2d"X00X0  @R KxX  ,KP P{ | x p t #  #  o xp P   (,! pY p ,0K p @nxKhn$10$1aPnxK<n @0RT P0RQ0Pe_oRU@0` <0R j}n ,0R0S.0 0nn0 S00ӈ Scn0 b΅dnK#( #Sn pon d4/f1fl0f1fl>fAx0fHA 1fD/ff -3LP@ j`P 3 tn@nn -L MRP H K408@@dK0@ P TK4/fv -\PL`P@  PV@ 0 ,0@V @_T>f>f>f -L M,!0D@P0\ P0408p8,` DDZNALĠX0  WCZFdP@Z@@XX00`W Wp@ T P p`@0q@r`spp0(Kt>f4/f 0-3L@   x0Q    #,#  B 3\Z00 P  @ #,#   0t>f -`0pLP @PbT VUV ڶ3 P`FU P (1 0(1PEm@t>f4/f3   x0Q    #,#  B / /  00Q    #,#  B /t>f 0-L@0 0,0   #,#   0t>f -aLpp0S0@p0t@TK 3 @TE 0LQt0 10 1 P @0 101$m"m PU 0 R P s0S   0 0SP Y |0Rq0S X$ 0$@ r0S $" 0"t>f4/fj@xdh@{/3 /P000Q000/t>f -@P0`PL d! 0P@   (  4 @P L2 XKht>fq2/00P/t>f0 00h  C40@ S  /t>f4/f 0-x@L p d( X4 L@ @L 4X (dK0h~t>fAAAAAAA 0-@LP| 3R#40   R h A $A$( 1  B 0303 00 0000@ @@04/f -pL M`k\1`@TG 0R00 0 3<00 03PP-pi 0 0"0!1 ^ PP@QA    0  0 R$  $    0 R 00ӵ0Ƶ(Kok4/f1fdl0fpd -L,M S@!0J300p R#2\Q D`A` ^P %V` R: T0S \k%(0, 0R P'6$F80 0D40 0&f#60c<0 000 00L0 HpsP} 00Pu80S0lV*@P@!@140@D@80@S10!@0  RD @PXV!40@@@|0 P@1@0  R  < B$ 40@@D@@0P0 E` 0H0 CP00X P0 m HP0H0 S aLAD0`k0PU  }000S00 f vtj'680 0\&f40 Lj, (00 Rq000 00D0 @P` 400PX p2Pp!p1`80S0=V*80fA/0@/d/-00,0$S" 0P1d>f -L@P`,x $0S0W R&R#*& 0  00S 1`VP%`F`T,PXE,E@,4# Rlo#P! L Ơ  B@  0RX0`V `F`<0P5%T,PXE,E@>fd>A -L`@\,0! P!*   R ` PUT@$PEPV,@XD,D`>fd>A -LM810@Sp aP U 0 0 T00. `, 04 V6! X`"*,0 %"0 00I V ,L,J,0T &"0 pp4 PT 0`P(K4/f_AdAAA>fp@-,``0`P R ?0S$ P :P*Qlp B/ pd>fp D00P 800S ,0( ///dl0f>f -LP -LPA -LP,0   >f -LP,0  >f -LP,0  >f -LP,0  >f,0 0P0 />f,0 $/>f,0 (/>f 0-L@P, 04#(0>f -,0p`РL0  h W6) P@P  80 #6< @ D H L  S : S *4 4 00 0hYhp>f4/f1f 0-LMX0P0PS003>8@00=0""  >,0C# K0l0f>f AA -,PLM0d@(0 `@( 0pS4@ 0 0,0F$(0K0@0P0 0 ( K>f p-L M`00PS@||x00Sp T`\X%* KlhP@, 402"P`$@Kpl0fi@)A4/f_AUAyAA>f -LM`,K!@PPepP*Z1 80 R00S (,PX100 0! P CZ$1pWpGp,0 `&&T,`3XF,F@Z80 R 00f 0,0R$ ppP0P&` ,0P $$X  0`f `<PP(Ki@AAl0f>fd>A A4/fOA -L(MP`pcKp`p(K`#KV0H$HH@f$F(@ f0 0 00 1/0F`p$K 0-8 ML  000 000  KsAGf -LP00Gf Gf QP-LMP @`pa Q  0!  V0 0!ı708` pa`0@ VP SR/!R0 0!ı! R bZ:#Kf#KV 0I 0#KZf#K!0 ` pZ#`(K -gpLM@V@@+K|0 R 0S 4\Q 8<P<< 80H  BH 80 //Jf4/f\0 R 0S (Q, P80 //Jf 0-`@LPU R0 P ` S  R   0 0S  0 0 `800$ <00@8@@H00H0Jf4/f 0-H0LP 0 @ST000 0Jf -@0Qp00P0L0ghP0e(,ঽP (,fP $0R` `e000P0pPpe40t0S 0``FV`&&`4040P "peeL0pgLpT0$ 0bT04PXX8e, (O#0XHP@4/f 1fJfdMfi@yA 0 Q&Jf -L(0M 0 0  f K34P2 -00ML06 0 0f K34P2 -LM600 p1!Pa4 P80 @P  0 E V? 6%:V T[4<0 6 S  w(!<0 !<06  !$0 000H S0| 8P0d0T  T eX 0 040!800R0 00XdPᐡ` 00S0db0dǢ(Kl0fdMfhd!Ce\b2 -@LL D0RH`P000L00L00P|dT00T0dp\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -`@L$0  b00b0 00C 00S0D 0S   R0 0S0I<x L00CL0000n$KkJfKf -LAKf]Kf -`0LpW @PU d @D0S  000Bn4 0 4F8P p Jf -LCM@0Sp`A x7H00 PdcT庎 RUP (7HP UP!B M@0 !~PAR|~@@0 $PP0 S 0| x |P`6`hgP :P0S*E?K & wP" KCPPo0S% `  0T 0 1 0 1 " CKPP T`00CSGh2d222222t0SP=p0P5 p Y5P@aPP  PaU Pp@04`0t0PS 0p0!X$ PDa]P (aHP a{0! P IK 34p 1 WtX X "ZPP I?Kp"KPP0P4 `000@x R0D D0?T4;%VZt0S00EX$1 b#$1 0i1 $1W" `@ 墤H B¢£ J XT 0Z< 4j($O>K" Pt0S !0S  0!!P A1x(0,P`0d00041L  L P P aP8PP0P 10W "U' `aHP`uP`P 0l`P PPP L (K4/fKf`4e0afMfAFA 1fAdAfuAAAAJf AdT2A*j@ A -Lƌs`PU) @T$ 0 4`P# p ` 8 <0R0<0<08 H00CH0V s8@ PT<`0,Kop7`W )AKf 1fJf0 .0 0-0x -LM#Kt0`@SP  @ 060p#K  #Kp` P(Ko/ -`pLMP 0@P0 =# 00 0 0@P/Y^Z3 Y030 0 0Ḡj^ 303 (P0#10#0 S#0@(KfAnA -LM#K( @p` ( @`pGQ W,0 PER Z $#KP @#K*R0`pG#K0 PR Z#K*0#K`V#KmP @0`(K -LM0@p ` 0`p]$V W   0 00  0] Kk^ -@L`p]dKh ^H/H  /H   @o/ 0-P,0L@T P@0d0/d -L 0 Kfd -L M`Pp0P@00 pP0 ЉPP0|P R @@0% K⩰P000P8U4PU@@ KKfdvAd 0-LMPP$ 囉P 0xS    KxP P 0S0C0@@(T$!K0KfvAdd-/ -@Ld`pPg\P@ @T@ U@  4/@`峉Kf@0S`00/0PQ/ Q   /0P P P    // 0-@L,00$00 000 0000`222<2?oQP0@-2 R 0R 00D$T0000 -`L@PT`@000 P# pW#  P  P0@S p@ P  P@pW0S0PPP@P P/(d 0    /0PQ/ Q   /0P P P    // D00-0<0@040L0(0 0000 22@22 P P/KF? K1"KK7@P1.K%0K?KK0AA -LAMP 1 00a  `!  d! !1 1 0  04q8<@T ġ ȡ p̡ С ᬡ ᰡ ᴡ ḡ4A 00 0K  c 0 p 弐 0Kg @tx0|0 Z0x0x0 1 t 0$0p0 0[l h d ` \ X 0k T0 0K|⬇0\#00KGK1@K< KK0n@P0$#0GK0/GKF@P ZpW U4qGK8P @ Z 1T 0q傷0K` l2 0 0;K40 KT:K(V0 \0 0 0 KKKK)KjKѾIKѼIKѬ@ K K K@K@K @ @ 9KN{40 K!@Pe1V1bv0c 1 尐T0 !  p00AK C/Kh  Ķ@PC ( K(0 K` e!@P;0S @1 1  1@ @@   0M!@PQU 0 S10@!PP U 0SP  /!P @W P01 (K00>0R @p c pP@@$400(K2h22 -LMP`4PopKx Bd@TG 00 0$0 00 00 00 00 00 :0 0|0 0x0 0t0 0l0 0h0 }>d0 0  0`0 ` 1\0 1X T0 0 0P0 P 0L0  0D0 01x@H 1T@0 0`@hP<0 `P^8P0P00TPg 0x004 @tP @@ tP@P@@$KP Qb55/Pd  0-PL@aP 0S 1(S3 SP00A -LIM0 P3S(pP*1S S``2S P221 $10 0 @P0,0(040002P""瀂R0'0CS@7  0 0 0@P00CP01 h0 @T ,0K #0 14/@P0 1   ! V  0@H0 `0 ( -QT@10 S T! 3L0P*C#@D@0" 0T @ 01 00 0S S0(1  2Y$000K0  00`. 0. DJ0 (0101D0 >0#60KШd -`L@V 00 X00  0 P=Vp  5pd -0b`pb 0L@RP:000U@ P \00 0000d -xL@$ 0$0SP` 0U*05# P P0000d -LM0@S6  * 0:`0 +( P0q"P L0xL00L0000 hqn `  0 D@P 003/K p-L$M00Q2@00 00 0 lP`0   ?V 0 0D . .0 Kp 0-LMP@P 00*"*0b000b0P0  000. D4PK0hK0 -L(M0K02 0000 0 PP K -LMT0p $#00<0<001@0CUT@@@01<@<`@p0bPg 80`g` R 0b 0Es 0 00 000P0e0P 000PP0 Kd2 -LM0`@00Ѐ@P! P0o/KPp WPT0$ K0 02A 0@MP 0 $K8afLaf@afedAHaf -LM0a0Ck $yRS0 SR2 K偫PQ2,K@0!2P 00@0*DSP PD0 x 07 hAT TPKqeP`4KxP PKoPIP ڰ0[/S,0K`0p0F@K00T00Sp ApTT!0P0 -0`0K` s00K0d K0KUnP<HaP@Q04 T0   Pb=nP$0 0C /P 0 0  P0dP  KP ` %nP  KK 400  tnPph,(Kf -LdM00@ 0 Q00hK00hKhK@`Tڴ@D@Q hK 4/0 & :hKhKt4/p0hK0&#: hKL4/KLf6@YA@@[A@ dkA6@i@@T>f@4/f@ 0-LTM,0?@0?`P0'> 00P(`$@ @@@ @p^0,0h? 0\?0'>0P0(`0$@ @@@ @I0,0? 0?0'>0P0(`0$@@@@ @40',00!> 0 <00P0(`$@ @@ @ 0,0> 0t>0l>0P(`0$@0 @@@ @ 0,08>,00>000P (`0 $@ @@@ @0,0= 0=0<0P0(`0$@ @@@ @`0,00x.!= 0 <0P0(`0$@ @@ @˞0 ,00!D= 0 <00P0(`$@ @@ @ᶞ0,0= 0 <00P0(`$@ @`@@ @ᢞ0,0< 0 <00P0(`$@ @@@@ @᎞0,00$0`< 0T<0<0P0(`0@@@ @xS0,00$0< 0< 000P (`0@@@ @b0 ,00!; 0 <00P0(`$@ @@ @M0,0L; 0l; 00 0P0(`$@ @@@ @80,0(; 0;0;0P(`0'>$@0@0@ @"0,0:0: 0<0P0(`$@ @@@ @ 0,0: 0 <00P0(`$@ @`@@ @R0,0D: 0<00P0(`$@ @@@@ @`R0,00$0:0 09 0<04P0(`@@@ @Ν000R0,00$0X: 0 0|90<4P0(`0@@@ @ᵝ000R0,00$09 0 090<4P0(`0@@@ @᜝%0,08 0 <00P0(`$@ @`@@ @ም&0+,00!8 0 <00P0(`$@ @@ @s(0,0D8 0 <00P0(`$@ @`@@ @_)0,07 0 <00P0(`$@ @`@@ @K*0,07 0 <00P0(`$@ @`@@ @7+0,0`7 0 <00P0(`$@ @`@@ @#,0 ,00!7 0 <00P0(`$@ @@ @-0,0;$06 06 060'>0P@(`0@@ @.0,0t6 0h60'>0P0(`0$@@@@ @10+,00!6 0 <00P0(`$@ @@ @͜20,05 050<0P0(`0$@@@@ @Ḝ30,05,05000P (`0 $@ @@@ @ᣜ60,00$085005 000P (`0 @@@ @፜70,04 040<0P0(`0$@ @@@ @x90(,00!4 0 <00P0(`$@ @@ @c<0,00$!@4 0 <0P0(`0$@ @@ @8 M>0,04 0800 <0P0(`0$@ @`@@ @8?0,03 0800 <0P0(`0$@ @@@@ @<@ @@ !`3080 0 <00P0,(`$@ @`@@ @ @0,03 030<0P0(`0$@ @@@ @`A0,02 020800P(`0'>$@0 @0@@ @B0,00|"!\2 0800P(`0 <$@0 @0@ @˛C0,00$"!2 0800P(`0 <$@0 @0@ @ᵛD0,00!!1 0800P(`0 <$@0 @0@ @៛E0,00t!!`1 0800P(`0 <$@0 @0@ @ቛF0,00!!a$ 3A@3A dAA2Apк9 B$@0@0@@ @J0,0d1 0l10800P(`0<$@0 @0@@ @ΚK0,01 01 00 0P0(`$@ @@@ @ṚO0,0202 0<0P0(`$@ @@@ @ᤚ<0 0@00\20P,0<(`0$@00K @@ @`Ꮪ<00@0,P(02$@ @0<000K @ @`{0$020 K 0<0,P(0@0 @020 30800'>00a;$0 0 0<00 K0@0,P(0l3 @0x3A0'>0J30 K 0<0,P(0@0$@ @03030800'>003<00 K0@0,P(04$@ 04 @0800'>000 0<00 K0@0,P(0`4$@ @0l40800'>004 0800>0P0,0(`$@ @`@@ @4 0<00@00P,04(`$@0<@0 @0ܙ(5 0<00@00P,0L5(`$@0<@0 @0ƙ<00P,0@0(`$@05 @ @05 0800'>00ᯙ(K 0-L8M!1@P`000 00`,P(P$@ @ @pᐙ 0,00 $00!0 000`(P00 @ @0 y0 ,00!T00`(P00$@0 @ @0 d$KA343pAA -LM$Q (R`p@0 R0 R0 R0 00 0K` s0 KT 0 0@00 0 0?o2P0S R08R 2222278870$KLf -LMp0P`!**@"&9 !|0K ` -0 KL 0 0 000000ǔKp4e -LMpP`K0` @0 0K\0 0 0 0`@000 0ᤔ?o2P0S  (K`af -LMpP`K` 0@0 0K\0 0`@ 0 0 000 0y?o2P0S R (Kd/u -LM@KP`p ` 0S S$0 00 c":0 &$0Kh # l0l 0 0bS0#610 0KT0 0@ 0 00000002$KT>f4/f -LM@0p0PS` 0"(K|0K` n 0R RK Kl!00L < 0 0 000000Kde -@LMPpK` `? K\ 0 0   0p  0 ` ד0?o2P0S 00  P00  (K -LMA 0 `^PpK` +0\P 0 p 0 0  0 0ᜓ0p?o2P0S00  pPp0Sp +\0ؿ X(Kxf -LM@ 0 `PpK` Ἷ+0\P 巿 0p 0  0  S0?o2PppW0S +\0嘿 (Kxf -LxMPK@`` pႿ0X0 X .1D0  S00Ө?$0@D0 DD T Xh0ը 0 0 0 00000P00@DT$K9ed -LxM`K@P` p:1X0 X ; U(R( D D0  S00ө?+(0@D0 DeD T þY ʀH ؀  0\ 0 0 00000`00᧒@DTD$K9ePd -LM_@`0 pK ` ݾ K\  0p 0   0 w0?o2PppWP0X t?oX20S00(Kd$d N 0-PL@G0T 7H0 -@PL0a A 0!0 D!(0:0L1 00$0D妙$0$$堙$0$P0(00,0(0S0 04000$ t0 l  ?S Rp 0 S080t0900S  @t0 l$ 0 0%<!0 \0X 0`00d0x0h0PQl lKhxk@n@@B -pLM`@^CPK ` (0KT0 0P@ 0 0 000 0Ñ?o2P0S@C0P$K -LM@apK  ` P K\ 0p  0 P0  ᔑ0@?o2P0S&00 0 P 0R Kk<0Ta)K ?)K Q 0)K$000 K0/(Kdɚ;6e -LMpP`K` 0@0 好0K\0 0`@ 0 0 000 0@?o2P0S0S\0oK _0`P 00@P0`(KdTd -LMR`p@PK A?K` _0@ 0 0 000 0P ?o2P0S$K -LxMP@K`p` 9T *0D 0 0@ 00000 0͐$K輆f p-L MP`b00@0S 0 Kp$af -L,MpR`020; @PӒKFL0K0P0 0U& 00T0 Z X LK⏼T0  0PH  L0 swdnF LKH$FZ H @P \F땒 @g@(K ef e -LMQ`0 @ Pu R 0\T@@p0좟P0 nw pE2Xb `0ScEOPFO00 rp FWE EU010#pᔠ0 Z' 0YS K E E K9 P  Xr $ E Rf Z4!0p e0C0 @4 EBrV 0`fV` #* U0 M @ J,1E00 hrP 1E lEU010#0 Z" 0YS ^K iE E K P PE R Z4!0p e0C0 @4 E<0=Eq] {Eq# R<(K00`0(P @.0,0<$00 00!0 0'>00`0(P @0 ,00!|00`(P0 <$@0 @@ @0 (K/@A@A A@AlbfA 3hafA*A -L 0 ,0":00& 00 00P0(p$@ @@ @'0,00 00!x00P(p0<$@0@ @0 (K7Ad=Ad@9eEAJAT>fTA\AeApA9ezA p-LMP` ` Ӎ?o2P@@T 0 S S0000Kpdafhbf -@P`p|30ML 00,(P$@ @a@ @Pᾑ0(003 00,$@ @a@ @P᭑0(02 00,$@ @a@ @Pᜑ0(02 00,$@ @a@ @Pዑ0(0p2 00,$@ @a@ @Pz0(002 00,$@ @a@ @Pi0(01 00,$@ @a@ @PX0(01 00,$@ @a@ @PG 0(0p1 00,$@ @a@ @P6 0(001 00,$@ @a@ @P% 0(00 0'>0,0$@ @a@ @P 0(00 00,$@ @a@ @P 0(0l0,$@0 @a@ @P0 $KA@AAB-AAA $BAcAAAA0 \0-CL 0@P 0R  P 0 0 = -(L@ a0@`٨PP0 6aWV`3p3:`Vp0PS S&0 01#d 0WV0t0d0 01#d 0WV0,0$MfXdAA 0-T@LP t0S  00P  0 000$Mf -Lh*n`pP@U 0t0SlXx wnP0 L0B n Phn0A0Mf$MfXdA$dA0000 m$Mf -0ML00`p :@PcP9 BKƔPP3P00 1P Q 1 j AKPP#t0S A P"KPP )K? RK1"KKPP *'"c'P mY0S 0000P`P I@  R <0P$0,0/@P 9m$K$MfA!30Mf -LMRp0S@ lK0Aw lm0SPJa@0 Ё K@0klKm A0 K0Ky_ @AK<0K|K> C%K᠕<`>C'K R00t'K`Qt  R0='K t t|k(KK K 0'Kht Q 0=A'K At D1t|0 41qK ($00,hK@0<AKwL z`H @l0 100S. 0#K@>0 40K0000000 00 @0l KYPP  < K@0$(m(K$Mf?B$d d C "`P0ZP0P?P09U 929/j`P 8 (! ` RP (  PP 9<29U P~V 4"hQ. $0P J/K01 TPPk(` RP(PWPqU01[0q`P PY 0a 0 0 1 '- CK^PP DI0(1 ?(t0S P7 KgP0SPUK0 *K`0  00S 000 000 000  K([.0EK$ 00(1 1 0 1q IK 0 3/P( (UPX 41 (Kxf 0S0 0Ab,$P|0T100!s~0100000009e[Add/0 0S/9ed 0-LMPQ@ 4)40% 04 S$$ Q00 @UH 0040 , 00C00 "K0G3dG39eHd 0-PLMp@a7h1U \1UMT100GH1U= @1U B000 0PP810P:P1P P*P, ክ0P0U*{P 4000040000(00,000 0L1$0PUD000PP L7K0:ec,c@9ecc,dd --LM0  0 KMf/Mf-//01( /d ::#0,/Q -PL@n@@HT Kh6 0-@L 50aA -@L/   6011>10Pa1?1?1` @P U 0-@PPL6@0<0C@00S  0 6K0hz6@:e@-!2 !@!$!!!r!E0!311S -A`LPM 0-LDT0p@-!2 A!Q!5!r`R "!P "!001Q!AA 2S^0C01p20Q 0SQ0CQ p 0-@P@ L\6 @0 S:=6pp00@00 S0D00@5001#60@:e diAA:edQ-  1 a>Q " R q 0o`0 -px0L@T `0S@4Pm50 S*P P$p05=e -QLM 0 |E iQ70pS0000 00 ?o 2?)0HS%0 0 0H?oR20S0H?or20SׁXM5@3H53`00 V `0S`t0S 0Sx0 RP .5PP0 @ f5T@00 bP 2Y54P=0 51@ 0 00 0 0R|*0Z0 r PUo X`2$ 0Rh 0 W00R0ST 00 4x0x K0 > K ( 0 4 K| x 0KKK( R  pKKt|L xH K < 8 4  44xW01x0# K{4Z000 00g0 X0 0$000Cs 000 ~ @4043aBl`X dP00S00004(40S 0)0(K\af4L2PU `0SP@ R00S0y0001`hi4g4`埀ot0S 4000 0@ R4T00 `P d1F44p=0 31t@ x0 0|0 x0t 0R9*| 0S| / pW, 00 30 0R $ Q!4p ?R h 4 @@ lK0 |04@0 lKzP p0@`@0Cp0 0$0t00t0 @3,03c`Ty {(K@:e:e\af0:0 D  B hࢧUڜ1S Y  44 ! h<00 ۧ800! hVڌf401001Ҍq@]1(K -@pP`L100000M140P11@ -x0p@`!L0Q P Z `1 2!001 d -5L0M00 0@P00 RPa1 r10S10:(1 <0  0"1 40 280 4 108  0c0P  's 011 R40  040  %;00 0P P P10nX <0 0(Kd:eA -4@p1 P1 mL l00U 0Kh:e 0-`P!L0q b P R)0D@P 1RU \P 0 P-0 6k0 0, @d:e 0-@L@  00 0-@L0@K0h 0-@PL40 @ 9010:e01 240gAd g= -LML2 1014820@1=40 /q1WPńaՇ0PcU  `Pn g I  UPɒ0âZ?҈1Ճ?Ҍ1 b/c> ! !1 11P11080 000 U880Z1 `V. (Q1UQ'< z/0 < 0 /Uڌ0 l00`0 02"!!!r!E031 P4!/(Kd:e -L M11 B01`000 g⡟PXP`pU!Z P  R 00 (\ ```  BU0 G`P^X 8 cQ020?SڌEP !.011QPoQQ F ?10a(Ko(Kd:e -LP`p@ P" 0t1 211 t PPR @0 @0 @PE d -0LQ0a4@1Sڽ@V4@ B1S PaQ`1U0S  R R    Pd 0-QLp@T@d T l`s.f8PPP.T <0d10z8PU@vt @0!#4# 11 11 0R!  P 003/0P00  P PYE@0P 0<00@0000H0 03/P  T +0<  00 +50 40 *80 080+0! *8008080 R080040 00@@0@@0@0n$0a* *000 0DWU XY 0(K(Nf Q-L`@ 0GPDU`  0-80L@DP i* 1T0 1  T0  K0h*0 -L M<0 ``Y@pPDQ > d020$ ?"9*80$080 0`$`90 0p*()*Y<  08  @0 0tv:0<0 0#K00,0 Dp V*DKsp *W$00$0$`$`G*$K -` @PL}P 0U M) -@0(@P@1L b})1T ʄ1 Q @1S@ 10S@*)45,Dd  -@L`0PT 0T .UP ,ZGV0J@?V@0,I@PTUPP@ 00 &V@ik (Nf 0-0@L U [) K0hNf,3_A -L MPp0 f 0QSb A U{PPP `UR0s  UJ@Q% P@S0@0` j wY  ğ  @`@0 $$ᮛ 察0d 0cC100  塟00(S00 0U(KNf(Nf 0-@PL) 0S& +U P U@Pd}U0PU HvU0 PP  PhU00(Nf0S 0H0/k@ -LmM  ! PRP (0S &{ 0S 0 mK 3/Pmm?K 0`0a 1 U8 Up1p#p@1K/K4/PYKOK21 0:0P @ 0SH 9 000 0 9/P90`0C01 @T1Pg01 V1`'0S 1   4P1 21 0S iOKeKsp1    P aOKX w0`L1 (0A 1 0p1 @0Sx 4P 0S eKiKPPy #Y 9(0|1 0!x1 0 _?K0-(1=1 ''K?K!R @8  !T|!x1R 00|!x1 0!S 0S eKiKPڸ(@@  B@  Q   8  8"  1 'H  2/'8 1 Y! 8  !  p 80 080' ~'|' 80 $#0  #0080 0080 0 00@@0@@0@0W''p1 KK @4/pM'K'101 K?K1 10S  Y R1  |x!Q  |x!1Op'n'W p @1 KK4/0! b1  (Kd -LM,0 00000 00] Kk@ -`@LT H0 0P3/P @ -L0L1 R1Ma& P  :Kh'd0 A 0-@LT0 0T0` 01 "Ķ Hd  lP ɧpP ŧLzy 0PK0hd8Nfxf 0-PL@&0T &0 0'唎Pd0 娎Pd -L Mp`@4 K P:/PePWe4P 00K FP ?P@00S 0A03/00`@0@`(K$af 0-@TLlMpD0 l0 @ h < lKD~0P`XP+ PdFtQ{"NPw"$_Pq`0(0`l$ 0;0" Pbظp0K02 0000  0 ڮPE p a *L ,!P (1Y51 h :/PD0P S#*L S :,0S004 @SR%lP lpP ptTX  @"῵ ۦ`(K8Nf`d -L0k?0h0pp000K02 `00P00,qh00pfW 0p00rZe00rYd00R00pPW0000P = q!000p 200!0D q001a!10 0S l0l00l000S0  0@00\0|0|0S|0|  0|@0 1 R @@0g1uD03/ 2!<Ju00000t0(0VL00e! c!a!  A[!xMlM@0<  :MDM @ H!e(KAhd A!A30#6000040>0#60@0>0#6000800<000qP  + 01p0 X # 3W R l0      2/ p l0 " ȯ WJ/0qLPP UP1#k p Tq 0/S+ Px xph00H̀@0h Nc`1<1d1D1,0K4#p 7/xpQ l8 0x0WT1<cT0  81\K\0 <1X0 @1T0 D1P0 T! ;pPg70S ?}P R0.,1000`0 9`0p0  pAl0 pw700l00l0p0h0 *0 0 $ 0P + +Pp0Pq0  0  pWpW`0<`0pW KprpW00P 20p 005 h0 0,03/h00S  3/᛽h0 $p (0bSWl pp Xm(0Xels003/4,K P000!l0p4 00 0 [pP9 003/\Wh Kp0SHKLqjq4 P$h傿H KlP ipP et0S E el  \l \^\p0 (0Prl0DP~p0~p @09/,K0)003/3 0000 0 DpP\01 003/Hn 1S  h00q 00S l0SD8  R001 d    0 0x000<00$0<00(00 -L M@ `p PY /p33X3X33(3X3<3H3x0S' %P@ t0S 0 S 00Z 1010$0S0N0QV D``0 t0S U 0000d0 > R001   00x0 00#<000<000W PX <0 P9X <XP0h 9 w(K -P0aL@T T /$ 6$0(0S0C0_W4A 0&P0S0S/t B\R R  B 000\00Q0\0x0D10S  0 00S0  00/Mf -LLMv0AP0T pd0:d00Sڒ0K80)d0H 8f) ,KIP  0 0000 t P 0P 0C0(  ] 0 1111K0 t0L0S J@1S "0P0 Fy1&8b080HI:>̡尀180S 3/p0  WQl0 00l00l010T: X! 4:0Z0T0 sT0 S  +OjB # b YX  X #<OY " %m' 1S h0/ 30P T " P 0T h 刐  h #+h  Q Q 00h |P Z  $1S(!(!$!(1 0S   1 R @@00ㄠt00000T 0S  0 00S0   0@0`0 x0SI\0S D K  DK 1N0<0 7X 1zN ](2 Lx0P ($p% ZD1(p5D10 tp0C000000 PE{aZ]MfJAP\  t0S\00\0 0U0`0@ 0h  hP 3,Kx 000*\P\ t0S\00\0 0Ux0`@0h  0 HP X `XZl0S  R #P p px p0^ t R p""p0d " t0 x h ` $ V! h P#+h @T@"@\ PR \ K \KqLz1t @< P  `P <T T <6<X6<<X60S X <4X <0. ! t R  B R x="e" R 0@+}@u7<9~|P lL -H$C;" B/o0"S R<0t 4000pv(K  0Z d` 0 0t 0000( 000t0(0?`00ܠSx0 000 0l h0 h00 0 \K0\0 0P0 0L0 L1 \K00 IIH0 (K;edd8OfAcAAA A!AMf `1<<S81ʀ !` ``&!4  4 !`!`000, !  !0(0(22(2x??P V40?PR7?Ph1S d9eeee 0-LM@0 0h0 00K0P0aPP @t0$  $ 0 @0K0A3A 0-P@LT 0 3/@0 -L@`P@ P ` P00S0@0S   N   d 0-8@L0S R 2/0 d d 0-0@LP 0S   ! 0 d(00S R0/0/ d dd -P`0@LV? P?0Ofd 0-P$@LC?K0h?0Ofhd qd -P`(0L@T 03/@ d Z dm 0-$0L@T 0 3/@0 d -LPp ` @P  p `C40 , R @@0@0 dA$d 0R 00 d P0-qpPP`LP00@T 0S 0 0 3/0@T 0S TKh 0S 0 (0 3/@4l@liA dAA 0-PL@J0T 0 0-(@L 3000HOfVA -PL,M@`pPwP i   0 4 K   p00 @0d@pP xwN 0S 4P40 P00 xZ?`p 44Vt 0V 440(" `!("4 (2<(24 (2@0(24 (2 0(204(0<V 440 U400(Kdhd -0LA0P PtL!Qh5(2  XP`0HPT 00bd_AgAHOfA -LP\T`0LS@ PE0UHOf 0 dA\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -0LP0S-@p`YXW @ 00Sp0p0xP `@+\0P@P0P@<P T 0@0 ((I|fdd9eBAAALl@A0 0 0/@;e\Of -pLPAy0S 0O00P` 0FPOP,Ko{lp@ z0S=MV 0JOPPj el,Koald@;e -0L@ሁ`_pW P@ t@30` S T0嬐0@d@D$2 S T0d00@d@8Vpd@;e0@o/@;e 0- L  KhL5 -LMpP`K` 0@0 0K\0 0`@ 0 0 000 0Z?o2P0S  R (K9e{ 0-PL@10T o0 -L 20CS 2$"R T -@0DML@i0 00@ @0@0@ 㸺+0x0K@ 0000,00 (00!H0'.0@0$@ @00 @ 0 ]^K;ex3A;e9e3A 0-x0x@L p@RI((1$!GqH LPLqDD?@@<0002K0h%;e@d$dhd5 AdAPd$ 0 s($ ( RdT 0-@L0Qi(0S0t0d01d00S 00C00SK0hIT>0S $00(0000K0hB -`PL@P 101'k00 20 201D0S GP0 !!0`1\0X0T000, !  !"KhdeeeP L1S 4/(00S/ -PPL` @+PPh !bD010Q V@ @T Q 0-PL@.0T l0 0-@LT t0Sl02l0++|@0 p-LM 0@T P 0 ` 0Q00@ 0000x0xPt10 03h0 0@@ @@@0~㇡ 00Kph[lm@ Uf 0-80L ^0t0@?0x00Qf0TQf 0 T1Qf0 THQf p-L M@`PUPUPU 0PK0% P o Kp Q-L@P& Q 'Q Q "00CSa4a4Ta4a4DZ`0ıV@0T 40 00CR0P d 0r -L\M@P | 0 Njp  ËDx c\K@PsU UlT0Ppl0 \0Xpl0 W@eP`1t0 hP W Ut0x l SP1Z# 0qPKl0h 0l0 x0h X@p0 d0 :`0 d0KL0 0H0 0JLK$JJd$K<@ 8 Uq LK WP,p00S@ P|0 0RS@3@f 0 p 10$01l0 0S T! R  X!0\10T1 0^00t1!  U0t1 0[/0N000 -@PLM  /㤐 堐 圐 嘐 唐 吐 匐 刐 g 0!04 `"08 p"0< '#0@ #0D $0H $1 0%0e< h&\0l00p0`bBp0pd\Bp0phVBp0pl|PBp0pphJBp0px0t0D1x00A0<0A0<070:0S0@(R- #0r/ / A< 000 !R A1 1cf gVf쐄00t0h1t =C1k1d1  <[C8000 0k1  &? Jp ? t R 01KJ00 4100 8100 <10 0 f KNf10S0BRS00 R*D*08410101010 "& @0 "&0 c0  ? 0`` !(0h1$Ap0pP0000(0S 0400$ t0 l  ?S Rp 0 S0i1t0j10S  by0  0& 0 A0夀p`KS đ堠 ȑ p̑ `Б ᬑ ᰑ ᴑ ḑ 쐔 쐄夠 娠 41YV p `  M$0 |01f0010 0Sh00h0100Uh00h01 1 0=l0 100S R   0%00t 0BRS00 R|*=<0 KK(11<0 }%0110K00 0X 00K001010101<e 0 J`V )؉ 0 R 0 J) 0 JK84ad ? ` ? A\ ? X ? AT ? P !? AL ? H "? AD ? @ #? A< ? 8 ? G<&p `0 K0P 0 S=9C K =C0 0P20T2(Kxm@m@m@m@n@n@?B -LDM@QX@ @ T0 @x(Ko~<@0ST0@00H0 0SP0 ^3 Z^.9>4 00  `^&040 9>`00 ^@ 040 ?00 :9W~S1@t`0PW@0 D0 080 0L0 ?@A&K\p T80S \0AT 080 `0pS@t0S 60X00 0ްPZ Cq4p4p4p4p4tq4q4q4q4x110$P(vl0  Q10 R 0S 100Sv.KSR00廭0VP0嶭 %p80S 00S0PP0@8P80 <0 H0X240P 00R0S* R~/ id< ~r<  400C40 \000D  X01X4p\0W8D00D0 H00hH0  L00L0 <0S pW00 6pZE0@0S @ D00bT 0L R pL0T G=009 c~`9<0S 0S    409 K~H9(KQ;Qᒪy ᑪx ኪ Y(K -L M`p0P娬,x0@v$)  bX_X @ [X P PP0-P/  " X AVw   :V  6V   (W %W   !WxvXV w  W  lx  w  v    (K -LM 0  K" 0-LM00  K -LM0tpb@uὩPḩ$0T 000K7 -LM 0  , K" 0-LM00  K -LM0tpbᎩ@uዩPᆩ$0T 000K701`0#400/ p-L MP`ᣫ00 0@ኩPPKphOᱫKp -LM@PT@#@`0q|1 ,K#` ,KK `0B<~ 00,(`$@ @@ @40 000!|>P0t> 0<(40,(`$@ @ @4; $00!(>/.0 >0004 ,0 (` @ @4 0!= 0<0400P,(`$@ @@ @4 0!=40< 0080P,(`$@ @@ @4 0!8=/00=8400 <00P,(`$@ @ @q4 0!<04P0P,(`$@ @ @+4 0!;0; 0/>@<08P4P0P,(`$@ @ @40 400!h; 0<0800P,(`$@ @@ @30 400!:/.0:800< 0P0 ,(`$@ @ @30 400!:/0: 00< 8P00P,(`$@ @ @30 400!H: 0<0800P,(`$@ @@ @30 400!9/098 00 <00P,(`$@ @ @30 400!t90p9 0/><08P0P,(`$@ @ @30 400!(9 0<0800P,(`$@ @@ @j30 400!8088 0/>@<00P,(`$@ @ @Q30 400!P8/.0L800< 8P0 0P,(`$@ @ @830 400!8 0<0800P,(`$@ @@ @!30 400!7/078 00< 0P0,(`$@ @ @30 400!,7/0(7 00 <08P0P,(`$@ @ @20 400!6 0<0800P,(`$@ @@ @20 400!l60d68 0/><00P,(`$@ @ @20 400!606 0/>@<08P0P,(`$@ @ @20 400!5 0<0800P,(`$@ @@ @20 400!H5/.0@5800< 0P0 ,(`$@ @ @v20 400!4/04 00< 8P00P,(`$@ @ @]2 0 400!4 0<0800P,(`$@ @@ @F2 0 400!$4/048 00 <00P,(`$@ @ @-2 0 400!303 0/><08P0P,(`$@ @ @2 0!3 0<0804`0P,(`$@ @@ @1 0! 3038 0/>@<04`0P,(`$@ @ @1 0!2/.0200< 8P0 4`0P,(`$@ @ @1 0 400!t2 0<0800P,(`$@ @@ @1 0 400!1/018 00< 0P0,(`$@ @ @1 0 400!1/01 00 <08P0P,(`$@ @ @1 0 400!T1 0<0800P,(`$@ @@ @n1 0 400!0008 0/><00P,(`$@ @ @U1 0 400!`00\0 0/>@<08PNAD=eWA4_A`A8_f4hA4AqAxAH4BBAAAAAAAAAAAA 4AA0P,(`$@ @ @10 000!L0L 0/>040,(`$@ @ @P10 000!0 0/>040,(`$@ @ @P00 000!04,0/>(`0$@ @ @P0 0(K - @0 XP@0 xp( '}`p W 1,#@ Rx0@ 0Wx0p )  P Dp08 E -L`p @Pd!AT0 Dj@4@`AT o=e=e p-QLtMP ,@xK xK,xKxKK KfU`P `X00S L^,0< S;# KpA@_fAd=e=e -5L MQ`P- 4Q 4Q 4Q184Q 44Q 4V%4 000 2P" 4 000 &P 0\D 000P@00 o3V 3V 3V 3Vj3Vu 3VC,b`3V |3V, t h`\0S S@4C,b0VSpp`0C@VW@3@#*p`p0S SB,b0VS`0Cp@VX@3@#*, M00,p080 0X00`00`S`V  $@PFAm,bV@b $@Pp, M00,08000X040`080%`PAJ0,bS V l 0R `{@2`V  w$@P j"  R@ TUP@  A R+#0S@1@!h0 XHLL@@@ KiRjR @hReR@lR 0 ,p(`$@@ @B$0 0 0!1 0'>0,p0(`$@@ @.$0 0 0!1 0'>0,p0(`$@@ @$ 0!H1 0'> 00,p(`$@@ @$1 00!0 0'>0,p0(`$@@ @# 0!0崠 0'> 00,p(`$@@ @# 0!l0,p0'>(`0$@ @ @0 #(KbB@Ap`fMA\AkA afuAAhdA 0-@0LP4@SKS0 02000$dp`f -LM0@S@1 T  pWG$Q0@z>0 oP@0EP` R>) 0,Q(pr^ P,50S(  00`rNO00` h0 00` L0v00` 00 00`K@ddAAAA -PLp `Q@0 T 00aX00X0Q00T0?T0;0Dƒ1Q  > PP000(2S$00$0 0T @V>W0T 40 TTKhMpMfhd 0-Lk  00Q    B ("R$  B$ @?P ; @‚!T@ RA"4 P Q0a0?o"RB  0 //(` 0L\S000X0S$07Ó7Q$0 0 \0S\  0S\\ 0 R00$07$00`0X0'= 0-X0LP0 Q 0?S0;0Cƒ1@=00T000dpMf 0-L00 R S000@@L0d0/  _A -L 20CS 2$"R  -LM,0 0S0W00n K|faA,n@pd 0-@L J000-/ -LMX1Q@Q<0  000 080 0 `40 040 0`8 00 20 2 00   AZp 8/*0S'00U6p640 #W @ 6@ pD0 8 6X 00Up<0(Koqd|f|d -0L@q00S7Ppp. gY U) Ph6 `PWV0$V `X. 0.0 X.0 $Kk6d|f -X0Q`Q ppP0LP@ P.d -PL.@ T@%  ` 6T @6 pX $0" S T`0 $Kk66 -`L0@LQP0S   aT@Z.d<00SP/ 0///|f<00S P/(0 0 `o//|fd,00SP/00//|f00/]Ӆ -0ML< <0 4 000  }0 K4dA@e 0-00PL E~@000@eB 0-L@BP0 ]~00@ed0!001<h  ΁P dQ00@0!!3//d 0S" 0"( ,00/ Q0-L@ 00RP 0S(0101!1 0R00d 0-@DPL 1T0 1  T0  K0h 0-P<0L10A 0D@ 0 0 10 Q0d 0-PL@0T 0 -P`@LT (0S$0(`00C04A0@- 00C"0!300  \  !@AT @Q @ P0000R0000#00 c0?o 0s0c0o0`!// -HALPTp` 0$04$00F"0!!3  (0S v@XX t0>S0?03/(00CS( 444444 4L4 0S $@@ T $@G CS 0(0000@@5 0-@0ML 00@@ @@@{0P 0t00@0@ @@0z{LPH媽72 02 ((K0hCA@e&A@@e44\4_A -H` QL[ @T0|@  0P8+̠ TP00000 -@LJP`@T o 4A p-L M`P@K`$ @   `Kp -@LMYHP0 (q40 00 ,0 (0  L `"   ㌑$`K`   0@\$0(0,0004` $pK`' 8p  4K`0aa 8aa`02 Sb0!!!!!!!! $K0 `LKP}B0U@0 00<0 x0040 <00 ,P P ( 0$0 S d0LK8 I Kp 0-d0 L1d00t0000@00d0 K0h踑0 -T1LpQ0At0Sd0S 2d0'10S` V 0 }4a^-d0S`OP 0Sd0St0S d0S00C00(0  $Kkd@@eH0JS 2<  < 8  8 4  4 00000 <0@  80<  408 040 D 00000 @P6$04$0/Y D2 !h  0 ]v  l T X0 > @10S3/P @PX H02S S !x0Sڈ01 h  l 0 $>@d01d0!@ᔁ(K@@ePK1儁00  \KoP  \KJ 0\K렀0S P 1dZ \0K :/0S \0K  PY \K^(Kd$af 0-x0L !@0!H " R 5555<00S K0h/K0hxd`faA 0-Ppt0d0L1d0>`0S 00C0@T T(0S0S V $0  `(p000:4A 0-\0LP10A 0x0Sh03h0 >`dQ K0hd$ t0 l  ?S Rp 0S/ -L@` pPU W0P00P`0 R 00@`  000/0Q0S/ S  0 0 0!< 0`4 0 ,   !/deee -`@ LP#@A @T00/ - 0@R000 L 0$ 00 $ 00 (Q(RR 0(KhIt0\ 0 b`00`00 `7O00(0PEKhSdpMf 0-LLA  0( <00\0K0h0dpMf -x1xaLQ0Sp fW= $0 G$ 40$0@2 XP- JTppW $@冇@D 0q B@P 01 W@P 01HB0@@ 0S 'X =( X@X(P #@d$af8,K8몀U $s sK00A9BPF6P P_K>6PP_K56P Pl_K-6Ph(8 _K&0P D R@q 8Y D0S qh}q 7 7@TXV A hDPAP&`BP!A@A?4(<1 41 q?K 0  ?sK    A@A$  ?4(<1 4P1 u?K   0 ?twKЀ l 0 sp@P D6  00r0S>APbzAP6AP1 {A C0P1 )qA nA1\$#,41 ! y?K 0 !\6":1 61 {?K 0 0, 0 FC@P (p? _K60#*0*_K"&&"(? 0$zq_K@P _Kp$@4@A@PAls AP=AP,4 ": :#60aWs8p0003`` U* 4P( 5P 0 SQP  B@P _K'6_K!**"&&"(? 0`#q_KPPWu@P@P}eK4PU @P@P |I@P `0 K`^P O@X4PeK.5UA @  C`P:@@@pƟ 4&<06$a$:0 `&  0 ACp1j@r[@P\@P H": :#60ar 08  xr(Klp00.PeK40KPp~p0`p$& `-@P*@? f v zlppl0```PdPAdkAx4eB(afX4epfLfAoA9BiAA@|AAGAp4e`4e0eAAyA~AniAA[ALAAAAf AAh4ezd@5A:A@GA$ t0 l  ?S Rp 0S// 0-L @0PK0h0 0-(0L@SP 1|0xPS0Px|0S0K0h 0-(0L@SPttPK0hѾ -Lo`A 0-PL@ှ0T ι0 -L`PX@Pp (2(p2(2僯@(2(p2(20h1$00$0} P00SD0P 800S, 0`o/df|fd\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee 0-p@MLdw \P\00@0I D000I ,000IK0@GenAtA}AAA -L`@pP0Q0l0&4  0 ˽A 80 $,Kohd@Aed -L`PpRP U0A0l0&4  0 ᖽ  ᴮH0 }ͽ% @偽d@Aed -Lp`PP ,Ko0UA ᪽0l0$4  0` \ z80 CZU@ Jd@Aed -T0L@0S 4  00P`40 Khd@Ae -<0L1 "R( R $0d0! 20 2/d$0@-#``pSRc# 0#@# 0D@VPUT#C R0##D R0# -@LM4K2 `S (r@p (2 p0WR2 PU 0P(0(22(2p弼(0T0C?o20S $00(0 0(0ŭ0S (2S@U"PW@0P"$2R ).22UX 0SǼ00) 0)(22(21崁0C1- 0-0S  W0S`00S 003/ YV`0S  P*[U t 101000S L 000 qq$KdPafd 0-$0LA0l0K0h.d 0-40LA0l0) 0)K0hd -hqhLA凯$bV" (0S$0 0$2* 2S $ 0$1("@$200PS0S( 0(0S #Ph0, 0,, 20 2 20C 2d@GeTafUafVafWaf -,0L1 @P $2S d -LMp P$`K|uE傻0S 0(0(2@2(2@@(22(2@孻- 0-0S  0SP\00S P003/ `VUP0S ` dPaf -( L@R0Q R R lh0  >0S X000$08$00$000S 0(0Kh菬(RR 0( `  *:$0(0P01KhhA - aLq1@T/ `0S@ `00"t R  BR  00t0PU 1U G$ 38$0(0S 14Q ,@帺}KhY 40 0?"'000 '40 0  0 00 uP '0 0S 00000 00S:  R0  0000 00`@00S8PPX0@S`(KdA -L$M`PQp 04S c-00K0 0s H@T'P" P/00V+1S(0S,^5^5^54^5 ^5L^5@Wx@ Wl@ d@-P@L@00 `0 Pp 0 4/(KA_5E5@O5V5R5a5 -LTM0 `VPX0  0B S< XKP 4T@K!XpP,00S 000@00 0X0Kl@V  XKT @T0S XW 3# K$af -LMp04SP`@ b3T1 0`0S0V0S)`0 KP#U -0 0 K0Kp P0HpW  0 0 @`0`0 0 07/(KA -LtMP0$Rp @` bm0SjQg0sd00 0K0K PZd0SV@ "( P S  PQ ( SF011H R@ ,0Kd # dppB!NP@0p 4@800 p`04 R#80S  P @D RT0`00 0S X_Y`0 |P ``Y i`Ip0X(KmA -LWMd1 0R` ph1  `Vbv`d1S0d!0Qn0 404`1S,0\1 0X1 XQ YX  \1 \! P,0K 1u Q 0s Kl1 P@l1?N?@E@CuPP PE, K !  1(0W 0 @ @ @    W W W$h10000K꼀 h1开 0 $00 @`p0@ @ 0 SK,0KV/K(a#  Pq @P  K(aXT1pK0 @`p>K K P@0K &PD0 R0 sRP`1 RSPPd1SPU ,0KV/K(a#SK S@P0 TXA 4\8`0`p`W  RX1 `1RX STa p|PU{PPx @vPᒧo@ &00 0`1pP0QP R000pP R0Q P0S` aL  P0G/KpS0`1 0 R!h! 70P∐`1  h!&`1!'JX`1  00 0 0 R 0W0C 0GK q 00C 0  ! 01QB  (  d1ST1d!00S$ TQX0S 0X0 "`pP  &0Xp70T  K8` `@(KA$ASAvAA --L0M0 00 @ T?p 0 0$ K!0s j $0KPD #pK K  W@P QTR`㄀K `开 &40 $0K0   $0K@# @`p)BP@2 84P @ \ 0` `VP 0P S0  XP X00S)" YPP 0 X(&0 XP' $K -`L$ 1V`04S8@P`p _6  `0#`@4 8`0D"S *` Q0Q 8P@PT8P 900S`@0P .0P (0400080P0SV$KkXafdA -P@0 L_ pa0Wt0 T t@h_T@ P_@@_@0@D_p`Kh{_AA AުA@!A -LMPJ @TG 匐K*`  .% 0 S3P ! 0 0` PqF1d  0 40 00 0K00K= P010 P,0Kd # ` P 0` `唥ᒥ0 0E(KXaf -L$M` PS00 p00 ,@K400 0 00 0p0m@?oV20S 0@X @3@#U000(K -pL\`@P^0WS T @00R01 )@00-'A@-Q@pppw@(-/0 R  0/ 0@-@ 0UT   0 @  0 0  0/ʚ;  0/@B 0/pcf 0-@P0L3/0c00 0-h0L@P\ 0 R @!QP @$03/03/@08d 0-@Pp`DML!l10p,`0(P00K$@ @@ @P +00SG 4p0`0 ,00!1 000(P0$@ @ @004p0`0 ,0@0$00'!0 000(P0 @ @004p0`0 ,0\0(P$@ 00!H0@ @000 0(K.0QP   0 W P0W(Kd8d -@LM$K$KK -@LM$K$KK 0-@LK0hcf -@LM$K$KK -@LM$K$KK0@-(PP@ 0T P0T08d -`,pL@PP sU P0U8d -`,pL@PP jU P0U8d0@-4PP@ 0T P0T  0@78dcf0@-(PP@@0T P0T08d0@-(PP@00T P0T08d -LM@a 0  0 )1P0P0 S 0 00]] S  0 0]P0 @$   PR0R !SR03/03/@G(Kh0$d0AALfApcf8dxcf c0-0L Kh1cf -LPӪ!@0S S $ $0 $ S P` 0p000 00 )ml嫪0@T "?o2U0S$AT D00(0 (xcf8dpcfl0'x0LK &Kx0؀$KR SRK*$K R0$K$KKR 0$K%KR0%K 0%K 0 %KR\9HZ PN@ȡ 0 $R  ^ Q0 H#6Q0 W  T(   T  , 0p, tpppl x 0x ea|0 @@D 0 T`pp pXpp,@K 4$ ¡ ᴽ(Kcfcf -LM0s K̕ -LMpiYP `{cY`P@ܐ!0 0SYm 01ShY )C0QU(Tt~lE@ W( 0pP夠ppP@0 @0WP W W   , AP@ϠPTQPX $0 H W W<Kl<K#K4 X00X X0SH  X I )T KG(Kcfcfɚ;6e -L(MPpU`@0T0S DKP  LKLP H0 PT D KG$K -@LPT` T夠V` `p4"\0\0 0S0S=`pqU 0\ X0`p^1`ep6X% 0%^X 0%h10X000S0@S eX R1#e(6,0X  RX X R 0 0 `$V 0S h)0S 0S 0S 0S0(\($Kk~F $KkScfɚ;6eĨdf 0-01L@0PS% 01@T U PU h00P@T 400P K0h0cf d0@-8P@ T0 R000 -PL`@ᾟ0V -2LQ 0@実PP```Qo 0  0  bRGR RC RC#   R RC RC#   R RC400<RC80#<<< 010R0 RC400<RC80#<<< 01 " 0"0 p0 00募7/D PR  P0900$Kkud -0 L@pP  0   aR 0  d00`00d0@d@$KkQ `U0  0 0 0咟P `0 0 00d00`00d0@d@0d -L⭟80 `` d +h Rhl00efd -LM@`T 8@㌟0-``0d0( h0000S  0PO](pS0l O 4PpL0Y*0D O P(0@N*@Kl5fAAAA 00 , 0  !$00/def00/ -L@Pp` p `Kh1 0-LP@ K0h% 0-@L00    0#Q000P T@0 -@L Mpq0# 0    0000aP0T,0V) W a_ 00 0$ 0$l000 p W L0(T0T p2p9X  (KddA -L@`P` PKh# 0-@L@$A@0 0-@L 0@@0 0-@L@@@0 0-@L@A@0 0-@L000K0h -1L@塝0`P00!h \ dhdlPldhlP@Chȑ, !\ dhȑdlȑPlȑdh(l(P*C!*h \ dhdlPldhlP#`pP8 003/PTP1 V 娜H(Pp`Y P PY 哜0, R,P(p 0 0( W(pY } 0R v9p @P $2S dHe A -L M PQ?000 ,0@Sp`& 0Q,   Z R T0P0000(Q  Z-X  V0 `F00 (KodHe -LMA0 R QL/e"A 0-LM PR 2/P10<0  ? (0S$ $K3/@P0[0C S0[0CS0[S0[;S0[<S$KK00@ <0P0K0d -L4MKP0 00TK|%KP0 lK0d"#K 010K0<K4K3K00K/0KKK4RP0S   %K<K @PcKw? R0K@+%KV%K/ P!g? R000S%KV0!0 0xK` 0`M`@0 <K V X44K%K#K040 00#K$K?4 Q`qD0 `Wʀ 0! `! 0    !LKh 0!!`q0    !@\bK(Kf .GAerAAQAAAAdeee0f`@eLfbA[AHNAjA$0$$08S 0  qLf58f0f 0-@LPHST 0T 0AT (0@@再0Je -L Khn 0-L@XP K0h04 / 0-40L@00S40040L0S 3/P0 0-40L@  00S40040P0S 3/P0T0S //T040LP 040/ 0-@PL0P0Lی40`0400S [RD @ER0 (0SKhG Dp@I 0-L@ P X0S K0h/0X/ -`L@ᣌp40P 0Sژ!Q 0 00fR| t_00C0\ PW R@ 00(01&-0J@ᵌdq ap@s w 0-@PLd00CS00Q .K0h蘌 rp@/\/ 0-40L@ 0S 00S40 040`0S 3/P0 0-4 L@  0S40 040d0S 3/P00h0S //d00\` h00l0/ l00-SL@ 3/0\0`0d0l00p/ 0-4 L@ 0S 40040t0S 3/P00 0-40L@ 0 00S 40040x0S 3/P0x00pt |0/ |00-SL@ 3/0p0t0x0|00 -PDL`P@ D0T*H01S 3/@ -H` 0DPLS  P 0 A%0pS!!0 @D0 S!702:DHpU i% -`@HPDpLT 1S1G S @ R  @T: T cD@H@Kh@%01 -@LQ L`@8000000!@ @T! T%\ HSR3Q SR*HSR3Q\SR: @8$Kk<0P 0P Je 0-@L0 0S S SP( P$PP0SPP00C0 0 RPP000 0R0 R0Je -PL`@P P @ 0-0L@SO00K0h -AOL0|P0St PPP`  P<(P8<@,<fA8A0A 0-@LK0hm 0-<@PLSPU000C0C00K0h芊Je p-LM`4KPP 0 R R0@P4K?@4KTh0 \?=P V R  $KpeA p-LMP`4KP@  U 4K @P 4KKp -LMp<KP@T# T ` W  `P4` 040 0S 03/P U4`<K@<K_$K 0-LMP,KKP@  P ,K,KFK0 -LM`@ #0` T ! 4K$P@ 0$0SP4KpP 0 $03/<P0S4K Ke 0-L M0p0 `@P"@0 CPP 0 0ht0@P pH0 8p,p,0  KA55545A -L Mp`@P#@0  PP tP h_:PP0\ \@P 0 0,<0]P KA455A55 A0/ P-L o/0@-^$ RP 0|@ 5S0\4C0200 R @b<4P000 T0 B 0 - QL M@0 `T1T00!Rp#H140 00Z V :T0 `eV T0 `T0A040pZ !(K -LMP @RJ R#b!r0 "b0   R | 0W  `` 00G40 0Z$0s! UW X40 0 0p 0Pe0PUP5V*4v9000UPEP(K(A -L b1 a<0 Z9 00OA -L$MP" `RpUPPT P ~    SD *0  0'9#Bi7됔# 0 !8 0 傡 H< 0 R( S%* g4  U1r|9X  0<0 00 0 Pi pR0500000 8040(KsAA b1 a0-0 RB  -L$MR`p P0YRdG S#R"180 0   R | 8Y  PP 0j됥# 0 !4  I@@ Y$ 4008 @ 000 40pj 040 <00 R  S * h<  W1rDy800d00@0 004(KAA -pP `LVP2b1R1: 0@ p`PJ 0A 0-@L K0h 0-LM@PP 0 S   _p  e K0 0-LM@PP 0 S  K0 -LM Rp@00 P`v V@D T00U0S= 4  @0S2 RR(Ko00"B`#180 0J40 0 00Y0S 0s U:@40 PdP40 P80p `(K -L M@P 0 S 00` 0K -L Mp@P`T@!@ vX R dU Ki( 0-L@PPT0@@0\ AP 0 -0LMP$@K0$0`̀pW 0 P!0 Pph(0S 0 0@00 0(0P (00$K@eHNA@jA -@P`pDML 嫅 ,0K@# 0,(P$@ @a@ @P p00S 400 ,0L0(P$@0@0 @a00 @00(K訆f(Af46-A -@P,`Lz 0 P@ 嶅訆f@e 0-@L\i PU H姅P < 0T00  T0  嗅0訆f@e -ML M0P0 ` Sd<`\q\>P1@T U TP X  Q@  U@@@BK+ @_BK+ @MUBK @. Y XU6PPU T? @ 804`03/(K8Adf@eVA\A0/0/0/0/ 0-@PL0P $ P 0 0-@ 0-L(M@ S 00^Gh0101D0\<0K40 08 P$ 00 (0< 4KD0BK 0 K0[>dhd 0-L(M S! 0@0T l0101D0^ <0K40 0@P00 0 008 $ D0 4K< BK0 K0[>dhd -pPLW7 P3 `@T0``0C0 0W@1R 040 V0S0    oP0pd0000d000d0  0 [>d-@T0 pUTT#*d/ p-L M@ KP`ᤋP0 5@ fKp p-L M@ KP`ᎋP0 O@ PKpP  k$P  c5/ /////,/Q :Q  4@o/49@o/4/4!@o/<0/P8/@/ -0LoP@- 00 0S@ P000QD0@0 0 S Q000eepete ~f -LM40 p4 0RP@0 0 tz~p4p$`< P80 Z7Q 00P P R R R_P[RXX PVRQQPLX00 40 1x~~00XB 0Sh#h3T#0S !R  VS  000 S.R S  P b!<02 0Q@@d9~00Sl"l2L"0< P8 S !R R`S  000 S].gQ S  P^ a!l<01 0QU@P4X<0 < 0UP$ P!`P40`F<0  :<0 P ~ 00$ r`P 0彮080T0`800P0000}0 @l @g(Kf e eetee\@p@ApeX@p@A e -P`$@LG}}f0 QP 000 P00//ee0 QP 000 P00//pete80 400S\ 0//ee80 400S\ 0//pete 0-@L|T00T 001S 0 00 t}00 T  R 0S H S< AT@@}0fee e epete 0-@PLX| P0L00R0 T@  @|00f e e 0-@PLX| P0L00R0 T@  @|00f e e -L MpP@? Pi|0 U  `V. 00  P00# RPU0 B R|00U`|d001S T  0@0Ds|P(Kf e eee -L MpP@? P|0 U  `V. 00  MP00# RPU0 B R|00U`4|d001S T  徨0@0D#|P(Kf e epete 0-4QL@P({$1%T0U 101S 1 00 {00 U  R#\ 00\00 1S $:@:#F0_&0@4P`,<0 ,@ $P @@P{0fpete e eee 0-4QL@P(r{$1%T0U 101S 1 00 {00 U  R#\ 00\00 1S $:@:#F0_&0@4P`,<0 ,@ $P @@Po{0fee e epete -@PL\p{`8S{V 0 $Kk/f -L@P`pP 0 $Kk/ 0-@LP000$00 00K0h/Le -L@P`pP  0 $Kk/ -L@P`pyP  0$Kk/ -LhP -L`P 0-L@PWP 0S K0h/0 -L@ԀP`pCP  0$Kk/ -@PL\plz>`8zV 0 $Kk/f -L@P`p$P 0 $Kk/ -L@P`pP 0 Kh/ -L@P`pP 0 Kh/ -L@P`pP 0 $Kk/ 0-L@PP 0K0h/0 0-L@PP 0S K0h/0 -L@P`pP 0 Kh/ -L@P`pP   0$Kk/ -L@P`P $0 Kh/ -L@ԀP`psP ( 0$Kk/ -LbP, -LZP,/0S 0 0:/ -L$M`(, p!pI၆Aa0P(0⠡ 8 40 唡*408  | p :/##K$0 S#KP:/W#K ?4#K:/$00CσS0Ġ ? 0:/U2 W$ (0R,cKB08 `p0 ` :/8 0,@`pP 0 0   08(Ko/(K6p@x6AgBA AAAAA -Ln P 0S -@L`P `xl x0t0p0P0 0T0`\P 0-@Lf  R X0 -`lPL@pxHQ@ @ T 4/@x 0-@LXW P 0 0f K0h{ 0-@Llyx`K0huxXa X XXU -؃XP0L`p@00$A ?J QP @T P0T0$@ -L$M@P0؃(4 X !)!0 0O8Q P <0 }00`p v<0K nK $ ?$K@0/? 0K$ 0WV *V 0, P04$0$K 0cKWV:WV *04 #:0#RppW 0000( $0`p8 0(K 0-P@L(,$+48 <0(0 $  & , 85/K0h艴 -`LM4PK@p V4` 0 0 00F?o2QP R6\! R @08@S  a"0S Q<  A`"808 K#APA -LfMp2PQ` 0Q d2Q00 RV  0, }0 WVz 2Q+ 1Q !7Q 1Qmg1Q` 1QK 1QcPQf/_Q m?Kf/(0RSE/I J0 S0;30&:`:#6i0aV! 5 0S b0 0 000000:10S P" 0S  2  3  3 4 Kd@d@hd edAd@|dyd -0@S<0`4 c 0a0/o?o b0cP T0!0LP$ \S  RP 0SM ,9#!\  R 0S 0Z$!pU  R ("(w R ("(o$ R 0: xV  d}U `  n 8V $KkAAAAAvABA -L MP+ p@T !PLPğ$8ap 40$  0 ? *   ꊡ 400$   ?p`* 0 KP  |,' 0@P0 T P0$0S0 $,T&0(K9Bp@A@ A 0p-LM@0P0 K`qP 0KP 

0,p0(`$ @0 00!0 000'>,p0(`0$ @j`0 00!\0,p(`0P0$ @0'>0 0U(KmATu6AXeo6%BDr6ts6OA 0-LGM@!< K0FMKL1CP-@G 8a KJH0|0 P0x0 h0t0 p0p0 0l0 0h0 #(K"&K"%K" 0)K#%K$$K$ 0(K0 D0 0@0 0K<0 080 040 000 00 xP0pe00@ (Kffe -L$M`@pq0P@0K0H0 U! Z0S'W@@  @KbV 0  @KH@0Kؘ0@K00K R`0 @K+0Pp@f`PH0 嗘H0@(Kfe RP // RP // -L 0- 1L@S  1S 0 0 10N>$ 1  S//1S/0N> -LMP`ASpQ03/(Q 0<0 000 08KD` 80 D0K40 @@ V8K6p& 1Q   013/ @Q 1 ;(Kd60R !##F0 !10S/ B0F010S/ : 0-L,0@Q 0 K0hdN> 13/  -P@L M忌0 S6` 1p`00 ܠX0ʀ !` , !! 40   ! !40`1000  !01000(Koߌ@Oedeee -LM`P (pN@@`뀐N@ @ Y` l $0K( #RPD D "+"(P ,0@$K@Oe9edl6 -`@ML8@ _ 00   0VK@Oe6A 0-@ 0LP  0@Oe 0 @Oe 0-@L⤢0 0d@Oe_@Oe 1/ -P`L@  4/Khd 0-LMP,0K( @ K0@Oe `6T0 0he -LM  T$0K*tP Khe -LM`p0p+T@@ T @ Q @p0h [@ @PT RT00X P 8P0h $ KPfAAA -LM  T$0K*P K8fT0 08f 0-L@M0K #0,(<4@P$  A fK0蔭6RA -LPM|B0R01 P 000 CK00`p@1 1!T~ 10Y{ hCK T0 0.Kl0p  0/K0 /K0< .K0D -K0H -K0L ,K08 ,K00 +K04 +K0 *K0 *K0 )K0 )K0 (K0 cK(K0 cK'K^) !?'K0 $K1o1 1\ X K 0#K#K 0#KgKfKfKeKeKdKdK0 CK3P@ {10(Ke 0-P@LT 0! 5/@0QA\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -@L`P]00p0!00P0   S<<< S8@08A?@Q 0 SS@蠑ff -LM@p`  0 P XPP )#K5X΄! #KSRX  R 8! 8! !. -L M4 !P0 ∁@iT@h!+Rx@ WVT   !  NXP W΅ WV WT T@T 8A8Q@^ W>CC W0k4  Q<<@(Kdf -@`tpLjW00 1 100 1 010 pRwU`tPU hhPPx0P0@0x00SHU@ K0P00@00eL5ffdd0fe -L$MP`dp@P 0 00000 0 000000o K萒f 0-LPd%U`0t@T D1H0D1_UY,UD1(0CD1@K0hOU0fe4f -0L@0Sژ00S0 xoPT0pa101<181@1'Uur$Kkm9e9eH6 -LM`0@S d3/P tpWUP'0$`K0&0吀 PQ 8 00R0| 0cS:< D00b, S: m T(0S (K$KPde -@L`TP0 ;S@R@ 0T08Q ;P0L0P0TPP,nTP0,0CP07TV@0ffe4f -L -@LRTD1S  0R 0tPx00 poo T29T00xTᏏPU Q 00 Q 00=U ,VT$KkG0feff 0-@LK0hpꐒf`d / -LMp`@Pᔀ0p00 R BT1 0( 0  0   Q0 `0( KP( Kd -L`Pp@ᄀ0p00 R * Pp  0 $Kk \05 5: Pd -1`0L@S 0P V00S 0`VP000p  3>PW 0 V   T T00T00S W 80T0?o20S 00Kh/|fd0e  -LKS 0 耔f0e00S/GS0ef00S/S0ef -L< <00   Kh|fq@ -`DPLSl@@ 1 @T \1@US,pP@7p @@p@p@  P@0'@P0"5h0    p  @@p@p@@@P0 0`00L LR kƣRQD0K0B S S1 D0K0t0d0  P@0  c0R  R0 0C &d0U T0Cd0  0d00   0@Pd 0@@B D0K0h  % c$".@P t L@ cL Y p ,0Kc@L L T Xd   d  d \X dSQ PUX   al l RP R Z ` HZ # 3Q R  H P x0 x0l  BX P RZ7` HZ # 3Q R,,l0 H P% P RZ H `/o"Z!3Q 0 H P0l0 H Pl0` Q R  U0\ dPaUP R Z ` HZ # 3Q RH P0l0 l0PE0PL @bTP R Z ` HZ # 3Q RPH P0l0 l0@DL @S P R Z ` HZ # 3Q R  H PL0 L00d P\0d @bT^P0S Z `0H Z0#03R0SPH P b@Dp0SH0 003/X(Kr@r@A0e --LM0@ @@ 000S@ @ K`f --LML0101l  1 0S 000  0 Kd --LML0101l  1 0S 000  0 Kd --LM00 0 0 K --LM>00 00 = K --LM-00 00 }, K --LM00 00 l00SR K|f 0-LMP@0 PV00SK0h:K0|f --L M00 F KPfA p-@PLM` K`"00,TU 0U0F0ćKp -Lᒋ\1 0S PA1S  8rPT !(21(240040A0S0 `V`Ao|`0p00S 0 0Q 0 k0删S  P 0 x]P o`V0S <0< 0Q01?F@ddf|f0eAhf4fa0A[A@ --LM -- LM0 0 k K -@LM <0@ ,K,@KP  >K@ 0-@L*K0h- --@LM0@ @@ l000S@ @ bLK`f0Q  AA p-`LM@P 0P A000S   7!Kp`f -0-LM@P@P 0S \9P P@v0 0 00K0 0--LM00 00   KPfA p-L Md0@0P` T 0@ 00` KphKpLfPfA --LM  K --L M00   K --L M  K -LMPx0`0p@@UU 0P D0 pN$00SKhKLfPfA|f --LM  K --L M00   K --L M  K p-L Mh0@0P8S`T 0@ 0H0` RKphKpLfPfA --LM  K --L M00 :  K --L M  K -L M00`pP PPl0X @  0 D0 p0S Ki KLf|fPfA --LM  K --L M00   K --L M  K -LM0P0`p@ @@jU 0P D0 pc$00SKhKLfPfA|f --LM  K --L M00   K --L M  K - @LPT0qT`kL <@eL01 010101L -0QLp<@1S'!0c! 880S*aP`Lop  $1 0$1(20(2 0d!Aop $Kk#L -LMpRP- 0a@Lp0  <0Q!Pa!( Q *QPFL &KgP KR:L2[ p&KrK(hP$K 0-d@P0ML@PD00P00 P 0PK 0 00 K0@PeAA 0-L@ 000 0-@L K0h - 1L@PU=00S  0 0`100  KPD00D0@0D@00KU0 x0p  TuK PP (  0@A K00|f9eQed@Pe9e@QeAL5\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -`QL0SS ` KD1@pT o P Z 0R00 `000@@@@`V R P = 0R0D0 @000```P@0S  Q   !00C0$KkK@Ped@Qe// -X`P𝤀0 !`!800 ,  , !deee 0!< 0`4 0 ,   !/deee -L@P`P 0S@@ 0-@LP000 -LP`W@ QJP  0-@LCJ}K0h700/ -@LPpn`o00(0@p!0 oKh{d -LP@`TpU0S00 U0 R`0S Kh -@LPp2`300@00 0!0 2Kh>d 0p-P@`LM00(@ $P Q 0K ( KPK (KW 0[S I PJ0Kp9ex6,/0 1\S/ / 0-L @I000 -LA -@RL``I 0SpP U !R Ppv Q PQ $ lP0 00 0aIP`7 -P`LaI0S@ p T 0V* @ 0AKhI 0-@L@ :I0 -PL`5I@T 002IP0 pS   0U* iPbIKh -`PL@IP@ 0S@ @GIP/0S / -L M`P00 H@pT 0SI(IH@X:!I -0140 @H@T X *00A0 II4 ! R !d00q0 R    HHT (Ko00A0(KoH(K3A -`V0L!V0 P x0Vp0pPPEP  X0@(P 40@ Pc d@B$d -L$M$@K4K "KKR, 0K0bS0 P=9K =0 K -LM !K K K -L$M$@K4KΜK"K R0,"K`Q  R0"K000 Kʚ; -L$M$@K4KzK"K R0,"K`Q  R0"K000 Kʚ;`0Q R 00R0S ,00Q0//<//?B dh0Q R 00R0S 40 ?Q0//<//ɚ; d 0-LP@P@0 p-@PLM,`K 0 0| 0Sl   "KP$ 00bS0P,   ;Kpɚ;6eʚ; -LM`p% 0RBnGT0"!0 4P ZQ40Z$ ЏO,KG1 0000 P `P Ab10 DGV  7P }GLX0`@ P@uG @ P#K 0P0@ UT+ a ??ᜀ!@T PUT 0 UTϠ !0l !V V6(KK7A000PPbK0h? -L>|Pt@0S "QPXHP;04`0>6/>" 0"QedQed 0-P@LP0XT3/@>& 0SR&Df K0h>QeRe -LM@`Pp>Ѐ""KK"QP  W`P@ 0(4 "K 0"0x 0  0,"K 0"0x0B>$KQed 0@-LS@07X07807P07   A -LM 8 @y @>D x }x  xx sx0  000 0t000xdi0 0T00000<0+KeQeAA.7AA\zAAA-7 P0-p``X@X@qL"WV=P"WV7Kh=ReQe 0p 1yQe -Lp`P=x@&SRd @DU@PD PTp@ X`_@PFp =ReQe9e -LM 0 ,Ġ0 K Kh 0 ,Ġ 0-@QLL@T0$Q L P0PRP0(0P0L 4.A=0K0h8XfHf -pLM`KP` @ܳ0K\0 0`@0 0 0 0000 0u?o2P0S RR %!*(Ke -pLM`KP` @媳0K\0 0`@0 0 0 0000 0C?o2P0S RR (Ke P0-L  P%P<0@T `0S@L0S =T HԂ0@@0S ˍ) 004r@0k?0h0 ``0 0K00`00.`P X{ :L0S ;p / `LP,`P:0U  ;0 (0?0t0e 0: :K,A4Ad97 -LDMX2X`0 0Spq82@ 1lK0AUPL0?S{P0Sx d0Ss `0SpY XP P PiLPUa z:$0S H WL0:S:V $0P80 0@ lKL 0 @ 0r'zW0 K W   R@P   >  : 00  @ 4/@P  >   S@Y  V񟗣N7N7N7XO7dO7P7P7P7P7P7P7P7|N7O7(O700@S\*@20\:3@0 K 0@m1 10  6@n#0000 S c㋒@@^ 00C 1,`K 00& 0 03/@PM0  " 0, K0" 0,03/pP0@ 0, K@00" 003/pP 0 0 00 003/ 0  03/@ 0  00 0 0 Kt03/@00 0, KP0" 003/@@@(K d~f}f3{f@|f 0-L@P *p0 0 0-LP@0P 003/@0 0 -LM@KP KRK -PL@`P (00CSDR7(R7(R7\R7-@ 0S<@0 @@I -L Mc@P 6 (0S 6-/0 `1K0#K"K0S S S p rKᛑ 0 040K0 2Kf 000 040K @K -LM@0 ` T0f 1 R 0R0_@ P@Q P V (P @P@-@I0FS0t00S BV|T7|T7|T7T7T7 K -LM01P`0 ;P  0 @f(Kf rdAg~$af}f~fHNA/A5AxA -  @00RLP;p 0+QPP(X  T P#@s0` QPPᷛP @`0  _/XP ϓPV U xf -L,MS0d7Xd7d7Lf7@ LKbL@PLK0 LKQ@PvLK,@r LKML@Pl!10pp0bP1`VbO!  YbQ - SbP P KTK:0T  P0p10l10t1@0h1X0x1 `P0PU ` bD3bQ -ZD-bP P KTK0T "DP000bO101@01 PrH b_GLU 1 M@ T LKHP LN@(KOfOfdd -P@`Lp 000P0000 0n?@r?vO`ad 0 -P@Lp0A` ,XH00`&P , $0R`0T0d 0-P@0L@T ,}PZ0A0SeC Q-L 00P P0-L vv@PtP@80@Px0U PJv0D@0S A( 0$000r@SeHf@SeRe -LDM@P T@2@0@ @@@0  R2 @/0@"R,`K@&@!2p0 < 00,(p$@ @@ @R~ 0!L20,0<(p0$@ @@ @p0 >~0Pk 0!1q 0'> p00,($@@ @'~0 0 0!1 0'>0,0($@@ @~0 0 0!X1 0'>0,0($@@ @} 0 0 0! 1 0'>0,0($@@ @} 0!0p 0'>0,0($@ p@ @}yu`P @ \\@@(KAdSeRe HfAAAeAAABr@g7.A Q0 0 dRe -@PLBoP 0R00 PUP 0 T /zKh -`0PL1p0a.00CS@ @0$N@6/T Pϊd -L M@p 0` NOPP6.j@PpP( PP0 jP p/ P1S!!1! pW 02 0 0s T o .(.0o K@Se -L@P`JP (0SU 0@.@ -LMpPP4 K@P ! 0KIP00S,00C>S04`S@ 0S@ 0Kx0104.K 0-LM@( KP (P $K{. $KkJK0 0-LM@ $KGIP( K$PP0S ( $KĤ( 0000R.Q  $K@JK0 -L$M01@ 80 p0` bNPP4K0KPP 00(    8# <<0 T 0!$3PPP#*Q 8 W@  RR R0R0 0z@ --*0j/ 0S0 T 0W`0  M,2 0$0?(0$2 0 0@0!2 0 Z]L1@@0 -@0pP @-  -P\00 0000<PF - PH< R@-PA<0 80Pp᝝! P<0P@-,1vorτn0pSk/1@!@y-`04 8p4 0 T V (KP@0 00[-4 08r@eBBo Se@Se p-LMP@ ` P  ,KHP,KAKp -LM4 Kp@IPPy4n₁4`(0 SR,0S% T 00K P 0@ 040 2 0f 0P"  #P<#P*4@T1  c0?o0c 0A0P00 R4 01S1 B"!,00C,04 TO (P@4, U 0  H?oW20SP   HP-(K -LM0K000@iP00K 0-L M@PP  $KjGP$K(0K QP(00K0 -LLMp,3 RP0X( X2 !@ &0S |z&,\ QPq0@0j&KP  [B@P i KPf:e -0 ML000@ PKhOK -LM0 P0000 0@Pxa%$0 oR8` 8@ 80S!&@e0S UP t&@V0u00 G u!PU $ SQ %@Aa%pW R P 80P %%%$%$qPPU 08 R ("|00S #W: 00S0S <K0PX0 P`@# 0h RT1S@#pS@#:TQl`p#0W #@808 \X\pP (Kd(s@DSeeNB -LMQ t1p1 210Q``@>@BBAWPKjPZ   >0PN Y   >0PA ᴙ0X 0  s>0P40ख़0 0 00000/oZ" R0 0 m?0/oY" R  b?0/oX" R  V?0 KU 0 0(Kd p-L4M@P`  <K$>PP,K 0P0[Kp 0-L0M@PP  4K>P #K"K?, $K0 0 00=K0 -LGM01 2`10?S3&:Q UKK@ᬼ@ =0P00 00P >0T 01 呼01(Kd p-LMP@u`0 :K(m$0,0K$  Kp@B p-L,MPP`  <K=P<@K @ P  ,K=P,K0KpE/ 0-PLP@da S}PX10`1XA` 0 000 -L M0@SP ,0ST 0`("PK 1T0S ZU000T17h Y l  p  8p p0p  q0p0pp\ 00P ?oP2PS  T!\!0\1(Ko#"Z0Va["PU 0`0T@0e0?o0cS1p! 0  .[U(KDSe(s@ -p`Lpa@Th@0C0P@PEPf"EZ0 00@wp@ADSed$  0-0L@S 0P! R X1T0X1  T0  00K0h!0 0-PL@f!0T !0 -L M 0`?SP@I01x0S  SApW<00S8U(?! +pP tPPEP x!W& /!PP 0 PP 0S PSP `!^!u0  U0 0 e KioT KSpPH0 ,0K #U0A@0  VH‰:0S0S`0 H3 l0 03Q 0S 3 a l0QP J$04$0PP D0S DKP(K\f`fUBN P b0o5NPY #fQ$1a1S$1f/! 0$1 61pS PWp Wp011S!!1! Y0 wWW-lKq'KKPt d0K0bSd0 P K d &KKPd 0K0bS0 P K (KR0 K 03/pWQP00 03/P #p(KAeʚ; -0LM/ K̕ 0 j 0-PL@ 0T ^0 p-@`L MP K ?@P 00  %Kp Q0-LP@ Q Q00SP 00MP h0Tt0 R0@DT -LMPrx0 o 0Sk0@ShU A&`P\ `0 QL110a @T> 00S L10 R5yy phpx?o20S k0(xP h0WtP SP tPWPEe0Pp 00P 00 P00 t0hpU 003/C4A0 00 00Z(K 0-P@LP ;P0P: 0-P@L ᶐ90 00,03/P0 0-2LPQ@b 1Q^ 0CQ@ 0Q0[ \1Q6 1Q1#30Q R1Q 1QD 1Q< G1Q8 x1Q5 p1Q>0S1::1&0!S0 0 0!!00t R:0S*00 `0aR 0, TK0h^ TK0h0!40iS 0\0 0(0@01K0h/0 s@{f@f@s@}fwt@|fsvt~fed -dLPP@`0  b?" 1R@0@P1B @@Vhf 0-@PPL<$1T0$1  T0  K0hhf 0-@PPL<}1T01  T0  K0hhfQ0 !88S0 00C0C0CQ0C0C3+C? R0/ -pLM`KP` @0K\0 0`@0 0 0 0000 0c?o2P0S(KeQ  P// --LM0 0 00  KkA\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -L1LP@$  0 000T1yx<PytP UA T1 >coPPPe x xP`  ? 0000PPPVSU! N U <  0 000T1 Px P ; U  c?0S-   0 000T1 c0 ? R7,77 7$7,770xPS0CL!B00000 hf@`s@ 0-0L@ T15T1T!"20# P0 @P U 0@SU^HU?@K0hA0 0-P@LT 6 30@D0 0-L@P 0S SI_D0@0\H0P40(0@*000pt@`t@hf  - LVℎt@ -|1LS 3/ 0-@,PL0<0K0hhf 0- 1L@Rʘ$Ir0 p-L M@^P a @` KPP  T K` KPP  E K0 :0c?N Kp -L M!T1P R@dTcoO \YB/E BR T!P ? R9nR13?@= 0\ 5p*T1 >0(K0PP (( KcT15T10:0PpPeUPPUJET [ 0 :0\600C0 K`s@xB0s S0/ -pQL@ t`tL!PQ 0!? ~0B0Q?0P?0~0B?0S0? ~0B0Q?01 -PLM KL KH KD`V KXKVKT`.xKp@@\Kx@KKK@pKx@$xK'\K%@K# Khf -@`pLXr0n@P@00 ]P$ 00S hfe -LM00@Tp3 @T2 @TP0 |PU" 0 S*> : 8Q` 0S`  jnP`` k 0S f@Y H03RRR Pd2 `kes ` 0" KZ K5GT  `x k?0 X"KI K$G 8PU4  0Y (0S S 0d K L0!(0!dL0K!K0S F41 Q F0`4Q0 KK`P"4 0< (200!Q'l0$ R! T! EP1x 0S}d H 482UQc T1w0W`U dQ`1d`# KPPP`KcU>L1 ?0!qB0U0P#T1`PE 860W0  x 0 K0`0`Pa00  ? 0P00ڼppGT10W0< p#0 PPPOw0W4? Y6 (Khfd L ;0 ,00@Pp!X2,K@(0 00p(P$@ @@ @P`;0,0 0 0 0!1 004p0P(P$@@ @`000;0,00 0 0!1 004p(P$@@ @`000;0,0(0 0 0!L1 004p(P$@@ @v`;0 ,00!10` `0 04p0(P$@@ @a` 0`!0 0<0K0p,`(P$@ @@ @P0K0@ L`|0 00!l0'.0d0,p(`00$@ @80K< K0K7`(Khf77ArByB}BBB'Be7B0- B, !1 S!1 0 !u 0oMehf 0-P@LX0T00 P00BI 00hf 0-@L$ 30  (K0h1 0-L@P TQ @Q  c? > 0>;0 0<0<Q x$IK0h0 0-@Lp,l0 R  g/0@000P000\U 00hfd;0 N \1 S S RP1  P Pp p0 P P"l@p0 P P V  @ X ^1SSQ Llj1 S S R  7aT 00 S   1RUQsM PPGXU? Uc X1U Y1U Z1U   U 0 0@`:0 S > 0  :0/_X1Pe_oSRPU  0PiUP#U PE0   d!e1R$Kkhf`s@ 0-PPL@  k@0hf -L$MT10K2T10@9000 000K P090K 0-T1L@ T1T 0h1Pi1S0 -`LPp$A@@P 1R@ 0P1B @ T Q X IBhf -TL@P`8 U."R0hf -LDM0@Sd `30 `#K44 1` P 0q T1T0  a1 Q,l ) S& X4?Pl01 0S, ` T  B  |` V T0<X0 Ci1h!S\ 0R?dPR0 S7R[P R ` R <K$bSPP0S<Kb0P0 LKb#KKP d40D` c k k` P`0U`0 .  jT0S@0\0 %0`P!B @P00#X0 d0  Lu #`0 (`$k h1S#VI V#VT {0T -h \l0 PPl0IceoQP h  R T0 QT0S6 `P1p> -X0XQS00Q00S#80 `  V0S X0S U X1U Y1U Z1UT0  U000! xj0SH1  dP x8 P000P1 1S 3/P000 (Kd$dhfPD D<:  8A(<v  1 , P ! k !+V  X+V ++V ;V 0CV8 0V 0;;V 0Vp+V  BV ;V H;0S8+V ,+V}  BV  V y;VC0 W*V :V 0V0 h:V :V ] _*V. .*Vp $*V :V: 1|*V t:VH 0S000:L:Vl L0CVF 0V6,=:V_ 0VG ,*V 9V0CVQ*0CV0L9VI D9V 9V ,9V  90S  p 0;0j &d 0` 0 0b0PUPPU  hP0' TS 0H0HS `^pP  0D 0 0 p  K9cPP 4^"IPO*^U@T, R00C0 7ἁ08W R R3l00 0S00c8W ! Q#l0  0S00V ! Rl0$00? P19P1070S P6V` ]L 0 1S 3/PPw0P1$0l1(0p1(0S  L6V# T1"    2T1`@P9 K`KT12T10VH10L1T1  0;; 0T1" 00T1  v00P! 0X nK0 03/0 3/PP 0 03/S؀K2 0T!  %00 000n& 0hfX/X!/ 0-H1L@ - e1Pa_oSRPU 0\ P!<0ᗋP 03/d1coSQ 0<0|1S $|13/#P0hf/ 0-P,0L@T }P@0e/ 0-@LPD0@PP  80P00S 00 00hf e 0-LPTjP0@T 0S808 TT 00 0@0hfe e 0-@PL 0K,0$8 TT 00C 0K0h0hf e -L@zP33`PPp mP煁Q C}P|0000 00d00S  R  080, @R 0F?hft@e 0-LP P ? eBXeB 0-@LXT08 TT 0S 000S   0hf e/ e-D ʠ ʠ ,!|!R  0/e-D ʠ ʠ ,!|!R 4 0/e ::# 001/e -P ::P`#L0L01@0003/~000|Qhfe :0-:#h0@ 0LR1 R,P@ < PH P00[0$0@00eu@t@hf -PtL`PD@@@ @T @ R@X 0APRTAL  X0 b@?"Wfhf 0-@PPL<,0T0,0  T0  K0hMhf -PPtL`0@@ R  @ P0S@ Q@T ?" PP @W ( QQ  0"hf 0-@PPL<0T00  T0  K0hhf 0-0L@ 0#*0*"6< $0000H0gK0hl0e -`Q`0LP#*0*"6p A00000P00P0 ,$E4L $=KhBe -LlM0`S} 1 **0" qP]뤠 @) 0 PX 0P0"@P^@]  ,Q,#RⰆU Q@T 0HQ0{ IQ L @? Y< @P 7@xpa@T$0@ dRd #K@PڈL Ks@lT  00T0S0@ @@3#@.(Kehf -pLtM@P`0 ::#t20h @p  N T Rxi R& TP"UdRd #``V`! K#Pv @0``Q V`K P`K qPP?@ #`fHU TT   n\!< ( 2/ PUp R+dRP1dP# K߅P2m @ `KR  P R (- 0PP@0  0WPP#@ @ D44Zn 0 PP(Kehf -p` ::L#(10Q )A@ 0@ @ R  0 P R0@ Q0S@ 0@ 0T 0?o2 AP0RT1#400S@ 0@ T Q X , (ehf 0-h0PQL0A TT 0S|A@OoBU @ T@0ef -aLP0S4@P||_0UT@ ឞpD0TU@$ᑞ T ! <{0p@ p@ |0pX&Ts` , mxq0AT ` TZ'0 aeBAf - J0JL$FpPx0x0aP?|AT X}L0D|1pu0003/T1;T1@P@Q@ehf\8 Q0-L@0P0$0S@@T0ef 0-@L $T@ 00褻fe -P.@SRL ": :d#&`00a $ ,$4 Khhfe - J0JL$F`pPPM40101@0@`p1H10L10T1Kx|@0D>St2T1S0 00qf0 $@04/p@0 sp@ 0 d1 R@F QpT1  0 1W0CW15 : 1W d0CW 00SP0@0P0H1< e1Sd100C?o2 @ S P0@ 0 0P0S P0@ 00P0 @$Ke`t8it_t f@hft tptu ut\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -P@`LeV` UB[00 0P 0-@LP IP 0QBQ?0000 0-@L0SP!  \P 00cS10CB>A>A0BQ3\000 0S00000CS0000 -LP``pV0S 00shST @@aV@ w0`dp0d00@ 0@T00 -PL`6^@2 V@@lT @@l)0L 0c" @l dR  0S  q! BB.A.A BW" @S  0 @S  dR 0-@PL0S0000R0  S0l0lU0 cPc0S00 0U R  K0h -@L`0 PSS 0S P0000`  BQ  1 R S0C>ౣ>!03 R S0C>ౣ>!0300 0000S000B -L M`Qp@]x0 0 ST S+0S 000$<奰 PC0 PPP` P`0UP v R0`ep000P 0PU00V& 0R! C0ࡁH P ⬑5!0C"!'*N 10c00Z 0009(KB-0S00QSt0CS0 0Q^ 00cS10CB>A>A0BP3̌䨻f-0l S0 0 ^ 0lS10CB>A>A0B\3, 䨻f 0-@L RP @Q  BA0 \P 0nS10CB>A>A0BQ3\R  0 0-@PLp 040101l 10 P K/d0-P0@l  P00 -`h0@1L01l  10 PU 8R0 ᇏ@ʑd -`h0@1L01l  10 PU 810 N@ᩑd 0-L0@01l  10 PU 0 ὎@ዑ00 0-L (0l!  P | Q  Qh@0!100R0@@ll0K0h\00at Bd0S/␛e/8 -xPL@h<*`pW sP<*pV0` 0 P@*ef 0-LMh0!@0X PS,EKtHAEKxpQ AKsp,EKkK0 -1L@/ H1S,P% P (1<`S 1(Q,Q:11 01"HaPU 0S 3/P | y0$H1_Y1:1 p-PLAM@qU 0SH,GKPP >GK QKPK)`P4 E0PS 1[S :GKo1 H1S0S`1HQ:1CK3/PU P  $XKp 0-L@L(P^^0$ ^0 K0h^괻f58H58 0-l LP00P0\0@T P0U*$0S 3/,PX@ 0 K0h}^괻fe$dܻf 0-p LT00T0`0@T P0U* 0S 3/,PX@$0uZK0hY^괻fe$d -LM" Q"  "  R㴢c@P 0" 2 &I`PI 2@22 T 00S (0SPU 1"R 0"00R000 0dP`2Z00Y0Sw ph000000S00  0`0?K -p2 r 2 "   @  Q0c"Kd2K K BRB/#r0S Q WK BRB/#r0\1K2K& A0 K ?K'0 A0 0 #K ->P0S  0 U 2 J =2 0Is @YP<-22S22]H(K@:e:eG-Q pQ@P`0@t GIQ  G 0 00-X00L@ X  #R|01X0S 3/P0U*0S 3/,P<0 R , 0 0 0 0c00eflf\ftfpf -LLM0 0@Ppl!2 000,P(p$@ @@ @P`hI 0!X2 0040P,P(p$@ @@ @P`I 0!2 0040,P(p$@ @@ @P`I0 000!1 004,P(p$@ @@ @P`pI 0!h1 0`108040P,P(p$@ @ @@I 0!1 0 108040,P(p$@ @ @@zI0 000!08400,P(p0$@0 @ @@ ldI00S pPp`ppU*P 0"S@ T (Ko(K}AfDBKBUB98w{A0B0Bf#P401X0S$00S PX0/ᴻfe -LP0 S * aoR \,0 0P0-L@ P0 S* R T T \RP \,000 0-L@P @0S K0h/0 0-L@P <0S K0h/0 -LPL -LP Kh@P0ӗ/u@ Q0-@!@3PL PP@0 -L0 S u Khpu@[B 0-LP@KP  H0S K0h/K0h -p0LP c2P D0S $Kk/P`U 1 !P @TvPe舀X h bR !vP@U1!V`` 0- L@0P  K0h0 -`PL@P(Kh*0S S S S S *0P`S@ S S KhS S Kh%` 0KhԪ KhH Kh 循ABB~BBBB[AB -`pL0L@T P0U*0S 3/,PX@e -`Qh0Lp@ T 0 R X@P0U*0S  3/,Pe808 0S0C1 S1 P #/LdT>f0 0 S / -L M$0 K@7PK[> -LMP`Kp` @o 0K\0  BR-:00 00 0@` 0 000Oo0 0.CBP@T$Q 0S S SlP0QQT<0P 庤 @000000孤(Kd0fu@dd -opLMOK np 0_Kd$02 ` 9o0P 0 00000|B lb 0 0B(K0fD8\ `P/0 !`8 00 ,  , !/deee 0!< 0`4 0 ,   !/deee -LMP0@T `0V*(0S 3/,`X@P!0p("a!(" @T!(210#(2ODT 0K0S 3/0Kmfu@ 0-@L( 0 00K0hDmP0 R0//0H0`0aaa0/ x00-tPQ@d LƢPT 0L00+40 4000P0X00H@` \000f -L$Mp @QZ Q @bQ T a0 0 `VT  f  a0 `0 PҧP00 PaUP! $m`e@00(KB BMBP@-A Q 0ࠣRS  S c0l00 0 c(0a& @a0^ T000 (0(0 (0Q0cPP00@-@P  0 00H000000 -@`pLQ0Qc@P0PaUP! 7/P@`eVQ Q/0lSQ/// 0-HPL@L0S0L0 L2fP T'TH L00L0HH@0 d T\ X^ \0` TK0h/T0 10K0hӡ00f -LPp!,@`$Օ1$ڕKh10f 0-X0PLPH@P 0 H@Q000 000f -`pPL0SP0 3S H L0ST0@` 0d@@d@0 L0@cT T@0 lj0p00@d@P T 1 # Xj0 Pp@cT0(0`d`(`o -LP H00000 0(0,000$0@0<0D0 0-Lz@P Zk0 0-@LW0 0P0 10 00f -@RLd` 80 0P0 1 U@0f =v@ -@PL0S@lU2 0 #R PH L RQ  3SHL0S T0a`00`0000c0S02k 000P -@L0P0,0S *0S  QpPb@:UpP 0 /0 嬠0c,b0U`X01V`!0 j0Pff0000fS00``p@TUU@p0f -L MpPUPZ`WpfPS`g& 0# 0 @P 22(00j(0((0"0 V f0 “007PP.*(+V0`P& V@P 0f 0000  \00 00HL$dH0H0 sj`0p000P(K0 -LMr8 p`<0 @ `0`(`S 0``g 4R0@0 8000 0W00D0 5pc0SI01 3S WPP W0 T000V0`0040 T 0 3S !1RY00@P@VPPUD0UP!S  <i<00<0 p`V PUp0 fXPP P\3d @5PT 0L00H@40 400;`0 3PPXP0\00 3S"HL0ST0 0b`  a 0,0 cRR10W 1 !Wi p i\fX ibPP~ 0 3SHL0S T0 0b`  a 0,0 c R !W  1$iP0@ @+H0L0S9g0 PP7TPFfVH1d 尞PT 0L00+40 4000P0X00HP0` \00;0H0L0S(40Y 1S  40040 0 h0000hS0 00@Y0i 0@ p 800 ( Z((K0f -PLM  K K -LM0000 K `Dv@ -LP`@P 0 V0f Ó0P`00 -rLM80 00?P` gQ0p00 pUh 0WpWP008, KP"< 嘢H8@ D0 f@ P@ D0S @2 00$H0v0(0(`0i(0 v g R ! 0_ 0S%000 10 00HLbH0H00v p`c0Wp0PvVQB Uv> Hd <坝PT 0L00H@40 400;`00PX\00<0` 3SH L0ST0` 0`00v S0!0  gR ! h0P< 020020 02002(KBB0fB -LM! K -LM K -pLP@PJ $1 000$0&H  0  00 00HLfaH0H0gPU w`P `  0  d00 00HLHaH0H0gP 020020f -L0K M#W@P @ 42042K0f 0bS-LPp9:-@P4 0  0  | pb,b0X`!W01V`!0 Kg0fpf0000fS00``PUXXP9820820f -`0RLMp00 pA0@0 08 PP8PG@Pf 2ᜡ(p20000K<0 W0YY @P Q00@0`eV`!fV%d DPT  L  $ $  P X H@`\ h ) V1# V Y<"0X000`0 S 3/f<0@ P@80R<@ phP (K0f -LM K, 4P K -L M0PSI NpPD 0(`X@`c1000 Vd 0țPT 0+40 4000P0X00H@L` \00  V + (0f0`cV 0P00 U000@Mp(K0f -LMP`֠ R @ 80V @`cTV0S@T0 4 0QHLQVP8 pf !RPR 0P  0S ``@g^P R8\V 4!\ 0 \HPL\Tl` c ̄ n\\  0 \000u0 3S HL0S0T0lH0 0 0c0SQ 0X00g0 0000 e0pgp@E0 E0 PPR 1d 00 ǚPT  L  $ $  00HP0P `X \00)P' p Qe0pgp 00 000'00P@`Z`(KB0f -L` aP@! PVd uPT 0L00+40 4000P0X00H@` \0P0f 0-@QLP%P P@00>$00$/$0S0$0/ Q0 / 0-LK0h% 0-@QLP$@T Q K0h0R$P 0S// 0- L@PP d0 -@`Lp$PU @PV0$000@$@P`0$0/$///-//-/-/-/-/-/ -L_ S-P1P!L` Up@g\ U l l  jPU: -L M 0`P 0 @pP( X01 0!00000P X h Y 0 0 0P Y i0P`e(K-/-/-/-/-/-/-/-/-// - @ L`p P  \0 cWp   cUP  c` -`@3LMQpP 1CQ 1CQ0S 09X@_   80"@KP 0  9 0SHBT@ D@DT KPKH@ᕡ$2W2 1CW 1CWPoDKi0p HB T D@DT 00S H@Tr@Q(1S90001S0:0 r`T> (1S= 01S: 0 d!K^@P)TK@P P! K KG0 A(!P0R0%W 0 24P1PPK4U@ PU 5/ Ki -LMp PPP `@P 00 `0 PPg(K -@L`PPPU b`P 0-@$LP ( |<G010WK0hGTed -PL`00CS0@,0$00?o2@"T  -@PL` &b$00 S9 (0S9 :0040080 00 '0  0'00P0:0?`P@@ -@Lp`(P$@UT  Khk 0-P<0L@@T $`P~@0Te 0-@L(P K0h葸 0 0-L@PP (0S @Y@00 0-LMPK@P0sT@ 00 0S ~ʸK0 p-L M`P$KP $@K00$hᴸ XKp 0-LMPK@P$0S@ @T@@KT 'K0 Q-L`P 0@40PῪ80P -@QL`p }]PPEP00 /R0S /_PPṄ P0W[ P0WFY#  ᧄ<㢄@ ` 0$(P0000Rf4i8 Z@?BTe -L@M@P T[ oq t@@@@0PPa &k; @00@p`0T!(0 0 (0K0p,`$@ @@ @81 00!10'>( K0,p(`$@@ @80 00!0,p(`0$@@ @0( K8d\0PPL`PU @50 4@˫+;$KTeHw@xfP}8.AB|ffBTe B -LM`0 ,Ki PP0,Kb@P/P&PP 0レPP` !p P0`S   @00C@0pW,00,0 WKTeTe -LM`0Qp0K(KUP@(00 $K(00 00 0(0 0 9/@Pp0 l00R@#*0p4 K@P ( 0040( 0m$Kw@Texf00 -L4M`0P<K 0qL0 P~@KHK Py H0,K(  ! @0 0 03/@Pd⨑ 1P0 P<KPP0&|1 0RO*0L K<K00ZP @G{+ v@> 0˫P. P iU0Zb@*  Q:Y@ LR @0@0@00J0L0 H@ LP  0P00@@@ Hs(Kw@Texf@Te -LM 0000 00^ K0 -PLM K`pcP, 0P  00S $0K ܡ@P $  X@V$ #@ T 00C 0 @@ 1K0 0-LM@ P$K PKP0 ,0Q$0K#P<K0ɚ;0  800b80@0Th0 0\3/T 00 R   X0  S R h0 2/7@000 S (Kd -LpPq@ 0` 0SP @@0H00T 808 ,0'&yK@P脿fe4/fPd 0-@ L0IKK0hPd -L M2ؐp0PU( k븠H0` T@00 p. n@N`@@f_!{$ $dO :00PS$W ͨvꄿf[>e4ff -LDM@00 X P 000 0   Z8 0 (Yp  !@  ""2@0  0 |20|20S`0`30d0 \0dD0 r Pn!0bX4a  00 ?o2Y0S IX0SH 0c00cP0\ 8;P Q9:Q7:S8Q   0SS 0 (DW  .D P+q0f40 Z00KP0  00 000804 R00S 0PU<0`(P P0`<0 40Sy PH 4 R  U 3Rn 40T0 0T 0Sf 40 UP!UXH0p~pp~pph0PL0 P  H0 d0 KP'v L@L0W6`0 H01dk0 `Tj#H0L 0H``P:\@#*0T  L00P L#4004X 00 0e0000 00e00 R0000C0U400e40 $4 fY00R0S 0 80S 00S|2 0[b U P00400e40 bP0P`0p(0P(PPXJYP` 00000 1:@ R! !Y;ö1\0S 00 D0 03/ 0 @`X 06/@0S101Y1;ö10P00 40YSY`p 9'(# 0D) 0P 0S  Y P[40 SP P<0UP400e40 80S| 00< ?oR20S0e 000o(Ke[>8tf I0-L8M ,00@`'~!1Q 00$@ @ @000(`p p/:0 ,00!0 00$@ @ @000(`p [/ `@$\QTN:r P 4 00$KkW8fBD8 Be&B,B5BT8xA -<0ML0000 $0}P  KSBfh8^B P/P/ -P@L` 0 Q )/00 3/@ -@LP1 40X aS 01?S0!t4 0003/PPate10 1 0 00/5/ 000/!  000/9/%/ -1L@P`1  0 Q 0 0Kh/ 00 8P-/ 0-@L21<1٥ץեK0h p-LlM@` P"1@01  d KV, DV0 00S z0403/KKp 0-LM@Q1K0h`$0S P 0S 1 < ?F0S 1 < 5F\H1US 9UK0h@K0 -L M0 @`P 0xPMU  P P/; _oVRPU )30S+.0V0a 010@41'D<01Yx0D1 ``,M003/PP 101i噡L@(Kp88 -L$MQ`0K8K@qˮ0P5$. 8@0 ǰ!$0 @0  ( 0"p 04Kq@P 18 00剮40X0!*!0008 10ݭV408 00 (Kd4s@ 0-@5L05 00$03/5P0C8#85?o2P0S h0 -@L1 ,PU4PU PU( 1P  1P]PP!00x St` 1 1 pPP 0S 0003/L寠101 $d Q-LP@ 0 `q@DT0 0Kh/ -@Pp`L T p`Kh 0-@0LP Dx K0hT -0L@S`P 0U  T P P  -L 0KM#  K -PLM@; 02R 0S 0S~  3/w0 SK SH SE  CRl@S0S4  S9 @S) S5  S%!S7  BS:  S  BSL OX!S1  SD GVh@0S1PPQa@K`/VY@Q`Uڼ1U U 0CU  \P0;0E7`CP1;1 ;0S@0 5@0050S@0 5@01/ <KX`V&܃K40 L0 : bH |:P 0H L0((00X0S0@0 0@ U@001*`*VV 0S 0S  3/P` *P`5(K $d d  -@LM,K 0 ,K?,K@,K)K -@LP@`0(@S 0@0S 0S:0  @ P  -0LP S@P 0S`d ?PT 0L00+40 4000P0X00H@` \0`c R000f -L M@0 Tɭ$Khй 0-@D0LP%0S S \0H0\0 1H0H0H000  X @,X 0x@w@w@ -L@`PPP H0y101 $0\p000Wd 80080@0<@0 H ` 0@0/ 800b80@01EK0h101 0-@L53K0h/  P-L2:@̀P`apVʀ 0! `! 0  , !|0 ,0"Od0 0!!`a0    !deeeef 0-LMPQ@l00U`0<101@0)  <@P 00PH 0UDPD0<0RH0K0谿fde -RpLP 0(0P7`V 00S`8 <0@0bD  `S0Q<A@P PPT 0L00H@40B300P0 X0\0` 00 VPV `0S `T0S@L@T@P` vB -`RLp$ 0P ԊX`V U@P%  P`( UP ( @@PT0SPLPT@0S@P@@T@PU@7B -`RL@ 厊0 0SP0 8<0@P0nDeS0RP0S bP_T0S`L`T`PPB -`@PpLT^ 0 0R`V 0SUD 01QT0T0T04U8 0#! RQ.  3SHL0S T0a`00`0<0a0S1Q0rO 00080 080@@L@P@0P000p@V U 0`` $Kk-B 0-@LP L0T00 0-@QLP T0S@0L@T@0Q 000000 K0hb0Q/T R 0 0S  TQ -@QLPL`L0' S  Q Q`0 R000S0T@@0Q 000000 Kh! -L@PT`ppLV(T W80 q@p0V0f00008 `f8``c^H@0ST>@T L@pL0SP0  RT0LpB 0-@L@0S 80 0-LM@P1 < < [>0D0K0 -0\`LP@ U[<S!p P  P 1S010SP0 R07e -4`$0L? RPH1S,= P; (!<0R 0(1,11:11 011 `@P# 1110111101 0 044T0T001014141<1<1D1D1=00 P 0!01111001>010 >00 0003/P V 101Q 0-LPL@U0L0L0SP0T0lVPP0 -L MPPP U``Vp00   44叇Gn@PA U7 UPT) 0L00H@40B30P``PX`\`0Xd 40 قPT  L  40H@$ $  +0P`` X`\0`0p 0 Pp(Kx@B0f p-PLM K`@P   MMKp 0-P@L0T @0 0-X (PLX@@,\  0`T  -L -0LP 0-0LS 0@@1K0hP0訿f -`pLX00X0W(@P @@0U T #X0( 0X0 -P@QL ꦛ0`T t 00S/$afK 0-@PL0U K0h[0 -LM@00` 0 (KNP#r(  1:1PP ( $. |WppAD 0@ @0( 0 0(  $K4s@ 0BS0-@LPP  (0S0#S0ĕP00B -LM0K0@ `P00K p-PL M` K@ᒣP @Kp 0-LMP@EKPE/KK0 0-LMP@KlP @K0 -LMp`8 @P (0S Ԣ&0K4KPP ˢ000P*X f q !p !* $Rl ,k@Pg!QDT  5 $DT $U R 4 PpJ40 ( P Ġ4   8@L7LT 4400004弡10 0L 00#. h10 40墣J-@@#@@><00 410,X   (KBd4s@ p-PL M` K@ᛢP8  1%@, F@P 0!00 S 1$ R M 0@1P pP 0@4 101t@$@ @ MKp 0-LMP@EKPE/KK0 -L4MD1P10a0R 0p 08 K@KH 3P=@08 K<K@80 40 @0H&P)<08000  PU X 4K=P0 <4 @ 0 <z $4 @t(Kd -pP@`LW W T 0 R @ R@ @D@ @@X P p -L M0RXpP$``0    R @ 00 ` V00PU@@dX U @T R` P 0 c(KB -L|M QRP Q O 0X  a R R(PDmplpK Rp  bPPt lpK  K0 x D | t  R || ^ZPX !P V@@T  m @I|0 0 0$ 00 K4Q05/ |0P0cPS 0 pP  #P R+ TTP P R P _lU @ 0 0X@ @Pl0KW lT(KB$af -PL M@ K`pἠP0 0 0 00p0000+@/K 0-LMPK垠P  @~K0 0-L M@PT  T00 R0S'0 K4KcP!0,KT ,K440@10   <.   v@P \.,KݟK0 0-L(M 0PS  4K]P 040 8 K<K)P)40 S%,K80,K 0<0!++!<@P40S  S 10 N@P 0KH@,K囟K0 -EL$M@`Pp@X d18K10@0XP@K 80`4K00M`P>4 0K@K1:18 1:1}`P/00 А0@00K<K 8 (  m`P<04 p p( 00084m`4V < @ᕠ 1 @-48@(Kd4s@ 0-LM@KPᡟP19@ 00003/@zK0 0-LM@KPჟP k 00403/@`K0 -LMpP`P@& C0 0   KuP R@U P  0R 0 H4 zPT 00   Kp@KB 0p-LEM@K1d0000P0` P 0#@P P̞P 7Kp -LMp @PP  KK"PKK0`K1f000 0P 0#@P PឞP  K -LMpP`P@& C0 0   KP R@U P  0TR 0  PT 00   K@KB -LR<PV@%PT 0L00H@40B300``P0X0\0 ` WP p \0 U@ 0 R #R Õ` RP$x@ -LM  0 PQR00S Q 0$  $  a R R(@hplpK 0Sp  @P0lpK0 0 x0 0(K00! D |0 t S |  | \R0QQ 0S0 KN@Pb Rm0S 1P $ 0K;@POVPPU h P>E00AQ00 K0 0|4/0@P0 |  X tT00#T0S T0 00  Āh0 @0bU 00S 0@ 0 Fhl0KW @hP P @(KB$aff[BBpf"B)Beeff9Bfe +90Bdf9BPf@BLfOB -$L 0P  t%9f^B000R@-@T P8(@01S iUT P   t0f 0-@LP0 ፈS0 -P`pL @ȗR*Q 00S0t#:0#0@ h0T UXPusP0 0R 0^T`PVff A$dB -`L`BB ,ʠ,V X\ 0$00 0 0P00 T00T0Kh4'9 0-@LT`L 0"00000 00 l00  | 0BBTf!Ce -P`pLW0p Se:l S8@T\pl0 0a#2 aS:S`8@T @T 0   300W H1!D10R6 ,L t ˇ,  00y2 00t0  S   $ x P x x0t U  y%SHO n@P \8`000ffdl0f 0-<0QLPm@P HUP000f 0-@LU`K0hQ 0-@L  0K0hmf 0-@0LhK05000  00;009    Q *  # ! RS0SS  0 Sڤ0 1   PP 80 3/~0P =U0 %$ 0S) 188@Q <   0  0000@ 0b 100`900000 0S l0 CSl M 0K0hZm0Xf fff -P`$@LKKhVf 0-@L 0  Xr<00 0E PU 0 080K0h/0 .K0hⲆK0h#B 0-LDPAT 0R01 K0hd 0-L@P 0P0<0! !@A(0 K0hK0hdf -`QL@P 0Uf QP $00Q0SKhKh -@LP`T P$0S@@T@@ӛ Kh 0-L@EPK0h!P 8 ( Q 0 3/0pNL000T0!x20x2#4<0<0zK0hfd -`L@V t0S`oP 9S 8 (0R PPP00P00S (0@ P U) 0)* 0*0 0060 0 =0w#* 0!x20x2߿0 =0VT00T0U000RU`fd  -L 6@P XP `0V0f0 0PP 0f0 0$0f -`@0PLT p0RP@f -LM`pK` @)6HQ\ 0R0 KK\ \       0p 0   0?o2P0S00 R0dS) 00pRl  aRplRp  bRl T:H@0lS`P$q (Keeff -L MP`:@ @T o$0$` `00 VG +p17'c0P40 _P! Q7 c!x R B!v*Y V 1 !050pW  010#>e40 @(00Ͼl @f@T@ P3 8@00  4/&@pp Q:lQ 4  t壾P@@PJb!"R(#R ! R!\(KBpfdfl0f$df4/f 0-PLp~ @P 0P:0H0$($HRtt xx@⭾0 0?0fff -`0@LPp+   Q( 50l0V0l0 ቾU ` ˃l0P CSl SL0 bjV -U00 dl0fff -LP`p) 0@P 0 P p IBP.  |@P  0P '0E( t\txA(8@` 1x0Dp`p8`w`0 tK Kd@Ue -`L0 M$KP0!p  00AT 0U0W 8P Xͻ0U(00\0 @ KTepMf -LM|R|B0cp2 0 0" 0d 0?SX[  qa pd 0t0`14 10p 02 8 40ZS000Z0pQ00 @% W\80cQ0DV `YD@D@0@0D0 X0<0 ZQ EH<哻 0  ? " 0"$ 0$a0pᜀ`00Q <% R 0S  p Xg @0e00f0& ?&(KUefd$dpMfTed ,@- L PK 0  Te$dB -0PL` pV00P1AU000,9 P   0XpY 00 0[PUV (  Z0 P000幺<P 000000P  )Pd 0-PLW000`AᏺU000˺* PP000忺`XV W0 800000寺᭺g ᨺᦺI<P 000000`d -L MDA40 @1P0 Q `pCY: X= 00S/PSU+ $ 40 $ S 04 0jR:00h f"" 0[ Y;PP 40S0 00 J(  ( C(KTed -pLM0`#70#W0@8 2R 0R ( 0(  e ӹ 8  P QX X Ĺ T0 \ < (@`  RH HL T㘐L T@P@ P R PT ᜐT  p8L0 80@  p,KD @ p!   p!R !; TV    R .R .R  A Q  ᪹ 娹(KUedTef p-@ -L5 -0ML@ @0 8 00 ,   b0 KI9dI9hBf -0L c@x01018P ` P 8P 8P 81100Ufd 0-P0L1018@'8@0d 0-L@'P8P 8P 8 0K0hc0f 0-80L@0SP88P0 0-@L80P K0hy80(0 R P20/ -@Q1DML0 0 @@@0Z`1p\a0 0 @@@ uZ z(`0@ (00!0p00A0 40K40p,@$@ @@ @ 0 !04 K0,00K(p$@@ @r 0!X0,(p0'>$@0 `@ @00K4 K_(KfmBtB$e|BBB -@PL, 0SP`' Q 0S  0 5]PVQ 0LS  0 %]0( 0000 0`0f$e -@LPT L`z⠶ 04R00 0 ٶ\00fff -@L`T 3[ @, 0 SxPzv0S0  Q    8   Q 0 @埶@fff 0-P$@LP00C0K0h茶f -LM#K0@S0f 080 Q 0Z cKSRT Q cKWV0S   0 \a0 0SPz 000 0PS00P0S9ZP H,#K 00000 00 00 00 0000S0  80PpA@(Kf$eff -P`p᐀LXhqZ@ ,0`000S0  0@00 000 00f$e -@L <00P1S P ` WVR 000D 0C0 00C 00 0C0 0P$Kk0f$eB -@0`SLP 000P Q0S0SP 0S5:// P/ -LGMp 0`01@QP8 0241 01 1 @TP4@c6a6<`;W01 T0$1 51SPi  C! / P C]4!$'EP]0$1 L#0E/KFKP0G6; 61S C! /  C0Q1 00CTS000;0 T, `0 5X( 6;P 5Pz 5 t0S 0W2 1 $  KDP 5 Z PPVV ! P 5U 5<1 1A/KFK0 10  1D5Z1 01 :PW *KPOK  U\eN 0 KK C?K0 00 KK?K ؠ .K Q P ,4,0K# !K0FXP 0KK )P-.K KK bXڸ^^Q Q O?K SR  bW"#* * n1S  Nc-5 (Kf@ -LM0 ,  o K80 01P80o/Q / -L,M@ T8 < T.JMpP, KE"pE0`8 @ D 00T300@ p rW0<0 ` 80pM"(K -LMP00E40 0`p0E9P804 K0KD@XFT t*40 C4 /  C07s4 K00p0E04 1!S @T &p 4P44 4Pa *(K Uf 0-@L0V,0$ R @@0右0f,e 0-L@LBH00S S0S   @ @t0f,e 0-LP<'80@T 0S 3/@K0h[f,e -PL`Tp H0@T 0S  3/PP@?f,e Q- L S 'S  CP-/ -@@PL0S L` -)00`0 0S 00Q \R xx Icp !C0\S0S 00Qc踂@BBBB 0-PL@@0S 0L00P0 0S(! // -x1(40,@$@a@ @0 0@0@ @@@ \T0H@ 88s(Ko赯Afh9FBDeNBYBxfx@h]9.A 0-P$@Ld00Cd0K0hDf -PL@|`V 'P h`` 803/0@Sh h0l 0lPd0@@ 0ef 0-@L|ӱd0Sp00S S h0Sl l l0h @03/`$@h0@@0f0e l0-L⭱`0@T <0S d0<0d0<03/$坱d00Cd0h@K0hױf0e -L`mrYq@P!TV <0V00S*^ 0 u]<@4ef -LMPA؁CK 8 < R ^$R ^ AcKT```Vp`YXa X8< AX((P#KSRYXAE#KR0 0 YX" |00T 0S) 2YX. X0࠳^(#KR0 X000| 0pIb#KV0#K|T0\  #KV00 YX(KaB p-LM$0PK@ `K0%`0 ZP 0 S 0S(Kp7v - L/v8e 0-@PL,P 4 80R8000804 (Pqv0 0-L@<-{   0K0h\f -Pa@؁QPL(@ QP(0`Vpa(0p`pu@ 'Du! 0!0,p00! R0!(0(0(`(P8e -LM$0@`PVD $pK0',K0 `P9 ,FP3`h9|h9h9h9i9,0( (0 ,',!aWV! 0! ( ,0( ,0( (0 ,(`x,! R0!(0(0 (`,! 0! K -L$M`!PR@ RR`p`0 P0XV`pV0| &0 D0 R R Rr ?P8 n 8 P P Pe 0r  0 $P@T D岯@0P R@0a$0!`  (`,`0   R Rt RP$8K5`Po 0#P@; 0@  6 R* w RʔP p Y ᮯАY ,$Q 夯 墯埯 坯(0 @   0Z3 0X P0  PU00P0(`4000D8000@4000t(0PS 48 Q8 0 804 0(0U z@0,pK0K`0'0 PPY P40@00(0r0PE(`Uk\m9m9m9n9n90S0S> 00  0RHTa!WV40@0! 0(!8 KF0@0S0S00,P 48 Q8 0 804 (@40080004040Y0 @00( ( 0 ( 040  (`(@! R0!(040 Y40@000(0! 0!P@"P !P a!a`p؁`YX`p a`Xp`p`P@P P  x  D寮T 8P  P(Kf4e8ed 0-@X0ML0L0 0D00@0@@@X$PK0Hf9Pf9yBf 0- L(HH0@ ,ZPP0 H0000xf -LM80 3`p刡0 @; 01<0 T h30T0 B/008 P0P% @ P34U<0x`m<0 k?000m_/ 0 /0/04000{L0!0 `0 P /.d4@PUL0 `0(  P.@.3P 0K0 S=PP ur0 7SPm PU80PPg R 0 b0000  b 00 0P 00S09000T# 0  >@030p  3W 0.:T +@0.0K p 9WT00t R 8 0$pY    pP 0r.T d30t0SV.@p?,x3 0u3P(KdfB X0-PL  P  P 0P $i^@PfB D0R P *20 R/R20/ 0-@$0L !Y K0hFxf 0-@L F @  0 0-LP@P 0+3P 0#0 -L@`PP 0+2@PP  Q0-L@K0hP 00 0- L@R(0XQ0000xf 0-@LP@DT@0 X@0xf -LM0 0`0 0 0 00) 0 %RdP h a h`@T-@@@00S+ 0( 0 00000000000 0000p0 P 0 $0R    00j-0P_`? 1018p n@T 0 ?@00 0 QP 0 /R P U0P0  !"P0P  @ N0.-0S! d>㈁cP 0S 001 @1@z(>0S 0 M0S Ft0S ,@<1p0hP p 00 00p00S00p00< 00 0p0 0 /R;p 0 000C00 P @e T/Tp@@^j n/P@ /P a a R ))Q))  )  R  .P.Q* * hd0Kh K6@P hP w,000000d0S0 o t0SB0 ;0S> 0SH x0 0 S*R00ȗx0 !x0   !`; NWx0 0 0=x000/S 0dh0 (,0d0 p0 00Sh0d0 0h0 p0p 090)S p00 hP ,d,0000@00p00  0p h 00S+P ,d0h0 0d0 md0SV  ShP S++0h0 d+ d +4d0p00S hP d `` Q +d+000d0 000p00S; :S@>L [ R 0CShP d0P ++0h0 d+0000@00!p00d<=p00 hP d0P++0h0 h0@0d006@ 000 00b 00SUh0S0 T 0x0 0x0 8Qx0$0 S$ B0`0(0( 0 \:0P0 hP ^+d\+0@00T0S. 0)@000H+@@0?@008G V` ` K;L  KLK\0 8 <0 H )0LK H<0P0  (V000 00 (K -LM(0 0 0 $ 0 0 0   $Kh K -(0LM 0 00 0 0 0$ 000  $KQ K p-L$M0@PgP?\/vPPV`[(000 0P4P,P (P 4@ $P ,0 ,0 ( < 4 P

P@0`$0P  ┤ ⏤ p@0V  0P⌤" AǤef -L`px0@T PP h@孤Pd0t0d0妤`P 0(0 /0N0PX0$ ` Pf0e0[f 0 #[f0 :[f 0-LMt0PSS@Pp0Kt!\SPSP@@1%K0 0-LMP` 0 RP.t0S S)p0A&pP" %(0 QP 0K P ,@%p0&P@@ P TV 0 0PK @0S#/ -L`=000@

O\0 0X07OT00$ #/O0| *O Rd0 1 000O`pP0e0STOLO @ OKy@y@ B9 B(A@L B{ B B B B1 B@@ B "0-聟DML00 (00!1@p`0,0 0p40K ,`$@ @@ @ 0'pQ!l1 P4 K000K,p(`$@@ @0 0 0!$14 K0,p00K(`$@@ @0 0 0!04 K0,p00K(`$@@ @ 0!0P4 K000K,p(`$@ P@ @y70 T0@0 ,f;(KfAXeAb Bl Bu Bf -LM`XP@pٝ 0 1PDV,  &/P$ 90 |_@P t,lXh@T& 0 |OP03 0|3002-\埝P x 4؝$ @ϝ$K f  -LM`p`0P0 , o 0 00  01P5blX )R0| 0 @P t  h@T )R0|0 P x 8{,g @r(Kf  0-P@LePt00CS 0p0!Ñ"h0|0Sh0|  0h@0000 -LM 0 0?Lo K -@4 <P$L$M`pdKğT!p 6(:`80 6<0 #K 0dK``p00K0 0 LP0-0@(K -P`$@L὜Khf 0-@XPL⮜H0  9H00 S0 1 0 K0hݜff 0-0| L@RP R| |00S H0  l R;H00000K0h!CeTf -1| LPR@ R| |000h`S#H0  l R;H0H0l` t0ppS SKP `0S (0@p0|0S0|  P`!CePe 0-0@ L R  R h/ R     , +, )R Q0fPe,0;,0/ -L,M0PS`JQG@pm1L0KZ VPP. 0 LKP0 +P0TL0K LK  0LK-0Kh@W*@dP ld LK@H岛d T Bd P0`Ppch!P(Kf0e -QLMp`-S0SOR81 0W>00DPK@P4 K P ' X *PgP # K K◷@P K⑷@P n f P}PgP$K@Ve 0- L@000 0000p0`0P0@0x0|00 -LM@`Kp0$@0 K0cK|KШtf -LM@`Kp0$@0 K0cKfKШtfP 0/y@1 B 0-@PL 0rK|0S kKK0h-0PfA@ -`MLPP@PȚ 0P p.p&忚lPU 0|  L3000S00S drP PdߚVP,䕚T0S  `lPΚU Kf B B -pL MP`]W  I @ 0 `=A0 (Ko] 0-LPDY@0@T tPh@d00d0博0f0e 80P0-L@P%  p0x000800)%*&(%)&  +KN+ 0|00 -L,MPp@ <0 PXd 0W!018`1 08 SK ȡ E?, K00"0 3p D @0 < 0D 0@00<00` V FF08D s 1DP`1`! @0 E@0V /f40K 8V -P`V4 t0St0S@'S! W! W 0SYl ,0R0pP d0K(0 K0`0(  '0@X03/+@@VU (W@(0X03/@@@d0K()(V @0K( ( $K8  -LM1@1P,K0qP;00 0 0 10 xVK @P*@0K(`T 'TK<00 80K 1P[0K[P R'@PkKd -LM1a@1p 0PAZP 0+㻵@PSKv@PNP1 0S <SP  @:00 00 0 1 11 VCK f@P)0SC?K(@ w'0P+8'@K00 80CK 1P0;;0 0K'@P A(Kdxf$af=B -LLM\5@pP K `PPJA8 P0`P `00X0 /W0 LK; LK$P T4Q LKLK Pf0LKL0KP0PX0 LKʒLKH0PX0 Pp0`0  0SX 0SX00oS  &(p000H Sp%P##*x. p坯PPp: 0S 5P` `@0p0 WPPL0 PPn`[(0 M85 (00P(0M8(0叔#U 0S zP 0  P0L  `@(0\0 20S \0,0 -P  0VPP&PP| ( M8M( 0&(  ,000,0  2, 00(00(0 0 ~PWP  pb PU_,0 (00(0( M8(0,0A ,;SS  U1\0dV+ P0 P#  MD(04VP0 P  T4 dKb@P h](P`hY`P&@@0 U@P ](0 L0SN Y@ K -LMp KR @P ^P(` @0(0"@(0@0(0O VK -L -L\Mx3@t KPt0`P0 S9989p99909T9|9999L99, dK`6 dK@P,  p dK`) d K@P dK@p$ dK` d K@P$ p( dK`  pK̭@Pd KpK@P(  pK`彭@Px( dKᷭ@Prd KpK dK⬭@PgdK@ dK`dK 9@ dK♭@PTdK @ dKᎭ@PI dK #0000@ dKz@P5p KdK@P/ pK⇮ `@ dKh@P#dK @P@ up @8>+`S@P @ Y>\@t: K y@xf -LM@ ,K2P,K K -L$MP0!Sp88! S@P[0Sd!8@TN P =?,@K00$0 3`8 <0 *<00<0 0@8{T  =)0080 cP 80崐 P 00/S Sd+0S@ +8 =(0o80(KxffB p-LM@T0P` KP 0 00 `p@ Kp y@ -`PLHc+ 0@`P ᚭ`U+ p-PLM K`@)_P  04 00!0`8@^Kpd -`PLH++ 0@`P b`+ -L$M80 01Pp@<0  +`@ tp0K:0@0 0oP UT*0 080P0 3/0P,@P P@Y<080P 00 80`0PU@0 3/0P UT0 00p0 @080 *80(KB -LM0 000 K0 -L M0p0Kz^PC00@t0S" P +?PU%4KPWU4@p`V9#8P ¼0S  \P|@  P](K -@LP0qXR `᜼P aP 4PX}PƜ0rR8R 0$Kk؜ -LM0 0p00`RP(K]P(0hPUt0S@"* @"TD 8] K p-LLMP` K`:P"T000 `04 \ X0 P, \K@P `H0`0t0S@"@P "Kp p-L M0 K0A`P 8@ P  00bKp p-LM00a00P@ ARP 0 K@P 8;Kp -5LTMP`pF 0pKtK8@"_P?!0D  0 l h @P0@0 QPp0Y< 0 ,2lKl @P p t^0S ,P0 pKw`@Pp00 t X,BPp0 t@P "p t %^(K -p0LM`P K$0 aPdu $K]@P$0 0 0000$0@S \ K -p0LM@` #PP  (0 f@Kd -LM0K00@0 cP00K -LM0K0 0@0P00K -LMP @R@` @ 0BT`p 0  0000 K 00S03PS0K -L M,`K& `Pp0@@T@3(0P00 0pPP x((K 00-0LP@0P 000S  K0h~F0-0 0AS-L`O( ptPP@@T@3Vp T V =(`P7(b p-0\ML00P PP<hK\P7T000 h04 \ X0 O, \K$@P h'H`hlKl@8T `K)@Pl0K 00S03H0 6@Pd `0S@3:l,@lKp -LMP0@!b!000 0 yPPeUP^  \KKq]PZ K pa@PGKE@T?t0S:  .@P6  @P.l Ke 0K*K @P 0啍0X  X ҍP0  @PH 0 f\ -@ \P (Kd -LM x K p-LMP000@` OP$ KP K$@$pT '@ iKp -LM@0KP KhK -LM`000P@p OP$ KP K$@$8T 0 0 0`@ ,K p-@ ML`P& 0P00`P$ #` &Kp -LM`00q00@ sOPB/K@P&PP 00 1A ܐ 1 MAK @PuX0 *Ko8010:j#: V0 $K  V0 0   V0  V )0  V0 0 0  0 0$K 0Đ RSKp`QP)R)S )S S3A/KAK0K( .A?K(` @P  A/KAK0K( 2@Pn { @@A?K(X_ l X Y @$K -0ML 0 cH K -0ML 0 ! ; K0-00 c3 crp p-LLM`0 11 d0KP>`K1@P%0P00 `0\@ 4P X0 L\K, 6@PH0S@dt0S D`0` R@\0K( @DD `d @\0K(D.DH0P HPKp y@y@ -;ML 000c0  K -LM 0;0 00 K0 c< 0c603 p-LLM0`KP5`04` \ 00 `0X0 bL, \K@P%H0S00\0K(DDH0P HP `l\0K(P D@P DD `[Kp0 c_0\0 cW -LMP XpP 7 (0S0`t0S, p0S S S@ @ KTP @*K@P @ P0@@X (K -LM`pXPP" 0}X(0St0S !"K  V@P,0K0 V@aX K 0-LM0KA@c NVK0 -LM`pjXPP" 0>X(0St0S !"K  @P,0K0 V@"X K 0-LM0KA@c -WK0 -pLLM0@PB hKT``P:h08` < `0 d EK4 L ` (J3J)J4JdK4` @P hShPOW@PPP \@P @\ WL K -0ML0 c K -LM 00 K 0-LHMPXK@CPX0@(@ P0 , T JTK$ I@P@@@$ XK0 -LM0 c K 0-LM@K@ P@0cP K0 0-LM@K@ P0cP K0 0-LM 0PKP @00@P K0 p-LLMP`K`PT000 `04 \ X0 }J, \K@P H@H `Kp -LM 00 c+ K -LM 00 K 0-LM@@0P KP 5@ K0 y@ p-L MP@ K-WP  0 `@ VKp 0-LM@@0P KRP @Y K0y@ 0-LM@0P D0D0 0KP @. K0y@ y@ -0ML0 c K 0-LMP@KVP0 @VK0 -LM 00 K 0-LM@@0P KP @ K0y@ 0-LM@0P L0L0 0KP 0 @ K0y@ y@ -0ML000 c K 0-LM@H0P KP 000@ K0 y@ 0-LMP@KVVP 0r@VK0 -LM00 00 K 0-LMP@K3VP 000N@UK0 0-LM@D0P KYP06@P K0y@ 0-LM@H0P K@P 000@6 K0y@ -LM@S11\Pp `@KLK 0S  P ]K0s00sK0s$0Sp0K Pp9"KP` K%KQP`T0V``P0``Kx0 sK0 s |KVK\KY,0"K0,0 @`W $K y@y@ 0-LMP@KcU0P  00  c e@ UK0 -LM 0  0@0 Q K -LM0 cC K -LHM@PP`p 0S <KiP<K40 !R %K? T0 $0 !R!$K? D0 \K0 0K - ML00 @0 K 0-LMP@KT0P  0  @TK0 -0ML0  K p-LM R0`P#0 KPx# t0S@ N @P"@PK K)K"@Kp y@ p-LM R0`$KTP0 @ Ph t0S@  @P Ka )K0K @Y%TKp p-LM` KaTP 0LP 0 0 @8TKp -LM`0K@TP.0  0 @& 00" 0 A@0 ؀@ PT 0pH @00 @@S(K p-LMP KTP 0 S `H` 0 0 r@SKp -0MLc 000n K -0ML00c K 0-LM c 0U K -LM c 0I Kc%# c0+c -LMP`$KpS@P$ 0 ` 0K`0 @0@ @0`0S 0 $ 001SK$af -p`01L8@ P100:1: p-P`LMp  K@<TBE0 S0H@PKp -L M0<@ KqP@jK y@ -LM`Ё 0PJ 1 R0R 0000K SP00  ` @Ll t0S`  0` R`(K -LM@a0%J 1 R0R0(KRP(0  @ P ; t0S@  `0 @ {R$KP 0S 0,000/ 0-@L\ЄP00CS0 <K0h , 0$ , K0hSf -@PLT P `P_P@ 0-P@Lp埄0S \J00H@80S  U R00I ff -hQ`L(@!P 0SO TE (!@TB 0S2 @@T 0S0(10!(!p◄T E@L 0100@S 0 p0C0~(!(!@304S` @  m&@fd4f f -L`p3P @T `PP 0S0 0 ʧ8`0WS0p 088X <@T0p 00aI f 00-$@0L/8IK0hf 0-h@Ld(,! ,à ⿃ ể,7I$4I7000fh:BB -`LP0@   0 X0@ 0c  0   -H2@"0LMS@` 2, \1r20,0  ( 0L0 (P0D0,0P m P\UP, U(PKq0Z0 40 040 0KȀ fPOPPk 0P0Z0P2lt0S0 0t0S.     P$K5 0K*K P YP awX00X0w  -Oy(K d -PLP@` =wX00CX0{w =PZ  -L,M`pကP@P\T0KL0 0H0 $K 0T P@ S<@ 8p LK001D040  LKN@PW0 LK]s<0Y@000P0S@X (K -LK0 0G/Kp0$0@$000-TV0Ky@ -LFMPp`0 GK@P0I/K@PGK0 0>K0 0G/Kp0$0@$u000-TV0Ky@ -LFMPp`0 GK巒@PIK@@P$1GK@t0 0>K0 0G/K0p0k@?000-TV0K p-LGM@P`0 GK凒P\0.K&PGKD` 000G/K @ -TVKpy@ p-LGM@P`0 GK_P\0.KPGK` 000G/K i@ -TVKpy@ -LFMP`p0 GK7PK?P 1GK@ 00G/K0A@??-TVK -L$M@0p0 KP)`,0K00 0@PU,0PV,0 `c(0K000~P P@( ( ,0000-TV Ky@ -L$M@0p0 K{P)`,0K00 0U@PU,0PV,0 `c(0K000CP P@( ( ,0000S-TV Ky@ -L$Mp8K?P+`80 40K00@PU40PV40 `c00K00P P@0 0 4000>-TV(K 0-LBM@P0 EKaPP0F/KP EK0E/K@-TVK0y@ 0-LBM@P0 EK=PP0F/KP EK0E/K@-TVK0y@ p-LCMP`0 GKPKz>P 1GK@0G/Km@$>-TVKp -`L0L@#2000FS`0P0`VP `0P -T0LM% K 0  0$K@ Pd0 K03/@$Kz@ -H0LM$0   0) K(K@ Pd0$K03/K {@ -LH$M   0 - K0,K@( $ Pd0(K 03/K({@ -LH$M   0 - K0,K@( $ Pd0(K03/KD{@ -H0LM$0   0) K(K@ pPd0$K03/K`{@ -H0LM$0   0) K(K@ YPd0$K03/K|{@ -H0LM$0   0) K(K@ BPd0$K03/K{@ -H0LM$0   0) K(K@ +Pd0$K 03/K{@ -H0LM$0   0) K(K@ Pd0$K$03/K{@ -LH$M   0 - K0,K@( $ Pd0(K(03/K{@ -LH$M   0 - K0,K@( $ Pd0(K,03/K|@ -LL$M, "K 0K!K01 K@( Pd0,K003/K$|@ -LL$M, "K 0K!K01 K@( Pd0,K403/K@|@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K803/K\|@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K<03/Kx|@ -T0LM% K 0  0$K@ jPd0 K@03/@$aK|@ -T0LM% K 0  0$K@ PPd0 KD03/@$GK|@ -D0LM% K 0  0$K@ 6Pd0 KH03/K|@ -X0LM$0   0) K(K@ Pd0$KL03/@(K|@ -X0L,M40 , ( 8K "K !K09 K@0 Pd04KP03/K}@ -L,M\"K "K 04 9 K0 8K0@0 Pd04KT03/@8K }@ -H0LM$0   0) K(K@ Pd0$KX03/K<}@ -H0LM$0   0) K(K@ Pd0$K\03/KX}@ -L,M 0 0\( 0 0$ 4K0 5 K0@0 , Pd00K`03/@4Kt}@ -LH$M   0 - K0,K@( $ |Pd0(Kd03/K}@ -H0LM$0   0) K(K@ ePd0$Kh03/K}@ -L$M0 0D$ 0 1 K00K@, ( KPd0,Kl03/K}@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , /Pd00Kp03/K}@ -H0LM$0   0) K(K@ Pd0$Kt03/K~@ -T0LM% K 0  0$K@ Pd0 Kx03/@$K~@ -D0LM% K 0  0$K@ Pd0 K|03/K8~@ -@0LM! K0 K0@ Pd0K03/KT~@ -`0LM% K 0  00$K@ Pd0 K03/@P $Kp~@ -P0LM! K0 K0@ Pd0K03/@ K~@ -L,M"K0\9 K$0 04 8K 0 0@0 00 Pd04K03/@8xK~@ -T0LM% K 0  0$K@ gPd0 K03/@$^K~@ -P0LM! K0 K0@ NPd0K03/@ EK~@ -@0LM! K0 K0@ 5Pd0K03/K~@ -H0LM$0   0) K(K@ Pd0$K03/K@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K4@ -H0LM$0   0) K(K@ Pd0$K03/KP@ -L4M#K0dA K,0 0< @K(0 0@$0 08 0 00 00 0Pd0<K03/Kl@ -L,ML"K "K 04 9 K0 8K0@0 Pd04K03/K@ -H0LM$0   0) K(K@ Pd0$K03/K@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , ~Pd00K03/K@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , bPd00K03/K@ -D0LM% K 0  0$K@ LPd0 K03/K@ -LH$M   0 - K0,K@( $ 4Pd0(K03/K@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K0@ -LB -P@`xP0Lt0@00d0L00L0 0 (z0P 0Pf 0 //0L0/ ///0/ -L -L 0-@LljP 0P pP ]0 0-@0L$ @ o0 -LB -0Ljk -$0L@0_k/ // 0 //0@-0S  0S@@0S  000C S}:}:}:}:}:}:}:}:}:}: 0(  0, 0 // 0-@PLj0U K0h40k -0L`p0@0 R R\ \PH P PH 0P@0  00X02(㈁50 @0,KᝉPP ,0(K0,000ᑉPP (D,(՝PP (M(N,L(q( P$P1 01, 101.~.p@( 0,0 0 0 S ( 101.0 $0 S$ , 1 01.00,0!Q*! $R4S( 0S (10S(P{(0m.P(U( $0Sa(0S.P(,U( KdBB 0-0L@x0S(0 p0$ 0BB@ 0-P@LT !0Bs3@ 03@_hjK0hh1f 0-| L@000H0 0H0+ R;H00`e 0-0L@0 6huhK0hU -LTM&K @ 0h0 0S|0V0 < K $P1/cKKt0婗)S 0`0l0 L0 0 40 L l0 V0p `R`0SgT00T06h0H $` 00` 0000h0S0H0PPP00H  02!20R0H P0&K%K/ 000D0L eK`Pp0ZK %K\0p#KSR&0S 0d bT0 P\0K gKZB KL 屲D0K040K0@0K 00i P P0&KKQP00\ Z00SH` ၥTd ` b\0H墤0 ) L ԅKXl  {#K 0#@V H嫦h0S. H/@`a崠PV㰀ʀ 0! `! 0    !H03/ 0!!`a0    !h h(Kdl0feee -LM000 $P@0  000 0P0 90 00 00 0 @:g'K ?KR(K|\K1/K06%KP0  @g܅Kt0S 0`0T00à'K X00 &C6 0 )KV0iKK0`l0 p0 'K 0)K0L-60  0p m0  P 0 KR vz1 S0 P5 0S 0S f#KR00SG L0KY  i#(K 'K 0`|00 d K (K1/ h |00 \ K (Kn@ft0S`0(0o`0 (03RSd|00 0S_ 3/\0Q  ,0KD # 0 'KP0  PPpp0P 10Cs  01S000 0 00R0S !LKSLKn`00 _e`/fV0S `09S 0*8 03/P{00 0S  L0SI F0 K?o20 'K R0":0 10 0000p0K0'Kh0 S<0 p0 0Sw T !#@P0S 0S_ p00S 0SU p0R  0p0 'K KSR00 pp RppW   p ,0K( #  )K p0P 0S! pe00 efKp0 0 t0S 0`00 0 40 0 8121 0S  0P0 `0 060 )K V0pR0``0p R`0 00$``00000` S600L7 000@7 0000PfU &61z3'zzg@ 0 H`Pg)K'KP P P 0S 'K K R0"VZ13@K000 0 P S:# 0RK0 ` Kگl0K0T0K0h0KK0 0`P0 00 l0K 0 p`'K P0V0 0 Kp`h/K'K 00LP00 P pe'K  Q0?KP/K !#@ 0%KSR7'K 00$p`K V0"&z0 b|0 0 00 Fd0 eR R# # R0# #ud00 .)KKSR00 R00S㰀  &|  0 aG0 )K fgK`Vp  %K0h'K 0'K00a0 ` H0Sz 0S ɠ`0V00S! 0S` |0 1 000? )K1/`Pc0 R!0Rd0wPc0 `Ipp0U*X% 3/o"## @03n0U0U0S 3 P3@ 3  3C03PHc0S &cP 0!"0S`> 0V00S fcV pc` L0KY  N0 00 0S 0S 0 8 03/S 0Sh (K=@Bd\b21f -L]MOK 0P0t1 ;101 ;0!0R41 ;0l1 |0X1 04!S0 0p1 0H1 0K0`1 |0K01 pWH0  ;H0l0SFZ H1S 8 03/ b Z% 0" 014!S` RpP #c c`@E`0T F @ P 0  H bT` 0oob 0 1H* 0K?KO?K PA& 6:!#/1$1 ! I?KKK R000x1 H09 p+  d!  S00@BePd4/f@: 0-@LP]0S 6K0h^ SS-L`Pp@ T W yKhs -LMpXp`P@{40K0@ 0 4/@P 0T00S4 i40V_ S_ $03/@PZpX@P00K0@ 0 4/@P 0T00S0 >00U2 V2 4P0P 40t Rp0S40P 0t0Sp0S P 4 0 0 $0 40P 4P @@@0P K@ @4P A(K -LM `@ 0 WT  (W $0 0004040X0000< 840 00(0S 3/AWEV -LjMX$@V   BV*<$V B ,$V($ $V: V $V  #V BV'*#V$ #V##V #V##V BV*#Vp#  #V # RH#V   l  p2Ve 2Vv  3V~ 2Vj 2V] 2V0CV*2V 20S20Sf/oK E/oK[oK|PJ070 0GpP&2D"VV!)*4Ÿ*0 "6 0p$b& `p0 `6,:0 &00 Gp070JR0P55 0P 80A80A:o_K8S5E/.PNJP@ {@J0$0 0S0 oKP`0JPU w10iJU W$Kgdwd~d({dЀfdydrdAd@edArdAmdedAhd |dg~}d(@~gd -LM@`Pl -U~&**0"6 p0$a& `p0 `6,:`0 &00 !F`P 0P 0${U0<   KiR03 b<0V   `0 @p`00P 00S V0t/0  0P00a 8 `p8V KhBAvBBB -LM@*ZZ0 %6l Y|`0␀Q0 pmI00 SU0=X0S 0 $Q 0p 0 01/0P )50 0BU 0 WUT0PTP  WP0PPP00U 8U0S T P00X0000 iI00(K -LDMpQP; @@0<@ 80 d@ `  4 dK*P-P`tX@!p0 @P"@P"@P 0H X00X00)I" K/ ::#0 P057#/f -@bL-"0\003/b -LM`@P 0S0hZ PP P P0PP 0   0`(KoB -LPP 0SUoH`HP⟽P@ 0!QP@A`HH5A -L M`p@P> 0S:U_WH帐`SH rP  mP`";+Ġ QP  0xx *"K-#K"K 0K8/```eHcH$K5A5B`@?B -LM@P7`PpB 0SA0h0S= p0 0p60T 00T 0T*0W h0200 Ki@ &y@ ∾@0 y**+* y K}d(@td@zd@vd -goPLG렑者p@P_ 0S p1 CS!1 01r G00$00ԆBG0h坅@GT0]&3ppPGᨅ'G0000000 0H0H0$#0h0p0!"$0Pp$00p0`GT00T0GTVG$KkG ;$d -L@nPP0 0S0h R00'$ R$ jP ዤ 0P ဤ#go"G101p6[G$KkQ$00$KkFJ -PP`L+@0S00go0$F1 CS!1 01 0 $&cr)GKh p-L M` KPḫP! @P   @P  0F 0X  X F z 00Kp -LMp@P/ 0S+UoF`F01S0d0S 0K PP0 h d00d0P W,1(100,1(1,!(1001`FFK 00-@L >KP K0h0@ -RLM`@ R2 4K2 4KpP( 4K0 ` 0 B ^##\ 1p0X`ß% v #zf0( 00  $K p-LM@P`?P 0S 0`0 0 GKp; ; p-LM@`$P 0S (0` 0600rGKp; ; -@L@`1rPp0T*0QU@P0P0wr,00US $Kknff -QLM`p0K␐lPEt@T W 01S @E$K v KvEK 0-0Pd@LT@Dd@OoB`EUET 0 h, 0h 0 -L`@P 0SU_dE`aE V,1(100,1(1,!(10S01Kh`EE -PUoLp=E0AT{EuE`-EKh -P@aL Mpnq0 0` U AT Q`P00P`qV[Iph]⡦go3D~1S 101d *E0  0  ݧ 0 3耄lD p00Cp00S   0 lEp#4Dq0080<00^qD# ;(Kffh@@B 0-LdMP0P`  4K*P0*R0Un];#K@-ᜐ堀***+0 <0 #0 ⛐p0 ]o א ݥ ug? P0 TD>T0 l080 SDH00t2Q *$K+%K*$K+dK&K R0`p 0fKdKR0$KV 00 S%K R0`p 0fKVdKR0 \$KdKSR%KfKSR<.P8JDY6X3 0L 000Lp8s `V PZ`<L0 D PD L0 `bpY 8Cp080Cp00S  0 DTE PCp:h☵P# H p 0dp8Cp080Cp00S  0 CT PCpվ: i` tP 0 +/Pp @Xa5: 1 00y*kp@^@ @`<0 'Np0P 0p0t0 0t@0BZ`:0Z !D D0< Z0`< .:9@P(KA ;BeffB@B9h -LM0P1 0GK p1  1 00!CKlD 01 Ct@0K␐T+ 1S*0S#` K:t K❹0e0K0  /t*%K+$K0K &tE/KKJ`P 00 0@``p00C$K -@LoP|p0T*0aV ٷP UP  0 7@ToffB -t@L`n@T*QU 0孷P(7o@@ 0off 0-LLn@@P0T*0Q  @K0hoff#B -LAQn nìP 劯PP  nPP`0U"*Q  R 00 0 S hA0 0P (Khnfe-BPB0B0BfsBf 0-LM41@L0SG $Q Wn K P8K K P1 7 P  '   P R   PU 0 3/P   P 8P(rnK0efBBB2BYBf -LM#Kp0P``pAd@T h0@d@00 @00K AY '0&  0  b0 $0 0#K#0{ \~` xATd00Cd0 0%A(K -PL M`pm븐0X%*0AT 0 000 ^00oP*SR+SR UP J0 G0 $ m(KffB -L@PP`D@00#4VP>P 0h@@`8 8#4`#/ -LMP` 790@ 0@P4 04$#4 8##<004$#48#x#<00p48 40 80 0 $4"40#4 0 0 $4"4 0#4 0 048 4 0 8 00 4$#48#(<R=0#<0ĕ ĕ0ąą0 8#Y!!048 40 8 004 40#4004 40#402Q W0!<30C(,00"0C!0CR0C X0KⰐ$0P 4"$4(!4"(0 ?< 9 P6PT3TX0X\-\`*`d'dh$hl!lppt1tRe0 vlP qlPN1 0EK1 C?K0C $ $ C?K$ $ B?K0C$ $     1Q[ Q0 /q0K *q0 %K0 %K0K0 1 qK5P 1 `pgP 086 (KREMPBB@5AB B -LyMPpPw60@P " ?`P x啼P0S W:`qZ_K8Ʀ_/K&Kv KT 00S1 DP0X S1  } 4 ,L`//H0/! 1 U61Gຽ!(61P @ᡜ 0 `P  $P ]qZ0K0pa 1 VA`{Ki "PD wK` &sKw/K&iK 0 2 2  P27@2 , Lp0K GpK" 0 R0%K3S0K6~8 iK4pKLP]0KiKPB0K 101 1p1!ST Y|0S >  Q#&-- ##?0<P@@D>0,1e -@PLpf/ᢴ<(00`$ R< #03, %@ ##:!0050 %,0540%4 5,00 800 k00 k>404<0 00080 X`00```0 i(0 00< !,0 $0@000(040,0Kh`,1eAWEV -(0L@#0!!᭰`P 0S00/꜀=00CS$0"08 Pp$Rv:WPbSP1`S0W   q  I0PeP000=$Kk|,1e - JJL$F`!dPP+ 9@A0tpD= VL0@L@  VH0@H@L H00SP0 ==D=刾`0@Pt4=,1ef - JJ<$FLaY(p(0Qb= @PU =,4  `  !뀾@P= U `u3V0S 0S 0t`U0= WL0PLP  WH0PHPL H00P0d= b=,1ef -LpJ@t`=P0SPU PPI=U `Agy0<p -LP$`@` P<[ ⏷2`\ 0S z0 APKhBA|e@ -p :@:#FLM!tlPPV `<0S 0p 00 0 0Mp <@9@AT <70X 1X ,0 @   $@T Y<눠p 0哤i<X @ @T 0 jꐀp嘐@<(K,1er @Pd p-@ P  LM!L`P 0S ,0`0 0=Kp,1e34\1; p-@ P  LM!P`ڮP 0S 40` 0600=Kp,1e34\1; 0-<@L 0;,4P K0h0,1efeBpR d0R \0RX0PR :D0R/-/P-//|fwt@t,@{f@~fvt 0-LP!6@ 0 gP$ 0 -@ :D:L M#640 /oP"U R Q   B 40 Sn@;;<;l<;<;<;<;<;<;<;<;<;<;<; SR ^PX0000 fP` L1jH&jzfWp!d;0 0 .y000 |  Ż y0|;0`WV: #::cSP1R  6P  0S00 R  R00  Q #,0吻zx(K[> Xe@Xe -p`L d;0 0@H0*P0z,Pe|(0 @Pd@Xe[> Xe 0-LPM@PT 0TK1 0 ) p x0@5 R  TK❷@ᇖ ^PP T PK0dB 0-@LK0h聸 -P`LP η@0@ DXe -@LP` \哽 4 <0$8!  UX: 0@@ A00-LP@  R S00000Sb/კ p- ::LM#P P`  0 ``" 0" K$K @P 80 =@` 0 $ KpeDXep@ -P0ML00 4@P5@@0 *P* ` p T00PU0S U\# n0P Y@T  0 a@0 00 00(KDXe -L,MpPY ha @T0SP7 PU 1 ! 0LK LKⅶP PP0UP00P0 P0S ˶0 R,#S 0 0ض P @P P0R RS @ 0#@@ (KDXedB 0-@0(ML 00@@ @@@ P0 0@0@ @@@$KN$0  "00#0#$0  0$KY`K0BDXeB0S  0 00/ 0@-@ 0 @  0 A! 0!0 -`@L&9PU 00P@H0P00P`^9Z9蜉@ 0-PP@L 9 ?"6Q  ?""R0PP?90 0-@PPL8P0T0P0  T0  K0h'9 0-@L80 0R 00(0,000K0h9 0-40L@SP 4y40,0S S 00 000f p-L M@P` 8埻Ѐ& 6!:  0K$ 4 <0P K0 #0@0`0EH: 08 Kp謉@ -P@Lc80pAP!`0!x X80S60S50S0S pP Q 50S0, tə050|8z8fdH; -L M@+8 j8D0S 00 H PKh 0-@L850S0500S K0hG8 -LM K$KpPP?900@<00@P`01x00ዌtXPNPPPPPP88dPd D7000`S 0 w,`8@ 0 $ KfEAf܉@ -`@LpM 0R\750St_055077 R7 00 0S#P> 0 0 0 ( H/o6"Q R  R   pPP #P 0S PU  P 0 0 P 7 ķPS70 00007 0-(@L,0S S 0  EP 0S K0hs0 0-p`PLU V4q@U@1 ƭPd`0B -@hPLp` 7 0S$0C(@ S  R (0S$0CJ p`Kh67fBf -p@LMPK CoK:` ክp l, 0` 0   0  P p 0?o2P0S(KfPD; -pLM`KP` @[0K\0 0`@0 0 0 0000 0?o2P0S  BP (Ke -LMp0@0 0 x0 l0K | t0 pp ,@ T2(K @DT <0 S Rz (⼦  0 Qm 0S K3/ KP`_ WK⎊00p00pg~! 0 V` `!PV`0g?0 .6 0PPQ 0S e6,w]  0 a)P 0P P60S5Io  00 岓0  qP03/P46Y p@Ts @Dwf -LCMP ` p 2S*   0S0 @(@,IK 2I/K0000000$ q Q , KL; 0 -LM 0  K> 0-@LP5 @T $@DT 0S (@T 0 0 0DoP00,5T 0fX;@Bf3B -LDM@P T-xQ a5Б 1 @@묡  ,0K@# p` 0,p(`$@ @@ @ ⲃ00SC 40p0 ,00! 1'.01 00(` $@0 @☃0040p0 ,00!0 000(`0$@ @ @⁃0040p0 ,00!`0(`$@0T0 @ @00 k(KfEAPXee\fTN;NBM;bBU;YB -LdMQP ~q gQd000 0Pp0 ZX_VPUPHA40SPD @Cl0K00t0 T> V  W R- ( K,l 4 Kh K5 0g K6 Kf K8 d < ` \ 4 R< K t e4@V 1@ #lKPP  f0 GrpSP @Cp 4Pp(Kff -X`P𝤀0 !`!800 ,  , !deee 0!< 0`4 0 ,   !/deee -P`\pL@T 00`0S 0003/AKh\f -L4MLCL `!(21(2T 3PX@ U<4s00 @KP0 14⎈@P\p L0pW Є 0S S :S2P S :sS\2P D2 82P  2 P 2P0e H0 0YXi:  Yh>0eY (0Z 0 0j0<07L PU  L20HpPP(p$QP0A3*80@PS 0 U 0 "BPP220:03` 006/U P `03/A\0P@K "( X0T!(210#(2(KdPXefff -LP(*3$q@aTq@DT 30S 0S040BT3Q3@T m8 @T $@DT 0U$I00(S P 00@(@$Kk#3ffPXe -Lp8`@P P200(0$0,0d00 p 0$0 0$pS( (0 l 0 p `$Kk2_BfPXef -L M0  "R:0 0 R  0(0\ $@ @PK>L; 0p-LAM@K!$1 01 0` 1 0P! 0K#@Kp -PL`0@ 3SH L0S0T 0H  0bS00S 00C0 000 ?0S  (  ( 0S 0 0ۨKh; 0-LBM0 0 0 CK>K ! 1 l K -L@P`Í(000S  Kh/e040/e 0-@LP K0h -`L<1@T(&2F 1tP101x00150Sᔓ0500S p 2200000P P  P P 0000/P22 fdf -L,MY@p1`01x00150StAP5P1T9W GH9W3 0CW ,9W $9W| 9W9f1&9W 0W 0CW+000+8W 8WU 8W 8W8Wb 8W 8Wx 堯  p80`8W T8W0<0 0CW 0W 0CW0608W 8W0@0 7W9 7W8 7W 7W7W 7W 7W$00PS0P31P0000S0S P'0 S 0S 000PP10SXP XX Q pKP P ePp PP`pdvPP00䀔`Q00X4 d00S0X4 RGPP040@{00S 009s00S 0!H0 (21(2L h5 pW. PP$pGW* 0H R0S 0S  P00 @KP0   zLPP0 @K(pW $pGP 4L!(210#(2l$0"00S8 R2 80 `V/ $`FV, S R (`4P700,0`0,0p0,0S  0,p`U  P0P40 wPP&0r/0S  ᅦPP$/0 0Q 0A Q0S 2 P0 F0 0A0CS…R$PEUC pW(PU<̤P0(pS`VP n P`` b/0U S 00,0P0,0`0,0S  .0,`P/PP1H10<1P 0S0 0P00( 0, 00 !&(00,00!80000080<0@0>/0D0}/ H HPP7P(KdkB@|B@iB fB@hB tB@oB@f@wt@{f@kB @oB@{B@$d d~fyB|f}BlB gBzBvtfBwBlBefPXefiB/P/ -LM K⧥`8 8#4`# K0M0004  Ѝ//Q21 //0-00Q:cPaQ00 P^0Q0 Q    ( 0 0-L00Q:cP0aS00 P00 0000Q:cP/000/ -QLM`i P@pA0=S IS" %S S S SR P S SK 0@ S  Sx SAPS S7 S9 0@c(Sp $S  S Sc +%S 'S &0Su ,S -ST5S <S 4S dS !LS ES @S_ DS 0@GS HSE TS MS PSf `S aS \S@S |S lS tS 04CS4 SPS S@ S S SN S 0@$x 0Q" 0Q& aR " *0Q* aR @\ @X *0Q* aRS( KS( K *0Q :S( K(0@S1 @. 0Q :Sz( K(0StQPPQ @ 0A 0Q 0A 0Q 0僑 0T 0T 0T 0 T:T 0 01@@eU2 U.  @@$E4E 0ძo@ 0@ 0C@d 0 S* 10U *01 3/R$K -LXMX0 L0KT0 0` \ ` KP0 { K -@PLPp pWp 0E S*10S0Sa  10L\ v;v;v;@w;8x;w;0@St Sq S)Sm Sk `Ss0Sp*3d m0Sj*^P\[ \X \U \ 0\ @\ \M `\J p\\ \NCA0S>C0 S S S0S @S:  Y UY, 1 !0 0U' U#0 1 0 S @S T \ S0\ * Uu@@ @@/ F/ -@L M$PK`@%(P #,쀟0pS @T 0&S QP,,0 \( P0X?,,P  0R0(0  0 /,003/ KHfPe -LMp` `@+ 㔠0PS E R,0 0(Ko/00 0  @@@(Ko+HfPe/ 0-(@L + 000HfBXe -@L`+0lP0@T  0LR00 0 +p7/sy+Kh+HfPe 0-(@Ll+006K0h+Hf -LMP0p嬀OK`0c U*0cN,K` ZN&؇PN,K Z`2`7N`5,`KY:`3`5 \L,K\5@ p-K% (Kr@B p-AMLM0PS`@ 0S0S08 r  ,BK0 0B>KfKpBA01(!("/d0!(21 (/d/QP////////0 00/ /Hao/  0-L@)< 00 -`PLMp@KP倝@0K f\V\P E0S 00C SPU60S 0Ѐ0@0K@T  ἟P  @0S P  00C ^ R0 0fSW@0[S <*@K($u*Z@@K(KBe `f 0-@3L08@~ 8(0PU (0S 3/XP0e -L M8  K7e -L M8  K7e -L M8  K7e -L M8  K7e -LM8  K7e -LM8 k K7e -L7 0-@PLP 0S00P00C0m70 -0pLMPK` @0 P\0`K X0P@ 0 0 000 0\` s?o2P0S(K};0/ -PLTM` P P0P 0<0804P0,`(p$@ @ @aw 0!<0<8p0x04P00<,`0(p$@ @ @0 Iw(K;#Al;~AX;;A;xA;BMABB -X`P𝤀0 !`!800 ,  , !deee// 0!< 0`4 0 ,   !/deee 0-LP@K0h -LP pYʞ@0@T 00S `3/adX@Khe -L@P(p`S( 0R607P00 000SPPPP000~(U( 0 ( ) 0)3  -PL@U y2`S 0C8C8S25/o0S 0$Kh裉$d -`P嘐LXp9@T 0S0000C06JT %( 0P% 003/03/\f -LC \ 0 p};xA;e -@L 'P0 P`0' LHH`@C 80P Kht`fXeBTXeBe -L@M 0K #0,(T L$  u 00S  K0;Bxded -LM0   KzA -LDM0 S$3!^00@p`(0200p,`$  00KuP ] 0!00K$  ,p(` uP 0!`2$ 000K ,p(` uP0 0 0!2$ 0,p(`40K0 KxuP0 0 0!1$0'> 0,p(`40K0 KcuP0 0 0!x1,p(`0$ 40K0 KPuPD10S W850S ($>$ ֈ0 SS00&000 P @   R oR 0R<"82oO@X`?S `<2S?82<2_S<2O@G]0R `V( PX Q" PU p P 2\W0 P0p! 0C0 !00!00p X`0T00S 0M0t w,P D0,2 %#0 2!#(KB};eXeeTXe`f7exd7eL5 D3-QL@P 1Q 3Q& 3Qp 3Q 2QN D! !2Q g0CQ `0Q@1 2Q 0Q 2Q2s΀!LSRi  \` @\ @` \ 0\` `\ \` `\ \`(`\ \0`1 0`13J'3 1`1 3`-3: 000331H0@00 ?$8 *8 %h X͗v`$SR L0d0S 4iui iivi ~iiipxd0LTXe -0Lp0SoCP 0SHB<2S oCVD@DT 0 R H@T!'P 3 P 0S 'P`f}; -L@`P@P @ -0L`PU_Ep0S`V 0ZS$Kk3꨿f -PLpH@U` 40 0P H HBT D@DT $P H@TD0CS   Q H0SKh0H2L0T 3`f+ 0-@L # K0h 0-@L 4 K0h0P/  rTXe0 R0/e -LP 0R}; 0 - 0 41<0R4"@ L(R /.\1`1+ D L3(p  XP0 ( L kDl ` i1i2i6i(iiX5i(#f 0-`2L@ d20d20 AP d20d2000 0-h2L@S 0d2 0d2 AP d20d200 -L@M 0 (00@lp!0$PK@%0 00,$@ @@ @b 0!D0,(080$@ @0 @0 mb$KXe&B; yA -P`p@L0T 0Q  6/P @ 0-@PL"@0|0S0|  @P0 0-@L K0h 0-6LP@@,03/ 0&@P@ D&! R!@A00006@/0S   6@ H0600C0/ -@0`0LP 6/P ?0|0S0|  P@ -L`MP`@XK4 p‰980"lK Tp &PH 0P S6 00p0K0 0XKf 0P6P4 P1 R- 20 4 0`p0Ѐ0`% R 0`px0f06;0 +  & ;00X0p  0N/P00p 00$KPdHd$ -@PLT0S PP ` T0P`P0CT0 0- L❷@P A0fLf 0-6L@ @& @0@03/PuP vtPx00Cx0x0PSL0S 3/H03/0Cx0g?0 -`pLP(>0 3/@(T?T3(>0 8/`(C?V @x00x0;? -@L>@T 0S` @`0V 0QU p>a?P $Kk?ff -d@LP`p>@T 0S$0 9/@ $Kk>ff 0-PLL @P 0  S 0(0<0 0@00$00800H00T;;;;,; -0@`PLc>0`0Kh>f80/ -@L`pP>@T 0S @0(B> (P0(>U P >ff 0-LM0@PK0%0($> TP |P@03/0(t>P |@K0; 0-@\PL>0T00 T0 U>H0K0h/ff -@Pp`LM ,K0(,p (` P =, K\z$P |P@03/0(*>$Q |P403/K;<0/@0/40/@0D0/// -L$ 0R00027@% 0%(( ?(P0S@@0@00J@VB\f ddd7e7edeeeBe00S/xfe 0-@PL T00-  00/ -L@p`PuP,0p `P0000wB -p`PL@U@DP 0 S ,P/0/ -`LP @0P@ T@ 0P   0P 坿0BBRQ -@@P@TL`PSP!S H!SM` PF  V P= `vP9  0S30pS00000p003/ @Tp@ Y Y!   0PPSY !0@ $**P@@T@@ p6i(5i -P@ LP u` 0#U0V00 u000<" R R0 0/0/@P P /P Pu//N//0H00YXe -`Lp @ R @P0Q@P0U PP| P0L X0D*!P Pዂ@00@0pi@ YeXe -P@L`pL P0L Q@0D0@P !R R 0AP  ؃@00C@0@hg c YeXe -L$M0("L0 @1!("H0 Pp@@KD P`@0PV*0 3/` @KL0H!(210#(2(KdXe -L q 0YeBXe 0-@x2lPLS|"|"|2x" DD8DD K0h謦Xe000S p"Rt"R x2/Xe -L`PP 㐦@pbtRNu,0 @ 0Rx"||2XeXe 0-@PL0 K0h -L@Pp`      -Pp`@hL 0 PP@PUTT 0 (@ 0-@PLz 0 -L,M@Q00 L D0 hP8 0!(21(2H P`Ġ@KD pPP @0U* 0L DK:/00D pR0SPP0 @K,0HT!(210#(2D00 (KdXeNu@-0A@`@@PS@ 0-LP@L  0 K0h -p0LP0`Q0CSPP@ FPP ث㑥P@P0U*˩P  H`LP9ed -Pp`p0@L0AS@0C@@P0W*屩pL填PF` $KkW9ed 0-LMPQ@H  ,K⪁, K@L填U UKK"KRK0;/ -`0`L@ 1PT`P Ppx GV9e 0-L0LP01T$p@g{0P >0d -P@L `ᬐPp0U*P ܨ0P loMMP8FAO`P0V0  [M0$Kk 9eB -`@HpLTP0T *ӨP u@P9e -01 ALRPBH0QA Apqᛤ`0X* רT  0S*0H P0U*叨P e0P @L䶨Pd9eB -LMpP`K` H0@0 0K\0 0`@ 0 0 000 0T?o2P0S(K -LMP`p@K ` Հ0KT0 0@ 0 0000000oT K0@-@ S*@!0`@P@ -LMQ`p K@ t ` G0K` ᛀ0 0000T@ DP 0 00 6T`ӣ$K<- 0S0!Q\ ^010 BS   " f0 S 0P* \// -0LP@`T  n@PP 00 00 00P`0@fB 0P 00S/0S 0 0/-0S 0   -L Mp0 P R  PP `Q0@ V*0^  ` 0L PH 0#0 B`g!Q0@@00 T 0 00 R1 1P+@PX! 0 00 R0  V 40 1@40T  S@  PZ(Kp@-0  `RPPbQ@ *@ ` TQ T:0b \* R p pp0-S>"0000 ( $#0 0  -@LP`p$ 0 0  \* Y000 0e PA L `0S@1: 0  000 @ `` -L M4r@`0T@PR UU Eg} eb}`X*0V FS` `hUᨡ0S` (` R dx~` 0` @ P@YTB0PA@  0p 0 Y~ %}0 0 KZ00@S`P z 0 SPU:`0 0 0dQ`F`eoo`bPg10V0 00 0TPÆʛ(KfeB0@ -`QLP 0 ]P @@YPTP 0T -L$MP0`Q< @80  :P ` 00 K<00@S@0 p0: S  V V R  QD0 H PD0 H PD0p0T p 0@ 000P WPP00P0pSP<0 0000 00@V `   @ pR'PSP0SU 0S 0SQvPP0S RP0S000V9 0 Sԡ5 80 S00W0S p0XpPU0 0 0 ho V 00 0P P P )(K/B -PLpR`P @ 1  dൃP*W  ZP @ 0R @T@0SC Q@  0T  0S 0 R1 S $ 00CS 0RSP 0 R Q $2  0  0 00PS& T0P `T00 Ta 0Rз#0Q P0 QPP(0P,0P?0 T0U00 R" Q࠳Q0 R AQ   0RSR ㌷`U P0P0 VPP 00 0#00#0   R0ZBfBB~B0 -`p@L0S@PPT 0 @6/P 0@ -`p@L0S@/PT 0 @6/P  0@ 0-<0LP0@S た0P@  0fe -@p`Lp {( P0pX 0 0p0d0(0P 000000 0f <<

!0R81S R2P ခP* P xP"0SU 3/P0 P 0 i*P  )P@U 0 V*Pr)~$K/0 z0  z -PSL`p 0S W1 8@ 0 0 03/@P 03/W@ ]9@ -0LS KbBQ0P//@-0@ S0 0 P44 04:P*@ `-z -LM40@0P  \ \ S R KK ᲀoK 0-@LP 0P P 000000 f -00L@SpPU 0S (`P 0090 -0`LPU, @T' " ?R00S   0 0R0 0 8s03/P嵩0S0C08ӳP0$$ $KhdfPdfmB$dn A 0 APU 0S   0 0R 0 0  0S0C0W/V 0 \Z8n PT`,pW00 P K KP #pP00   N@P s00400V0 0K 0 0P P 0X P 0 00SP٣mPLp<0S0P0$QP#PSP 0 0H0ἀ 1 `P h埣4(0S 3/0S KcKZ @8vmPp A 0 AV  K#묀KTW` P Z 8Xm 7`0S K5P`3`P`pKO(0!(210#(2(Kdf fBffBYe -PLTMptK@X`Pi $30#P00Sx akPA vX ?0P7x0L0V3xP 0S 0S40 A)  4 `Kr0, K@L0"`K8@ \p XP T 4` Cx R4@Px @4  4 ȠxP XQ0 nX 3 Z  4 `Kr0 D0 `K0\p XP T tK}(Kfff -@Pp`L8M4 PKr0 PK(0 Lp H` DP K 0-LMK,@PPwTK0 0-LMP@p0 gQ` R K `K?0P L0T UA3T4 K=r,0W00 0 KK` 0 @ 尀 `P8WP W W1+*(0S K3/L T DL0(0S K3/& 0H0(0S K3/Q` KBB p-L< -LM$0P    Ky K f><$P0/ f 0-808PL@T 0S 3/X@0e f - 0L ^B10!(21 (/dL0P0  0  !P P  /$ $/, ,/e 0 /f@-DGDG EH@EHFICFCF 0 0`0P@ HdPd-/-/-//-/-/ 0-@Lfd-0 0-LM 0 "0@P2K`pL8@T 0S80<000@00C@0LT 0 K1K(000 K訿fef -L 0S 39 -L 0S ,90"S  0S  R  3/*///-0"SP PP0 \ ^.PV**T0  -LtB -LnB -LhB -LDM@ 0pl",PK@%!10p 00,($@ @@ @@lG 0!04p 0000@0,($@ @ @@XG0(0(0$00 00,pp!h0 dP00@ @BG40 <<D043PL(KB`PX0 0P0 0V $ 00G1@01feC< -`0L$M040 0@@0 1@ < 0D0 @0 SD0@tcx@X0PP8 00 8 0S8 "  0 R pBpUp bH0 ~nH0Y0P Up  p n P@000 S00 ?oV20S 40S! 00S 00S TP ᖑ@040 X@7 U00<0[@00S@(K脎@ -L@M0@SP4 0_4 XKm0T0 00P0 0L0 hH04 S (10D0 0@0 H03080 \0K0 0XKLP:0S P 0S400@00'$'$(%(%)&&#&#%") l`h R0Ѐ 0&H0@2@@0X0@\  0WP0\ @00$KPdHd -LM0" iAK1 !1 0 0 (2pP1 (27`-0SpP 0@(@wT00T 0`0 PPP 7` 0 (0S+`܀ 1K4 01x00"m @ x 0NSRP \3 0@S00C00Z0R| CoTP P00@000cRj ``0S  R KB`P  0@00ܠZP kP X At1@|600SU XU@U@ 0 (0Spc;T01Z Z @ @@(1 @ 00 0K0 00 6h2?K400 ,00 0101x00 0S0 S000 K 0K W" 0@x 0 00K0 @ h|01 KK01x00 2:K400 10 x07P 0 T X~(KeȎ@ Bd -L8M00 00S @0KP  Ke -L8MP01`00SF  P0Ku@P@ 0 3SHL0S T0  b`00a0 < 0b0S*pP  gPp U 0 g0000 (00(00PPSKe 0-LMPP @oD00P @P 0S 0S K0pe@-x:p@0#2000000 aRPP^PU`0 pC.CCPr@ 0 /f -L M    0 Kf -LM@pHP`nc49,10#W00S 0 8š44 P00S 80" K[K0`K -PL@`RP ?RPx00Cx0x00x00 0KhR$d4g< -@PL6@x0S L0S 3/H0Kh/0Cx05@0`(6@x0 0Cx0up@咐P* 0*啐剐)@PI卐SL0S 3/H03/0Cx0(Khf 0$R 0 0 0 0Qff 0-LLM!3@P`p0< 00p,P(`$@ @@ @y> 0!x30<0 00K4p0,P(`$@ @@ @c>008p40 000'! 3 00,P(`$@ @ @PJ>008p40 000 00!2 00,P(`$@@ @P2>008p40 000!X2,0P200,P (`0 $@ @ @>008p40 000 00!1 00,P(`$@@ @P>008p40 00 0 00!1 00,P(`$@@ @P=008p40 000 00!<1 00,P(`$@@ @P=008p40 000 00!0 00,P(`$@@ @P=008p40 000 00!0 0,P0(`$@@ @P=㎏H00(KxA<#B e Bd Ae0KN0KP`K![ :K[1 `V (r0PK3/PPA` 0P  dxKL`T`@T< q0@DT8 80S1<0 Y S R*d dKX0S X`0 :/јZ  Z U  dxK0dKxK  `P0 dK4@T0@DϘU \0x`d@S pW `07/ xKۙ xK ֙  (Kf eZe -L$M@`K`@P0pP \0dS Z `0 :/@P0 ᨙ 40  ᡙy (KZe -PL M`p0 UV 0RY0WV0WSUVOW W JU 0SEVG 0SU 0S;V= 0S694@T; 0@DT8 80W<00 SX0SH0 S 40 e`P40  L^`PP0 S 40 S`P40T L`P kl1@W W<@ "@l-}P (}P@E "}PD? 00@ 8p<000D W0 W@0 0P0D0H  L 0@0 0P0D0H  L 0T0 HY LY PY TY 0d\00`0d0尘P  @P |DP |l|(KZe -pLPW` U U l|l|@P l Y0d8P`000P S S L00S<00S (0 80R 0CSS fQ Q QP0P/ BR , S0P//fMfQ Q 40P0CS0P//f,0( 0S0P//@f A0-L@ Q/<@<<<,<<<<<,<nP@D T|00Sh00S0 0Ta9P P,0 P0S00fA Q< <<< < < < < << < <<(0P0P//f 0-LDM (00!42@Pp00 040K0P,p$@ @@ @`+40,K 0(0!1 000,P0(p$@ @@ @+ 0!1'.00| 0 ,P(p$@ @ @u+ 0!0040K ,P(p$@ @@ @c+1 00!04 K00,P0(p0$@@ @O+ 0!0'004 K ,P0(p$@ @ @<+ 0,00 (00!D0'000P $@ @ @0 &+(K#Bd&B<$B$B- B 0 /f 0-xLt*p@ hh$ \\ PP DD 880蘰<.Afı<_A<̉-<0c (0 1 , P'008吃0i319 31 0a$K 0-0L@S 3/<K0h|q0- P, 0C 00/,4ep@-P@R`0 d @   ` p@/@-@0n   @/ -LMP  `p0H00000YVP P h T0#03V``VL00V@0, 00T0 $Kk/$Kd0S:0Si6KQ 00 U!00AP@` QS u@P@SUQ @00u0S0@cT  @ U0S0S030C0A`(K -L M0`Si  P0@p T0S0S01T Q1 00 00 THUPR000A  Z !8 1 1+ 0,0 88 0 00088 00<00!  R'tR 0Q   0 0 0 00000(K/00SR080// -QLMp@uR㡠`bo Z! 0W:d%  40 0 9/0 P40P0h(00 9/P00 U0g*000 0  BS0 JQPpG0W#:d(  80 4 9/4 P800e% PERP40 9/P40  PQe"0Ud(PB0  0 RW d(K0 R R0/)@R0@- @@0PACPAL PP \ l0S d  000-@ A0@S0 AC^ 0SPc 0-L MP@P0 0S  ?o2 P0S  e! 4KIx@D0S  K!0 0R0 0B@ 0S K0 \0eK0G@@-0M Q+\C0 ܍@H̍^ SL \\P 1N0C0  QS\Q Q܍R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@H P//R@-0 @\ 0ct ^00 0-L MP@QK0hE0S0 RQ!  4KHtPE0S  K!0 0R0 0B<K0 \0 0SdK0O@8@-@PDD8R- 0\ n 0  -@']LM@  lyH8 uH 0<*O* S47 0:=B>0CS)嚂<:0<: R *0010#210  Sl2l"cq'0&F#~`0D"`p 0SR"0F"0F)]  0 U<:0<:` PSZ0$p0`)00 00SWPU R0 t:<: 0<:R 0## :0:pGw R0)  <: 0<:R 0%"P!:ؠ0:`̐p: S 0 0) S  0 0)<:0<:`VpPUP G< (K2f'CX@o*B?*B*BX@t@+B]+B -<@L8`, .0P P@44eAR*0S  b/-Q*  a0@-Q O @ S A @PUT0C0\8 C @PUT \@0 R( ^ PL_UQ)@A,à0@8 0@ 0@ \\QPAQ  Q00@000Q 000 -L MԀ`@PQ4PKT0@Kc0 QZW Q V SR:SR0S"00 SR"0305* SR(K -L MԀ`@PQ4PKT0@K0 QZW Q VR V0S"00 R "00 V(K 0BR"S-LMp0唁P@ `D TV``0-TP@` +T@P00T00XS 00 C R A BRP@pW0Tp p ?"KD K?D00 D ^@a DRW@DA DR 7@DW#KQP 0 pY SE00\00S(0, ,2".0@0$K謜@+B -0BLMR"S8 < 80xx@P E UX0-U@P +UP@00U00XS 00 C R A BR@PY0U X`q`q ?#K|D? vDX`p Z` ipj00 E \Pa ERWPEA ER7PEY < R@ S@D8@<0@9X P0,QP00Z00S#004 42",0RV0QP00Z00S004 42",0P0<0S(K趜@+B 0-LP@0000 0c0  2 /UUUU3333 @-A/ 0SAS/0-$(0@# A  A A A0/Q1/Q!/Q1/Q!/Q/Q/Q/Q/p@-@P`+ VPpR00WA B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/ -pLPW @@`P W P ?P0@- R  0P@^^00T0Q@-D R  0 B 0#01,#3 P `eP  P,, A ,| ,Ġ 20 ">< 20 80?"10 ?8 "10 ܋K+K " 0#80< <30 <8 30 ,K " 0#$K܅K&K " 0#܃K K%K܆K %K " 0#܄K 0܈KKV&KK(K'K)K &K'K$K&K$K$K%K&K#K%K%K#Kd0` !   ! " | #x !    ! "# ԍKlK `& p'  ԎKhKmK!`& p'iK`hKK !`pԉKhK`& p'LH! LԆK1 HnK L Kp'H`&L H K !KdKK`pK !hK`p`  0'K 0'KT0P #>21 ">T 21 P0?"11 ?P "1 1 A?K`C?K p'P0`&T <K31

 ~ b>p ]>0P0H >@ >Kh -PRL@`n @$ p`UP: >$ 0QP$$ 0$PPg` {>$Q 0Q$U@pP &gW$$+0 SR$$ 0$pG T> $+0 SR$$ 0$pGgW#SEU  P9>0QSU$ 0$ -`PLP B@ @@T = 0-@PL @ ( > P= 0$$0@]P -`PLP @ @0T = -LM@ p lK=p000 p000 p00t0 p0t 00 p000 l0ctc00?SPp@p` @8R?0UL@p gKh-8 p-L MP@0$`KS  !1" 0S h0~? S P U 0 # !1" 0SKp+B@ 0!0 00/#EgvT2ܺ -@L\M@ lK70 lp0 0# hd0# X 0 :  b{p  ` " " \b)pak#!c; ȇ" !b+h,!lˠ (!0Thj0 0# PP ` \0*0#L  j 0%0#H e[隀0! 0#D0a ) " 0@ ic9 . P pmvmzNS\lˠ p p p' h`  b,p!pp'``a`jp"pp' @b+ lɀp& pp'fk` p,pp'llˠa p p p' X`  b)p!pp'`a`fmp"pp' db+ ˀp& pp'8fk` p,pp'Hlˠ p p p' P`  b*p!pp'`Da`mp"p p' p4b+x&0 )fk`' ,g{â0) 0#  =D i ,\!`lˠ`f # "phc;p+P!XP% a iZ" Lb+`%`&00ciP0e[ ,a͂T` 0& 0#  b .,4ğ ",xğn  #, \ğ$ 0!,0Dc> .,᪃$ " ! ğ0n #!  Ď<# 0 * "0#c> . " #ꪃ  , "n#  # ", |#ā 0 * "0d#c> ! . L*,.0a #. ā0 .$0c=  *  b+) ) Ł (00|c=  ( `0b+ ( < ( (Ł0 (p0c=p p'  pb+ ppp'0P3: /M?0VG@P eKh / 0-@PLMK " !? 7R8 bx b8K  X K0h.B@0S *0@,Ġ@@,̠@/ 0G- P @@M`p hdp`pRl`0@S0`. `0`&`0n,0!0 , 0 " 0*p0&00#0ꦠ p`0! 00#0`> `"``&` `*` `&` j #  " ꦠ ! 0 " $0. 0&00#(0`0*0 0#0,`:!`"``& 0`ꦠ  )4 鎠ܔ #  "8 0 *  " <0*0(00# 6   hꮠ D    + 0 3陠0  00 3ꮠ0  00ਃ$0 0 40|#苠 00   X3 陠0 0  00 00#>    (#    8"苠    崒)  0 0匒>   ,d   <<苠     ) 0!)0> p(p'q pp"p'芠`#`& p a(ᘑ`0`!`&0(`>p `(`&`aX`p"8`p'芠 `#`& p a(`0`!`&0$`>p `(`&`ؠ`p"4`p'芠 `#`& p `(ᘐ`0p!,`p'0> `(`&p``X`p"<`p'芠 `# `& PȌ@P @@ЍyZn000 0/#EgܺvT2 -@`0!L0R00?@P`000Vp>0P3: -*?0V$@P eKh, 0-@PLMK  !? 7R8 bx b8K  X K0h,@ -` a!`.4 a !  `8 8#4-`D#0`.p|PL0 40E h4PE 40Ed^40P00EE0E`VP@p@$DPfC-p00 C Rh0S@ P 0 XR@P@P0 `L 0C YU8@CT\2"0 BUUP0C PH A@PC.SR^9* 0S P1 C S\<T9 g^ ^ ^R05,1:R*08<R08<4 Q b8"8#4b$# "40"8",0   a0CSa0A00c"0@ Ѝ -LMKwP K/ -Lf+B-M Ѝ -LMK2K K -LM2 KQ:P:/// -L@p/@-HX $H%X&XhȠ&h"Ƞ!&H%Ȏhx$Ȍ&  -oO "L R0# M$K0!P2K P!KQP:/// -L@  B?QR/ bQ20" /PQao@`/0`o `/P0aPo a/Qoo /@-p@/ ?!BC @@- p@ P` !LN3 !@A801  32  3231 0S00  b0/o/ Q-0aLP( P! 6@+B 0-@PPR0LT0( T0! 0@,B000 0c 1 2  ?/UUUU33330` 0@-tP@  P00"AO\#Q@ P0 ".!2,0   0UUUUUUUU33333333  P-L  `@J,B QP-L p@,B P-LP@Q QP%t t/?` !`bcQVʔRV( 0a~V 5@,B -QLMP@P`pSR!B SRQP9% l $ R0%Ǐ0"K & R0'0#K"KR0#KR0\ 5#PP#K q("KP0@ 0 r0e("KP0 5$K@-B P-LPQ0/? !@bcQTRaT00QP -L B,QPP-SR%0$o P! " R0#0XR\pVV  r0(P 000SRQP Q-0LP( P! @R-B 0-@PR0LP0( P0! 0@-B P-L ? c@-B QP-L / !P@.B / RC/A 0\R#R! R/`o `/` `! / // -L Mp@` PU"*T 4 0 }00P 0P4 @ Q !Q P@0W VSP(Kyaratcid0S/0S/ 0-LP @P  0P 0 -L` v@P $pPP $PUP g000000/ 0-0L@0CS00SP$Iq K0hC0 H0-L;@P 00a0 0-@PL P 0@0Q0P/0S   0  /P/0S000// -PLPp@P U *`P P 0-LPZ@P P00 0-LPW@P Pr00 0-@PL00S 0Q0S+P 00V0 0-@PL00S 0Q0S P 00<0 0-L@NP0  S* 0  0 -L M0@S,0, ,0((0r000KK.BHNAAZ.B p-L M0PSh0h h0dd0X@@DT@` 0T*@rHKphDKpW.BHNAAZ.B -P0LM@40 pW `80K`0 K QPR 80SX@=`<0K4 KC800`P04` 4S S ;Y U80 4 6P4  4( Y U80 4"NP4   4 PY4 vT4 PP  4Pp(K -L MPS@`p @ 00 P@ roXO@ 0j@ K 0-LM 0 K 0-LM 0K@0 K0KPP 0R0 R R   P K0 -LP`j @P -LP` @P -LP`6 @Pp -LP`w @P^ -LP`3 @PL 0-LM@0 K0K8P 0 R R  $ *P K -LMPR@`  00 P pWO @ K 0-PML@P0 P TK0 0-LP@PwTO0 0-@LM0K@ KP 0PU U -K0 0p-L M`0 @PP GPOKphKp0= -@p0ML`0 PP *PO KhK0gnts0atad0rbmn0loob -@LP` 0Kh{ 0-@LP K0h> 0-LM@00 KjPPT K0loob loob -L@P`X 0KhG 0-@PLI K0h 0-LMP@ K@04P U T |K0atad 0-LMP@ K@0P U qT bK0atad 3atad -L@P` 0Kh 0-@PL K0h 0-LM@D0 KP PPOT K0atad -@LP`{  0Kh 0-@LPm  K0h 0-LM@00 KPPT  K0gnts 0-LM@00 KPPT  K0gnts gnts -L@P`U 0Khv 0-@PLF K0h8 0-LM@D0 KdPP TPO T K0atad }rbmn -`LpP(*⥤PP%  @P ἤ0@l0W d0WV@`ᩤV`T yaratcid -L M0p10@0P 0P!PP  ) 0*$K.`0! 2@P` (@P(0HiV Kdyaratcid p-LM@@@P@`T *0 0` 0  PKp0B 1Be0 qyara0 84e0 htcid0 84eQ_/yara0084eQT/tcid0084e / y/ 0-@LP0 @0000/// / 0-pPL0@0S 0 `V  03/P 000 0PS 00@ 0-L@PP00PP0tcid 0-L@P 0P00loob -PL`f@PP  P  0-LP@X0P 0PP&0-QPrbmn 0-LP@oX0P 0P P0P0rbmn -PL`@PP  P -PL`@PP  P 0-LP^@'`0P 0PP00 QPrbmn 0-LP;@X0P 0oP nP0P0rbmn -PL`&@PP  ?PL -PL`!@PP  +P8 0-LP@`0P 0'P& PS0Z0!QPrbmn 0-LP@X0P 0P  P=0,P0rbmn -PL`@PP  P  -PL`@PP  P  0-LP@RX0P 0P@P0P0rbmn 0-LPi@2X0P 0P @P0P0rbmn -PL`T@PP  mPz  -PL`O@PP  YPf  0-L@!P $0P 00gnts -PL` @PP  3P@  0-L@P $0P 00gnts -PL`@PP   P  0-@RL P 00 0-L@P 0P`00loob -PL`C@PP  P  0-LP@l X0P 0PP0 QPrbmn 0-LP@L X0P 0P P0P0rbmn -PL`n@PP  P  -PL`i@PP  ~P  0-PLG@PP Pn 0 0-PL5@PP P\ 0 0-LP6@ `0P 0KPJPw0~0 QPrbmn 0-LP@ X0P 0(P 'P`0OP0rbmn -PL` @PP  P  -PL` @PP  P  0-PL @PP  P 0 0-PL @PP P 0 0-LP@Q `0P 0 P P 0 0!QPrbmn 0-LP@/ X0P 0 P  P 0 P0rbmn -PL`Q @PP  uPw  -PL`L @PP  aPc  0-PL* @PP }PQ 0 0-PL @PP kP? 0 0-LP@ X0P 0. P- @PZ 0a P0rbmn 0-LP@ X0P 0 P  @PF 05 P0rbmn -PL` @PP  P  -PL` @PP  P  0-PL @PP P 0 0-PL @PP P 0 0-LPi@P P 00 0-L@{P% $0P00gnts -PL`C@PP  yP{  0-LPJ@P Pk 00 0-L@CP $0P00gnts -PL`$@PP  APC  0-@QL dP8 00P0/(@HNA0@-\ӤP P? P P00P"7t@tDT\@@@P\P( P P" \:$$  ?o23NP0T0 NUT:xx0S000 -pL0@0ŅPV 00d  8 PXP@@V<0P0ŅPZ X?4@<PQ< 00 V0 4[<0 ŅP, 0S- @0 S*R00P c@l0<V>0@0ŅPV 0 8 d40 X40PX@P @VŅP Z@VŅP,040 0 Q<040 0i 0S, H0S)Y P<0c@0@h00 0V>0@0ŅPV 00d  8 WPY@P@VŅP000  0 Z 0S H0SY P<0c@0@h00 0V>0@0ŅPV 00d  8 WPY@P@V=00ŅP%Kd 8 WPL 0@VPS# 2Z H0X:Y<0 Pc@0@h00 0 V>0@0ŅPV 00d  8 \WPZ@P@V#00Ņ,0 P40 00 RD q D 0 FQ :Q =Q SDbQ fQ| MD0 $H 0  SQD0& Y P<0c@0@h00 0V>0@0ŅPV 00d  8 WP@@V<0P0ŅPZ C<4@<Q  R@ 0<  V< 4 [@0 ŅP) 0S. H0S+Y P<0c@0@h00 0V>0@0ŅPV 00d  8 VPY@P@VŅP000  0 Z0 L0 L0K X0 %KP 0%K 000 L0 0S  RX0% Y P<0c@0@h00 0V>0@0ŅPV 00d  8 VP@@V<0P0ŅPZL 4@<Q  R@ 0<  V< 4 [@0 ŅPT0RvD0=S6 0S) H0S&Y P<0c@0@h00 0V>0@0ŅPV 00d  8 =VPZ@P @V=00Ņ P @V=0><040 000 000 0S R@V,0P)H RY P< b@ @h0  V> @ ŅPV D0 00P d 8 UD0Z@P  @V0ŅP0 0S0 @V#00ŅP,040 40<S @V>00ŅP@0 0R0<040 n D0FS"(K /B?A A 00-LM@0@K0/ -P`L@ T -`pL@P T -p-PL`@ TKp 0-PL@ DT0 -`pL@P T -p-PL`@ TKp -`pL@P T -p-PL`@ TKp -LM Kx K -L M`d ,s0@ S( 00 @p@g@`F$p`pdt'PdPgV%@g@e%F$pepdx'PdPgR%@g@eA$pepd00u'PdPgে% 0CS P S S 0\ 0X0TpSS S S0|0x0t0p @XSV S S S0L0H0D0Fq0@ \ 0" P L@ Pp@g@eF$pepdt'dg৆(@g@h(F$phpdx'dgূ(@g@hA$phpdu'dgে(\ P0 L 00T0\0L 00p0\ 0L 00@0g0e6#pepct'cg!0g0a!6# a c("cb!0b0a1# a c%"cb '!0 (Ky7@0-P@  P 0S RP0/P0    PP0/0/<< --LM 00S S K|f  B01R/ b120" /  BR/ 0b03  /QJ:/P/1o?o 0CL/P@ P@ P@ P@ P @  P @ P @  P @ P @  P @ P @  P @ P @  P @ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ /!@-p@ / ?!BC  @  0   S/i 0- LS/B 0-,LF@P 00 000hf@ 0-@L0P yH0hf P-L 0R ,0QPoHNA 0- 0PSL@HK0h P /P K0h0&/B -Lp@P qP⡘`P0~` P 0-LP@P PW0 000 -PPL p0Rq@P 0000 l`P0QG`@HNA -PPL X0RI@P  J`P0Q%`@HNAP/ 0R /@P/ 0R /@ 0-PPL0 80R @P 0Q0@HNAP/ 0R0P//@HNA -L M@P`'?o 2Q0S0S P 0PpP  H0R S0 , VR PP  K@HNA@ -L M@P |0R` PPpᰗ`P 0< S0, (R P`P  K@HNA@0P- ?o, 2^0S0S@ P-L ,0R0Po@HNA -LM$0pSP `-`V+`$0K P# $X@P 00$  0KP 0$ S ` @P 9P$0@ 0[K&/B 0S -S0-S0>S//00// 0-P0L@Q 9P 0< 0 P0 0-PL@AQ P0 -@`PL 0U* P P<P P >Kh 0-LP<@P /P P >P K0h0 -@`PL 0U* P P<P P /zP >uP Khn 0-@LPAQ <Q >Q &Q 84rP0Q0@/B6/B;/B D0-L@^P ,hP K0h90@F/B ,0-L@xP K0h(0i/B 0-L=@P  8PP0R0,0 00I -pQL@P b  0@0S63<P 0S !S0-S0E?o 2-R0SP/S PEU0S0(0P(P` P 0B0S0300#0>R/R  R`0aW0 X P0/S0P$0(0S0$00>S 0>S0 000 0?0S  0@0S<3  P   0@0S0>300#=P00S P u b 0"Sp0 S 0j "P P0b b  >R]000@- PPU <P: &P0@aT @mT@pT6@;T3"lTtP,;P)<pT$oP!sP;P' gTtP;P>Q ^ *SU0qT 0uPoPtP;P"0 Q-L &o p-LIMPIKj`@ R 0 P @ T@K?K@J/KMKIKyP' @,1 MKIK(A4/04a  MKIK3/P4101  `K?KJ/KKIK_P 41 0K,1IK(A4/P 0141 0Kpx@ -L@,㬔PP, `@@ 0B0S63 @<R p P 0>SSS᭔ XP  DP @@@BP @Z/B`/Bo/B -LM0 IK0a00S 3/@0P P U7 5/50KIK03/U` 5/V*  V V$p01(1 (Q00S 3/`0@ P0JK03/PT 4/T 4/ p003/0K0 IKPK -LP[@P) PP$0SP 0t P P PP  0`P{Pi/BAP0/ p-PLKM8 IK< GU0nK00 ?o2S7*@q0S3P 00 0$+0S& 00R"P wP P -P P 0  03/P PP V @  00C 0 0U* wP P@b@@3@ 0-@P@L 0 0 0K0hK -@PL& 0R$p`PP 0U* 0兑ᅡ   0兡 0P 0000@ 0P-L 00RP 000@ 0-@PL000K0h 0-@PL 00RP@00@ -@PL` L0RPp0S@#*4@@ 0-@PLYT $0R@@0@ -PPL x0R@:`0V* 0upP `pWA@ -@PL` @0R P N@m@0P ?o42 R  R00 S5/@ -LM@P 2R0p0 K  PP @,0S 5| PP 巗1崗  P,U <UU@b<P`   P|T tYPP \受HP8冗U 0QV`P` VP 00 80 J P 80S0C00 ! F 0P 00 bF@ b!7 00 0Q 00 1 000000@(K@D4eD=PfTfhfXfHfD@ -L@TP`pۍT I 4P @0 $Kk7000P- ?o42 ^0S00 S@ -LM@P`) 0R%P0 K0P 0 p`  b! 00C00002K@0P/?o( 2\0S/00 S/@0P- ?o, 2^0S0S@P/ 0R/D@0P- ?o, 2^0S0SD@ P-L`Pp7 @TP* }  x u0 S @T 000 0  00 0 0P @ 0-LP@P cP00 03/P hP P0 -0LpS@P 6`P $Q`㢌0P1 `Kh|@ 0-,Lb:@P d00 0008f@ P-L 0RR o 0-@L0P ;08f - 0`SL@l,KoVPR PL `V$0PpU("#1 '# P?p< P6   P0 p P* `FV,KoDVpP(1 pP '"020 P VpQ =P =P$4A@ -`L MP@(("pQU A \2̠ <Q0 K =QR  PC 0 V====U`T5*iU X,i Œ@`U Xi @`U T*i@`R<Rp BQ=R +V0Z@S" R Vt=t=H==<  L<R R BR1"  @(K@ -LPpPU@ N`P  ` P 0-LP@P0P @000 -PPL p0R@P 0000  0S `P  `@P/ 0R /@ 0-PPL H0R  P @P  000@P/ 0R/@0P- ?o, 2^0S0SH@ P-L , ^ \o@ -LM$P`U@IP 0!P@ 0S=  K 0$ 0 R2 $0KP) $⌊PP# $ 00 0KP $0 R \OP @Pᒊ pWPዊp$0 0@K|@$4A/ 0-@8L0S (1$0T @@0L4e=(f 0-0@0PL0 00(f@0 Q{y/Bt/BP/?o4 2\0S0SP//@ 0-@PL 0R00@P/ 0R/@0P- ?o, 2^0S0Sj@ 0-0L@S $0S 0 ~0t/B00C0/  0P0S 00// -`PL ὉPPPT7@P Hpp!0 P`000U ‰@f$@ 0-@LpK0hl P-L`Pp, @TP*    0 S@T 000 0!0 0!0 @:8 0-P@L@̾zP&0 p-L M@P0 S R _ⴾ`81CaP` 00 P 00C0`Kp@f -p PL`@P U  !U @p + -LM@Pp` P000L  P (0S @( @0YP K@= 0-LP҈@P ,00$00[0P00 008=l= -P`L@10SዾKhP@2 ?o2S* 0RpP 00 0 PP 0 03/PP 00C 0 0U* _P P@J@$@ 0-0L@P 00Q 0 Q00000P 0-@P@L㿽 0 0 0K0hut -@PL 0Rpᦽe`PP 0U* 0 0P000$@ -LP000 0-@PL 00RPt@н00$@ 0-@PL 00RP_@廽00$@ -@PL` L0RPI0S@#*@ួ$@ 0-@PL2T $0R@@ᅽ0$@ 0-@PL000K0hr 0-@PL @@@$e0 -@PL` @0R P0S 0@AN$@ -@PLP`! 0Rpۼ0@0S@ 0 0a000@ $@ -@PL` <0R Pᮼ@$@ -LP`U@p P Kh 00 -@PLP' 0R#`w0 Khϼ 0 qQ0R* 0 P0C0000庼Khq$@0P- ?o, 2^0S0SD$@ 0-LP@P XPކ00 03/P ]P P0 -0L`SP@ aP $0S Khz@ -`L@P dT 0-PL@ WT0 -`L@PD JT0-!00!! 1\1 0000000#0. 0#0000!R0Q000! 00000 -@`L1SUP&T1  ! R   R  S   1   0T6 @``@T   S Q  Q      !R  |1!000Khr0 000 0/ -`PLpU  @` 7/P Q -@pPLU  `` 8/P @QT ` -@pPLU  `` 8/P @QT ` - Pp`@LW  `  9/PW  q0P R0 0  R0RQ1, @@ppTP     0000W @0@0  0 !Rho 000 -Q"Q  1`0!R Q   \c Q c - LP`@0 ^ R\  0TT 0\00pR"/o"`pT0#00#0000000^000P0T000  " `X  Pp```&T`\ \ 01T 00000000, ,0 0 0000000 T0V00 $Kk T 00X0000`00`  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/ 0BR"S-LMp0!>P@ `D TV``0-TP@` +T@P00T00XS 00 C R A BRP@pW0Tp p ?"K K?00 D ^@a DRW@DA DR 7@DW#KQP 0 pY SE00\00S(0, ,2".0@0$KP@+B -0BLMR"S8 < 80xx=@P E UX0-U@P +UP@00U00XS 00 C R A BR@PY0U X`q`q ?#K ? X`p Z` ipj00 E \Pa ERWPEA ER7PEY < R@ S@D8@<0@9X P0,QP00Z00S#004 42",0RV0QP00Z00S004 42",0P0<0S(KY@+B -0BR"SL`0ll<P@ pD TWpp0-TP@p +T@P00T00XS 00 C R A BRP@`V0T` ` H 00D \@a0DSW@DA0DS7@DV P `Y RE00Q00S@  @a@+B  0S S/P/$(0#   @// / ////H-M 0ЍH-M 0Ѝ -Lp`@P6& 0@TP0@ -LÏO " R 0#M0!P`$p$ P!$K 0RR! R/P/0@ 0A0S}*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/ R.0 \ B BѴ Bôr- B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@@t@P B@@P B@@P R@/ R/ R Ѥ ä/-\{F ,DP`pL%T\&dl't |@P`p B RR,DP`pL%T\&dl't |@P`p R/ RAn,D R L@Af,HP`pH%XX&hh'x x@P`p B RR,HP`pH%XX&hh'x x@P`p R/ RA:,H R H@A2,LP`pD%\T&ld'| t@P`p B RR,LP`pD%\T&ld'| t@P`p R/ RA,L R D@A /R Ѥ ä// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/ -pL@Q`P xyP  `P10r 0 P 0-L@\% ^ QRS  T00myLQ R S "  T  00 00 -LMP0Qp`@00 U S "0 0 00S`p`R?U 00S  0 0 P 00S 00p0E 0 Reo0`01s?o/o0bS00Sp`h0 c7s6 8U) B00S00  TP d@Oo@d 0d7t6G?oo c!0 S S@ c7z6?o/o0bS0 Soo < 8 cK`܃Kp`pD @ dK`Xp0S` p00 S`(KQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ -L1+B -LM00K3S ?  K  K`  K K K8 K0K0K0K 0KvlP[ K 04 8 < S $S $S ` S $S /Q 00/Q 0/ //PP 04 8 < S $S $S p S $S $S//Q 00/Q 0/ // -LM R 00S$ 0 =-$9S 0S0 @ S S! S " SS# $ K[A*[A 0-LM@P (Ki m0h h0K0.[A@0!(21 (/d0M/ \⾤ 0<P   /  >꼢dܢd) -@!1`pL1PJH;` C(R1 S00Ӳ!111%; S Q 0?0$Kk$d -PQpL`{PW@(d f+PT 0L00+40 4000P0X00H@` \00 0U0 p` nPk0P\Pb 3SHL0STP0b`PPVX 0`V.\0SX1PUV :p VcX.X  U=@>X: A BR40 A BR  00C S(0C-S X$0B 0bq 0 AHX V0.S 00U S  0b0ACX 0၌0flbf -`p@LM |PK.K* .L`K* .*`0K 0KA0!(21 (/d -LLM(@aP,p` 00```&` R0S1く"44"8P#R0 #0 3 0`AP r R6 0lKS 0S0s000:P (01H0[ X  0Y$P (01H0[ X 070S -P -6&0S   0 &4"4 8#8 ! R 0 1  &4"4 8#8 A&4"4 8#8 1 0(KC- P0HQ" <`p,X\00R0S  P0S @@YS  00R  e -L(M%U(22(2ulCE6Aqk!S NFS*Z~B1 > ,Qw:{4Ӹ끜ţ)놆{m뮬m|PyP${bW@E뇅/7x(4= < ,4 PIT~jmu; -{pU߹럜z멅zչ0  ѹ08Sl-@psHc7릹-B,AD3@~+40040+ 3p,]Y<_Yh+OUlᘁUW}+o;랹YH2 @@02@ 00`fP9zwCnsThBhriP- L-000 SR" !& r+}@1 "1@@`1 01fjP7 #.i14@KLkp1|1@T |#K<, Ai?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_4>>?> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    Tp dq q 8r r 5,s @C6|s 5lsllsrasrror @@@HNA@HNA@HNA@@#@P&@#@`*@HNA_M.@2@P 8@<@@@mA@ D@I@P L@I@Q@V@ Z@V@^@V@ c@V@g@l@o@l@s@x@{@x@@x@@x@pP@@@@p@@pP@@@(A@(Ap @@p 0@@p `@@p p@@P qA@P @@P @@@P P@@- A$@@$@ @@@@@@@@ @@ >A@@@@@@@0 @#A00@#A00@#A00 @#A@#A@#A@#A @#A&@#A+@#A 1@HNA 5@HNA ;@HNA ?@HNA C@HNA G@K@N@p@N@@ R@V@ R@Z@/^@6@oa@@0/@@6@p e@SAj@o@@r@o@w@{@@@{@@HA@HA@HA@HA@@@@@@@@ {A@ @@ @@@ `"@@ A@ @@ @@ @@ @@ 0@@ PXA@ p@@ @@ @@ ~A@ @@A@ @@@@@@@@@@@@@@ "@@0&@@@*@@P.@@`2@@p6@@:@@>@@B@@F@@J@@N@@T@X@]@X@ a@X@0e@X@@i@X@PAX@`m@X@pAX@q@X@u@X@y@X@}@X@@X@@X@@X@ @@ @@|A@@@ @L@0BL@@@L@P@L@@@PA@@@@@@@@@ @@0@@@@@@ @@0@@@@@@@@@@@@@@@@eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfafafdeaedsdeppmzHNAHNA@@HNAHNA@@HNAHNA@@HNAHNAczAbA0.01.02.03.04.05.00.510.00} 8} 6_bus_dma_busaddr_to_paddr@@@@@@@@@@@ @@/@G@\@VAu@Y>2PVA@Y>2VA@Y>2AVAc@Y>3VAj@Y>3 VAq@Y>3pAx@Y>3qA@Y>3qA@Y>3qA@Y>3qA@Y>3A@Y>4D @lY>4D @,Y>4i @X>4`Rf@Y>4 i @X>4qA@Y>4TrA@Y>4TtA@Y>4TtA@Y>4TA@Y>4T A@Y>4TA@Y>4TPT@Y>4T`A )@Y>5TE`A 3@Y>5TE`A 3@Y>5TE%V =@Y>5TEWV L@Y>5TE i^@lX>5TE $ie@,X>5TE0$is@,X>5TE ,ie@,X>5TE0,is@,X>5TE .i@W>5TE0.i@W>5TEAi@,W>5TE!i@W>5TE !i@W>5TE)i@W>5TE )i@W>5TE-i@lW>5TE -i@W>5TEAi@V>5TEAi@V>5TEAi@V>5TEA @Y>5TE A @Y>5TE`A @Y>5TEJ`A @Y>5TEJ`A@Y>6J`A @Y>6J`A.@Y>6ZK A=@Y>6KPAJ@Y>7ApAW@Y>7AAd@Y>7A/Aq@Y>7A?A~@Y>7AA@Y>7A/A@Y>7A?A@Y>7AOA@Y>7A/A@Y>7A?A@Y>7AA@Y>7A0A@Y>8ApA@Y>8ApA@Y>8AA@Y>8AXV!@Y>`A!@Y>XV!@Y>?A!@Y>@XV1@Y> A1@Y>@X/V1@Y> Bu@q@z@@@@@@@@@@@@@@@@@@@@@@@ @@@&@0@6@@@G@R@Z@A@H@N@T@Z@`@f@l@r@x@~@@@@@@@@@@@`@f@l@r@x@~@@@@@@@H@N@@Z@@@l@r@x@~@@@@@@@@@@@@f@l@r@x@~@@@@@@@H@N@T@Z@`@f@l@r@x@~@@@@@@@@N@T@Z@`@f@l@r@x@~@@@@@@@@@@@`@f@l@r@x@~@@@@@@@@N@@ @1@G@X@r@x@~@@@@@@@H@N@T@@@@i@r@{@~@@@@@@@@@T@Z@`@f@l@@@@@@@@@@@@@`@f@l@r@x@~@@@@@@@@@@@@@@@@@@@@@ @@H@N@T@Z@`@f@l@r@x@~@@@@@@ @` @ @` .@@ @@]@@ s@@@ @@@ @@@ @*@@ ?@_@data_abort_handlerbadaddr_read@````` ```pmap_map_chunkd  \@s@}@@@@@@@@@@@@%@ES-6600 q  P!"%&<&R"L>"D>"X"]"a" 5 5Z" 57@C6|3 5 #(-27<FP d'SpectecSDIO WLAN CardSDW-820d' #(-27<FPsdmmc_mem_enableAaAPAA ,A@P /D"A%A!""" "$"<"T"l"pxa2x0_i2c_intr_subW#V#$A$A$AxW#@X# 5 5a# 50Y#@C6X# 55\|>P{>5z>y>=\|>P{>=z>y>Vty>hx>Vx>v>-*A2*Av>u>M*AD,A@u> t>Ps>r>Q*A@0r>$q>p>o>%  8  @!!@! ! #/ ''w0 g'' c0c ;+AD,A@HTB+AN+AzW+Ad+Az+A+A +A+A ;+A+A+A+A+A+A+A+A@+A+A@+A+A+A+AD,A/A-*A2*Al ,AD,A,AH/,AD,A@8,A=,A;+AM,Ab,A@IeIIi,An,AI0I0E+Av,A,A,A@&II  I,A,A+A,A@"I0,A,A,A-/,A,A,A,A,A,A,A-A,A-A,A+-A,AA-AY-A`-A,Ao-A,A-A,A-A-A")-A-AuE o@o @o @;+A-A-A-A32AM*AD,A@@& 3BI@-A.A @(#01.A;.ATB .A-.A@.A2'E.A.A.A.A /A"/A*/A;+A.A5/A=/AJ/A=/A;+A.A;+AS/A-A/A/A/A/A/A/A/AVVwh,A0A,A0A+0A70AY-AL0AY-AW0A`0A/Ai0Ar0AP8soo P q q sMklt/A/Att30A0A hC0A0A h&FILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!Zפ B/2A32A72AA;2A2A$2A###4#0# 5# 5#@C6# 55A5A5A5A5A5A5A5A5A5A5A6A 6A6A6A)6A16A<6AD6AiA@d@c@c@2@ @?@ "@D@Q2@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@`1l70   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u    :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F    u ;u )%u&5Fu 3 4u&6F  0 1  2 50$1$2$,5$86$ 54$@C6H0$ 5.$,$.$q3?C$hC$=$|:$:$5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;<=>?@ABCDEOMPJQNRK ??O???4.??O? ֨?Z ??A?FJ?:?J?PT? ? ? Χ? ? N?H(?Xx? `? J? `? D?bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>.'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>| 9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm 8>AB>AF>AA">A(>A,>A0>APM$L$$O$K$@K$@T$i$Pa$Ta$a$(c$Xa$`a$da$uisdata_bio1W 1 Q  Pj$ i$  % L i$Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ P!#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^d P@9WPurl_int_miibus_writeregurl_int_miibus_readreg B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn /,$EAEAF hF ,%+%p+%*%(*%)%\)%,%+%,%,%*% 57@C6|3\)%/T)%%AFAsysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intrTHIS is A memory TEST patternD%%%%%%%%@C6D7 5 ##$ & &@ & &@d&(& @ @        @ ) 2P&&&&&&G&%&#&&4H&0&L&3&|G&,&8&@&4H&&T5&3& G&#&8&(&&&5&|2&8H&t>&@&4H&&,5&1&F&T*&8&P@&&&     A&9&h#&P!&@!& && @6cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IXkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث XXXXEEEE,,,,????kkkk::::AAAAOOOOggggꗗ𴴴sssstttt""""筭55557777uuuunnnnGGGGqqqq))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<</_@[ ,Κ;qLr!oADSgEmV1JBچ8{ Bieee80211_setmode@P ,    $ 0H`l     $ 0H`lieee80211_media_status , $0H`lieee80211_media_change   $0H`l  $0H`l_ieee80211_crypto_delkeyieee80211_crypto_registerieee80211_crypto_unregisterieee80211_crypto_newkey{XAXAXAXAXAieee80211_crypto_setkeyieee80211_crypto_encapieee80211_crypto_decapccmp_setkeysYA&& &&x& &&ieee80211_hdrsizeYA(&,&0&&h&8&P&Ƅ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_setkeytkip_decapZAd&\&`&&&&&ieee80211_hdrsizetkip_encap0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ZAx&p&&&8&h&&ieee80211_hdrsizeieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_lateattachieee80211_node_table_initPieee80211_encapieee80211_mbuf_adjustieee80211_compute_durationPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_updateAvAAvAAvAAvAOvAAvAOvAieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupxAdX{((d(Ć(dCO(dG(`G(p @(K(d|)\G(XG(< @)d`(TG(PG( @Z)o) o)d(dG(`G(p @dCA aA <~A ?A ,A -ؠA A #A FA =mA :A A ʡA"A6A$6AZAP~A##   1 @,,,,,,,P,,,X,, 22     * #hhu hhhA,X,(,AA A=A,T,x,eA,Ĭ,T,UAUAU2£AU3AU1A`,,`},'AU5'AԶ,,`},,,,з, xA{  AT,,,,T,D,,1APAoAA,,,}٥A}A}A<,,8,<,,`},vEAvrAn`EAD,,`},X9AH,l,`},,,,`},xor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zeroP,,,,t,,L,,,H, 5%Ad--- --h-bA---+- ---@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!AAAAAAAAëAɫAϫAիA۫AAA AAAAAAAAA[A_AcAgAkAoAsAwA{AAwsevent_copyout_events1-/-HN-O-7- 5A- 5\8-@C68- 5ABCDEFGHIJKLMNOPQRSTUVWXYZxc-([-[- 5Hc- 5[-@C60\- 5@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?خd&d&pd&6@6@o8@#9@                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~T:@:@a;@)h;@2;@;@;@ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~PXȩ--TF--PNШ-RR-CE-STT-NM--CL0-0PL0-0RE-@RR-CE-STT-SL0-RR-CE-STT-ER-CE-STT-:A@@@>@/p-Alf>@@]9 {@R:({@R:D{@R:`{@R:|{@R:{@-{@D-{@-{@R:|@R:$|@R:@|@R:x|@:\|@R:|@R:|@R:|@R:|@R:}@R: }@R:<}@R:X}@R:t}@R:}@R:}@R:}@R:}@R:~@R:~@R:8~@-T~@ -p~@:~@:~@R:~@R:~@-~@:@R:4@R:z@D*9@R:pf @@@]9 {@:({@:D{@:`{@:|{@:{@-{@D-{@-{@:|@:$|@:@|@:x|@:\|@:|@:|@8:|@:|@`:}@: }@ :<}@:X}@:t}@:}@:}@:}@:}@:~@:~@:8~@-T~@ -p~@:~@:~@,:~@:~@-~@:@h:4@`:z@D*9l@܌:@:tfA@@]9 {@-({@:D{@:`{@ :|{@ :{@-{@D-{@-{@-|@:$|@:@|@:x|@:\|@:|@:|@:|@L:}@ : }@:<}@:X}@-t}@:}@:}@:}@-}@(-~@\-~@:8~@-T~@ -p~@:~@:~@|-~@-~@-~@:@-4@:z@D*9l@܌:@:???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ`-4-:-:-updatefatsUpF@/.pA. .. fxF@@]9 {@.({@M.D{@:`{@ :|{@N.{@XD.{@PO.{@h/.{@3.|@h6.$|@:@|@:x|@:\|@:|@:|@:|@:|@L:}@@S. }@:<}@h:.X}@:t}@;.}@S.}@:.}@:}@E.~@:~@:8~@L-T~@-p~@:~@:~@2.~@B.~@C.~@:@HE.4@@D.z@D*9l@܌:@:AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z.̱..е.nfs_sillyworker̸... @Y@Y@Y@zY@nY@\Y@HY@.Y@Y@X@X@X@X@X@`X@>X@*X@X@X@W@W@W@ ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  @]@[@xZ@/ /B\)fZ@@]9 {@R:({@R:D{@R:`{@R:|{@XL/{@E/{@$/{@o/{@;/|@ *>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?0Y1:Z1ffs_newvnodeffs_reload0000k0000 ffs_sync`e@c@8b@/ 0A|)f@b@@]9 {@R:({@R:D{@R:`{@R:|{@W1{@1`{@>1|{@>1{@AJAassert_sleepablemodule_builtin_addmodule_start_unload_threadmodule_relemutex_vector_enterselfl@l@l@l@$m@m@$m@m@l@systemdrvctl=e@=e@@ @@ rw_vector_enterAD 0  pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) $444\sysctl_lookupAA AAconfig_devdeleteconfig_finalize_mountrootHNAAAdevice_pmf_driver_deregisterdevice_pmf_lock1device_pmf_unlock6p6bdevsw_attachcdevsw_attachopendiskFAMAUA ]A(eA0mA8uA@}APA`ApAAAAAA@AAAAAAA'A 1A@;Ax666ԕ66 56 56@C6,6 5pool_initpool_getpool_do_put|/-\0123456789ABCDEF0123456789abcdefvmem_rehash_start<77E7F7A7F7H7A7 A7/|C7]A u7g7m7 p7p7Lo7{7w7{7w7tq3|q3q3Pq3g7lf7,m7hq3pq3/h7AX7ܾ77 7p77x787@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@87X77T7ttyoutttyinttybgttyopnttyclsBBBBBBB 8$ 8 8 8 888( 8$88 8 8@C6D7 58 888$8L5 8h8@C6x 8 5 5 5 5 5 5 57@C6|3 5-8L5D-8,8<.8L5t,8@C64,8 5jsockaddr_copyWARNING: mclpool limit reached; increase kern.mbuf.nmbclustersm_freem_freemexv@q8:4>:E:L:?:pq3B:B@B@ B@ B@ B@ B@ B@ xBx@ lBp@ cBh@ YB`@ KBX@ >BP@4BH@*B@@!B8@B0@ B(@B @ B@B@B@ B@ B @ B܁@ BЁ@ Bȁ@ B@ B@ B@|B@ pB@!gB@"\B@#SB@$FB@%<Bx@&/Bp@'"Bh@(B`@) BX@*BP@+BH@,B@@ -B8@.B0@/B(@0B @1B@@z@ {@({@D{@`{@|{@{@{@{@{@|@$|@@|@\|@x|@|@|@|@|@}@ }@<}@X}@t}@}@}@}@}@~@~@8~@T~@p~@~@~@~@~@~@@4@P@l@@@@@@@0@qB܂@xf@@|:z@ : {@T{:`{@h{:|{@ :{@p{:|@|:$|@:@|@:x|@ :\|@{:|@{:<}@{:X}@{:t}@{:}@{:}@ : }@ :8~@{:T~@ :p~@:~@p:~@|:~@D|:~@t|:~@:|@ :l@|:@|:<::P:~:|f@@]9 {@|:({@:D{@:`{@:|{@:{@:{@:{@:{@,:|@:$|@:@|@:\|@:|@:|@ ~:|@:|@:}@ : }@:<}@:X}@:t}@:}@:}@:}@:}@:~@:~@:8~@ }:T~@ :p~@:~@:~@}:~@:~@$:~@:@P}:4@:z@ :@T:genfs_suspendctl̾::̾:$:̾:0:/:Blayer_bypassf@@]9 {@:({@:D{@:`{@:|{@:{@:{@:{@:{@:|@:$|@:@|@:x|@:\|@:|@:|@8:|@:|@`:}@: }@ :<}@:X}@:t}@:}@:}@:}@:}@:~@:~@:8~@:T~@:p~@4:~@<:~@,:~@:~@:~@D:@h:4@`:z@D*9l@܌:@:devclsdeviocdevoutdevindevwaitdeviodevopn/P:FAdkdump;; ;;; ;T;;;0;;; 57@C6|3T;B=BBBBEFI PART(s*K>;pA2IчH5A|nQn- q+5AZIчHA|nQn- q+ASFU0eCAIчH/BIчH5B-чHB-чHBSFH0eCBB|3;2;8;8;T6; 57@C6|3 5|3;2;\1;T6; 5/; 5L5L5:;:;9; 57 :;|3 5?; 5 5 5 5 57@C6|3 5A;@;?;Pq3P?;>;p>;H>;pq3`E;D;8I; 5 5 5 5 57@C6|3 5|J;Y;b;Pq3G;F;a;D;pq3_bpf_mtap_softint_init/hS;EAB/0m;Bifaddrpref_ioctld n;0&AvQkkXaM*C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jrt_initrt_timer_initmZV%[Ag%=C+ˮ{0w-0 jB;rt_deladdrxx route_outputrt_msg1route_enqueuert_newaddrmsg eA@sAAܒ@CAԒ@oCA̒@DAĒ@DA@EA@EA@dpdDddddd\d,ddԙdxdddddpdd$dЂddddddȃdpdXdd(ddTddd0dАdpdddddd ddtddddtdHd̘dܧdddXd,ddԦdd|dPd$dd̥d\ddAAj)B^)BAAA@@@'B AS>As)B:A?9Ab9A3A8A3A8A4A@|)BA A A%4AR)B`/A`/A5 AV)B@@)BB@)BF@s)B(@[@[@O@X@Q@e)B@@AA 4e3e3e3e3el3eL3e,3e 3e2e2e2e2el2eL2e,2e 2e1e1e1e1el1eL1e,1e 1e0e0e0e0el0eL0e,0e 0e/e/e/e/el/eL/e,/e /e.e.e.e.el.eL.e,.e .e-e-e-e-el-eL-e,-e -e,e,e,e,el,eL,e,,e ,eș@ș@ș@ș@<@l@X@@(@@p@@D@@@@p@@@@@8@@ܙ@Ԙ@@@@<@l@@@ș@P@4A(B?9A)B@ A)B@[@~B@|@@3A,5A@)B@A@A@)B@A@%4A)B@@AB@)B@3A,5A@)B@A@A@)B@A@`/A'A@'B)B@@Q@)BA@)BqBj)BAA@A)B@|)BA5 A)B@iB@A~B@|@.BmA@)B@@AO@@)B@|@.B)B@)B@)B@.B@s)BA@)BqBNBCDB     @ @ Zgg} j(sFK#(%strtoumaxstrtoimax0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG__subvsi3__subvdi3__negvsi2__negvdi2__mulvsi3__mulvdi3__addvsi3__addvdi3__absvsi2__absvdi2.B5A.B.B=B.B.BApA/B.B.BAA.BBB.B.B.B5BB.BqA.B.B.B.B.BB/BHNAgntsԠ=|==hf-/B @=t/B=y/B=$4A=@=/B<=&/B===rbmn== =̶= =pf(/Btcid===L=$===== yekd===`f /BHf/BXf</Bhf,/Batad=H==ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/8f/Bloob$===yarax=@==X=0=@f /BstrtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALLNetBSD 8.0 (INSTALL) #0: Tue Jul 17 14:59:51 UTC 2018 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL @(#)NetBSD 8.0 (INSTALL) #0: Tue Jul 17 14:59:51 UTC 2018 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL 8.0NetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s The operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partitionbad sector table I/O errorbad sector table corrupted: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerpxapcic_scoop: GPIO controller unable to acquire bus. error=%d output write failed. error=%d ioexp%s: not configured. can't map bus space couldn't establish power handler zssp%s: not configured zssp: zssp_ic_send: invalid IC %d Sharp Zaurus frame bufferSharp Zaurus LCDzlcdstdw100lcd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctlcouldn't register event handler zkbd: pseudo power management module apmdevifzapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbuslr, rrx, %s r%d, %s #%dthumb insn %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusmachine_archWarning IRQ's disabled during boot() total memory = %s avail memory = %s single-skdb-k-aquiet-q-v-x%s: curaddr %#lx not in range_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: _BUS_DMA_BUFTYPE_RAW_bus_dmamap_sync: _BUS_DMA_BUFTYPE_INVALID_bus_dmamap_sync: map %p: unknown buffer type %d _bus_dmamem_map: size botch%dKB/%dB %d-way %s L%u %cI%cT Unified cache %dKB/%dB %d-way L%u %cI%cT Instruction cache %dKB/%dB %d-way %s L%u %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-SARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A15 r2Cortex-A15 r3Cortex-A17 r1Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: Misaligned Kernel-mode Program Counter %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %ppmap_pv_protect: page not pv-tracked: 0x%lxfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vmapbufvunmapbufpmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)scsiverboseperiphtapeprinterprocessorwormcdromopticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storagescsipi_dtype: impossible device typescxsplWARNING: not enough memory for scsipi_xfer_pool unable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer %02x DEFERRED ERROR, key = 0x%x , requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data =Sense Error Code 0x%x at block no. %d (decimal)request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedsearch returned equalverify miscompareunknown error keyscsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter %s(%s:%d:%d:%d): killed sync (%d.%02dns offset %d), 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueingtagged queueing ATA illegal length indicationATA volume overflowATA command abortedunknown error code %d %s(%s:%d:%d): wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: PIO mode %d rejected, falling back to PIO mode 3 wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out %s:%d:%d: %s error (0x%x) wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: driver failed wdc_atapi_get_paramswdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d: error 0x%x unable to allocate periph for drive %d wdc_atapi_scsipi_request %s:%d:%d atapiscsinitq: SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed target %d lun %d: <%s, %s, %s> %s %sscsibus at %s channel %dscsibuswaiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X GENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA drive %d: <%s, %s, %s> %s %s: %d targets atapibus at %satapibusALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.02Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25read_cd_capacity: extra large block size %u found - limiting to 2kByte optical mediaMMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d cd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct NEC CD-ROM DRIVE:260cache synchronization failed no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectorsdrive offlineunformatted mediastandby immediate command didn't complete wd_standby: status=%s wdstart1: bad return code from ata_bio()ST506fictitious%s: (error not notifieddevice faultdevice timeoutchannel resetsoft error (corrected) wddump: try againwddump: polled command has been queuedwddump: unknown atacmd code %dwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %dwd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEFORCE_LBA48quirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors WARNING: block size %u might not actually work wd_setcache command not complete wd_setcache: status=%s flush cache command didn't complete wd_flushcache: status=%s trim command didn't complete wd_trim: status=%s wdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015AS%s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: not ready, st=0x%02x, err=0x%02x recalsetmultidrive fault error (%x) atabus at %swd at %s drive %d%s: unknown child %patasplatainitqatadowncan't alloc drive array qidlataactatdrnunable to create kernel thread: error %d %scnfunable to create config thread: error %d atathata_thread: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabuscouldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't create task thread "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't alloc memory (sdmmc function) sdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d couldn't read CIS can't change bus clock switch error error waiting for high speed switch: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x can't change high speed %d, error %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x %s: %s failed with error %d SD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) can't get SD status: %d %d-bit, C%d, U%d, V%d, A%dcan't execute SD tuning SD card status: unknown bus widthwrite-protected Default/SDR12High-Speed/SDR25SDR50SDR104DDR50: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> sdmmc discard countsdmmc discard errorssdmmc discard busy%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_hook: malloc failedconfig_connect: malloc failedconfig_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxaippxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented stray interrupt %d : Interrupt Controller intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostNot supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d lcd_free on active screen Stray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacunable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL pcmciabusunable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout couldn't start dma xfer. (error=%d) data not a multiple of %u bytes too much data mmcmdunsupported bus frequency of %d KHz : MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentunknown error codeAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! Cannot allocate cfe entry CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for pcmcia_check_cis_quirks: malloc pfpcmcia_check_cis_quirks: malloc cfeSVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-EthernetDYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmcia: USB revision %s, not supported %s: can't register softintr usb_doattachusbevt%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s usbreausbtskunable to create task thread: %s usb_create_event_thread taskusb at %susbtask-hcusbtask-drpre 1.01.13.0usbd_transfer: not doneusbxferusbhcxferWARNING: pipe closed with active xfers on addr %d usb_desc_iter_next: bad descriptor usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_detach_wait: %s didn't detach usbdetusb_detach_waitold: %s didn't detach usbverbosevendor %4.4xproduct %4.4x port %d configuration %d interface %dusbdevifserialnumberusbifif%x.%02x%s (%#04x) %s (%#04x), class %d/%d, rev , addr %dusbdlyout of data0 lengthiface descusbd_fill_iface_data: bad descriptor(s): %s usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDillegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d hub not fully initialised, but child deleted?multiple%s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint cannot open interrupt pipe port %d power on failed, %s uroothubuhubuhid at %s reportid %d%s, iclass %d/%d could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidbusuhidev_intr: bad repid %d uhidev: input=%d, output=%d, feature=%d uhidreauhiddetuhid%s: was console keyboard bad modifier sizetoo many Variable keyskey code size != 8key codes not on byte boundarymultiple key code arraysattach failed, %s This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). ukbd%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umassdetusing %s over %s quirk init failed endpoint not found %u/%u/%u unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers command protocol=0x%x not supported bus attach failed ATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumassuisdata_exec_command: large datalen %d uisdata_exec_command: bad command 0x%02x uisdataex%s: ATA_POLL not supported %s: multiple uisdata_bio uisdatablumass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cbcan't allocate link for drive %d %s: reset failed %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: MII read timed out %u usb errors on intr: %s aue_send error=%s open intr pipe failed: %s failed to set configuration, err=%s getting interface handle failed auemcauemccl%s-mccreating multicast configuration thread couldn't get endpoint descriptor %d missing endpoint Ethernet address %s %s: EEPROM read timed out aue%s: watchdog timeout %s: no memory for rx list -- packet dropped! %s: usb error on rx: %s %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: tx list init failed %s: rx list init failed %s: usb error on tx: %s no union descriptor no data interface setting alternate interface failed unexpected endpoint could not find data bulk in could not find data bulk out faking address cdce%s: cue_send error=%s %s: %u usb errors on rx: %s couldn't get ep %d %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s loading firmware failed could not read Ethernet descriptor kue%s: %s: bad register %04x %s: url_send error=%s failed to get interface, err=%s couldn't get endpoint %d urlwrite PHY failed read PHY failed media change failed can't read rxmodefailed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axebpf%s: udav_send error=%s udavunable to flush cache lddrain%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x detect auto increment bug, try again wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: cleaning outstanding rssadapt descriptor for %s %s: tx rate %d -> %d (%d) %s write fid %x failed %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list if_initialize failed(%d) Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d device enable failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s 'ns16550, broken fifons8250 or ns16450, no fifons16550a, working fifoAu1X00 UART, working fifons16650, no ERS, working fifoOMAP UART, working fifoIngenic UART, working fifoTegra UART, working fifois_consolecan't re-init serial console @%lx txfifo disabled unable to allocate ring buffer 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s %s channel %d: reset failed for drive 0 drive 1__wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xferlost interrupt type: %s tc_bcount: %d tc_skip: %d missing untimeoutatapollatadrdyatacnfwdccmdatardlNetBSDRoot hubOHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted WARNING: addr 0x%08lx not found ohci_device_isoc_abort: early return ohci_setintr: 0 interval , legacy supportohciabohcixferOHCI version %d.%d%s unsupported OHCI revision SMM does not respond, resetting reset timeout BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d crypto_core_constant32[0] == le32dec(&sigma[0])crypto self-test failed: %scrypto_core_constant32[1] == le32dec(&sigma[4])crypto_core_constant32[2] == le32dec(&sigma[8])crypto_core_constant32[3] == le32dec(&sigma[12])block[i] == le32dec(&out[i*4])expand 32-byte kinvalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: WEP data frame too short, len %u [%s] unable to pullup %s header wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u %s: control frame[%s] Missing ExtIV for AES-CCM cipher not enough data in following buffer, m_len %u need %u [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt [%s] Discard frame due to countermeasures (%s) TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: too short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicatedata too short: expecting %uunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.ratesbad scan.rates len %dno scan.ssidbad scan.ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table 0x%p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %s: free all nodes in %s table %s %s table %s: %s[%u] still active ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set:%s%u start chan %u passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country infokey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s %s table, inact %u Cannot allocate key index map with %u entries scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!%s: cannot expand storage not enough room, need %u got %zu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %d (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlinpcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechoICMP: redirect failed to register timeout for route to %s, code %d icmp_erroricmp lenforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailableselectedreserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblist(unknown)TCP: invalid wscale %d from %s, assuming %d tcpipqepltcp_pulloutofbandsynplm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULLtcp_outputsackholepltcp_inittcpcbpltcp_new_issrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscompat_42cwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesglobalmaxholesglobalholeslocal_by_rttdropiss_hashabcaggressivemsltremoteremote_thresholdvtw%s: af %dtcp6inet6newrenocubic%s: could not allocate %zu bytes for hash anchors%s: could not allocate %zu bytes for fatp_t array%s: could not allocate %zu bytes for vtw_t arrayudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc%s: RTM_DELETE (src=%s dst=%s tgt=%s)icmp6nd6_prunend6_delaynd6_umaxtriesnd6_mmaxtriesnd6_useloopbacknodeinfond6_maxnudhintmtudisc_hiwatmtudisc_lowatnd6_debugnd6_drlistnd6_prlistmaxqueuelen%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ENOBUFS in icmp6_error %d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: the prefix length of an existing (%s) autoconf address should not be changed %s: addmulti failed for %s on %s (errno=%d) in6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlprefix ioctls are now invalidated. please use ifconfig. %s: %s marked tentative %s: %s marked detached in6_if2idlen: unknown link type (%d) in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: never found a good ID %s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address in6pcbpl::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) mcast/dstbcast/mcastunspec/srcsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6accept_rtadvrtadv_maxroutesrtadv_numrouteskeepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedrr_prunev6onlyauto_linklocaladdctlpolicyuse_tempaddrprefer_tempaddrtemppltimetempvltimemaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxifprefixesmaxifdefroutersmaxdynroutesip6_init%s: off < sizeof(struct ip6_hdr)ip6_nexthdr: m == NULL%s: packet to an unready address %s->%s pim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludgeregen_tmpaddr: failed to create a new tmp addr, errno=%d nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu scope error in prefix list (%s) scope error in router list (%s) nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt Cannot enable an interface with a link-local address marked duplicate. %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s %s: preferred lifetime(%d) is greater than valid lifetime(%d) %s: %s/%d is already on-link %s: failed to find any ifaddr to add route for a prefix(%s/%d) on %s %s: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d rtpref: impossible RA flag %x %s: %s/%d is already off-link %s: failed to recover a prefix %s/%d from %s to %s (errno = %d) %s: failed to delete route: %s/%d on %s (errno = %d) %s: lladdrlen mismatch for %s (if %d, RS packet %d) %s: called unexpectedly (forwarding=%d, accept_rtadv=%d) nd6_defrouter_select: more than one router is installed %s: failed to make %s/%d offlink on %s, errno=%d %s: failed to make %s/%d offlink, errno=%d %s: failed to make %s/%d onlink, errno=%d nd6_prelist_remove: negative count on %s %s: failed to find a good random IFID %s: failed to find a unique random IFID %s: ifa update succeeded, but we got no ifaddr nd6_defrtrlist_del: negative count on %s %s: src %s is not link-local nd_ra_input: lower CurHopLimit sent from %s on %s (current=%d, received=%d), ignored %s: invalid option len %d for prefix information option, ignored %s: invalid prefix len %d for prefix information option, ignored %s: invalid prefix %s, ignored %s: failed to make the prefix %s/%d on-link on %s (errno=%d) %s: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p %s: IFID undefined (%s) %s: invalid prefixlen %d for %s, ignored %s: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: %s is already configured %s: failed to make ifaddr %s on %s (errno=%d) %s: failed to create a temporary address, errno=%d %s: bogus mtu option mtu=%lu sent from %s, ignoring %s: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring %s: lladdrlen mismatch for %s (if %d, RA packet %d) raw6sa6_recoverscope: assumption failure (non 0 ID): %s%%%d siteorganizationglobaludp6_output: IPV6_V6ONLY option was set for a connected socket udp6 addr 0x%xiicintr: I2C bus unable to create intr thread i2c-indirect-configi2c-child-devicescookiecompatibleWARNING: ignoring bad device address @ 0x%02x %s at %s addr 0x%02xWARNING: intr handler list not empty WARNING: proc handler list not empty i2cexec,i2c_bitbangi2cexeciic at %smii_attach: phyloc and offloc specifiedmiimii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverbosemiiautmii_phy_setmedia: MASTER on wrong mediaHomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXcouldn't establish power handler: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX, BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyno media presentDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance no media present exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX, LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_common_attach: no memory kbdmux %d: console (%s, %s emulation), using %swsswscreen %d deleted wsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumbwsemul_vt100_output_c0c1: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmuxwsmux: attach out of memory %s: disconnecting from %s rasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660utf8_joliet%/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfsRRaArrAamsdosmsdosfs_write(): bad file typerename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad v_usecount%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%s%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inodefile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcvffs_discarddata drain timeout %s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on listffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %d%s: dup alloc ino=%lld on %s: mode %x/%x gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsdoclusterreaddoclusterwritedoreallocblkslog_changeoptorg.netbsd.kauth.systemffs_modcmd: can't listen on system scope. appleufsffsinoffsdino1ffsdino2, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: lost blocks %lld files %d %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfsmfs_rootmfs_ioctl not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s missing NUL in namenot roundednull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageanonpllivelockuao_getpageuao_getuao_create: hashinit swhash faileduao_create: swslots allocation faileduaoeltpluao_flush: strange, got an out of range flush (fixed) uao_put%s: impossibleuao_detubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectubc_alloc%s: error=%d udv_detachudv_faultudv_attachflt_noram5flt_pmfail1flt_pmfail2anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2fltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpgloanagainloanzeroloanuopguser_va0_disablevmmpeplvmspplvm_map%s: kernel object %p %p %s: process wants to map virtual address 0; see vm.user_va0_disable in sysctl(7). vmmeterloadavguvmexpuvmexp2maxslpuspaceidlezerominaddressmaxaddressthread_guard_sizeuobjwirepguvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: Tried to unplug unknown range ractx%s: swapdev not in list%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning of swap...stopping swap on %s failed with error %d uvn_fp1uvn_fp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncerfork aiodoned%s %s (%s)/sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinencpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfshwddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_ticksclockinterruptCondition variable%.*spid %d (%s): %s write of %zu@%p at %lld failed: %d cpu%dfdcloseincrease kern.maxfiles or MAXFILESfdfilefiledescfile2dup2EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMERexecargsshould not happenpspawnlwpwaitkernel mapping failed %d netbsdinit died (signal %d, exit %d)orphaned traced processincrease kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx softintpserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)swapperWARNING: module error: %s: can't find builtin dependency `%s'%s: too many required modules %d >= %dbuiltin module `%s' failed to init, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size %zu != %zuDEBUG: module: TRUEFALSEunload requested for '%s' (%s)module `%s' not foundmodule `%s' busy (%d refs)cannot unload built-in secmodel module `%s'cannot unload module `%s' error=%dunloaded module `%s'module `%s' declined to be auto-unloaded error=%d%s: builtin module "%s" init failed: %dmod_unld/stand/%s/%d.%d/modulesbuiltin %s failed: %d moduleautotimemodunload%s: %d%s: gonemodule `%s' pushed by boot loader already existsduplicate bootlist entry for module `%s'unable to load `%s' pushed by boot loader, error %dunable to fetch_info for `%s' pushed by boot loader, error %ddependentrecursion too deep for `%s' %d > %duse -f to reinstate builtin module `%s'%s module `%s' already loadedout of memory for `%s'cannot fetch info for `%s', error %dmodule `%s' built for `%d', system `%d'forced load, system may be unstableincompatible module class for `%s' (%d != %d)dependency name mismatch (`%s' != `%s')module with name `%s' already loadedcircular dependency detected for `%s'required module name `%s' longer than %dself-dependency detected for `%s'recursive load failed for `%s' (`%s' required), error %dunable to affix module `%s', error %dmodule properties failed for %smodcmd function failed for `%s', error %drecursive load causes duplicate module `%s'module `%s' loaded successfullyLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for %skern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfmutex_init: impossible typeMutexmutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) %s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) %s: %s suspension %s (delegator %s) removed by %s classresume failed Powering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: class suspend %s: driver suspend %s: bus suspend %s: suspend enter %s: suspend exit Flushing disk caches: Suspending devices:%s: bus resume %s: driver resume %s: class resume %s: resume enter %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueueprocplproc2proc_args%s (pid %d) changing logname from %.*s to %s rasplimitplpstatsplcurprocpaxflagsrlimitcputimefilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitrnd: source "%s" failed continuous-output test. rnd: source "%s" failed statistical test.rnd: disabling source "%s". rndsrcrndsamplernd: seeded with %d bits printfautoconfrnd: bad seed length %d rnd: bad seed checksum requesting entropy from dead rndsink: %prndsink %p in unknown state: %drndsinkdestroying dead rndsink: %pcacheht_timebalance_periodaverage_weightmin_catchtimesoftintskpreempt_priupreempt_prirunqueue pullrunqueue pushrunqueue stayrunqueue localizeowner/count : %#018lx flags : %#018x Reader / writer lockrwlocksigactsksiginfosorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d WARNING: softint_establish: table full, increase softint_bytes softdissoft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpuse one of: %s[a-%c] none halt reboot wedge:parsediskmd0 (default %sdump device (default %sb)file system (default %s): use one of: genericunknown device major 0x%llx %s%lludevice %s (0x%llx) not configured root on %scan't determine root device swap dumps on %sCannot open "md0" (root)sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesetrunnable: lwp %p state was %dWARNING: negative runtime; monotonic clock has gone backwards exceeded RLIMIT_CPUpid %d is killed: %s pid %d, command %s, is killed: %s /usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_createv: sysctl_create(%s) returned %d sysctl_create succeeded but node not found?! sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummyptimerplptimersplnanoslppid %d attempted to set the (obsolete) kernel time zone callout_init_cpu (2)late/%ucalloutwait/%utstilepltstileturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time uidinfoproccntlwpcntlockcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrttsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlers%s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x device-attachdevice-detachcfgmiscdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_attach: allocation of device softc failedFound %s (root)%s at %sWARNING: power management not supported root device %s not configured done. WARNING: %d error%s while detecting hardware; check system log. detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcprng %s: reseeding with partial entropy cprng %s: NIST CTR_DRBG reseed failedurandomarandomcprng %s: NIST CTR_DRBG instantiation failedcprng %s: creating with partial entropy sysctlcprng %s: NIST CTR_DRBG failedureadc: non-positive residureadc: non-positive iovcnt%s: block majors exhausted%s: character majors exhaustedwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and partition table is fullno raw partition and disk reports bad geometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table type KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpusetkcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-2048kmem-4096kmem-8192kmem-16384kmem-8kmem-16kmem-24kmem-32kmem-40kmem-48kmem-56kmem-64kmem-80kmem-96kmem-112kmem-128kmem-160kmem-192kmem-224kmem-256kmem-320kmem-384kmem-448kmem-512kmem-768kmem-1024not modular%s error: %s,%zu: %s lock address : %#018lx current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) page %p, nmissing %d, time %u %s: [%s] too large itemsperpage(%d) for PR_NOTOUCHpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missingMust specify a pool to print. POOL CACHEPOOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer entry uncontended %llu contended %llu cache layer empty groups %u full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p empty cache groups: (null)Skipping crash dump on recursive panic panic: %s: table is full - %s %s: table is full exclusive accesspsrlzspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclocvxchicvcrosscallunicastxcallxcall/%uaio_process: invalid operation code aioworkaiodoneaio_jobs_poolaio_lio_poolposix_aioaio_listio_maxaio_maxsys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s mqmsgplposix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqsendcvmqrecvcvparkedpsetpsets_max%d:1,%d:2direct_selectcompatposix_schedpri_minpri_maxttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutftkstatninnoutcanccrawccqsizettyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_streamseqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumsizemclbytesnmbclustersmblowatmcllowatmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)m_copym: off %d, len %dm_copym: m == 0, off %dm_copym: m == 0, len %d [!COPYALL]m == NULL in m_pulldown()unixpsemposixsemmaxsemcntksemsomaxkvasbmaxsokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dsocketnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamemsgcontrolmsghdrmbfreembdatambheadermbsoptsmbftablembcontrolmboobdataunp_threadunp_connect1unp_disconnect1uipc 1uipc 2unp_attachunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbflushbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestedcachegcncachenchinit %dnamecacheentries scannedentries collectedover scan targetunder scan targetforced reclaimsnamecache_statscwdidirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkspnbufpllf_findoverlap: defaultlockfchrooted pid %d uid %d (%s) detected outside of its chroot namei_simple_convert_flags: bogus sflags /../earmzauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dot%s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system failedunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... ILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFELOCKSWORK TEXT EXECMAP WRMAP WRMAPDIRTYONWORKLSTDIROPfiledelaydirdelaymetadelayvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dfdesckernfsafsfstchgfstcnt%s: cannot reclaim%s: bad ref countdead but not cleanvcacheplvcachevdrainvdrainwt%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-namexattr-valxattr-listsystem.user.security.trusted.vop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad oplayerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_ioctlspec_read typespec_write typespec_fdiscard: not a device spec_close: spurious pgrp refspec_close: not specialdev %llu, %llu spec_node_destroy: corrupt hashdefault labelWARNING: %s: total sector size in disklabel (%ju) != the size of %s (%ju) %s: %ju trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%ju) raidframe%s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu) %s at %s (%s) deleted dkdrn%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdcgdmdidle%s: cfattach_attach failed %d %llu %uurandom%urndtemprndctxrndpseudoopen hardopen softbpf_mcpybpf_change_type%s: softint_establish() failed%s: no bpf_if found for %smaxbufsizepeersbpfattach%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#%slink#%huif_ifqmaxlendropsifnetifasdl%s: could not attach sysctl nodes sndqrcvqif_detach: WARNING: AF %d not purged UPDOWN%s: lost link state change %s too many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %s%s: discarding oversize frame (len=%d) %s: can't handle af%d ether%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_loopifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedpfilpktqsyncpktqrenqMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find our annotation rn_delete: couldn't find us radix already initializedrn_init: radix functions require max_keylen be set rn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) %s: unable to delete rtentry @ %p, error = %d rtfree 2route_purgeifroute_abortroute_acceptroutertable%s: message too long%s: queue full, dropped message %s: unknown command %dkeeplog_movementslog_permanent_modifylog_wrong_ifacelog_unknown_network%s: %s not ready arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! %s: DAD duplicate address %s from %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s %s: ouch, empty static llinfo for %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: Extensionsorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d curtainusermountuser_set_cpu_affinityextensions_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionscryptofssppsptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadzfstprofisvvideohdaudiouhsorumpblknpfdtvfilemoniscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmecttyphysconptcqmsofconsfdtunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseulptraidugenucomuriouscanneropenfirmbiconsdevisdnisdnctlisdnrchanisdntrcisdntelsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomsysmondmoveriosscomksymsisdnbchanepcomtslcdtwensmbwdcpxapcicpxamciziicsdmmcbuswskbddevusbuswsemuldisplaydevreportiddriveconfigurationproductchannellunkbdmuxcontrollerindexdackirqintrbase%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%sKernel RNG "%s" monobit test FAILURE: %d ones Kernel RNG "%s" poker test failure: parameter X = %lld.%lld Kernel RNG "%s" long run test FAILURE: Run of %d %ds found Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d <= %d) Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d >= %d) %s: invalid base %ddivide by 0/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvsi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvdi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvsi2.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvdi2.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvsi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvdi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvsi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvdi3.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvsi2.c/usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvdi2.c/usr/src/sys/lib/libkern/../../../common/lib/libppath/ppath.cp->p_refcnt != 0unusedv6v7v71kv8otherhpfsadosfilecoreext2fsntfsjfs2vinumudfsysvbfsefsnilfsminixfs30%llo%s:%d: abort in %sstringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl %s %s SIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... kern.driversinvalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@#}##"#+@2>F $## ## !$$#$9$J$_$r$eE $@$$$$@$ffs!v$% %!%%% %%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedforcemount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfsysvbfsefsnilfsstrdup9'C'Nb##w)HN'! ## )"!@U'\'a'j't'x'}'' bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:ruserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.9'C'Nb##w)HN'! ## )"@#4@")!@#}o:mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %ssoftdep9'C'Nb##w)HN'! ## )"@!@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s9'C'Nb##w)HN'! ## )""!@|u22H2 2@222222 ؖ@4002111 %1@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac[-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %drecvrpc: reject, astat=%d, errno=%d getport: %scallrpc: error = %d sendrecv: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s;;;<H<<<<<=<=c=w====>(>P>u>>>>#?C?h??%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()nnnusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG{,{E{r{{{{|%|E|e||||}3}]}}UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1LOCALBROADCAST pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtudfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, flags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%d%-*.*s %-*.*s %-6.6s FlagsAppleTalkEncapInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-z-dCan't exec `%s' (%m)Can't exec `%s'hw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfR ***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20150912NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (ftp_debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnecteditepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Receiving HTTP reply: %sInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'fetch_ftp: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 Passive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPASVPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N netrc] [-o outfile] [-P port] [-q quittime] [-r retry] [-s srcaddr] [-T dir,max[,inc]] [-x xferbufsize] [[user@]host [port]] [host:path[/]] [file:///file] [ftp://[user[:pass]@]host[:port]/path[/]] [http://[user[:pass]@]host[:port]/path] [...] %s -u URL file [...] Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. anonymoushttpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)xsignal_restart: called with signal %d %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. ftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamNetBSD gzip 20150113malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintf compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%can't read stdin(stdin): unexpected end of file(stdin)usage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directory%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gzD"D#D%D't\S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESlikrklkukdkPkNkh@7kDhcxndadbticmsovb|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcupndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i$$KT&$a H$i L$u~$$($ʁف%$$ 8$ 7$ $ ($ $'.l$8 $B!$K'$Uf$rX$p$~,$+$˂'$ۂ*$ H$ G$~$ $`$.$: $F $>m:AUʗӗڗ:x ,#l(,0:@DLPeVhw.disknamesU2IчH!ZIчH IчH=rGy=iG}o3Dh&xSFH0eC  SFU0eC(-чH_IчHe-чH| (s*K>; Hah!IdontNeedEFI      !"#$%&  X`$Y<$[ $\|$/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-25s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)51210242048409681921638432768FFSv1 [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed usage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] Installation messages in Englishen_US.ISO8859-1YesSomeNoneOnOffunchangedDelete?reinstall sets forupgradeNetBSD/zaurus 8.0 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksaverage file size (bytes)mount point (or 'none')secMBNetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk into multiple BSD partitions. You must now set up your BSD disklabel. You can use a simple editor to set the sizes of the NetBSD partitions, or keep the existing partition sizes and contents. You will then be given the opportunity to change any of the disklabel fields. The NetBSD part of your disk is %d Megabytes. A full installation requires at least %d Megabytes without X and at least %d Megabytes if the X sets are included. Choosing megabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'. MB Cylinders Sectors Filesystem Mount point?Size for %s in %s?Change input units (sectors/cylinders/MB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionAccept partition sizes. Free space %d %s, %d free partitions.Reduce partition sizes by %d %s (%u sectors).The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated to %d %s. Type enter to continue This disk is too large for a disklabel partition table to be used and hence cannot be used as a bootable disk or to hold the root partition. We now have your BSD disklabel partitions as: This is your last chance to change them. Start %3s End %3s Size %3s FS type Newfs Mount Mount point --------- --------- --------- ---------- ----- ----- ----------- %9lu %9lu %9lu %-10s %-5s %-5s %sShow all unused partitionsPartition sizes okThe current values for partition `%c' are, Select the field you wish to change: MB cylinders sectors ------- --------- --------- FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9sToggleRestore original valuesSelect the typeother types%s Special values that can be entered for the size value: -1: use until the end of the NetBSD part of the disk a-%c: end this partition where partition X starts size (%s)%s Special values that can be entered for the offset value: -1: start at the beginning of the NetBSD part of the disk a-%c: start at the end of previous partition (a, b, ..., %c) start (%s)Badly formed sector number Select file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device /dev/%s%c on %s failed. The extraction of the selected sets for NetBSD-8.0 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-8.0 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-8.0 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-8.0 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. Available CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory %s: %s. Install aborted. Delete after installRelease set %s does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Your choices have made it impossible to install NetBSD. Install aborted. The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that /dev/%s%c is not a BSD file system or the fsck was not successful. Try mounting it anyway? (Error number %d.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbols%-27s %3sSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions %c and %c overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file %s Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-8.0 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-8.0 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemyes or no?Hit enter to continueChoose your installationSet sizes of NetBSD partitionsUse existing partition sizesMegabytesCylindersSectorsInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryFetch and unpack pkgsrc for building from sourceNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit BSD partitionsEdit and save MBRSwitch to GPTSwitch to MBRSet disk nameFormat as RAIDFormat as LVM PVEncryptBootable flagSafe eraseUndo changesUnconfigureEditForce umountFill with zerosFill with random dataFill with crypto data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity.RemoveAddThis removes all partitions on the disk. Do you want to continue?Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG) Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. MBR partitions, if desired, must be created before editing the disklabel. To use RAID, LVM, or CGD: 1) Create BSD partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM. raid%d (level %1d) on %-34s %11uM EMPTY RAID!Disks: %33sSpares: %32sRAID level: %22dnumRow: %22dnumCol: %22dnumSpare: %22dsectPerSU: %22dSUsPerParityUnit: %22dSUsPerReconUnit: %22dMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID: PATH NOT DEFINED! vnd%1d on %-51s ASSIGN vnd%1d on %-45s %11uMFile path: %29sCreate new image: %20sSize: %22sMRead-only: %22sSet geometry by hand: %18sBytes per Sector: %18sSectors per Track: %18sTracks per Cylinder: %18sCylinders: %22sFile path?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders? DISK NOT DEFINED! cgd%1d %-48s %11uMBase device: %24sEncryption: %24sKey size: %24dIV algorithm: %24sKey generation: %24sVerification method: %17sDisks in VG: %-44s %20sM EMPTY VG!PV's: %34sName: %34sMaxLogicalVolumes: %20sMaxPhysicalVolumes: %20sPhysicalExtentSize: %20sName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)? Logical volume %-35s %11uMSize: %33dMRead-only: %27sContiguous: %27sLogicalExtentsNumber: %18sMinor number: %26sMirrors: %27dMirrorLogRegionSize: %18sPersistent minor number: %14sReadAheadSectors: %18sStripes: %27sStripeSize: %27sZeroing of the first KB: %13sLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named %s) seems to exist on %s. Do you want to use that?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)We are now going to install NetBSD on the disk %s. NetBSD requires a single partition in the disk's MBR partition table, this is split further by the NetBSD disklabel. NetBSD can also access file systems in other MBR partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single MBR partition used to cover the entire disk. If you want to install more than one operating system then edit the MBR partition table and create a partition for NetBSD. A few hundred MB is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least 5GB if you want to build NetBSD itself. Which would you like to do?Edit the MBR partition tableUse the entire disk Total disk size %lu %s. Start(%3s) Size(%3s) Flg Kind ---------- ---------- --- ---------------- %10d %10d %c%c%cYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OK type: %s start: %d %s size: %d %s end: %d %s active: %s install: %s%ssize (maximum %d %s)Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s) %s%sStart (in %s)Partition kind (0..255)There can only be one extended partitionThe Current MBR partition table is shown below. Flgs: a => Active partition, I => Install here. Select the partition you wish to change: Partition table OKDon't changeOther, input number Do you want to re-edit the MBR table (or abandon the installation)? There is no NetBSD partition in the MBR partition table.There are multiple NetBSD partitions in the MBR partition table. You should set the 'install' flag on the one you want to use.Setting up the DOS partition table ... Rewrite of MBR failed. I can't continue.Log ended at: %s # Script ended at: %s sysinst terminated. /usr/share/sysinst/catalog//usr/share/sysinst/catalogsysinstmsgs.sysinst: environment variable TERM not set. %u:%uDr:f:C:psysinst: screen too small xfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgftp dirpub/NetBSD/NetBSD-8.0ftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfix.tgzdisknamemydiskpkg hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/8.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file------------------------------sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 /dev/r%s%c%s -p -c 3 /dev/r%s%c/sbin/fsck_%s%s -p -q /dev/r%s%cdisklabel -w -r%s -f /tmp/disktab %s '%s' -i /sbin/newfs -V2 -O2 /dev/r%s/sbin/newfs %s%.0d-tffs -o async/sbin/newfs -V2 -O %d -b %d -f %d%s%.0d-tffs -o log/sbin/newfs_lfs -b %d-tlfs-tmsdos%s /dev/r%s/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /dev/%s none swap sw%s 0 0 %s/dev/%s %s %s rw%s%s%s%s%s%s%s%s %d %d /dev/%s%c /tmp mfs rw,-s=%lli swap /tmp mfs rw,-s=%lli kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/dev/%s%cdkctl %s delwedge %sgpt show -u %s 2>/dev/nullPritableSectable:no_mbrdevice %s %s (%s@%s)%s (%s, %s)%s (%s, %s %s)gpt -qr header %sCannot process disk %s: too big size (%d) /dev/%s %s ffs %s/dev/%s %s ufs %scd0araiddk:no_partwindows,hfsefibios/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'/dev/rcd%d%cCD001/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES//.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xhepf -rm %sfsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%smkdir -m 755 /mnt2 /usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700gamestestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug -async noatime nodev nodevmtime noexec nosuid log /bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD60/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgin/usr/pkg/bin/pkgin -y install %ss,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update%-50s %-10schpass -s %s rootpasswd -l rootsource for 3rd-party packageschroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu XXX Help Stringntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s %dMlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s%s -l %d%s -p %d%s -s %dlvm vgcreate %s %s %s%s -C %c%s -M %c%s -p %s%s -Z %c%s -n %s%s -l %s%s --minor %d%s -m %d%s -R %d%s -r %d%s -i %d%s -I %d%s -L %uMlvm lvcreate %s %sPartman device: %s lvol%.2dvg%.2dgpt remove -a %s-t %sgpt add -i %u -b %u -s %u %s %sCannot create GPT partition #%d on %s dkctl %s addwedge HACK%d %d %d unuseddkctl %s listwedgesdkctl %s addwedge dk%d %u %u %s %s (%s)Cannot create wedge dk%d for %s. dkctl %s delwedge dk%d/tmp/%s%c/sbin/mount %s /dev/%s%c %smkdir -p %s dd if=/dev/zero of=%s bs=1m count=%d progress=100 msgfmt=humanvnconfig %s vnd%d %s %d %d %d %dvnconfig %s vnd%d %slvm pv%-33.32s %-22.21s %12.12sdk%d: %s %-30.29s %-22.21s %11uM%s%c: %s %s%-33.32s %-22.21s %11uM(%s-%d) on %sVG '%s' on %d/%ugpt create -f %sgpt destroy %spartmanSpecial disk %s preparing error Disk %s preparing error /tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks /dev/%s START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dRAIDframe configuring error #%d cgdconfig -g -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d /dev/%s /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %s (%s, %s-%d)%s (lvl %d, %d disks, %d spare)dd of=/dev/%s if=/dev/zero bs=1m progress=100 msgfmt=humandd of=/dev/%s if=/dev/urandom bs=1m progress=100 msgfmt=humansh -c 'cgdconfig -s cgd0 /dev/%s aes-cbc 128 < /dev/urandom'dd of=/dev/rcgd0d if=/dev/urandom bs=1m progress=100 msgfmt=humancgdconfig -u cgd0umount -f /dev/%scgdconfig -u %svnconfig -u %sraidctl -u %sdkeject -t disk /dev/%sdraidctlvnconfigcgdconfiggptdkctl-t nullraidctl -v -A root %sError writting RAID bootsector to %s gpt biosboot -i %d %sError writting GPT bootsector to %s Error writting bootsector to %s dkctl %s makewedges%s. %scan't delete extendedmain-extended mixupUser answered no to destroy other data, aborting. Unknown (%d) %*s (%s)Extended partition, LBAFreeBSD/386BSDLinux swapDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32Windows FAT32, LBANTFS volume setPReP BootUnknown(%lli)%6lli%8s%10lli%10lli %c %s%lli%sdlsize=%lld ptsize=%lld ptstart=%lld disk %c/tmp/disktab.%sCreating disklabel %s in %s cat <>/etc/disktab %s|NetBSD installation generated:\ :dt=%s:ty=winchester:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:%s\ nparts limited to %d. :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:sh -c 'cat /tmp/disktab.* >/tmp/disktab'*************************************************************************************************************************************************************************************************************************************** usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipe -%uusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-X deadline] [-x maxwait] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu ping6: wrote %s %d chars, ret=%d --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmaprefusedunknown qtype no address %s(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qRS:s:tvwWx:X:too many intermediate hopsff02::2:0000:0000getaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified SuccessRefusedIPv6 addresssetvarcontrol_handle_datacontrol_writeonedhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1Edhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2018 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optionb\cd%ef)g\hijk5lm?nm}oFpq՜rQsXtu v`wAxgzywA}BCDE+FGHI:JKLMNOPQ!vSuTUVWX Z14#6|W$~,}75>N`nluszH5#+/( F/%default_configread_configrt_new0rt_deletemake_varappend_configF make_envKIKj script_runreason0123456789abcdefdhcp_envoption3\=f%Lw0N`r1I]q4Rf;Mu]I )Ilrif_opensockets_os arp_probe1arp_announce1arp_tryfreearp_readarp_openarp_probearp_announcearp_new5( HPHHPbpf_arp( PEP HEHH@DCH``Pread_leasedhcp_handleudpdhcp_openbpflog_dhcp#dhcp_bind"*236 >dhcp_handledhcpdhcp_readpacketdhcp_expiredhcp_lastleasedhcp_start1dhcp_initdhcp_dumpipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_addaddrsipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_dadcallbackipv6nd_expireraipv6nd_handledataipv6nd_handleraipv6nd_sendrsprobeipv6nd_startrs1z ~ *ALXfdhcp6_checkstatusokdhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrebinddhcp6_listendhcp6_writeleasedhcp6_recvifdhcp6_startrequestdhcp6_recv '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_envdhcp6_dump%s_%s=%s/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: unknown carrier, waiting for interface flagsRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version7.0.6--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-46ABbDdEGgHJKkLnPpqTVw] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr]] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [interface] [...] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 7.0.6 %s Compiled in features: INET ARP INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-7.0.6 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: is a NET/ROM pseudo interfacepicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type %.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix lenoption `%s' does not take an IPv4 addressinvalid IAID %sIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argument%s: IA_PD not compiled inunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactive reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingif_route (CHG)if_route (DEL)if_route (ADD)deleting%s_%sTESTSTATIC6ROUTERADVERTUNKNOWNinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=trueif_down=falseif_up=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid= - %s /libexec/dhcpcd-run-hooks%s: executing `%s' %sRC_SVCNAMEPATH=%sPATH=/usr/bin:/usr/sbin:/bin:/sbin%s: %s: WEXITSTATUS %d%s: %s: %s%s: arraytostr%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed index uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s%s_%s=/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtnet.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6%s: ARP probing %s (%d of %d), next in %0.1f seconds%s: ARP announcing %s (%d of %d), next in %d.0 seconds%s: ARP announcing %s (%d of %d)%s: probing for %s%s: ARP announcement of %s cancelled%s: hardware address %s claims %s%s: DAD detected %s/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: waiting for DAD on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: dhcp_read_lease_fd%s: %s: truncated lease%s not found%s: extending lease until DaD failure or DHCP%s: extending leaseNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %s0.0.0.0/0MS %s: using %sClassless Static Routesip_addresssubnet_cidrnetwork_numberserver_name%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: waiting for 3rd party to configure IP address3RDPARTY%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: if_sendrawFAIL%s: dhcp_makeudppacket%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: cannot add IP address in test mode%s: DAD completed for %s%s: wrong xid 0x%x (expecting 0x%x) from %s%s: xid 0x%x is for hwaddr %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: checksum failure from %s%s: invalid UDP packet from %s%s: server %s is not destination%s: truncated packet (%zu) from %s%s: redirecting DHCP message to %s%s: DHCP lease expired%s: timed out contacting a DHCP server, using last lease%s: dhcp_openudp%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: needs a clientid to configure%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %sDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sDISCOVERREQUESTDECLINEACKRELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s broadcast %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s: preferring %s on %sip6_address%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: %s is reachable again%s: %s is unreachable, expiring itrtpref: impossible RA flag %x%s: %s: router expired%s: expired address %sIPv6 ICMP packet too short from %sIPv6 RA/NA did not contain index from %s%s: IPv6 NA too short from %sinvalid hoplimit(%d) in NA from %s%s: NA multicast address %s (%s)%s: %s not a router (%s)IPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: reject RA (no option %s) from %sdhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s_nd%zuaddr%zu%s: delaying Router Solicitation for LL addressff02::2%s: no IPv6 Routers available%s: sending Router Solicitation%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: DHCPv6 Vendor Class too big%s: extending DHCPv6 lease%s: DHCPv6 DAD completed%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: ignoring unicast option as not masterbroadcastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f seconds%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: %s received from %sINFORM6ITIMEDOUTBOUND6RENEW6REBIND6REBOOT6TIMEOUT6%s: %s will expire before renewal%s: ignoring T1 %u to due address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: failed to request information%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %s%s: recvmsg_reallocDHCPv6 packet too short from %sDHCPv6 reply did not contain index from %s%s: incorrect client ID from %s%s: RECONFIGURE recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %sDHCPv6 reply for unexpected interface from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: DHCPv6 lease expired%s: no advertising IPv6 router wants DHCP%05d %s%s: delaying DHCPv6 soliciation for LL addressSTOP6RELEASE6%s: dropping DHCPv6 due to no valid routers%s_dhcp6DUMP6Unspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~0' Zz_ @/etc/group/etc/master.passwd%s%s%s 646towlowertowupperalnumblankcntrlgraphpunctxdigitUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*ju,uappnduchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SXDB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'NAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs30%llo%lld0x%llx/dev/%s%s%s%c%.*s/r%sr%s%.*s/%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkadd_new_key: bad type passed unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo dataseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist